4O98A

Crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
306
Chain Sequence
APAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFKSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVPVEFSPIRSDRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords organophosphorus hydrolase
publication title Switching a newly discovered lactonase into an efficient and thermostable phosphotriesterase by simple double mutations His250Ile/Ile263Trp
pubmed doi rcsb
source organism Pseudomonas oleovorans
molecule tags Hydrolase
total genus 80
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4o98A00
4Z60A 3X30A 4D1WA 4U4LA 4NQ4A 5A87A 5LMCA 5KILA 1P9EA 2H6AA 5K4NA 3KNRA 5EVBA 5HIQA 4FEKA 1WUOA 4RM5A 4C1FA 4D1VA 4C1DA 2P18A 2Q0IA 5LCAA 2WHGA 3DHCA 4NQ6A 3MD7A 3IE2A 4XWWA 4TZFA 1HLKA 5A0VA 5FQAA 2BFLA 5K4KA 2NZEA 3AJ3A 4AX1B 4DILA 5A0TA 4XUKA 3L6NA 1YCGA 4O98A 5ACPA 2OHJA 3BC2A 4AX0B 1K07A 2WYLA 1BC2A 2XF4A 2BMIA 4D1UA 5FQCA 5LCHA 3DHBA 2BG8B 2ZO4A 3I14A 5EVDA 2M5DA 1VJNA 5AHRA 2ZWRA 1X8GA 3IDZA 5EHTA 4FSBA 1JJEA 2YNTB 2NZFA 3RPCA 2P4ZA 3F9OA 4PVTA 3FAIA 1X8HA 4ZNBA 4RL2A 5HIPA 3I11A 2YNTA 5HH5A 1A7TA 2P1EA 5EV8A 3ZR9A 1WUPA 1MQOA 2DKFA 2Y8AA 3X2YA 1QH5A 5HIOA 3ZWFA 4Z5YA 3SRXA 4TZ9A 4JO0A 4UWOB 2OHHA 1A8TA 3X2ZA 4PVOA 2Q0JA 4ZO2A 3ZNBA 3BV6A 2BIBA 3BK2A 1M2XA 2GCUA 4Z5ZA 4B87A 5EVKA 2CBNA 5AXRA 5EW0A 5K0WA 3IE0A 5FQBA 2ZNBA 3P2UA 4NQ5A 5LE1A 4EYBA 5ACSA 3DH8A 4GCWA 4D1TA 3PY5A 2FU9A 2GFKA 5HH6A 3S0ZA 2HB9A 4EXYA 3Q6VA 4AD9A 2GKLA 2Y87A 3SFPA 3QH8A 1BMCA 1L9YA 5DPXA 5B3RA 2GFJA 4BP0A 2BFZB 5ACWA 5EWAA 4EYFA 4BZ3A 4C1EA 1JJTA 4TZEA 2GMNA 4TZBA 2Y8BA 2UYXA 2OHIA 1XTOA 4KEPA 3SW3A 4UA4A 2A7MA 4XWTA 5IQKA 5EV6A 1QH3A 4D02A 4C1HA 3PY6A 4TYFA 5LCFA 3DHAA 3IEKA 2I7TA 2QJSA 2BG8A 2YNVB 2WYMA 4KEQA 5ACRA 4DIKA 4CHLA 5AHOA 1WRAA 1DD6A 3SD9A 2XR1A 2I7VA 1KO3A 4P62A 4Z67A 1DDKA 2BFKA 3ZQ4A 3T9MA 4EXSA 3IE1A 3RKKA 4GYUA 4HL2A 2R2DA 4HL1A 1VMEA 4AWZA 3T3NA 4Z6XA 2QDSA 2QINA 3IOFA 1Y44A 1DXKA 2VW8A 2E7YA 2FHXB 5LS3A 1JT1A 3T3OA 3X2XA 1X8IA 4WD6A 1KR3A 1XM8A 5ACTA 3ESHA 3A4YA 5A5ZA 4RL0A 5LLDA 4UBQA 2BG6A 5HH4A 4EY2A 5AXOA 2FK6A 2FU8A 2P97A 3I0VA 2YCBA 2BG7A 4HKYA 4UWPB 1YCFA 3PG4A 1ZNBA 4AWYB 5ACVA 2NYPA 4EFZA 5AYAA 5B15A 3KL7A 5ACQA 3VQZA 4YSBA 4UWRB 2BTNA 5LM6A 2BFZA 3FCZA 3WXCA 3IELA 2M5CA 1ZTCA 4C1CA 5EH9A 2WRSA 2BG2A 5B1UA 4H0DA 1KO2A 2BGAA 2FU6A 3IEMA 4J5HA 2Q42A 1BVTA 3IOGA 5ACXA 2FU7A 4YSLA 2I7XA 2DOOA 4UAMA 5K4MA 4C1GA 4RAWA 4YSKA 2YNWA 2YNVA 2QDTA 3SBLA 4RAMA 4NQ2A 4Z7RA 3TP9A 3SPUA 3H3EA 3LVZA 5ACUA 4EYLA 1ZKPA 2YZ3A 5AEBA 4LE6A 3G1PA 3I15A 3AF5A 3I13A 3RKJA 5KIKA 1VGNA 4RBSA 4ZEJA 3R2UA 4UWSB 4GYQA 5HISA 4F6ZA 4ZO3A 2WYMC 2BC2A 1YCHA 2NXAA 2AZ4A 3BK1A 2Q9UA 1SMLA 2FM6A 4V0HA 4F6HA 3AF6A 3ADRA 4TYTA 1E5DA 2ZZIA 4FR7A 2FHXA 2YNUA 2BR6A 5LSCA 3KNSA 3JXPA 4J5FA 2QEDA 4C09A 1WW1A 3VPEA 2AIOA
chains in the Genus database with same CATH superfamily
5AJLA 4Z60A 3X30A 4D1WA 4U4LA 4NQ4A 5A87A 5LMCA 5KILA 1P9EA 2H6AA 5K4NA 3KNRA 5EVBA 5HIQA 4FEKA 1WUOA 4RM5A 4C1FA 4D1VA 4C1DA 2P18A 2Q0IA 5LCAA 2WHGA 3DHCA 4NQ6A 3MD7A 3IE2A 4XWWA 4TZFA 1HLKA 5A0VA 5FQAA 2BFLA 5K4KA 2NZEA 3AJ3A 4AX1B 4DILA 5A0TA 4XUKA 3L6NA 1YCGA 4O98A 5ACPA 2OHJA 3BC2A 4AX0B 1K07A 2WYLA 1BC2A 2XF4A 2BMIA 4D1UA 5FQCA 5LCHA 3DHBA 2CG3A 2BG8B 2ZO4A 3I14A 5EVDA 2M5DA 1VJNA 5AHRA 2ZWRA 1X8GA 3IDZA 5EHTA 4FSBA 1JJEA 2YNTB 2NZFA 3RPCA 2P4ZA 3F9OA 4PVTA 3FAIA 1X8HA 4ZNBA 4RL2A 5HIPA 3I11A 2YNTA 5HH5A 1A7TA 2P1EA 5EV8A 3ZR9A 1WUPA 1MQOA 2DKFA 2Y8AA 3X2YA 1QH5A 5HIOA 3ZWFA 4Z5YA 3SRXA 4TZ9A 4JO0A 4UWOB 2OHHA 1A8TA 3X2ZA 4PVOA 2Q0JA 4ZO2A 3ZNBA 3BV6A 2BIBA 3BK2A 1M2XA 2GCUA 4Z5ZA 4B87A 5EVKA 2CBNA 5AXRA 5EW0A 5K0WA 3IE0A 5FQBA 2ZNBA 3P2UA 4NQ5A 5LE1A 4EYBA 5ACSA 3DH8A 4GCWA 4D1TA 3PY5A 2FU9A 2GFKA 5HH6A 3S0ZA 2HB9A 4EXYA 3Q6VA 4AD9A 2GKLA 2Y87A 3SFPA 3QH8A 1BMCA 1L9YA 5DPXA 5B3RA 2GFJA 4BP0A 2BFZB 5ACWA 5EWAA 4EYFA 2CFZA 4BZ3A 4C1EA 1JJTA 4TZEA 2GMNA 4TZBA 2Y8BA 2UYXA 2OHIA 1XTOA 4KEPA 3SW3A 4UA4A 2A7MA 4XWTA 5IQKA 5EV6A 1QH3A 4D02A 4C1HA 3PY6A 4TYFA 5LCFA 3DHAA 3IEKA 2I7TA 2QJSA 2BG8A 2YNVB 2WYMA 4KEQA 5ACRA 5AIJA 4DIKA 4CHLA 5AHOA 1WRAA 1DD6A 3SD9A 2XR1A 2I7VA 1KO3A 4P62A 4Z67A 1DDKA 2BFKA 3ZQ4A 5A23A 3T9MA 4EXSA 3IE1A 3RKKA 4GYUA 4HL2A 2R2DA 4HL1A 1VMEA 4AWZA 3T3NA 4Z6XA 2QDSA 2QINA 3IOFA 1Y44A 1DXKA 2VW8A 2E7YA 2FHXB 5LS3A 1JT1A 3T3OA 3X2XA 1X8IA 4WD6A 1KR3A 1XM8A 5ACTA 3ESHA 3A4YA 5A5ZA 4RL0A 5LLDA 4UBQA 2BG6A 5HH4A 4EY2A 4PDXA 5AXOA 4NURA 2FK6A 2FU8A 2P97A 2YHEA 3I0VA 2YCBA 2BG7A 4HKYA 4UWPB 1YCFA 3PG4A 1ZNBA 4AXHA 4AWYB 5ACVA 2NYPA 4EFZA 5AYAA 5B15A 3KL7A 5ACQA 3VQZA 4YSBA 4UWRB 2BTNA 5LM6A 2BFZA 3FCZA 3WXCA 3IELA 2M5CA 1ZTCA 4C1CA 5EH9A 2WRSA 2BG2A 5B1UA 4H0DA 1KO2A 2BGAA 2FU6A 3IEMA 4J5HA 2Q42A 1BVTA 3IOGA 5ACXA 2FU7A 4YSLA 2I7XA 2DOOA 4UAMA 5K4MA 4C1GA 4RAWA 4YSKA 2YNWA 2YNVA 2QDTA 3SBLA 4RAMA 4NQ2A 4Z7RA 3TP9A 3SPUA 2CFUA 3H3EA 3LVZA 5ACUA 4EYLA 1ZKPA 2YZ3A 5AEBA 4LE6A 3G1PA 3I15A 3AF5A 2CG2A 3I13A 3RKJA 5KIKA 1VGNA 4RBSA 4ZEJA 3R2UA 4UWSB 4GYQA 5HISA 4F6ZA 4ZO3A 2WYMC 2BC2A 1YCHA 2NXAA 2AZ4A 3BK1A 2Q9UA 1SMLA 2FM6A 4V0HA 4F6HA 3AF6A 3ADRA 4TYTA 1E5DA 2ZZIA 4FR7A 2FHXA 2YNUA 2BR6A 5LSCA 3KNSA 3JXPA 4J5FA 2QEDA 4C09A 1WW1A 4AV7A 3VPEA 2AIOA
chains in the Genus database with same CATH topology
4Z60A 3X30A 4D1WA 4U4LA 4NQ4A 5A87A 5LMCA 5KILA 1P9EA 2H6AA 5K4NA 3KNRA 5EVBA 5HIQA 4FEKA 1WUOA 4RM5A 4C1FA 4D1VA 4C1DA 2P18A 2Q0IA 5LCAA 2WHGA 3DHCA 4NQ6A 3MD7A 3IE2A 4XWWA 4TZFA 1HLKA 5A0VA 5FQAA 2BFLA 5K4KA 2NZEA 3AJ3A 4AX1B 4DILA 5A0TA 4XUKA 3L6NA 1YCGA 4O98A 5ACPA 2OHJA 3BC2A 4AX0B 1K07A 2WYLA 1BC2A 2XF4A 2BMIA 4D1UA 5FQCA 5LCHA 3DHBA 2BG8B 2ZO4A 3I14A 5EVDA 2M5DA 1VJNA 5AHRA 2ZWRA 1X8GA 3IDZA 5EHTA 4FSBA 1JJEA 2YNTB 2NZFA 3RPCA 2P4ZA 3F9OA 4PVTA 3FAIA 1X8HA 4ZNBA 4RL2A 5HIPA 3I11A 2YNTA 5HH5A 1A7TA 2P1EA 5EV8A 3ZR9A 1WUPA 1MQOA 2DKFA 2Y8AA 3X2YA 1QH5A 5HIOA 3ZWFA 4Z5YA 3SRXA 4TZ9A 4JO0A 4UWOB 2OHHA 1A8TA 3X2ZA 4PVOA 2Q0JA 4ZO2A 3ZNBA 3BV6A 2BIBA 3BK2A 1M2XA 2GCUA 4Z5ZA 4B87A 5EVKA 2CBNA 5AXRA 5EW0A 5K0WA 3IE0A 5FQBA 2ZNBA 3P2UA 4NQ5A 5LE1A 4EYBA 5ACSA 3DH8A 4GCWA 4D1TA 3PY5A 2FU9A 2GFKA 5HH6A 3S0ZA 2HB9A 4EXYA 3Q6VA 4AD9A 2GKLA 2Y87A 3SFPA 3QH8A 1BMCA 1L9YA 5DPXA 5B3RA 2GFJA 4BP0A 2BFZB 5ACWA 5EWAA 4EYFA 4BZ3A 4C1EA 1JJTA 4TZEA 2GMNA 4TZBA 2Y8BA 2UYXA 2OHIA 1XTOA 4KEPA 3SW3A 4UA4A 2A7MA 4XWTA 5IQKA 5EV6A 1QH3A 4D02A 4C1HA 3PY6A 4TYFA 5LCFA 3DHAA 3IEKA 2I7TA 2QJSA 2BG8A 2YNVB 2WYMA 4KEQA 5ACRA 4DIKA 4CHLA 5AHOA 1WRAA 1DD6A 3SD9A 2XR1A 2I7VA 1KO3A 4P62A 4Z67A 1DDKA 2BFKA 3ZQ4A 3T9MA 4EXSA 3IE1A 3RKKA 4GYUA 4HL2A 2R2DA 4HL1A 1VMEA 4AWZA 3T3NA 4Z6XA 2QDSA 2QINA 3IOFA 1Y44A 1DXKA 2VW8A 2E7YA 2FHXB 5LS3A 1JT1A 3T3OA 3X2XA 1X8IA 4WD6A 1KR3A 1XM8A 5ACTA 3ESHA 3A4YA 5A5ZA 4RL0A 5LLDA 4UBQA 2BG6A 5HH4A 4EY2A 5AXOA 2FK6A 2FU8A 2P97A 3I0VA 2YCBA 2BG7A 4HKYA 4UWPB 1YCFA 3PG4A 1ZNBA 4AWYB 5ACVA 2NYPA 4EFZA 5AYAA 5B15A 3KL7A 5ACQA 3VQZA 4YSBA 4UWRB 2BTNA 5LM6A 2BFZA 3FCZA 3WXCA 3IELA 2M5CA 1ZTCA 4C1CA 5EH9A 2WRSA 2BG2A 5B1UA 4H0DA 1KO2A 2BGAA 2FU6A 3IEMA 4J5HA 2Q42A 1BVTA 3IOGA 5ACXA 2FU7A 4YSLA 2I7XA 2DOOA 4UAMA 5K4MA 4C1GA 4RAWA 4YSKA 2YNWA 2YNVA 2QDTA 3SBLA 4RAMA 4NQ2A 4Z7RA 3TP9A 3SPUA 3H3EA 3LVZA 5ACUA 4EYLA 1ZKPA 2YZ3A 5AEBA 4LE6A 3G1PA 3I15A 3AF5A 3I13A 3RKJA 5KIKA 1VGNA 4RBSA 4ZEJA 3R2UA 4UWSB 4GYQA 5HISA 4F6ZA 4ZO3A 2WYMC 2BC2A 1YCHA 2NXAA 2AZ4A 3BK1A 2Q9UA 1SMLA 2FM6A 4V0HA 4F6HA 3AF6A 3ADRA 4TYTA 1E5DA 2ZZIA 4FR7A 2FHXA 2YNUA 2BR6A 5LSCA 3KNSA 3JXPA 4J5FA 2QEDA 4C09A 1WW1A 3VPEA 2AIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z60 A;  3X30 A;  4D1W A;  4U4L A;  4NQ4 A;  5A87 A;  5LMC A;  5KIL A;  1P9E A;  2H6A A;  5K4N A;  3KNR A;  5EVB A;  5HIQ A;  4FEK A;  1WUO A;  4RM5 A;  4C1F A;  4D1V A;  4C1D A;  2P18 A;  2Q0I A;  5LCA A;  2WHG A;  3DHC A;  4NQ6 A;  3MD7 A;  3IE2 A;  4XWW A;  4TZF A;  1HLK A;  5A0V A;  5FQA A;  2BFL A;  5K4K A;  2NZE A;  3AJ3 A;  4AX1 B;  4DIL A;  5A0T A;  4XUK A;  3L6N A;  1YCG A;  4O98 A;  5ACP A;  2OHJ A;  3BC2 A;  4AX0 B;  1K07 A;  2WYL A;  1BC2 A;  2XF4 A;  2BMI A;  4D1U A;  5FQC A;  5LCH A;  3DHB A;  2BG8 B;  2ZO4 A;  3I14 A;  5EVD A;  2M5D A;  1VJN A;  5AHR A;  2ZWR A;  1X8G A;  3IDZ A;  5EHT A;  4FSB A;  1JJE A;  2YNT B;  2NZF A;  3RPC A;  2P4Z A;  3F9O A;  4PVT A;  3FAI A;  1X8H A;  4ZNB A;  4RL2 A;  5HIP A;  3I11 A;  2YNT A;  5HH5 A;  1A7T A;  2P1E A;  5EV8 A;  3ZR9 A;  1WUP A;  1MQO A;  2DKF A;  2Y8A A;  3X2Y A;  1QH5 A;  5HIO A;  3ZWF A;  4Z5Y A;  3SRX A;  4TZ9 A;  4JO0 A;  4UWO B;  2OHH A;  1A8T A;  3X2Z A;  4PVO A;  2Q0J A;  4ZO2 A;  3ZNB A;  3BV6 A;  2BIB A;  3BK2 A;  1M2X A;  2GCU A;  4Z5Z A;  4B87 A;  5EVK A;  2CBN A;  5AXR A;  5EW0 A;  5K0W A;  3IE0 A;  5FQB A;  2ZNB A;  3P2U A;  4NQ5 A;  5LE1 A;  4EYB A;  5ACS A;  3DH8 A;  4GCW A;  4D1T A;  3PY5 A;  2FU9 A;  2GFK A;  5HH6 A;  3S0Z A;  2HB9 A;  4EXY A;  3Q6V A;  4AD9 A;  2GKL A;  2Y87 A;  3SFP A;  3QH8 A;  1BMC A;  1L9Y A;  5DPX A;  5B3R A;  2GFJ A;  4BP0 A;  2BFZ B;  5ACW A;  5EWA A;  4EYF A;  4BZ3 A;  4C1E A;  1JJT A;  4TZE A;  2GMN A;  4TZB A;  2Y8B A;  2UYX A;  2OHI A;  1XTO A;  4KEP A;  3SW3 A;  4UA4 A;  2A7M A;  4XWT A;  5IQK A;  5EV6 A;  1QH3 A;  4D02 A;  4C1H A;  3PY6 A;  4TYF A;  5LCF A;  3DHA A;  3IEK A;  2I7T A;  2QJS A;  2BG8 A;  2YNV B;  2WYM A;  4KEQ A;  5ACR A;  4DIK A;  4CHL A;  5AHO A;  1WRA A;  1DD6 A;  3SD9 A;  2XR1 A;  2I7V A;  1KO3 A;  4P62 A;  4Z67 A;  1DDK A;  2BFK A;  3ZQ4 A;  3T9M A;  4EXS A;  3IE1 A;  3RKK A;  4GYU A;  4HL2 A;  2R2D A;  4HL1 A;  1VME A;  4AWZ A;  3T3N A;  4Z6X A;  2QDS A;  2QIN A;  3IOF A;  1Y44 A;  1DXK A;  2VW8 A;  2E7Y A;  2FHX B;  5LS3 A;  1JT1 A;  3T3O A;  3X2X A;  1X8I A;  4WD6 A;  1KR3 A;  1XM8 A;  5ACT A;  3ESH A;  3A4Y A;  5A5Z A;  4RL0 A;  5LLD A;  4UBQ A;  2BG6 A;  5HH4 A;  4EY2 A;  5AXO A;  2FK6 A;  2FU8 A;  2P97 A;  3I0V A;  2YCB A;  2BG7 A;  4HKY A;  4UWP B;  1YCF A;  3PG4 A;  1ZNB A;  4AWY B;  5ACV A;  2NYP A;  4EFZ A;  5AYA A;  5B15 A;  3KL7 A;  5ACQ A;  3VQZ A;  4YSB A;  4UWR B;  2BTN A;  5LM6 A;  2BFZ A;  3FCZ A;  3WXC A;  3IEL A;  2M5C A;  1ZTC A;  4C1C A;  5EH9 A;  2WRS A;  2BG2 A;  5B1U A;  4H0D A;  1KO2 A;  2BGA A;  2FU6 A;  3IEM A;  4J5H A;  2Q42 A;  1BVT A;  3IOG A;  5ACX A;  2FU7 A;  4YSL A;  2I7X A;  2DOO A;  4UAM A;  5K4M A;  4C1G A;  4RAW A;  4YSK A;  2YNW A;  2YNV A;  2QDT A;  3SBL A;  4RAM A;  4NQ2 A;  4Z7R A;  3TP9 A;  3SPU A;  3H3E A;  3LVZ A;  5ACU A;  4EYL A;  1ZKP A;  2YZ3 A;  5AEB A;  4LE6 A;  3G1P A;  3I15 A;  3AF5 A;  3I13 A;  3RKJ A;  5KIK A;  1VGN A;  4RBS A;  4ZEJ A;  3R2U A;  4UWS B;  4GYQ A;  5HIS A;  4F6Z A;  4ZO3 A;  2WYM C;  2BC2 A;  1YCH A;  2NXA A;  2AZ4 A;  3BK1 A;  2Q9U A;  1SML A;  2FM6 A;  4V0H A;  4F6H A;  3AF6 A;  3ADR A;  4TYT A;  1E5D A;  2ZZI A;  4FR7 A;  2FHX A;  2YNU A;  2BR6 A;  5LSC A;  3KNS A;  3JXP A;  4J5F A;  2QED A;  4C09 A;  1WW1 A;  3VPE A;  2AIO A; 
#chains in the Genus database with same CATH topology
 5AJL A;  4Z60 A;  3X30 A;  4D1W A;  4U4L A;  4NQ4 A;  5A87 A;  5LMC A;  5KIL A;  1P9E A;  2H6A A;  5K4N A;  3KNR A;  5EVB A;  5HIQ A;  4FEK A;  1WUO A;  4RM5 A;  4C1F A;  4D1V A;  4C1D A;  2P18 A;  2Q0I A;  5LCA A;  2WHG A;  3DHC A;  4NQ6 A;  3MD7 A;  3IE2 A;  4XWW A;  4TZF A;  1HLK A;  5A0V A;  5FQA A;  2BFL A;  5K4K A;  2NZE A;  3AJ3 A;  4AX1 B;  4DIL A;  5A0T A;  4XUK A;  3L6N A;  1YCG A;  4O98 A;  5ACP A;  2OHJ A;  3BC2 A;  4AX0 B;  1K07 A;  2WYL A;  1BC2 A;  2XF4 A;  2BMI A;  4D1U A;  5FQC A;  5LCH A;  3DHB A;  2CG3 A;  2BG8 B;  2ZO4 A;  3I14 A;  5EVD A;  2M5D A;  1VJN A;  5AHR A;  2ZWR A;  1X8G A;  3IDZ A;  5EHT A;  4FSB A;  1JJE A;  2YNT B;  2NZF A;  3RPC A;  2P4Z A;  3F9O A;  4PVT A;  3FAI A;  1X8H A;  4ZNB A;  4RL2 A;  5HIP A;  3I11 A;  2YNT A;  5HH5 A;  1A7T A;  2P1E A;  5EV8 A;  3ZR9 A;  1WUP A;  1MQO A;  2DKF A;  2Y8A A;  3X2Y A;  1QH5 A;  5HIO A;  3ZWF A;  4Z5Y A;  3SRX A;  4TZ9 A;  4JO0 A;  4UWO B;  2OHH A;  1A8T A;  3X2Z A;  4PVO A;  2Q0J A;  4ZO2 A;  3ZNB A;  3BV6 A;  2BIB A;  3BK2 A;  1M2X A;  2GCU A;  4Z5Z A;  4B87 A;  5EVK A;  2CBN A;  5AXR A;  5EW0 A;  5K0W A;  3IE0 A;  5FQB A;  2ZNB A;  3P2U A;  4NQ5 A;  5LE1 A;  4EYB A;  5ACS A;  3DH8 A;  4GCW A;  4D1T A;  3PY5 A;  2FU9 A;  2GFK A;  5HH6 A;  3S0Z A;  2HB9 A;  4EXY A;  3Q6V A;  4AD9 A;  2GKL A;  2Y87 A;  3SFP A;  3QH8 A;  1BMC A;  1L9Y A;  5DPX A;  5B3R A;  2GFJ A;  4BP0 A;  2BFZ B;  5ACW A;  5EWA A;  4EYF A;  2CFZ A;  4BZ3 A;  4C1E A;  1JJT A;  4TZE A;  2GMN A;  4TZB A;  2Y8B A;  2UYX A;  2OHI A;  1XTO A;  4KEP A;  3SW3 A;  4UA4 A;  2A7M A;  4XWT A;  5IQK A;  5EV6 A;  1QH3 A;  4D02 A;  4C1H A;  3PY6 A;  4TYF A;  5LCF A;  3DHA A;  3IEK A;  2I7T A;  2QJS A;  2BG8 A;  2YNV B;  2WYM A;  4KEQ A;  5ACR A;  5AIJ A;  4DIK A;  4CHL A;  5AHO A;  1WRA A;  1DD6 A;  3SD9 A;  2XR1 A;  2I7V A;  1KO3 A;  4P62 A;  4Z67 A;  1DDK A;  2BFK A;  3ZQ4 A;  5A23 A;  3T9M A;  4EXS A;  3IE1 A;  3RKK A;  4GYU A;  4HL2 A;  2R2D A;  4HL1 A;  1VME A;  4AWZ A;  3T3N A;  4Z6X A;  2QDS A;  2QIN A;  3IOF A;  1Y44 A;  1DXK A;  2VW8 A;  2E7Y A;  2FHX B;  5LS3 A;  1JT1 A;  3T3O A;  3X2X A;  1X8I A;  4WD6 A;  1KR3 A;  1XM8 A;  5ACT A;  3ESH A;  3A4Y A;  5A5Z A;  4RL0 A;  5LLD A;  4UBQ A;  2BG6 A;  5HH4 A;  4EY2 A;  4PDX A;  5AXO A;  4NUR A;  2FK6 A;  2FU8 A;  2P97 A;  2YHE A;  3I0V A;  2YCB A;  2BG7 A;  4HKY A;  4UWP B;  1YCF A;  3PG4 A;  1ZNB A;  4AXH A;  4AWY B;  5ACV A;  2NYP A;  4EFZ A;  5AYA A;  5B15 A;  3KL7 A;  5ACQ A;  3VQZ A;  4YSB A;  4UWR B;  2BTN A;  5LM6 A;  2BFZ A;  3FCZ A;  3WXC A;  3IEL A;  2M5C A;  1ZTC A;  4C1C A;  5EH9 A;  2WRS A;  2BG2 A;  5B1U A;  4H0D A;  1KO2 A;  2BGA A;  2FU6 A;  3IEM A;  4J5H A;  2Q42 A;  1BVT A;  3IOG A;  5ACX A;  2FU7 A;  4YSL A;  2I7X A;  2DOO A;  4UAM A;  5K4M A;  4C1G A;  4RAW A;  4YSK A;  2YNW A;  2YNV A;  2QDT A;  3SBL A;  4RAM A;  4NQ2 A;  4Z7R A;  3TP9 A;  3SPU A;  2CFU A;  3H3E A;  3LVZ A;  5ACU A;  4EYL A;  1ZKP A;  2YZ3 A;  5AEB A;  4LE6 A;  3G1P A;  3I15 A;  3AF5 A;  2CG2 A;  3I13 A;  3RKJ A;  5KIK A;  1VGN A;  4RBS A;  4ZEJ A;  3R2U A;  4UWS B;  4GYQ A;  5HIS A;  4F6Z A;  4ZO3 A;  2WYM C;  2BC2 A;  1YCH A;  2NXA A;  2AZ4 A;  3BK1 A;  2Q9U A;  1SML A;  2FM6 A;  4V0H A;  4F6H A;  3AF6 A;  3ADR A;  4TYT A;  1E5D A;  2ZZI A;  4FR7 A;  2FHX A;  2YNU A;  2BR6 A;  5LSC A;  3KNS A;  3JXP A;  4J5F A;  2QED A;  4C09 A;  1WW1 A;  4AV7 A;  3VPE A;  2AIO A; 
#chains in the Genus database with same CATH homology
 4Z60 A;  3X30 A;  4D1W A;  4U4L A;  4NQ4 A;  5A87 A;  5LMC A;  5KIL A;  1P9E A;  2H6A A;  5K4N A;  3KNR A;  5EVB A;  5HIQ A;  4FEK A;  1WUO A;  4RM5 A;  4C1F A;  4D1V A;  4C1D A;  2P18 A;  2Q0I A;  5LCA A;  2WHG A;  3DHC A;  4NQ6 A;  3MD7 A;  3IE2 A;  4XWW A;  4TZF A;  1HLK A;  5A0V A;  5FQA A;  2BFL A;  5K4K A;  2NZE A;  3AJ3 A;  4AX1 B;  4DIL A;  5A0T A;  4XUK A;  3L6N A;  1YCG A;  4O98 A;  5ACP A;  2OHJ A;  3BC2 A;  4AX0 B;  1K07 A;  2WYL A;  1BC2 A;  2XF4 A;  2BMI A;  4D1U A;  5FQC A;  5LCH A;  3DHB A;  2BG8 B;  2ZO4 A;  3I14 A;  5EVD A;  2M5D A;  1VJN A;  5AHR A;  2ZWR A;  1X8G A;  3IDZ A;  5EHT A;  4FSB A;  1JJE A;  2YNT B;  2NZF A;  3RPC A;  2P4Z A;  3F9O A;  4PVT A;  3FAI A;  1X8H A;  4ZNB A;  4RL2 A;  5HIP A;  3I11 A;  2YNT A;  5HH5 A;  1A7T A;  2P1E A;  5EV8 A;  3ZR9 A;  1WUP A;  1MQO A;  2DKF A;  2Y8A A;  3X2Y A;  1QH5 A;  5HIO A;  3ZWF A;  4Z5Y A;  3SRX A;  4TZ9 A;  4JO0 A;  4UWO B;  2OHH A;  1A8T A;  3X2Z A;  4PVO A;  2Q0J A;  4ZO2 A;  3ZNB A;  3BV6 A;  2BIB A;  3BK2 A;  1M2X A;  2GCU A;  4Z5Z A;  4B87 A;  5EVK A;  2CBN A;  5AXR A;  5EW0 A;  5K0W A;  3IE0 A;  5FQB A;  2ZNB A;  3P2U A;  4NQ5 A;  5LE1 A;  4EYB A;  5ACS A;  3DH8 A;  4GCW A;  4D1T A;  3PY5 A;  2FU9 A;  2GFK A;  5HH6 A;  3S0Z A;  2HB9 A;  4EXY A;  3Q6V A;  4AD9 A;  2GKL A;  2Y87 A;  3SFP A;  3QH8 A;  1BMC A;  1L9Y A;  5DPX A;  5B3R A;  2GFJ A;  4BP0 A;  2BFZ B;  5ACW A;  5EWA A;  4EYF A;  4BZ3 A;  4C1E A;  1JJT A;  4TZE A;  2GMN A;  4TZB A;  2Y8B A;  2UYX A;  2OHI A;  1XTO A;  4KEP A;  3SW3 A;  4UA4 A;  2A7M A;  4XWT A;  5IQK A;  5EV6 A;  1QH3 A;  4D02 A;  4C1H A;  3PY6 A;  4TYF A;  5LCF A;  3DHA A;  3IEK A;  2I7T A;  2QJS A;  2BG8 A;  2YNV B;  2WYM A;  4KEQ A;  5ACR A;  4DIK A;  4CHL A;  5AHO A;  1WRA A;  1DD6 A;  3SD9 A;  2XR1 A;  2I7V A;  1KO3 A;  4P62 A;  4Z67 A;  1DDK A;  2BFK A;  3ZQ4 A;  3T9M A;  4EXS A;  3IE1 A;  3RKK A;  4GYU A;  4HL2 A;  2R2D A;  4HL1 A;  1VME A;  4AWZ A;  3T3N A;  4Z6X A;  2QDS A;  2QIN A;  3IOF A;  1Y44 A;  1DXK A;  2VW8 A;  2E7Y A;  2FHX B;  5LS3 A;  1JT1 A;  3T3O A;  3X2X A;  1X8I A;  4WD6 A;  1KR3 A;  1XM8 A;  5ACT A;  3ESH A;  3A4Y A;  5A5Z A;  4RL0 A;  5LLD A;  4UBQ A;  2BG6 A;  5HH4 A;  4EY2 A;  5AXO A;  2FK6 A;  2FU8 A;  2P97 A;  3I0V A;  2YCB A;  2BG7 A;  4HKY A;  4UWP B;  1YCF A;  3PG4 A;  1ZNB A;  4AWY B;  5ACV A;  2NYP A;  4EFZ A;  5AYA A;  5B15 A;  3KL7 A;  5ACQ A;  3VQZ A;  4YSB A;  4UWR B;  2BTN A;  5LM6 A;  2BFZ A;  3FCZ A;  3WXC A;  3IEL A;  2M5C A;  1ZTC A;  4C1C A;  5EH9 A;  2WRS A;  2BG2 A;  5B1U A;  4H0D A;  1KO2 A;  2BGA A;  2FU6 A;  3IEM A;  4J5H A;  2Q42 A;  1BVT A;  3IOG A;  5ACX A;  2FU7 A;  4YSL A;  2I7X A;  2DOO A;  4UAM A;  5K4M A;  4C1G A;  4RAW A;  4YSK A;  2YNW A;  2YNV A;  2QDT A;  3SBL A;  4RAM A;  4NQ2 A;  4Z7R A;  3TP9 A;  3SPU A;  3H3E A;  3LVZ A;  5ACU A;  4EYL A;  1ZKP A;  2YZ3 A;  5AEB A;  4LE6 A;  3G1P A;  3I15 A;  3AF5 A;  3I13 A;  3RKJ A;  5KIK A;  1VGN A;  4RBS A;  4ZEJ A;  3R2U A;  4UWS B;  4GYQ A;  5HIS A;  4F6Z A;  4ZO3 A;  2WYM C;  2BC2 A;  1YCH A;  2NXA A;  2AZ4 A;  3BK1 A;  2Q9U A;  1SML A;  2FM6 A;  4V0H A;  4F6H A;  3AF6 A;  3ADR A;  4TYT A;  1E5D A;  2ZZI A;  4FR7 A;  2FHX A;  2YNU A;  2BR6 A;  5LSC A;  3KNS A;  3JXP A;  4J5F A;  2QED A;  4C09 A;  1WW1 A;  3VPE A;  2AIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...