4O98A

Crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
306
Chain Sequence
APAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFKSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVPVEFSPIRSDRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching a newly discovered lactonase into an efficient and thermostable phosphotriesterase by simple double mutations His250Ile/Ile263Trp
pubmed doi rcsb
source organism Pseudomonas oleovorans
molecule tags Hydrolase
molecule keywords organophosphorus hydrolase
total genus 80
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4o98A00
3KNRA 5HISA 5ACWA 4C1CA 5EWAA 5DPXA 3IE1A 4AWZA 3L6NA 2AZ4A 1ZKPA 4J5HA 3X2XA 1VMEA 2GCUA 5LLDA 4HL2A 4C1GA 3PY5A 4EY2A 1KO3A 3FAIA 2BFZA 4RM5A 3BK2A 3IELA 5FQBA 4BP0A 3AF6A 4Z6XA 4NQ4A 4WD6A 2H6AA 4UAMA 3QH8A 3IE0A 4HKYA 4FSBA 3T9MA 1XM8A 4EXYA 4RAWA 1L9YA 2M5DA 4DILA 4C1DA 5K0WA 4YSLA 4TZEA 5FQCA 1M2XA 1A7TA 4D02A 1A8TA 4RL0A 4TYTA 1BVTA 5HH5A 4Z7RA 2UYXA 5HIOA 4RL2A 3SPUA 4D1WA 2BG8B 4ZO2A 3RKJA 4TZBA 2GFKA 5HIPA 3PY6A 2QDTA 3DHAA 2FU6A 1P9EA 4AX0B 4ZO3A 1YCGA 2FU9A 3IDZA 4Z5YA 3WXCA 2ZO4A 3T3NA 5ACQA 3H3EA 2BG7A 5EW0A 5LCFA 2BTNA 3BV6A 4C1FA 1KO2A 4BZ3A 2YNTA 3MD7A 2GKLA 3VPEA 5ACXA 4C1EA 4B87A 2HB9A 5A5ZA 4CHLA 4YSKA 2GFJA 3P2UA 4Z67A 1X8IA 1JJTA 5ACVA 5ACPA 2BG2A 3ZQ4A 4HL1A 2P4ZA 1K07A 2YNVB 5EVKA 3I15A 2VW8A 4XUKA 2AIOA 1QH5A 2OHIA 3ESHA 5EV6A 4Z5ZA 2BR6A 2DKFA 4FEKA 2I7TA 3KL7A 1JJEA 3LVZA 2XF4A 2YNVA 2BG8A 3SFPA 4AWYB 1WUPA 2YCBA 1WW1A 2P1EA 2FHXB 2Y8BA 2BC2A 5ACTA 3ADRA 4J5FA 5A0TA 2BMIA 3Q6VA 2QJSA 3IEMA 2E7YA 2Y87A 3BC2A 4EYFA 3DHBA 3DH8A 3X2ZA 2BG6A 4NQ5A 5HH6A 4F6HA 1ZNBA 5A87A 3AJ3A 2WHGA 4V0HA 2WYLA 3DHCA 4RAMA 3I13A 2QDSA 1XTOA 3X30A 1MQOA 5ACRA 2YNWA 4D1TA 4PVOA 5KIKA 2WYMC 2NZFA 2WYMA 2FU7A 2GMNA 5AXOA 4ZNBA 3ZWFA 2I7XA 4UA4A 5KILA 4EYLA 3SBLA 3X2YA 5K4KA 2BFKA 4UWSB 1VGNA 4UWRB 3IE2A 2YNTB 5HH4A 1X8HA 3A4YA 1JT1A 2BGAA 4NQ2A 2BIBA 1BC2A 5EVDA 4D1UA 5AHOA 4XWTA 2XR1A 4H0DA 2FU8A 4TZ9A 2QINA 2ZZIA 5LM6A 4NQ6A 4EXSA 5LCHA 1VJNA 3IEKA 5LS3A 4KEQA 4DIKA 3IOFA 5AHRA 3SW3A 4O98A 3KNSA 1YCHA 1SMLA 1WUOA 2OHJA 3TP9A 3RKKA 4GCWA 2NYPA 5LMCA 3S0ZA 2FHXA 1HLKA 4UWPB 5B1UA 2ZNBA 5LSCA 1X8GA 2BFZB 3RPCA 1ZTCA 3SRXA 1DXKA 3R2UA 2NXAA 2P97A 5EVBA 4ZEJA 4TYFA 4YSBA 5LCAA 5FQAA 4AX1B 4C09A 4C1HA 2FK6A 5EV8A 3ZR9A 3I0VA 4GYUA 1DDKA 5AXRA 4GYQA 4P62A 3BK1A 4RBSA 4F6ZA 2M5CA 4PVTA 4FR7A 4UWOB 3SD9A 1E5DA 5HIQA 5ACSA 4D1VA 3JXPA 2OHHA 5K4NA 5B15A 5IQKA 4Z60A 1YCFA 3IOGA 2Q0JA 1WRAA 3F9OA 4U4LA 4EYBA 4EFZA 1DD6A 2WRSA 5LE1A 2A7MA 5AEBA 2Y8AA 2QEDA 3I11A 2YNUA 4UBQA 1Y44A 1BMCA 3FCZA 3T3OA 4JO0A 2Q0IA 4TZFA 5EHTA 5K4MA 2CBNA 2FM6A 2YZ3A 2P18A 2ZWRA 5B3RA 2NZEA 3G1PA 5A0VA 2DOOA 2Q9UA 3PG4A 4LE6A 2Q42A 1KR3A 4XWWA 4KEPA 2I7VA 4AD9A 3ZNBA 5AYAA 3AF5A 2BFLA 1QH3A 5EH9A 3VQZA 3I14A 5ACUA 2R2DA
chains in the Genus database with same CATH superfamily
3KNRA 5HISA 5ACWA 4C1CA 5EWAA 5DPXA 3IE1A 4AWZA 3L6NA 2AZ4A 1ZKPA 4J5HA 3X2XA 1VMEA 2GCUA 5LLDA 4HL2A 4C1GA 3PY5A 4EY2A 1KO3A 3FAIA 2BFZA 4RM5A 3BK2A 3IELA 5FQBA 4BP0A 3AF6A 4Z6XA 4NQ4A 4WD6A 2H6AA 4UAMA 3QH8A 3IE0A 4HKYA 4FSBA 3T9MA 1XM8A 4EXYA 4RAWA 1L9YA 2M5DA 4DILA 4C1DA 5K0WA 4YSLA 4TZEA 5FQCA 1M2XA 1A7TA 4D02A 1A8TA 4RL0A 4TYTA 1BVTA 5HH5A 4Z7RA 2UYXA 2CG3A 5HIOA 4RL2A 3SPUA 4D1WA 2BG8B 4ZO2A 3RKJA 4TZBA 2GFKA 5HIPA 3PY6A 2QDTA 3DHAA 2FU6A 1P9EA 2CFUA 4AX0B 4ZO3A 1YCGA 2FU9A 3IDZA 4Z5YA 3WXCA 2ZO4A 3T3NA 5ACQA 3H3EA 2BG7A 5EW0A 5LCFA 2BTNA 3BV6A 4C1FA 1KO2A 4BZ3A 2YNTA 3MD7A 2GKLA 3VPEA 5ACXA 4NURA 4C1EA 4PDXA 4B87A 2HB9A 5A5ZA 4CHLA 4YSKA 2GFJA 3P2UA 4Z67A 1X8IA 1JJTA 5ACVA 5ACPA 2BG2A 3ZQ4A 4HL1A 5A23A 2P4ZA 1K07A 2YNVB 5EVKA 3I15A 2VW8A 4XUKA 2AIOA 1QH5A 2OHIA 3ESHA 5EV6A 4Z5ZA 2BR6A 2DKFA 4FEKA 2I7TA 3KL7A 1JJEA 3LVZA 2XF4A 2YNVA 2BG8A 5AJLA 3SFPA 4AWYB 1WUPA 2YCBA 1WW1A 2P1EA 2FHXB 2Y8BA 2BC2A 5ACTA 3ADRA 4J5FA 5A0TA 2BMIA 3Q6VA 2QJSA 3IEMA 2E7YA 2Y87A 3BC2A 4EYFA 3DHBA 3DH8A 3X2ZA 2BG6A 4NQ5A 5HH6A 4F6HA 1ZNBA 5A87A 3AJ3A 2WHGA 4V0HA 2WYLA 3DHCA 4RAMA 3I13A 2QDSA 1XTOA 3X30A 1MQOA 5ACRA 2YNWA 4D1TA 4PVOA 2WYMC 5KIKA 2NZFA 2WYMA 2FU7A 2GMNA 5AXOA 4ZNBA 3ZWFA 2I7XA 4UA4A 5KILA 4EYLA 3SBLA 5AIJA 3X2YA 5K4KA 2BFKA 4UWSB 1VGNA 4UWRB 3IE2A 2YNTB 5HH4A 1X8HA 3A4YA 1JT1A 2BGAA 4NQ2A 2BIBA 1BC2A 5EVDA 4D1UA 5AHOA 4XWTA 2XR1A 4H0DA 2FU8A 4TZ9A 2QINA 2ZZIA 5LM6A 4NQ6A 4EXSA 5LCHA 1VJNA 3IEKA 5LS3A 4KEQA 4DIKA 3IOFA 5AHRA 3SW3A 4O98A 3KNSA 2CFZA 1YCHA 1SMLA 1WUOA 2OHJA 3TP9A 3RKKA 4GCWA 2NYPA 5LMCA 3S0ZA 2FHXA 1HLKA 4UWPB 5B1UA 2ZNBA 5LSCA 1X8GA 2BFZB 3RPCA 1ZTCA 3SRXA 4AXHA 1DXKA 3R2UA 2NXAA 2P97A 5EVBA 4ZEJA 4TYFA 4YSBA 5LCAA 5FQAA 4AX1B 4C09A 4C1HA 2FK6A 5EV8A 3ZR9A 3I0VA 4GYUA 1DDKA 5AXRA 4GYQA 4P62A 3BK1A 4RBSA 4F6ZA 2M5CA 4PVTA 4FR7A 4UWOB 3SD9A 1E5DA 5HIQA 5ACSA 4D1VA 3JXPA 2OHHA 5K4NA 5B15A 5IQKA 4Z60A 1YCFA 3IOGA 2Q0JA 1WRAA 3F9OA 4U4LA 4EYBA 4EFZA 1DD6A 2WRSA 5LE1A 2YHEA 2A7MA 5AEBA 2Y8AA 2QEDA 3I11A 2YNUA 4UBQA 1Y44A 1BMCA 3FCZA 3T3OA 4JO0A 2Q0IA 4TZFA 5EHTA 5K4MA 2CBNA 2FM6A 2YZ3A 2P18A 2ZWRA 5B3RA 2NZEA 3G1PA 5A0VA 2DOOA 2Q9UA 3PG4A 4LE6A 2Q42A 1KR3A 4XWWA 4KEPA 2I7VA 4AD9A 3ZNBA 5AYAA 3AF5A 2CG2A 2BFLA 1QH3A 5EH9A 4AV7A 3VQZA 3I14A 5ACUA 2R2DA
chains in the Genus database with same CATH topology
3KNRA 5HISA 5ACWA 4C1CA 5EWAA 5DPXA 3IE1A 4AWZA 3L6NA 2AZ4A 1ZKPA 4J5HA 3X2XA 1VMEA 2GCUA 5LLDA 4HL2A 4C1GA 3PY5A 4EY2A 1KO3A 3FAIA 2BFZA 4RM5A 3BK2A 3IELA 5FQBA 4BP0A 3AF6A 4Z6XA 4NQ4A 4WD6A 2H6AA 4UAMA 3QH8A 3IE0A 4HKYA 4FSBA 3T9MA 1XM8A 4EXYA 4RAWA 1L9YA 2M5DA 4DILA 4C1DA 5K0WA 4YSLA 4TZEA 5FQCA 1M2XA 1A7TA 4D02A 1A8TA 4RL0A 4TYTA 1BVTA 5HH5A 4Z7RA 2UYXA 5HIOA 4RL2A 3SPUA 4D1WA 2BG8B 4ZO2A 3RKJA 4TZBA 2GFKA 5HIPA 3PY6A 2QDTA 3DHAA 2FU6A 1P9EA 4AX0B 4ZO3A 1YCGA 2FU9A 3IDZA 4Z5YA 3WXCA 2ZO4A 3T3NA 5ACQA 3H3EA 2BG7A 5EW0A 5LCFA 2BTNA 3BV6A 4C1FA 1KO2A 4BZ3A 2YNTA 3MD7A 2GKLA 3VPEA 5ACXA 4C1EA 4B87A 2HB9A 5A5ZA 4CHLA 4YSKA 2GFJA 3P2UA 4Z67A 1X8IA 1JJTA 5ACVA 5ACPA 2BG2A 3ZQ4A 4HL1A 2P4ZA 1K07A 2YNVB 5EVKA 3I15A 2VW8A 4XUKA 2AIOA 1QH5A 2OHIA 3ESHA 5EV6A 4Z5ZA 2BR6A 2DKFA 4FEKA 2I7TA 3KL7A 1JJEA 3LVZA 2XF4A 2YNVA 2BG8A 3SFPA 4AWYB 1WUPA 2YCBA 1WW1A 2P1EA 2FHXB 2Y8BA 2BC2A 5ACTA 3ADRA 4J5FA 5A0TA 2BMIA 3Q6VA 2QJSA 3IEMA 2E7YA 2Y87A 3BC2A 4EYFA 3DHBA 3DH8A 3X2ZA 2BG6A 4NQ5A 5HH6A 4F6HA 1ZNBA 5A87A 3AJ3A 2WHGA 4V0HA 2WYLA 3DHCA 4RAMA 3I13A 2QDSA 1XTOA 3X30A 1MQOA 5ACRA 2YNWA 4D1TA 4PVOA 5KIKA 2WYMC 2NZFA 2WYMA 2FU7A 2GMNA 5AXOA 4ZNBA 3ZWFA 2I7XA 4UA4A 5KILA 4EYLA 3SBLA 3X2YA 5K4KA 2BFKA 4UWSB 1VGNA 4UWRB 3IE2A 2YNTB 5HH4A 1X8HA 3A4YA 1JT1A 2BGAA 4NQ2A 2BIBA 1BC2A 5EVDA 4D1UA 5AHOA 4XWTA 2XR1A 4H0DA 2FU8A 4TZ9A 2QINA 2ZZIA 5LM6A 4NQ6A 4EXSA 5LCHA 1VJNA 3IEKA 5LS3A 4KEQA 4DIKA 3IOFA 5AHRA 3SW3A 4O98A 3KNSA 1YCHA 1SMLA 1WUOA 2OHJA 3TP9A 3RKKA 4GCWA 2NYPA 5LMCA 3S0ZA 2FHXA 1HLKA 4UWPB 5B1UA 2ZNBA 5LSCA 1X8GA 2BFZB 3RPCA 1ZTCA 3SRXA 1DXKA 3R2UA 2NXAA 2P97A 5EVBA 4ZEJA 4TYFA 4YSBA 5LCAA 5FQAA 4AX1B 4C09A 4C1HA 2FK6A 5EV8A 3ZR9A 3I0VA 4GYUA 1DDKA 5AXRA 4GYQA 4P62A 3BK1A 4RBSA 4F6ZA 2M5CA 4PVTA 4FR7A 4UWOB 3SD9A 1E5DA 5HIQA 5ACSA 4D1VA 3JXPA 2OHHA 5K4NA 5B15A 5IQKA 4Z60A 1YCFA 3IOGA 2Q0JA 1WRAA 3F9OA 4U4LA 4EYBA 4EFZA 1DD6A 2WRSA 5LE1A 2A7MA 5AEBA 2Y8AA 2QEDA 3I11A 2YNUA 4UBQA 1Y44A 1BMCA 3FCZA 3T3OA 4JO0A 2Q0IA 4TZFA 5EHTA 5K4MA 2CBNA 2FM6A 2YZ3A 2P18A 2ZWRA 5B3RA 2NZEA 3G1PA 5A0VA 2DOOA 2Q9UA 3PG4A 4LE6A 2Q42A 1KR3A 4XWWA 4KEPA 2I7VA 4AD9A 3ZNBA 5AYAA 3AF5A 2BFLA 1QH3A 5EH9A 3VQZA 3I14A 5ACUA 2R2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KNR A;  5HIS A;  5ACW A;  4C1C A;  5EWA A;  5DPX A;  3IE1 A;  4AWZ A;  3L6N A;  2AZ4 A;  1ZKP A;  4J5H A;  3X2X A;  1VME A;  2GCU A;  5LLD A;  4HL2 A;  4C1G A;  3PY5 A;  4EY2 A;  1KO3 A;  3FAI A;  2BFZ A;  4RM5 A;  3BK2 A;  3IEL A;  5FQB A;  4BP0 A;  3AF6 A;  4Z6X A;  4NQ4 A;  4WD6 A;  2H6A A;  4UAM A;  3QH8 A;  3IE0 A;  4HKY A;  4FSB A;  3T9M A;  1XM8 A;  4EXY A;  4RAW A;  1L9Y A;  2M5D A;  4DIL A;  4C1D A;  5K0W A;  4YSL A;  4TZE A;  5FQC A;  1M2X A;  1A7T A;  4D02 A;  1A8T A;  4RL0 A;  4TYT A;  1BVT A;  5HH5 A;  4Z7R A;  2UYX A;  5HIO A;  4RL2 A;  3SPU A;  4D1W A;  2BG8 B;  4ZO2 A;  3RKJ A;  4TZB A;  2GFK A;  5HIP A;  3PY6 A;  2QDT A;  3DHA A;  2FU6 A;  1P9E A;  4AX0 B;  4ZO3 A;  1YCG A;  2FU9 A;  3IDZ A;  4Z5Y A;  3WXC A;  2ZO4 A;  3T3N A;  5ACQ A;  3H3E A;  2BG7 A;  5EW0 A;  5LCF A;  2BTN A;  3BV6 A;  4C1F A;  1KO2 A;  4BZ3 A;  2YNT A;  3MD7 A;  2GKL A;  3VPE A;  5ACX A;  4C1E A;  4B87 A;  2HB9 A;  5A5Z A;  4CHL A;  4YSK A;  2GFJ A;  3P2U A;  4Z67 A;  1X8I A;  1JJT A;  5ACV A;  5ACP A;  2BG2 A;  3ZQ4 A;  4HL1 A;  2P4Z A;  1K07 A;  2YNV B;  5EVK A;  3I15 A;  2VW8 A;  4XUK A;  2AIO A;  1QH5 A;  2OHI A;  3ESH A;  5EV6 A;  4Z5Z A;  2BR6 A;  2DKF A;  4FEK A;  2I7T A;  3KL7 A;  1JJE A;  3LVZ A;  2XF4 A;  2YNV A;  2BG8 A;  3SFP A;  4AWY B;  1WUP A;  2YCB A;  1WW1 A;  2P1E A;  2FHX B;  2Y8B A;  2BC2 A;  5ACT A;  3ADR A;  4J5F A;  5A0T A;  2BMI A;  3Q6V A;  2QJS A;  3IEM A;  2E7Y A;  2Y87 A;  3BC2 A;  4EYF A;  3DHB A;  3DH8 A;  3X2Z A;  2BG6 A;  4NQ5 A;  5HH6 A;  4F6H A;  1ZNB A;  5A87 A;  3AJ3 A;  2WHG A;  4V0H A;  2WYL A;  3DHC A;  4RAM A;  3I13 A;  2QDS A;  1XTO A;  3X30 A;  1MQO A;  5ACR A;  2YNW A;  4D1T A;  4PVO A;  5KIK A;  2WYM C;  2NZF A;  2WYM A;  2FU7 A;  2GMN A;  5AXO A;  4ZNB A;  3ZWF A;  2I7X A;  4UA4 A;  5KIL A;  4EYL A;  3SBL A;  3X2Y A;  5K4K A;  2BFK A;  4UWS B;  1VGN A;  4UWR B;  3IE2 A;  2YNT B;  5HH4 A;  1X8H A;  3A4Y A;  1JT1 A;  2BGA A;  4NQ2 A;  2BIB A;  1BC2 A;  5EVD A;  4D1U A;  5AHO A;  4XWT A;  2XR1 A;  4H0D A;  2FU8 A;  4TZ9 A;  2QIN A;  2ZZI A;  5LM6 A;  4NQ6 A;  4EXS A;  5LCH A;  1VJN A;  3IEK A;  5LS3 A;  4KEQ A;  4DIK A;  3IOF A;  5AHR A;  3SW3 A;  4O98 A;  3KNS A;  1YCH A;  1SML A;  1WUO A;  2OHJ A;  3TP9 A;  3RKK A;  4GCW A;  2NYP A;  5LMC A;  3S0Z A;  2FHX A;  1HLK A;  4UWP B;  5B1U A;  2ZNB A;  5LSC A;  1X8G A;  2BFZ B;  3RPC A;  1ZTC A;  3SRX A;  1DXK A;  3R2U A;  2NXA A;  2P97 A;  5EVB A;  4ZEJ A;  4TYF A;  4YSB A;  5LCA A;  5FQA A;  4AX1 B;  4C09 A;  4C1H A;  2FK6 A;  5EV8 A;  3ZR9 A;  3I0V A;  4GYU A;  1DDK A;  5AXR A;  4GYQ A;  4P62 A;  3BK1 A;  4RBS A;  4F6Z A;  2M5C A;  4PVT A;  4FR7 A;  4UWO B;  3SD9 A;  1E5D A;  5HIQ A;  5ACS A;  4D1V A;  3JXP A;  2OHH A;  5K4N A;  5B15 A;  5IQK A;  4Z60 A;  1YCF A;  3IOG A;  2Q0J A;  1WRA A;  3F9O A;  4U4L A;  4EYB A;  4EFZ A;  1DD6 A;  2WRS A;  5LE1 A;  2A7M A;  5AEB A;  2Y8A A;  2QED A;  3I11 A;  2YNU A;  4UBQ A;  1Y44 A;  1BMC A;  3FCZ A;  3T3O A;  4JO0 A;  2Q0I A;  4TZF A;  5EHT A;  5K4M A;  2CBN A;  2FM6 A;  2YZ3 A;  2P18 A;  2ZWR A;  5B3R A;  2NZE A;  3G1P A;  5A0V A;  2DOO A;  2Q9U A;  3PG4 A;  4LE6 A;  2Q42 A;  1KR3 A;  4XWW A;  4KEP A;  2I7V A;  4AD9 A;  3ZNB A;  5AYA A;  3AF5 A;  2BFL A;  1QH3 A;  5EH9 A;  3VQZ A;  3I14 A;  5ACU A;  2R2D A; 
#chains in the Genus database with same CATH topology
 3KNR A;  5HIS A;  5ACW A;  4C1C A;  5EWA A;  5DPX A;  3IE1 A;  4AWZ A;  3L6N A;  2AZ4 A;  1ZKP A;  4J5H A;  3X2X A;  1VME A;  2GCU A;  5LLD A;  4HL2 A;  4C1G A;  3PY5 A;  4EY2 A;  1KO3 A;  3FAI A;  2BFZ A;  4RM5 A;  3BK2 A;  3IEL A;  5FQB A;  4BP0 A;  3AF6 A;  4Z6X A;  4NQ4 A;  4WD6 A;  2H6A A;  4UAM A;  3QH8 A;  3IE0 A;  4HKY A;  4FSB A;  3T9M A;  1XM8 A;  4EXY A;  4RAW A;  1L9Y A;  2M5D A;  4DIL A;  4C1D A;  5K0W A;  4YSL A;  4TZE A;  5FQC A;  1M2X A;  1A7T A;  4D02 A;  1A8T A;  4RL0 A;  4TYT A;  1BVT A;  5HH5 A;  4Z7R A;  2UYX A;  2CG3 A;  5HIO A;  4RL2 A;  3SPU A;  4D1W A;  2BG8 B;  4ZO2 A;  3RKJ A;  4TZB A;  2GFK A;  5HIP A;  3PY6 A;  2QDT A;  3DHA A;  2FU6 A;  1P9E A;  2CFU A;  4AX0 B;  4ZO3 A;  1YCG A;  2FU9 A;  3IDZ A;  4Z5Y A;  3WXC A;  2ZO4 A;  3T3N A;  5ACQ A;  3H3E A;  2BG7 A;  5EW0 A;  5LCF A;  2BTN A;  3BV6 A;  4C1F A;  1KO2 A;  4BZ3 A;  2YNT A;  3MD7 A;  2GKL A;  3VPE A;  5ACX A;  4NUR A;  4C1E A;  4PDX A;  4B87 A;  2HB9 A;  5A5Z A;  4CHL A;  4YSK A;  2GFJ A;  3P2U A;  4Z67 A;  1X8I A;  1JJT A;  5ACV A;  5ACP A;  2BG2 A;  3ZQ4 A;  4HL1 A;  5A23 A;  2P4Z A;  1K07 A;  2YNV B;  5EVK A;  3I15 A;  2VW8 A;  4XUK A;  2AIO A;  1QH5 A;  2OHI A;  3ESH A;  5EV6 A;  4Z5Z A;  2BR6 A;  2DKF A;  4FEK A;  2I7T A;  3KL7 A;  1JJE A;  3LVZ A;  2XF4 A;  2YNV A;  2BG8 A;  5AJL A;  3SFP A;  4AWY B;  1WUP A;  2YCB A;  1WW1 A;  2P1E A;  2FHX B;  2Y8B A;  2BC2 A;  5ACT A;  3ADR A;  4J5F A;  5A0T A;  2BMI A;  3Q6V A;  2QJS A;  3IEM A;  2E7Y A;  2Y87 A;  3BC2 A;  4EYF A;  3DHB A;  3DH8 A;  3X2Z A;  2BG6 A;  4NQ5 A;  5HH6 A;  4F6H A;  1ZNB A;  5A87 A;  3AJ3 A;  2WHG A;  4V0H A;  2WYL A;  3DHC A;  4RAM A;  3I13 A;  2QDS A;  1XTO A;  3X30 A;  1MQO A;  5ACR A;  2YNW A;  4D1T A;  4PVO A;  2WYM C;  5KIK A;  2NZF A;  2WYM A;  2FU7 A;  2GMN A;  5AXO A;  4ZNB A;  3ZWF A;  2I7X A;  4UA4 A;  5KIL A;  4EYL A;  3SBL A;  5AIJ A;  3X2Y A;  5K4K A;  2BFK A;  4UWS B;  1VGN A;  4UWR B;  3IE2 A;  2YNT B;  5HH4 A;  1X8H A;  3A4Y A;  1JT1 A;  2BGA A;  4NQ2 A;  2BIB A;  1BC2 A;  5EVD A;  4D1U A;  5AHO A;  4XWT A;  2XR1 A;  4H0D A;  2FU8 A;  4TZ9 A;  2QIN A;  2ZZI A;  5LM6 A;  4NQ6 A;  4EXS A;  5LCH A;  1VJN A;  3IEK A;  5LS3 A;  4KEQ A;  4DIK A;  3IOF A;  5AHR A;  3SW3 A;  4O98 A;  3KNS A;  2CFZ A;  1YCH A;  1SML A;  1WUO A;  2OHJ A;  3TP9 A;  3RKK A;  4GCW A;  2NYP A;  5LMC A;  3S0Z A;  2FHX A;  1HLK A;  4UWP B;  5B1U A;  2ZNB A;  5LSC A;  1X8G A;  2BFZ B;  3RPC A;  1ZTC A;  3SRX A;  4AXH A;  1DXK A;  3R2U A;  2NXA A;  2P97 A;  5EVB A;  4ZEJ A;  4TYF A;  4YSB A;  5LCA A;  5FQA A;  4AX1 B;  4C09 A;  4C1H A;  2FK6 A;  5EV8 A;  3ZR9 A;  3I0V A;  4GYU A;  1DDK A;  5AXR A;  4GYQ A;  4P62 A;  3BK1 A;  4RBS A;  4F6Z A;  2M5C A;  4PVT A;  4FR7 A;  4UWO B;  3SD9 A;  1E5D A;  5HIQ A;  5ACS A;  4D1V A;  3JXP A;  2OHH A;  5K4N A;  5B15 A;  5IQK A;  4Z60 A;  1YCF A;  3IOG A;  2Q0J A;  1WRA A;  3F9O A;  4U4L A;  4EYB A;  4EFZ A;  1DD6 A;  2WRS A;  5LE1 A;  2YHE A;  2A7M A;  5AEB A;  2Y8A A;  2QED A;  3I11 A;  2YNU A;  4UBQ A;  1Y44 A;  1BMC A;  3FCZ A;  3T3O A;  4JO0 A;  2Q0I A;  4TZF A;  5EHT A;  5K4M A;  2CBN A;  2FM6 A;  2YZ3 A;  2P18 A;  2ZWR A;  5B3R A;  2NZE A;  3G1P A;  5A0V A;  2DOO A;  2Q9U A;  3PG4 A;  4LE6 A;  2Q42 A;  1KR3 A;  4XWW A;  4KEP A;  2I7V A;  4AD9 A;  3ZNB A;  5AYA A;  3AF5 A;  2CG2 A;  2BFL A;  1QH3 A;  5EH9 A;  4AV7 A;  3VQZ A;  3I14 A;  5ACU A;  2R2D A; 
#chains in the Genus database with same CATH homology
 3KNR A;  5HIS A;  5ACW A;  4C1C A;  5EWA A;  5DPX A;  3IE1 A;  4AWZ A;  3L6N A;  2AZ4 A;  1ZKP A;  4J5H A;  3X2X A;  1VME A;  2GCU A;  5LLD A;  4HL2 A;  4C1G A;  3PY5 A;  4EY2 A;  1KO3 A;  3FAI A;  2BFZ A;  4RM5 A;  3BK2 A;  3IEL A;  5FQB A;  4BP0 A;  3AF6 A;  4Z6X A;  4NQ4 A;  4WD6 A;  2H6A A;  4UAM A;  3QH8 A;  3IE0 A;  4HKY A;  4FSB A;  3T9M A;  1XM8 A;  4EXY A;  4RAW A;  1L9Y A;  2M5D A;  4DIL A;  4C1D A;  5K0W A;  4YSL A;  4TZE A;  5FQC A;  1M2X A;  1A7T A;  4D02 A;  1A8T A;  4RL0 A;  4TYT A;  1BVT A;  5HH5 A;  4Z7R A;  2UYX A;  5HIO A;  4RL2 A;  3SPU A;  4D1W A;  2BG8 B;  4ZO2 A;  3RKJ A;  4TZB A;  2GFK A;  5HIP A;  3PY6 A;  2QDT A;  3DHA A;  2FU6 A;  1P9E A;  4AX0 B;  4ZO3 A;  1YCG A;  2FU9 A;  3IDZ A;  4Z5Y A;  3WXC A;  2ZO4 A;  3T3N A;  5ACQ A;  3H3E A;  2BG7 A;  5EW0 A;  5LCF A;  2BTN A;  3BV6 A;  4C1F A;  1KO2 A;  4BZ3 A;  2YNT A;  3MD7 A;  2GKL A;  3VPE A;  5ACX A;  4C1E A;  4B87 A;  2HB9 A;  5A5Z A;  4CHL A;  4YSK A;  2GFJ A;  3P2U A;  4Z67 A;  1X8I A;  1JJT A;  5ACV A;  5ACP A;  2BG2 A;  3ZQ4 A;  4HL1 A;  2P4Z A;  1K07 A;  2YNV B;  5EVK A;  3I15 A;  2VW8 A;  4XUK A;  2AIO A;  1QH5 A;  2OHI A;  3ESH A;  5EV6 A;  4Z5Z A;  2BR6 A;  2DKF A;  4FEK A;  2I7T A;  3KL7 A;  1JJE A;  3LVZ A;  2XF4 A;  2YNV A;  2BG8 A;  3SFP A;  4AWY B;  1WUP A;  2YCB A;  1WW1 A;  2P1E A;  2FHX B;  2Y8B A;  2BC2 A;  5ACT A;  3ADR A;  4J5F A;  5A0T A;  2BMI A;  3Q6V A;  2QJS A;  3IEM A;  2E7Y A;  2Y87 A;  3BC2 A;  4EYF A;  3DHB A;  3DH8 A;  3X2Z A;  2BG6 A;  4NQ5 A;  5HH6 A;  4F6H A;  1ZNB A;  5A87 A;  3AJ3 A;  2WHG A;  4V0H A;  2WYL A;  3DHC A;  4RAM A;  3I13 A;  2QDS A;  1XTO A;  3X30 A;  1MQO A;  5ACR A;  2YNW A;  4D1T A;  4PVO A;  5KIK A;  2WYM C;  2NZF A;  2WYM A;  2FU7 A;  2GMN A;  5AXO A;  4ZNB A;  3ZWF A;  2I7X A;  4UA4 A;  5KIL A;  4EYL A;  3SBL A;  3X2Y A;  5K4K A;  2BFK A;  4UWS B;  1VGN A;  4UWR B;  3IE2 A;  2YNT B;  5HH4 A;  1X8H A;  3A4Y A;  1JT1 A;  2BGA A;  4NQ2 A;  2BIB A;  1BC2 A;  5EVD A;  4D1U A;  5AHO A;  4XWT A;  2XR1 A;  4H0D A;  2FU8 A;  4TZ9 A;  2QIN A;  2ZZI A;  5LM6 A;  4NQ6 A;  4EXS A;  5LCH A;  1VJN A;  3IEK A;  5LS3 A;  4KEQ A;  4DIK A;  3IOF A;  5AHR A;  3SW3 A;  4O98 A;  3KNS A;  1YCH A;  1SML A;  1WUO A;  2OHJ A;  3TP9 A;  3RKK A;  4GCW A;  2NYP A;  5LMC A;  3S0Z A;  2FHX A;  1HLK A;  4UWP B;  5B1U A;  2ZNB A;  5LSC A;  1X8G A;  2BFZ B;  3RPC A;  1ZTC A;  3SRX A;  1DXK A;  3R2U A;  2NXA A;  2P97 A;  5EVB A;  4ZEJ A;  4TYF A;  4YSB A;  5LCA A;  5FQA A;  4AX1 B;  4C09 A;  4C1H A;  2FK6 A;  5EV8 A;  3ZR9 A;  3I0V A;  4GYU A;  1DDK A;  5AXR A;  4GYQ A;  4P62 A;  3BK1 A;  4RBS A;  4F6Z A;  2M5C A;  4PVT A;  4FR7 A;  4UWO B;  3SD9 A;  1E5D A;  5HIQ A;  5ACS A;  4D1V A;  3JXP A;  2OHH A;  5K4N A;  5B15 A;  5IQK A;  4Z60 A;  1YCF A;  3IOG A;  2Q0J A;  1WRA A;  3F9O A;  4U4L A;  4EYB A;  4EFZ A;  1DD6 A;  2WRS A;  5LE1 A;  2A7M A;  5AEB A;  2Y8A A;  2QED A;  3I11 A;  2YNU A;  4UBQ A;  1Y44 A;  1BMC A;  3FCZ A;  3T3O A;  4JO0 A;  2Q0I A;  4TZF A;  5EHT A;  5K4M A;  2CBN A;  2FM6 A;  2YZ3 A;  2P18 A;  2ZWR A;  5B3R A;  2NZE A;  3G1P A;  5A0V A;  2DOO A;  2Q9U A;  3PG4 A;  4LE6 A;  2Q42 A;  1KR3 A;  4XWW A;  4KEP A;  2I7V A;  4AD9 A;  3ZNB A;  5AYA A;  3AF5 A;  2BFL A;  1QH3 A;  5EH9 A;  3VQZ A;  3I14 A;  5ACU A;  2R2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...