4O98A

Crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
306
Chain Sequence
APAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFKSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVPVEFSPIRSDRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching a newly discovered lactonase into an efficient and thermostable phosphotriesterase by simple double mutations His250Ile/Ile263Trp
pubmed doi rcsb
source organism Pseudomonas oleovorans
molecule tags Hydrolase
molecule keywords organophosphorus hydrolase
total genus 80
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4o98A00
2QDSA 2FHXA 1ZTCA 1KO2A 2AZ4A 4UAMA 2QDTA 5K4KA 4NQ6A 2FU9A 2NXAA 1P9EA 5KILA 1WRAA 4P62A 4C1DA 2NYPA 4ZNBA 5EVBA 3SRXA 3I15A 4YSBA 2H6AA 5AXRA 4C09A 3AJ3A 5AEBA 1XTOA 3JXPA 1KR3A 2NZEA 3I14A 1ZKPA 5B3RA 4EFZA 4AX0B 5AYAA 4B87A 4TYFA 3SW3A 5EWAA 1DDKA 2R2DA 5ACUA 4FSBA 2BTNA 4DILA 2BG6A 4UA4A 1VJNA 4EXSA 5LCAA 3TP9A 4LE6A 1M2XA 2QJSA 3SD9A 1BMCA 3KNRA 4XWTA 3T3OA 5FQBA 3G1PA 4ZO2A 1DXKA 3KNSA 3BK2A 4UBQA 1A7TA 3X2YA 3IOFA 4PVTA 5EVKA 2Y8BA 1KO3A 2ZWRA 2I7XA 3RKKA 5HH4A 2BG7A 4YSKA 2BC2A 2NZFA 2FM6A 1YCHA 5HH6A 1YCGA 5ACSA 1QH3A 4F6HA 2BFLA 1X8IA 5ACWA 3I0VA 2BFZA 3SFPA 3A4YA 3DH8A 3FCZA 1QH5A 3T9MA 5K0WA 2YNWA 4F6ZA 2YNTB 2BMIA 2GFJA 5ACVA 2CBNA 2P97A 4UWSB 1X8HA 2Y8AA 5EH9A 4CHLA 2Q0JA 2ZNBA 5A5ZA 5B15A 2WYLA 3VPEA 4D1TA 4EYBA 1HLKA 4GCWA 3PY6A 3F9OA 3RPCA 5A0VA 4TZ9A 3BC2A 3RKJA 2YNVB 4D02A 2P4ZA 4Z5ZA 2GCUA 2YCBA 5LCFA 1JJTA 3ESHA 3BK1A 4JO0A 4ZEJA 3X30A 4C1GA 2BFKA 4EYLA 5EHTA 3DHBA 2BG8A 4EY2A 1WW1A 4Z7RA 5A0TA 4KEQA 4FR7A 3IE2A 3IEMA 3ZR9A 3ZWFA 3IEKA 2OHJA 3AF5A 3IOGA 3MD7A 5LS3A 3P2UA 2QEDA 1L9YA 5EW0A 4BP0A 5ACPA 4C1HA 2ZO4A 4XUKA 2FU7A 4C1FA 3X2XA 4NQ4A 2QINA 2I7TA 5DPXA 2WYMA 2YNUA 4RL0A 1VGNA 3KL7A 2FU6A 1WUOA 2DKFA 4HL1A 4Z5YA 2I7VA 3I13A 4TZFA 1ZNBA 5EV8A 5A87A 2P1EA 2BG2A 4RBSA 4AWYB 4AX1B 3LVZA 5HIOA 4XWWA 5ACXA 4RAWA 4RAMA 2P18A 3IELA 3IE1A 4UWOB 4Z60A 5FQCA 2OHHA 4C1CA 2WYMC 4PVOA 1BC2A 5HIPA 1A8TA 3L6NA 4YSLA 2UYXA 2M5DA 2M5CA 4EXYA 2GMNA 3SPUA 2ZZIA 4TZBA 4RM5A 5AHOA 2BGAA 5LCHA 1BVTA 5KIKA 2YNTA 3Q6VA 4J5FA 3DHAA 5FQAA 3FAIA 4FEKA 3IE0A 4D1WA 1VMEA 3I11A 4D1UA 2BFZB 5ACTA 2E7YA 4Z6XA 3PG4A 4HKYA 3T3NA 3WXCA 2Q42A 3QH8A 1JJEA 3AF6A 5K4MA 1E5DA 5EV6A 3X2ZA 5HH5A 4NQ5A 2XR1A 3VQZA 2Y87A 5IQKA 4KEPA 4RL2A 4WD6A 5AXOA 1YCFA 3IDZA 2Q0IA 1K07A 2WHGA 2YZ3A 4UWPB 2DOOA 4U4LA 3DHCA 4AD9A 5HISA 2WRSA 2BG8B 4C1EA 2A7MA 3BV6A 3ZQ4A 4EYFA 3ZNBA 2YNVA 2XF4A 1DD6A 1WUPA 2FK6A 1JT1A 4TYTA 4NQ2A 5K4NA 5LLDA 3SBLA 4V0HA 4H0DA 3ADRA 2FHXB 4O98A 5ACQA 2FU8A 1MQOA 1Y44A 4ZO3A 2GFKA 3R2UA 4J5HA 5B1UA 4Z67A 4UWRB 4TZEA 5LMCA 2OHIA 2HB9A 5ACRA 5LE1A 3S0ZA 4HL2A 3PY5A 2BIBA 1X8GA 2Q9UA 2BR6A 4BZ3A 5LM6A 5EVDA 2AIOA 2GKLA 3H3EA 4GYQA 5LSCA 1SMLA 4D1VA 4DIKA 4GYUA 5AHRA 2VW8A 1XM8A 4AWZA 5HIQA
chains in the Genus database with same CATH superfamily
2QDSA 2FHXA 1ZTCA 1KO2A 2AZ4A 4UAMA 4PDXA 2QDTA 5K4KA 4NQ6A 2FU9A 2NXAA 1P9EA 5KILA 1WRAA 4P62A 4C1DA 2NYPA 4ZNBA 5EVBA 3SRXA 3I15A 4YSBA 2H6AA 5AXRA 4C09A 3AJ3A 5AEBA 1XTOA 2YHEA 3JXPA 1KR3A 2NZEA 3I14A 1ZKPA 5B3RA 4EFZA 4AX0B 5AYAA 4B87A 4TYFA 3SW3A 5EWAA 1DDKA 2R2DA 5ACUA 4FSBA 2BTNA 4DILA 2BG6A 4UA4A 1VJNA 4EXSA 5LCAA 3TP9A 4LE6A 1M2XA 2QJSA 3SD9A 2CG3A 1BMCA 3KNRA 4XWTA 3T3OA 5FQBA 3G1PA 4ZO2A 1DXKA 3KNSA 3BK2A 4UBQA 1A7TA 3X2YA 3IOFA 4PVTA 5EVKA 2Y8BA 1KO3A 2ZWRA 2I7XA 5AIJA 3RKKA 5HH4A 2BG7A 4YSKA 2BC2A 2NZFA 2FM6A 1YCHA 5HH6A 1YCGA 5ACSA 1QH3A 4F6HA 2BFLA 4AV7A 1X8IA 5ACWA 3I0VA 2BFZA 3SFPA 3A4YA 3DH8A 3FCZA 1QH5A 3T9MA 5K0WA 2YNWA 4F6ZA 2YNTB 2BMIA 2GFJA 5ACVA 2CBNA 2P97A 4UWSB 1X8HA 2Y8AA 5EH9A 4CHLA 2Q0JA 2ZNBA 5A5ZA 5B15A 2WYLA 3VPEA 4D1TA 4EYBA 1HLKA 4GCWA 3PY6A 3F9OA 3RPCA 5A0VA 4TZ9A 3BC2A 3RKJA 2YNVB 4D02A 2P4ZA 4Z5ZA 2GCUA 4AXHA 2YCBA 5LCFA 1JJTA 3ESHA 3BK1A 4JO0A 4ZEJA 3X30A 4C1GA 2BFKA 4EYLA 5EHTA 3DHBA 2BG8A 4EY2A 1WW1A 4Z7RA 5A0TA 4KEQA 2CG2A 4FR7A 3IE2A 3IEMA 5A23A 3ZR9A 5AJLA 3ZWFA 3IEKA 2OHJA 3AF5A 3IOGA 3MD7A 5LS3A 3P2UA 2QEDA 1L9YA 5EW0A 4BP0A 5ACPA 4C1HA 2CFUA 2ZO4A 2CFZA 4XUKA 2FU7A 4C1FA 3X2XA 4NQ4A 2QINA 2I7TA 5DPXA 2WYMA 2YNUA 4RL0A 1VGNA 3KL7A 2FU6A 1WUOA 2DKFA 4HL1A 4Z5YA 2I7VA 3I13A 4TZFA 1ZNBA 5EV8A 5A87A 2P1EA 2BG2A 4RBSA 4AWYB 4AX1B 3LVZA 5HIOA 4XWWA 5ACXA 4RAWA 4RAMA 2P18A 3IELA 3IE1A 4UWOB 4Z60A 5FQCA 2OHHA 4C1CA 2WYMC 4PVOA 1BC2A 5HIPA 1A8TA 3L6NA 4YSLA 2UYXA 2M5DA 2M5CA 4EXYA 2GMNA 3SPUA 2ZZIA 4TZBA 4RM5A 5AHOA 2BGAA 5LCHA 1BVTA 5KIKA 2YNTA 3Q6VA 4J5FA 3DHAA 5FQAA 3FAIA 4FEKA 3IE0A 4D1WA 1VMEA 3I11A 4D1UA 2BFZB 5ACTA 2E7YA 4Z6XA 3PG4A 4HKYA 3T3NA 3WXCA 2Q42A 3QH8A 1JJEA 3AF6A 5K4MA 1E5DA 5EV6A 3X2ZA 5HH5A 4NQ5A 2XR1A 3VQZA 2Y87A 5IQKA 4KEPA 4RL2A 4WD6A 5AXOA 1YCFA 3IDZA 2Q0IA 1K07A 2WHGA 2YZ3A 4UWPB 2DOOA 4U4LA 3DHCA 4AD9A 5HISA 2WRSA 2BG8B 4C1EA 2A7MA 3BV6A 3ZQ4A 4EYFA 3ZNBA 2YNVA 2XF4A 1DD6A 1WUPA 2FK6A 1JT1A 4TYTA 4NQ2A 5K4NA 5LLDA 3SBLA 4V0HA 4H0DA 3ADRA 2FHXB 4O98A 5ACQA 2FU8A 1MQOA 1Y44A 4ZO3A 2GFKA 3R2UA 4J5HA 5B1UA 4Z67A 4UWRB 4TZEA 5LMCA 2OHIA 2HB9A 5ACRA 5LE1A 3S0ZA 4HL2A 3PY5A 2BIBA 1X8GA 2Q9UA 2BR6A 4BZ3A 5LM6A 5EVDA 2AIOA 2GKLA 3H3EA 4GYQA 5LSCA 1SMLA 4D1VA 4DIKA 4GYUA 5AHRA 2VW8A 4NURA 1XM8A 4AWZA 5HIQA
chains in the Genus database with same CATH topology
2QDSA 2FHXA 1ZTCA 1KO2A 2AZ4A 4UAMA 2QDTA 5K4KA 4NQ6A 2FU9A 2NXAA 1P9EA 5KILA 1WRAA 4P62A 4C1DA 2NYPA 4ZNBA 5EVBA 3SRXA 3I15A 4YSBA 2H6AA 5AXRA 4C09A 3AJ3A 5AEBA 1XTOA 3JXPA 1KR3A 2NZEA 3I14A 1ZKPA 5B3RA 4EFZA 4AX0B 5AYAA 4B87A 4TYFA 3SW3A 5EWAA 1DDKA 2R2DA 5ACUA 4FSBA 2BTNA 4DILA 2BG6A 4UA4A 1VJNA 4EXSA 5LCAA 3TP9A 4LE6A 1M2XA 2QJSA 3SD9A 1BMCA 3KNRA 4XWTA 3T3OA 5FQBA 3G1PA 4ZO2A 1DXKA 3KNSA 3BK2A 4UBQA 1A7TA 3X2YA 3IOFA 4PVTA 5EVKA 2Y8BA 1KO3A 2ZWRA 2I7XA 3RKKA 5HH4A 2BG7A 4YSKA 2BC2A 2NZFA 2FM6A 1YCHA 5HH6A 1YCGA 5ACSA 1QH3A 4F6HA 2BFLA 1X8IA 5ACWA 3I0VA 2BFZA 3SFPA 3A4YA 3DH8A 3FCZA 1QH5A 3T9MA 5K0WA 2YNWA 4F6ZA 2YNTB 2BMIA 2GFJA 5ACVA 2CBNA 2P97A 4UWSB 1X8HA 2Y8AA 5EH9A 4CHLA 2Q0JA 2ZNBA 5A5ZA 5B15A 2WYLA 3VPEA 4D1TA 4EYBA 1HLKA 4GCWA 3PY6A 3F9OA 3RPCA 5A0VA 4TZ9A 3BC2A 3RKJA 2YNVB 4D02A 2P4ZA 4Z5ZA 2GCUA 2YCBA 5LCFA 1JJTA 3ESHA 3BK1A 4JO0A 4ZEJA 3X30A 4C1GA 2BFKA 4EYLA 5EHTA 3DHBA 2BG8A 4EY2A 1WW1A 4Z7RA 5A0TA 4KEQA 4FR7A 3IE2A 3IEMA 3ZR9A 3ZWFA 3IEKA 2OHJA 3AF5A 3IOGA 3MD7A 5LS3A 3P2UA 2QEDA 1L9YA 5EW0A 4BP0A 5ACPA 4C1HA 2ZO4A 4XUKA 2FU7A 4C1FA 3X2XA 4NQ4A 2QINA 2I7TA 5DPXA 2WYMA 2YNUA 4RL0A 1VGNA 3KL7A 2FU6A 1WUOA 2DKFA 4HL1A 4Z5YA 2I7VA 3I13A 4TZFA 1ZNBA 5EV8A 5A87A 2P1EA 2BG2A 4RBSA 4AWYB 4AX1B 3LVZA 5HIOA 4XWWA 5ACXA 4RAWA 4RAMA 2P18A 3IELA 3IE1A 4UWOB 4Z60A 5FQCA 2OHHA 4C1CA 2WYMC 4PVOA 1BC2A 5HIPA 1A8TA 3L6NA 4YSLA 2UYXA 2M5DA 2M5CA 4EXYA 2GMNA 3SPUA 2ZZIA 4TZBA 4RM5A 5AHOA 2BGAA 5LCHA 1BVTA 5KIKA 2YNTA 3Q6VA 4J5FA 3DHAA 5FQAA 3FAIA 4FEKA 3IE0A 4D1WA 1VMEA 3I11A 4D1UA 2BFZB 5ACTA 2E7YA 4Z6XA 3PG4A 4HKYA 3T3NA 3WXCA 2Q42A 3QH8A 1JJEA 3AF6A 5K4MA 1E5DA 5EV6A 3X2ZA 5HH5A 4NQ5A 2XR1A 3VQZA 2Y87A 5IQKA 4KEPA 4RL2A 4WD6A 5AXOA 1YCFA 3IDZA 2Q0IA 1K07A 2WHGA 2YZ3A 4UWPB 2DOOA 4U4LA 3DHCA 4AD9A 5HISA 2WRSA 2BG8B 4C1EA 2A7MA 3BV6A 3ZQ4A 4EYFA 3ZNBA 2YNVA 2XF4A 1DD6A 1WUPA 2FK6A 1JT1A 4TYTA 4NQ2A 5K4NA 5LLDA 3SBLA 4V0HA 4H0DA 3ADRA 2FHXB 4O98A 5ACQA 2FU8A 1MQOA 1Y44A 4ZO3A 2GFKA 3R2UA 4J5HA 5B1UA 4Z67A 4UWRB 4TZEA 5LMCA 2OHIA 2HB9A 5ACRA 5LE1A 3S0ZA 4HL2A 3PY5A 2BIBA 1X8GA 2Q9UA 2BR6A 4BZ3A 5LM6A 5EVDA 2AIOA 2GKLA 3H3EA 4GYQA 5LSCA 1SMLA 4D1VA 4DIKA 4GYUA 5AHRA 2VW8A 1XM8A 4AWZA 5HIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDS A;  2FHX A;  1ZTC A;  1KO2 A;  2AZ4 A;  4UAM A;  2QDT A;  5K4K A;  4NQ6 A;  2FU9 A;  2NXA A;  1P9E A;  5KIL A;  1WRA A;  4P62 A;  4C1D A;  2NYP A;  4ZNB A;  5EVB A;  3SRX A;  3I15 A;  4YSB A;  2H6A A;  5AXR A;  4C09 A;  3AJ3 A;  5AEB A;  1XTO A;  3JXP A;  1KR3 A;  2NZE A;  3I14 A;  1ZKP A;  5B3R A;  4EFZ A;  4AX0 B;  5AYA A;  4B87 A;  4TYF A;  3SW3 A;  5EWA A;  1DDK A;  2R2D A;  5ACU A;  4FSB A;  2BTN A;  4DIL A;  2BG6 A;  4UA4 A;  1VJN A;  4EXS A;  5LCA A;  3TP9 A;  4LE6 A;  1M2X A;  2QJS A;  3SD9 A;  1BMC A;  3KNR A;  4XWT A;  3T3O A;  5FQB A;  3G1P A;  4ZO2 A;  1DXK A;  3KNS A;  3BK2 A;  4UBQ A;  1A7T A;  3X2Y A;  3IOF A;  4PVT A;  5EVK A;  2Y8B A;  1KO3 A;  2ZWR A;  2I7X A;  3RKK A;  5HH4 A;  2BG7 A;  4YSK A;  2BC2 A;  2NZF A;  2FM6 A;  1YCH A;  5HH6 A;  1YCG A;  5ACS A;  1QH3 A;  4F6H A;  2BFL A;  1X8I A;  5ACW A;  3I0V A;  2BFZ A;  3SFP A;  3A4Y A;  3DH8 A;  3FCZ A;  1QH5 A;  3T9M A;  5K0W A;  2YNW A;  4F6Z A;  2YNT B;  2BMI A;  2GFJ A;  5ACV A;  2CBN A;  2P97 A;  4UWS B;  1X8H A;  2Y8A A;  5EH9 A;  4CHL A;  2Q0J A;  2ZNB A;  5A5Z A;  5B15 A;  2WYL A;  3VPE A;  4D1T A;  4EYB A;  1HLK A;  4GCW A;  3PY6 A;  3F9O A;  3RPC A;  5A0V A;  4TZ9 A;  3BC2 A;  3RKJ A;  2YNV B;  4D02 A;  2P4Z A;  4Z5Z A;  2GCU A;  2YCB A;  5LCF A;  1JJT A;  3ESH A;  3BK1 A;  4JO0 A;  4ZEJ A;  3X30 A;  4C1G A;  2BFK A;  4EYL A;  5EHT A;  3DHB A;  2BG8 A;  4EY2 A;  1WW1 A;  4Z7R A;  5A0T A;  4KEQ A;  4FR7 A;  3IE2 A;  3IEM A;  3ZR9 A;  3ZWF A;  3IEK A;  2OHJ A;  3AF5 A;  3IOG A;  3MD7 A;  5LS3 A;  3P2U A;  2QED A;  1L9Y A;  5EW0 A;  4BP0 A;  5ACP A;  4C1H A;  2ZO4 A;  4XUK A;  2FU7 A;  4C1F A;  3X2X A;  4NQ4 A;  2QIN A;  2I7T A;  5DPX A;  2WYM A;  2YNU A;  4RL0 A;  1VGN A;  3KL7 A;  2FU6 A;  1WUO A;  2DKF A;  4HL1 A;  4Z5Y A;  2I7V A;  3I13 A;  4TZF A;  1ZNB A;  5EV8 A;  5A87 A;  2P1E A;  2BG2 A;  4RBS A;  4AWY B;  4AX1 B;  3LVZ A;  5HIO A;  4XWW A;  5ACX A;  4RAW A;  4RAM A;  2P18 A;  3IEL A;  3IE1 A;  4UWO B;  4Z60 A;  5FQC A;  2OHH A;  4C1C A;  2WYM C;  4PVO A;  1BC2 A;  5HIP A;  1A8T A;  3L6N A;  4YSL A;  2UYX A;  2M5D A;  2M5C A;  4EXY A;  2GMN A;  3SPU A;  2ZZI A;  4TZB A;  4RM5 A;  5AHO A;  2BGA A;  5LCH A;  1BVT A;  5KIK A;  2YNT A;  3Q6V A;  4J5F A;  3DHA A;  5FQA A;  3FAI A;  4FEK A;  3IE0 A;  4D1W A;  1VME A;  3I11 A;  4D1U A;  2BFZ B;  5ACT A;  2E7Y A;  4Z6X A;  3PG4 A;  4HKY A;  3T3N A;  3WXC A;  2Q42 A;  3QH8 A;  1JJE A;  3AF6 A;  5K4M A;  1E5D A;  5EV6 A;  3X2Z A;  5HH5 A;  4NQ5 A;  2XR1 A;  3VQZ A;  2Y87 A;  5IQK A;  4KEP A;  4RL2 A;  4WD6 A;  5AXO A;  1YCF A;  3IDZ A;  2Q0I A;  1K07 A;  2WHG A;  2YZ3 A;  4UWP B;  2DOO A;  4U4L A;  3DHC A;  4AD9 A;  5HIS A;  2WRS A;  2BG8 B;  4C1E A;  2A7M A;  3BV6 A;  3ZQ4 A;  4EYF A;  3ZNB A;  2YNV A;  2XF4 A;  1DD6 A;  1WUP A;  2FK6 A;  1JT1 A;  4TYT A;  4NQ2 A;  5K4N A;  5LLD A;  3SBL A;  4V0H A;  4H0D A;  3ADR A;  2FHX B;  4O98 A;  5ACQ A;  2FU8 A;  1MQO A;  1Y44 A;  4ZO3 A;  2GFK A;  3R2U A;  4J5H A;  5B1U A;  4Z67 A;  4UWR B;  4TZE A;  5LMC A;  2OHI A;  2HB9 A;  5ACR A;  5LE1 A;  3S0Z A;  4HL2 A;  3PY5 A;  2BIB A;  1X8G A;  2Q9U A;  2BR6 A;  4BZ3 A;  5LM6 A;  5EVD A;  2AIO A;  2GKL A;  3H3E A;  4GYQ A;  5LSC A;  1SML A;  4D1V A;  4DIK A;  4GYU A;  5AHR A;  2VW8 A;  1XM8 A;  4AWZ A;  5HIQ A; 
#chains in the Genus database with same CATH topology
 2QDS A;  2FHX A;  1ZTC A;  1KO2 A;  2AZ4 A;  4UAM A;  4PDX A;  2QDT A;  5K4K A;  4NQ6 A;  2FU9 A;  2NXA A;  1P9E A;  5KIL A;  1WRA A;  4P62 A;  4C1D A;  2NYP A;  4ZNB A;  5EVB A;  3SRX A;  3I15 A;  4YSB A;  2H6A A;  5AXR A;  4C09 A;  3AJ3 A;  5AEB A;  1XTO A;  2YHE A;  3JXP A;  1KR3 A;  2NZE A;  3I14 A;  1ZKP A;  5B3R A;  4EFZ A;  4AX0 B;  5AYA A;  4B87 A;  4TYF A;  3SW3 A;  5EWA A;  1DDK A;  2R2D A;  5ACU A;  4FSB A;  2BTN A;  4DIL A;  2BG6 A;  4UA4 A;  1VJN A;  4EXS A;  5LCA A;  3TP9 A;  4LE6 A;  1M2X A;  2QJS A;  3SD9 A;  2CG3 A;  1BMC A;  3KNR A;  4XWT A;  3T3O A;  5FQB A;  3G1P A;  4ZO2 A;  1DXK A;  3KNS A;  3BK2 A;  4UBQ A;  1A7T A;  3X2Y A;  3IOF A;  4PVT A;  5EVK A;  2Y8B A;  1KO3 A;  2ZWR A;  2I7X A;  5AIJ A;  3RKK A;  5HH4 A;  2BG7 A;  4YSK A;  2BC2 A;  2NZF A;  2FM6 A;  1YCH A;  5HH6 A;  1YCG A;  5ACS A;  1QH3 A;  4F6H A;  2BFL A;  4AV7 A;  1X8I A;  5ACW A;  3I0V A;  2BFZ A;  3SFP A;  3A4Y A;  3DH8 A;  3FCZ A;  1QH5 A;  3T9M A;  5K0W A;  2YNW A;  4F6Z A;  2YNT B;  2BMI A;  2GFJ A;  5ACV A;  2CBN A;  2P97 A;  4UWS B;  1X8H A;  2Y8A A;  5EH9 A;  4CHL A;  2Q0J A;  2ZNB A;  5A5Z A;  5B15 A;  2WYL A;  3VPE A;  4D1T A;  4EYB A;  1HLK A;  4GCW A;  3PY6 A;  3F9O A;  3RPC A;  5A0V A;  4TZ9 A;  3BC2 A;  3RKJ A;  2YNV B;  4D02 A;  2P4Z A;  4Z5Z A;  2GCU A;  4AXH A;  2YCB A;  5LCF A;  1JJT A;  3ESH A;  3BK1 A;  4JO0 A;  4ZEJ A;  3X30 A;  4C1G A;  2BFK A;  4EYL A;  5EHT A;  3DHB A;  2BG8 A;  4EY2 A;  1WW1 A;  4Z7R A;  5A0T A;  4KEQ A;  2CG2 A;  4FR7 A;  3IE2 A;  3IEM A;  5A23 A;  3ZR9 A;  5AJL A;  3ZWF A;  3IEK A;  2OHJ A;  3AF5 A;  3IOG A;  3MD7 A;  5LS3 A;  3P2U A;  2QED A;  1L9Y A;  5EW0 A;  4BP0 A;  5ACP A;  4C1H A;  2CFU A;  2ZO4 A;  2CFZ A;  4XUK A;  2FU7 A;  4C1F A;  3X2X A;  4NQ4 A;  2QIN A;  2I7T A;  5DPX A;  2WYM A;  2YNU A;  4RL0 A;  1VGN A;  3KL7 A;  2FU6 A;  1WUO A;  2DKF A;  4HL1 A;  4Z5Y A;  2I7V A;  3I13 A;  4TZF A;  1ZNB A;  5EV8 A;  5A87 A;  2P1E A;  2BG2 A;  4RBS A;  4AWY B;  4AX1 B;  3LVZ A;  5HIO A;  4XWW A;  5ACX A;  4RAW A;  4RAM A;  2P18 A;  3IEL A;  3IE1 A;  4UWO B;  4Z60 A;  5FQC A;  2OHH A;  4C1C A;  2WYM C;  4PVO A;  1BC2 A;  5HIP A;  1A8T A;  3L6N A;  4YSL A;  2UYX A;  2M5D A;  2M5C A;  4EXY A;  2GMN A;  3SPU A;  2ZZI A;  4TZB A;  4RM5 A;  5AHO A;  2BGA A;  5LCH A;  1BVT A;  5KIK A;  2YNT A;  3Q6V A;  4J5F A;  3DHA A;  5FQA A;  3FAI A;  4FEK A;  3IE0 A;  4D1W A;  1VME A;  3I11 A;  4D1U A;  2BFZ B;  5ACT A;  2E7Y A;  4Z6X A;  3PG4 A;  4HKY A;  3T3N A;  3WXC A;  2Q42 A;  3QH8 A;  1JJE A;  3AF6 A;  5K4M A;  1E5D A;  5EV6 A;  3X2Z A;  5HH5 A;  4NQ5 A;  2XR1 A;  3VQZ A;  2Y87 A;  5IQK A;  4KEP A;  4RL2 A;  4WD6 A;  5AXO A;  1YCF A;  3IDZ A;  2Q0I A;  1K07 A;  2WHG A;  2YZ3 A;  4UWP B;  2DOO A;  4U4L A;  3DHC A;  4AD9 A;  5HIS A;  2WRS A;  2BG8 B;  4C1E A;  2A7M A;  3BV6 A;  3ZQ4 A;  4EYF A;  3ZNB A;  2YNV A;  2XF4 A;  1DD6 A;  1WUP A;  2FK6 A;  1JT1 A;  4TYT A;  4NQ2 A;  5K4N A;  5LLD A;  3SBL A;  4V0H A;  4H0D A;  3ADR A;  2FHX B;  4O98 A;  5ACQ A;  2FU8 A;  1MQO A;  1Y44 A;  4ZO3 A;  2GFK A;  3R2U A;  4J5H A;  5B1U A;  4Z67 A;  4UWR B;  4TZE A;  5LMC A;  2OHI A;  2HB9 A;  5ACR A;  5LE1 A;  3S0Z A;  4HL2 A;  3PY5 A;  2BIB A;  1X8G A;  2Q9U A;  2BR6 A;  4BZ3 A;  5LM6 A;  5EVD A;  2AIO A;  2GKL A;  3H3E A;  4GYQ A;  5LSC A;  1SML A;  4D1V A;  4DIK A;  4GYU A;  5AHR A;  2VW8 A;  4NUR A;  1XM8 A;  4AWZ A;  5HIQ A; 
#chains in the Genus database with same CATH homology
 2QDS A;  2FHX A;  1ZTC A;  1KO2 A;  2AZ4 A;  4UAM A;  2QDT A;  5K4K A;  4NQ6 A;  2FU9 A;  2NXA A;  1P9E A;  5KIL A;  1WRA A;  4P62 A;  4C1D A;  2NYP A;  4ZNB A;  5EVB A;  3SRX A;  3I15 A;  4YSB A;  2H6A A;  5AXR A;  4C09 A;  3AJ3 A;  5AEB A;  1XTO A;  3JXP A;  1KR3 A;  2NZE A;  3I14 A;  1ZKP A;  5B3R A;  4EFZ A;  4AX0 B;  5AYA A;  4B87 A;  4TYF A;  3SW3 A;  5EWA A;  1DDK A;  2R2D A;  5ACU A;  4FSB A;  2BTN A;  4DIL A;  2BG6 A;  4UA4 A;  1VJN A;  4EXS A;  5LCA A;  3TP9 A;  4LE6 A;  1M2X A;  2QJS A;  3SD9 A;  1BMC A;  3KNR A;  4XWT A;  3T3O A;  5FQB A;  3G1P A;  4ZO2 A;  1DXK A;  3KNS A;  3BK2 A;  4UBQ A;  1A7T A;  3X2Y A;  3IOF A;  4PVT A;  5EVK A;  2Y8B A;  1KO3 A;  2ZWR A;  2I7X A;  3RKK A;  5HH4 A;  2BG7 A;  4YSK A;  2BC2 A;  2NZF A;  2FM6 A;  1YCH A;  5HH6 A;  1YCG A;  5ACS A;  1QH3 A;  4F6H A;  2BFL A;  1X8I A;  5ACW A;  3I0V A;  2BFZ A;  3SFP A;  3A4Y A;  3DH8 A;  3FCZ A;  1QH5 A;  3T9M A;  5K0W A;  2YNW A;  4F6Z A;  2YNT B;  2BMI A;  2GFJ A;  5ACV A;  2CBN A;  2P97 A;  4UWS B;  1X8H A;  2Y8A A;  5EH9 A;  4CHL A;  2Q0J A;  2ZNB A;  5A5Z A;  5B15 A;  2WYL A;  3VPE A;  4D1T A;  4EYB A;  1HLK A;  4GCW A;  3PY6 A;  3F9O A;  3RPC A;  5A0V A;  4TZ9 A;  3BC2 A;  3RKJ A;  2YNV B;  4D02 A;  2P4Z A;  4Z5Z A;  2GCU A;  2YCB A;  5LCF A;  1JJT A;  3ESH A;  3BK1 A;  4JO0 A;  4ZEJ A;  3X30 A;  4C1G A;  2BFK A;  4EYL A;  5EHT A;  3DHB A;  2BG8 A;  4EY2 A;  1WW1 A;  4Z7R A;  5A0T A;  4KEQ A;  4FR7 A;  3IE2 A;  3IEM A;  3ZR9 A;  3ZWF A;  3IEK A;  2OHJ A;  3AF5 A;  3IOG A;  3MD7 A;  5LS3 A;  3P2U A;  2QED A;  1L9Y A;  5EW0 A;  4BP0 A;  5ACP A;  4C1H A;  2ZO4 A;  4XUK A;  2FU7 A;  4C1F A;  3X2X A;  4NQ4 A;  2QIN A;  2I7T A;  5DPX A;  2WYM A;  2YNU A;  4RL0 A;  1VGN A;  3KL7 A;  2FU6 A;  1WUO A;  2DKF A;  4HL1 A;  4Z5Y A;  2I7V A;  3I13 A;  4TZF A;  1ZNB A;  5EV8 A;  5A87 A;  2P1E A;  2BG2 A;  4RBS A;  4AWY B;  4AX1 B;  3LVZ A;  5HIO A;  4XWW A;  5ACX A;  4RAW A;  4RAM A;  2P18 A;  3IEL A;  3IE1 A;  4UWO B;  4Z60 A;  5FQC A;  2OHH A;  4C1C A;  2WYM C;  4PVO A;  1BC2 A;  5HIP A;  1A8T A;  3L6N A;  4YSL A;  2UYX A;  2M5D A;  2M5C A;  4EXY A;  2GMN A;  3SPU A;  2ZZI A;  4TZB A;  4RM5 A;  5AHO A;  2BGA A;  5LCH A;  1BVT A;  5KIK A;  2YNT A;  3Q6V A;  4J5F A;  3DHA A;  5FQA A;  3FAI A;  4FEK A;  3IE0 A;  4D1W A;  1VME A;  3I11 A;  4D1U A;  2BFZ B;  5ACT A;  2E7Y A;  4Z6X A;  3PG4 A;  4HKY A;  3T3N A;  3WXC A;  2Q42 A;  3QH8 A;  1JJE A;  3AF6 A;  5K4M A;  1E5D A;  5EV6 A;  3X2Z A;  5HH5 A;  4NQ5 A;  2XR1 A;  3VQZ A;  2Y87 A;  5IQK A;  4KEP A;  4RL2 A;  4WD6 A;  5AXO A;  1YCF A;  3IDZ A;  2Q0I A;  1K07 A;  2WHG A;  2YZ3 A;  4UWP B;  2DOO A;  4U4L A;  3DHC A;  4AD9 A;  5HIS A;  2WRS A;  2BG8 B;  4C1E A;  2A7M A;  3BV6 A;  3ZQ4 A;  4EYF A;  3ZNB A;  2YNV A;  2XF4 A;  1DD6 A;  1WUP A;  2FK6 A;  1JT1 A;  4TYT A;  4NQ2 A;  5K4N A;  5LLD A;  3SBL A;  4V0H A;  4H0D A;  3ADR A;  2FHX B;  4O98 A;  5ACQ A;  2FU8 A;  1MQO A;  1Y44 A;  4ZO3 A;  2GFK A;  3R2U A;  4J5H A;  5B1U A;  4Z67 A;  4UWR B;  4TZE A;  5LMC A;  2OHI A;  2HB9 A;  5ACR A;  5LE1 A;  3S0Z A;  4HL2 A;  3PY5 A;  2BIB A;  1X8G A;  2Q9U A;  2BR6 A;  4BZ3 A;  5LM6 A;  5EVD A;  2AIO A;  2GKL A;  3H3E A;  4GYQ A;  5LSC A;  1SML A;  4D1V A;  4DIK A;  4GYU A;  5AHR A;  2VW8 A;  1XM8 A;  4AWZ A;  5HIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...