4O95A

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor cppu
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
494
structure length
467
Chain Sequence
VGGGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRGRGPGAAVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGSGGGRRFDYVEGFVVAASVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGRTAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytokinin dehydrogenase 4
publication title Kinetic and structural investigation of the cytokinin oxidase/dehydrogenase active site
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 147
structure length 467
sequence length 494
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2014-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4o95A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4o95A02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 4o95A03
3FW9A 4BC7A 1ZR6A 3VTEA 2P4PA 5ADZA 2PLIA 2BVGA 4UD8A 4BC9A 1E8HA 2NQWA 1W1SA 1AHUA 1UXYA 2VFSA 2VFRA 1VAOA 2OAIA 5AE1A 4PVEA 1AHVA 4XLOA 1SB3B 1QLUA 3W8XA 4MLAA 1WVFA 1WYGA 3TSHA 3W8WA 1DZNA 2P13A 1MBTA 5HHZA 2W3SA 1AHZA 1MBBA 3D2HA 4PYTA 2R2ZA 1JROA 3ETRB 1RM6B 5HQXA 4BBYA 4PVHA 3D2DA 3LAEA 2I0KA 3NVVB 2QKNA 5HMRA 5D79A 4JB1A 1JRPA 1W1RA 2PLSA 1F0XA 3TSJA 1T3QC 5G5GB 3W8ZA 3S1CA 3KJMA 3B9JB 3D2JA 1FIQB 3FW8A 3TX1A 2RK5A 3AM9A 2Q85A 4PZFA 3FW7A 1VDVA 3HRDC 1FFUC 1W1KA 3BW7A 2VFUA 3PM9A 2W3RA 4EC3A 2AXRA 3NVZB 5FXFA 1DIIA 4PVJA 1N5WC 3GSYA 1HSKA 2GQUA 3FWAA 1N62C 1QLTA 4PVKA 1W1LA 1WVEA 1E8GA 2P3HA 3DEDA 1FO4A 3S1FA 4PWCA 1N60C 1E0YA 5FXPA 2YVSA 3SR6B 3NVYB 2O3GA 1W1QA 1W1JA 5G5HB 2EXRA 2QPMA 3I99A 2GQTA 5AE3A 3AN1A 3AMZA 1E8FA 1N61C 4O95A 2BVFA 1ZXIC 3EUB3 5AE2A 1FFVC 2Q4WA 1N63C 4OALA 4PWBA 1V97A 3NRZB 1W1MA 5FXEA 4DNSA 2VAOA 2BVHA 3S1EA 1N5XA 2VFTA 5FXDA 1I19A 1DIQA 4ZOHB 4HG0A 2MBRA 2W55A 3JS8A 3S1DA 2E3TA 3DQ0A 3NVWB 2W54A 4JAYA 2R8DA 3C0PA 4BCAA 3NS1B 3LLBA 2VFVA 4ML8A 1W1OA
chains in the Genus database with same CATH superfamily
3FW9A 4BC7A 1ZR6A 3VTEA 2P4PA 5ADZA 2PLIA 5I1WA 2BVGA 4UD8A 4BC9A 1E8HA 2NQWA 1W1SA 1AHUA 3POPA 1UXYA 2VFSA 2VFRA 1VAOA 2OAIA 5AE1A 4PVEA 1AHVA 4XLOA 1SB3B 1QLUA 3W8XA 4MLAA 1WVFA 1WYGA 3TSHA 3W8WA 1DZNA 2P13A 1MBTA 5HHZA 2W3SA 1AHZA 1MBBA 3D2HA 4PYTA 2R2ZA 1JROA 3ETRB 2Y3RA 1RM6B 5HQXA 4BBYA 4PVHA 2UUUA 3D2DA 3LAEA 5L6FA 2I0KA 3NVVB 5L6GA 3PQBA 2QKNA 5HMRA 5D79A 4JB1A 1JRPA 1W1RA 2PLSA 1F0XA 3TSJA 1T3QC 2Y4GA 5G5GB 3W8ZA 3S1CA 3KJMA 3EJEB 2UUVA 3B9JB 3D2JA 1FIQB 3FW8A 3TX1A 2RK5A 3AM9A 2Q85A 5I1VA 4PZFA 3FW7A 3HSUA 3RJ8A 1VDVA 3HRDC 1FFUC 1W1KA 3BW7A 2VFUA 3PM9A 2W3RA 4EC3A 3EJDB 2AXRA 3NVZB 5FXFA 1DIIA 4PVJA 1N5WC 5AWVA 3GSYA 1HSKA 2GQUA 3FWAA 1N62C 2Y08A 1QLTA 4PVKA 1W1LA 1WVEA 1E8GA 2P3HA 3DEDA 3RJAA 1FO4A 3S1FA 4PWCA 1N60C 1E0YA 5FXPA 2YVSA 3SR6B 3NVYB 2O3GA 1W1QA 1W1JA 5G5HB 2EXRA 2QPMA 3I99A 2GQTA 5AE3A 3AN1A 3AMZA 1E8FA 1N61C 4O95A 2BVFA 1ZXIC 3EUB3 2WDWA 5AE2A 1FFVC 2Q4WA 1N63C 4OALA 4PWBA 1V97A 3NRZB 1W1MA 5FXEA 4DNSA 2Y3SA 2VAOA 2BVHA 3S1EA 5K8EA 1N5XA 2VFTA 5FXDA 1I19A 1DIQA 4ZOHB 4HG0A 2MBRA 2W55A 3JS8A 3S1DA 2E3TA 3DQ0A 3EJBB 3NVWB 2W54A 4JAYA 2R8DA 3C0PA 2IPIA 4BCAA 3NS1B 3LLBA 2VFVA 4ML8A 1W1OA
chains in the Genus database with same CATH topology
3FW9A 4BC7A 1ZR6A 3VTEA 2P4PA 5ADZA 2PLIA 5I1WA 2BVGA 4UD8A 4BC9A 1E8HA 2NQWA 1W1SA 1AHUA 3POPA 1UXYA 2VFSA 2VFRA 1VAOA 2OAIA 5AE1A 4PVEA 1AHVA 4XLOA 1SB3B 1QLUA 3W8XA 4MLAA 1WVFA 1WYGA 3TSHA 3W8WA 1DZNA 2P13A 1MBTA 5HHZA 2W3SA 1AHZA 1MBBA 3D2HA 4PYTA 2R2ZA 1JROA 3ETRB 2Y3RA 1RM6B 5HQXA 4BBYA 4PVHA 2UUUA 3D2DA 3LAEA 5L6FA 2I0KA 3NVVB 5L6GA 3PQBA 2QKNA 5HMRA 5D79A 4JB1A 1JRPA 1W1RA 2PLSA 1F0XA 3TSJA 1T3QC 2Y4GA 5G5GB 3W8ZA 3S1CA 3KJMA 2UUVA 3B9JB 3D2JA 1FIQB 3FW8A 3TX1A 2RK5A 3AM9A 2Q85A 5I1VA 4PZFA 3FW7A 3HSUA 3RJ8A 1VDVA 3HRDC 1FFUC 1W1KA 3BW7A 2VFUA 3PM9A 2W3RA 4EC3A 2AXRA 3NVZB 5FXFA 1DIIA 4PVJA 1N5WC 5AWVA 3GSYA 1HSKA 2GQUA 3FWAA 1N62C 2Y08A 1QLTA 4PVKA 1W1LA 1WVEA 1E8GA 2P3HA 3DEDA 3RJAA 1FO4A 3S1FA 4PWCA 1N60C 1E0YA 5FXPA 2YVSA 3SR6B 3NVYB 2O3GA 1W1QA 1W1JA 5G5HB 2EXRA 2QPMA 3I99A 2GQTA 5AE3A 3AN1A 3AMZA 1E8FA 1N61C 4O95A 2BVFA 1ZXIC 3EUB3 2WDWA 5AE2A 1FFVC 2Q4WA 1N63C 4OALA 4PWBA 1V97A 3NRZB 1W1MA 5FXEA 4DNSA 2Y3SA 2VAOA 2BVHA 3S1EA 5K8EA 1N5XA 2VFTA 5FXDA 1I19A 1DIQA 4ZOHB 4HG0A 2MBRA 2W55A 3JS8A 3S1DA 2E3TA 3DQ0A 3NVWB 2W54A 4JAYA 2R8DA 3C0PA 2IPIA 4BCAA 3NS1B 3LLBA 2VFVA 4ML8A 1W1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW9 A;  4BC7 A;  1ZR6 A;  3VTE A;  2P4P A;  5ADZ A;  2PLI A;  2BVG A;  4UD8 A;  4BC9 A;  1E8H A;  2NQW A;  1W1S A;  1AHU A;  1UXY A;  2VFS A;  2VFR A;  1VAO A;  2OAI A;  5AE1 A;  4PVE A;  1AHV A;  4XLO A;  1SB3 B;  1QLU A;  3W8X A;  4MLA A;  1WVF A;  1WYG A;  3TSH A;  3W8W A;  1DZN A;  2P13 A;  1MBT A;  5HHZ A;  2W3S A;  1AHZ A;  1MBB A;  3D2H A;  4PYT A;  2R2Z A;  1JRO A;  3ETR B;  1RM6 B;  5HQX A;  4BBY A;  4PVH A;  3D2D A;  3LAE A;  2I0K A;  3NVV B;  2QKN A;  5HMR A;  5D79 A;  4JB1 A;  1JRP A;  1W1R A;  2PLS A;  1F0X A;  3TSJ A;  1T3Q C;  5G5G B;  3W8Z A;  3S1C A;  3KJM A;  3B9J B;  3D2J A;  1FIQ B;  3FW8 A;  3TX1 A;  2RK5 A;  3AM9 A;  2Q85 A;  4PZF A;  3FW7 A;  1VDV A;  3HRD C;  1FFU C;  1W1K A;  3BW7 A;  2VFU A;  3PM9 A;  2W3R A;  4EC3 A;  2AXR A;  3NVZ B;  5FXF A;  1DII A;  4PVJ A;  1N5W C;  3GSY A;  1HSK A;  2GQU A;  3FWA A;  1N62 C;  1QLT A;  4PVK A;  1W1L A;  1WVE A;  1E8G A;  2P3H A;  3DED A;  1FO4 A;  3S1F A;  4PWC A;  1N60 C;  1E0Y A;  5FXP A;  2YVS A;  3SR6 B;  3NVY B;  2O3G A;  1W1Q A;  1W1J A;  5G5H B;  2EXR A;  2QPM A;  3I99 A;  2GQT A;  5AE3 A;  3AN1 A;  3AMZ A;  1E8F A;  1N61 C;  4O95 A;  2BVF A;  1ZXI C;  3EUB 3;  5AE2 A;  1FFV C;  2Q4W A;  1N63 C;  4OAL A;  4PWB A;  1V97 A;  3NRZ B;  1W1M A;  5FXE A;  4DNS A;  2VAO A;  2BVH A;  3S1E A;  1N5X A;  2VFT A;  5FXD A;  1I19 A;  1DIQ A;  4ZOH B;  4HG0 A;  2MBR A;  2W55 A;  3JS8 A;  3S1D A;  2E3T A;  3DQ0 A;  3NVW B;  2W54 A;  4JAY A;  2R8D A;  3C0P A;  4BCA A;  3NS1 B;  3LLB A;  2VFV A;  4ML8 A;  1W1O A; 
#chains in the Genus database with same CATH topology
 3FW9 A;  4BC7 A;  1ZR6 A;  3VTE A;  2P4P A;  5ADZ A;  2PLI A;  5I1W A;  2BVG A;  4UD8 A;  4BC9 A;  1E8H A;  2NQW A;  1W1S A;  1AHU A;  3POP A;  1UXY A;  2VFS A;  2VFR A;  1VAO A;  2OAI A;  5AE1 A;  4PVE A;  1AHV A;  4XLO A;  1SB3 B;  1QLU A;  3W8X A;  4MLA A;  1WVF A;  1WYG A;  3TSH A;  3W8W A;  1DZN A;  2P13 A;  1MBT A;  5HHZ A;  2W3S A;  1AHZ A;  1MBB A;  3D2H A;  4PYT A;  2R2Z A;  1JRO A;  3ETR B;  2Y3R A;  1RM6 B;  5HQX A;  4BBY A;  4PVH A;  2UUU A;  3D2D A;  3LAE A;  5L6F A;  2I0K A;  3NVV B;  5L6G A;  3PQB A;  2QKN A;  5HMR A;  5D79 A;  4JB1 A;  1JRP A;  1W1R A;  2PLS A;  1F0X A;  3TSJ A;  1T3Q C;  2Y4G A;  5G5G B;  3W8Z A;  3S1C A;  3KJM A;  3EJE B;  2UUV A;  3B9J B;  3D2J A;  1FIQ B;  3FW8 A;  3TX1 A;  2RK5 A;  3AM9 A;  2Q85 A;  5I1V A;  4PZF A;  3FW7 A;  3HSU A;  3RJ8 A;  1VDV A;  3HRD C;  1FFU C;  1W1K A;  3BW7 A;  2VFU A;  3PM9 A;  2W3R A;  4EC3 A;  3EJD B;  2AXR A;  3NVZ B;  5FXF A;  1DII A;  4PVJ A;  1N5W C;  5AWV A;  3GSY A;  1HSK A;  2GQU A;  3FWA A;  1N62 C;  2Y08 A;  1QLT A;  4PVK A;  1W1L A;  1WVE A;  1E8G A;  2P3H A;  3DED A;  3RJA A;  1FO4 A;  3S1F A;  4PWC A;  1N60 C;  1E0Y A;  5FXP A;  2YVS A;  3SR6 B;  3NVY B;  2O3G A;  1W1Q A;  1W1J A;  5G5H B;  2EXR A;  2QPM A;  3I99 A;  2GQT A;  5AE3 A;  3AN1 A;  3AMZ A;  1E8F A;  1N61 C;  4O95 A;  2BVF A;  1ZXI C;  3EUB 3;  2WDW A;  5AE2 A;  1FFV C;  2Q4W A;  1N63 C;  4OAL A;  4PWB A;  1V97 A;  3NRZ B;  1W1M A;  5FXE A;  4DNS A;  2Y3S A;  2VAO A;  2BVH A;  3S1E A;  5K8E A;  1N5X A;  2VFT A;  5FXD A;  1I19 A;  1DIQ A;  4ZOH B;  4HG0 A;  2MBR A;  2W55 A;  3JS8 A;  3S1D A;  2E3T A;  3DQ0 A;  3EJB B;  3NVW B;  2W54 A;  4JAY A;  2R8D A;  3C0P A;  2IPI A;  4BCA A;  3NS1 B;  3LLB A;  2VFV A;  4ML8 A;  1W1O A; 
#chains in the Genus database with same CATH homology
 3FW9 A;  4BC7 A;  1ZR6 A;  3VTE A;  2P4P A;  5ADZ A;  2PLI A;  5I1W A;  2BVG A;  4UD8 A;  4BC9 A;  1E8H A;  2NQW A;  1W1S A;  1AHU A;  3POP A;  1UXY A;  2VFS A;  2VFR A;  1VAO A;  2OAI A;  5AE1 A;  4PVE A;  1AHV A;  4XLO A;  1SB3 B;  1QLU A;  3W8X A;  4MLA A;  1WVF A;  1WYG A;  3TSH A;  3W8W A;  1DZN A;  2P13 A;  1MBT A;  5HHZ A;  2W3S A;  1AHZ A;  1MBB A;  3D2H A;  4PYT A;  2R2Z A;  1JRO A;  3ETR B;  2Y3R A;  1RM6 B;  5HQX A;  4BBY A;  4PVH A;  2UUU A;  3D2D A;  3LAE A;  5L6F A;  2I0K A;  3NVV B;  5L6G A;  3PQB A;  2QKN A;  5HMR A;  5D79 A;  4JB1 A;  1JRP A;  1W1R A;  2PLS A;  1F0X A;  3TSJ A;  1T3Q C;  2Y4G A;  5G5G B;  3W8Z A;  3S1C A;  3KJM A;  2UUV A;  3B9J B;  3D2J A;  1FIQ B;  3FW8 A;  3TX1 A;  2RK5 A;  3AM9 A;  2Q85 A;  5I1V A;  4PZF A;  3FW7 A;  3HSU A;  3RJ8 A;  1VDV A;  3HRD C;  1FFU C;  1W1K A;  3BW7 A;  2VFU A;  3PM9 A;  2W3R A;  4EC3 A;  2AXR A;  3NVZ B;  5FXF A;  1DII A;  4PVJ A;  1N5W C;  5AWV A;  3GSY A;  1HSK A;  2GQU A;  3FWA A;  1N62 C;  2Y08 A;  1QLT A;  4PVK A;  1W1L A;  1WVE A;  1E8G A;  2P3H A;  3DED A;  3RJA A;  1FO4 A;  3S1F A;  4PWC A;  1N60 C;  1E0Y A;  5FXP A;  2YVS A;  3SR6 B;  3NVY B;  2O3G A;  1W1Q A;  1W1J A;  5G5H B;  2EXR A;  2QPM A;  3I99 A;  2GQT A;  5AE3 A;  3AN1 A;  3AMZ A;  1E8F A;  1N61 C;  4O95 A;  2BVF A;  1ZXI C;  3EUB 3;  2WDW A;  5AE2 A;  1FFV C;  2Q4W A;  1N63 C;  4OAL A;  4PWB A;  1V97 A;  3NRZ B;  1W1M A;  5FXE A;  4DNS A;  2Y3S A;  2VAO A;  2BVH A;  3S1E A;  5K8E A;  1N5X A;  2VFT A;  5FXD A;  1I19 A;  1DIQ A;  4ZOH B;  4HG0 A;  2MBR A;  2W55 A;  3JS8 A;  3S1D A;  2E3T A;  3DQ0 A;  3NVW B;  2W54 A;  4JAY A;  2R8D A;  3C0P A;  2IPI A;  4BCA A;  3NS1 B;  3LLB A;  2VFV A;  4ML8 A;  1W1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...