4O9HH

Structure of interleukin-6 in complex with a camelid fab fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
200
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYRMYWVRQPPGKGLEWVSAISAGGGSTYYGDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCANRAGWGMGDYWGQGTQVTVSSASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNGVHTFPAVLQSSGLYSLSSVVTTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining residues of naturally-occurring Camelid somatic affinity variants yields ultra-potent human therapeutic IL-6 antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-6
total genus 38
structure length 200
sequence length 220
ec nomenclature
pdb deposition date 2014-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hH01
1H8OA 1NGZA 1GL4B 2W9EH 1PX3A 4M6OL 1WT5A 1AGBA 5J1TC 3CH8A 3PHQB 1QQDA 1UWGL 1IEAB 1S9VA 5DR5H 5IFHL 4EOWH 4CVWA 3R0MA 1A7RH 4PJXA 4AEIL 3HI1B 5C0AE 5KVEL 4GMTH 2VZTA 4ZPVB 4N90D 3GRWA 4XTRD 2RB8A 1S8DB 3P11L 1ZHLA 5LGJA 1I9JH 1WC7B 4Q74A 1QG3A 2Q3AA 5C0CA 2FX7L 1NC2D 4KY1L 4U1NA 4N8CL 5E2TL 3VFPB 3S7GA 3FT2A 4MVBC 5EOQH 2Q86A 4QCIB 4WIQA 2PTTA 1NUFA 2EYRB 4DGIL 1MHEA 3NCMA 5IEKA 3B83A 3OB0K 3EDJA 1AR1C 2ED7A 2YKLL 3CFJB 2QQKL 2D9CA 1H5BB 1M6OA 4I3SL 3P9LB 1X9QA 4UV7H 3DX9A 2FL5B 5KG9B 3E6FB 1U8HB 3CFCL 3OB8A 2ARWA 5JORB 5JDSB 1F8TL 3MA7A 4PGDB 4DOHE 3UBXA 3B5HA 4M9PA 4N0RA 3CLFL 3QWRD 3FKUS 4YHOL 4ODWA 3LKSA 3PWNA 4KVNL 2AP2A 5HI4C 4HAFA 1YEEH 3TYFA 3W0WE 4MVBD 3LEVH 3QFDB 4NQCB 3TO4B 1N2RB 2ZG2A 1OAQL 2DYPA 4WI4A 3ZE1F 2CRYA 4ENED 5HDLA 2EDNA 3QZWG 3MV7A 2PYEB 4APQC 1T1ZB 4J12A 3CX5J 4MNGB 1OTUC 5FYJD 1B2WL 1N8ZB 3OXSB 4FXKB 5C08B 1CD0A 1OGAA 1NGQH 1I1AA 2FZ3A 4QTIH 2D03L 1TTUA 3O2DH 4NZJA 4X6EB 2PKDA 3MV9A 3DVNA 1V7ML 3L5WB 1ACYL 4JPVL 3D3VB 4MD5A 3CZFB 3LZFH 3ULUF 1NBYA 1QSZA 4NZUH 3ZDYF 1FJ1A 1K4CA 2OS7A 4UDTA 5AAMA 3EO0B 1R24A 5HVGB 3UZVB 2Z92A 3DMMB 3ZLQC 4YIQA 3WJJC 1F4AA 1HSAB 2GCYB 2H8PA 2IAMC 3HE6D 5FA4B 2DB8A 2VR5A 1NLDH 1CF8H 3RA7H 3PWPB 3AREC 4NO0A 3HLAA 1SJEB 2VRAA 1UZ6F 4ODXA 3BJ91 4IRJD 15C8L 2P45B 1A6VL 2C3WA 4L4VE 4XWGH 3MGAA 3NOIA 3EOYG 3O2DA 5EORH 4MB4A 3BQUB 2ATPB 4MDJA 1V05A 4JRXB 2NW3B 5DJCA 5F72S 2BSRA 3VDCA 4ZPTA 5CBEB 1OW0C 1T0PB 5CEXB 1YEFL 3P0VH 5H8DA 1PKQE 4OD1L 3REWB 5K9KA 4FFZL 4FRWA 1XZ0B 1ZTXH 4JM4L 4TNWF 1TZGL 5F1IA 1YYLL 5EOCL 3MV7D 1JGDA 3QEHA 3G6DL 3VFTA 1HCVA 1D7FA 4O2EB 3CLFH 3V7AE 3LRHA 1ZA3A 3MA9L 4IRJB 5I9QB 1AQKH 3MLRH 5F7NC 5DSCB 4YFEA 1A6AA 3CMGA 3Q5OA 2AJVL 1J8KA 1I8KA 1GOFA 1T80A 2HKHL 4XWGL 1FQ9C 3EGSB 1ZHLB 1HXYA 5TGBA 4J4PC 2OR7A 1ZHNA 4BFGA 2R0WL 3W0WD 1XEDA 4LSTL 5HGGS 5MHSE 3NZ8B 4JO1H 3ARFB 3PDOA 2O5YH 4NBZB 2R8SL 1WF5A 2WP3T 4KPHH 3DI2B 5C09A 3U0WH 4JN1H 5F1NA 4BFIB 4ZQKB 4Z0XB 2AKRA 2EDDA 1NCUA 4JQXA 2NW2A 1S7TB 4WVRA 3VXSE 4CVZB 3JWDL 3U30B 5IB3B 3HI5L 1DP0A 2CIKB 3FQNA 3GSNL 4V2CB 2WUBL 1CL7H 1WZ1L 3VFGH 5M95B 2FX8L 1A5FH 2J1KA 1NFDE 5D7LA 2P24A 3ARFD 2D03H 2BNRA 3SJVE 1G7JA 3S88H 4YFLI 2HFFA 2HN7B 1A0QL 4P2OD 1MCLA 1YEKH 2NZ9C 3P73A 1RZ8B 4CUCA 4RX4A 4ONGH 3WIHL 4C55A 3FONB 3O6LH 3RHWK 1A1OA 3WDIA 3LY6A 3SKNB 3GMPA 4N0UE 2PYEA 2JB6A 5IJVB 1ZV5A 2GY7B 2A1WH 1PEZA 3U6RB 5IGXH 1XF3A 5GRXG 4Y4HC 1JRHI 1N4XH 3QNYB 4JO2L 5E2VH 5KSVA 3BWAB 5ENWA 5EC2B 4RFEA 1RJYA 3HZKA 5JW3L 3DROB 1JZ7A 1U2HA 3C2SA 4FN0A 1KIQA 3UBXB 2DQGH 1U3HD 2V17L 5HHNA 4N8CH 4RFNB 4YIQB 5CJXC 3S34L 4EXKA 2VH5L 4MCYB 3P4NB 3VFVA 3PL6D 2YPVH 1RUKL 1S7SA 2UVEA 3B9AA 4OUOA 1X6LA 1HI6B 2QKIA 1XR8A 4NQSA 1AHWC 2CR3A 3VFWB 2AEQL 3RNQA 4U2ZA 3OKMA 1DE4B 4LLYB 5JPMA 2B8OT 2RGSA 4JO4H 5MEOA 1JPFA 4YWGL 5BCAA 4PJIE 3RGVC 3U1SH 1YN7B 5IG7A 3VGGA 4H1LH 4RDQF 3ARGC 3EJZD 4CJ0A 5I1HL 1HH6B 3BXNB 4LSTH 5D1QB 3RWJB 1R6VA 1UKQA 2EDYA 2EE9A 4HULB 1W8NA 3ZE0F 3GSNB 4P2QA 1DFBL 1G9MC 1AQDA 4JFZL 5D7SH 3ARUA 5SWQA 4FTVB 3O8XA 4GRLC 4PJAE 2UWEB 3FN9A 2BRRL 4WDIA 2XQYK 4F9PC 2AI0H 5LCVH 4XH2A 4Y8DC 4OV5B 4N0YL 4Y89A 2QJDA 3UYRH 5J3HD 4LF3B 2F58H 4X7TA 5D71L 4HBCL 1X7QA 4D94A 3RKDC 5EU6E 1CD9B 1UEMA 5DHVA 5E8PA 1I75A 1KTDB 2ICWJ 1VFAA 4PJ7A 3TYGH 4LFHG 4NO0B 3UTPE 4FA8A 5GGUB 2XY2A 4P48A 1KELH 4Y19E 4AEEA 2XWJA 3W9EB 3C5ZD 3F62A 3QH3A 2BC4B 4LCWB 4BZYA 3T09A 4RGND 2FZ3B 3MNWA 4D3CH 4M43L 2NX5D 4KK5C 2BDNL 5MERA 1BQHA 4OZIA 3HI1A 1FC2D 2NXYB 4EN3A 3PWJB 3T77B 5B3JE 3MCLH 5DJZA 4KKNA 3U46B 3ABZA 2Y06L 4O2EA 5LBSL 4P23D 2GYSA 3ARPA 4V2BA 4MCZB 3BKCH 5FFLA 3ZE1E 2WUCH 4P9MH 2F5AL 2X5PA 3UTOA 5IWLC 4HJJL 3SGKC 4RAHA 2Q7YA 3KPNA 3VXUE 4NQDD 3TH2T 4RBPH 1EVUA 4Y4HB 1VGEH 1MIMH 4P3WA 4O02H 3ULUH 3V4VH 5IOPA 4JHAH 3LCYA 1RUQH 1TVHA 3L95A 1S9YB 2VTFA 1BVZA 2EC9T 4ZTPH 3HNVH 3KYMB 2P48B 3IFNH 2I5YL 4JFED 2BSRB 4QRRB 1D9KB 1MLCB 3NN8A 4ODUB 4NDMA 1B3JA 3E6HB 1OAKH 2R2EB 4WGWB 2PTVA 4JY4B 2R2CA 3HG1B 1AY1H 1Y6MR 1QFWI 4JGUA 1LD9B 5F96H 4OQTH 3X3FH 2BSSB 2BCKA 3E2HB 5J1AB 4FQQA 4EDXB 4JFDD 2UWEE 3WUWB 3WFDL 3IDJB 3O2VH 5AZEH 3HG1A 3ULUC 3FB6A 1WVZA 1BVKA 2A73A 3ARGB 3L3HB 3QRFM 4MZ2A 4Z7WB 3SKOB 5EU7C 5DLML 3P9MB 5GHWH 4HBCH 4EVNB 1GGBH 3QP3A 3NIGE 1OAYH 3VWJD 3QUKB 4GG6A 5TE4L 3PWVA 1GAFH 3O0RH 3BOVA 2C4XA 5IW6B 3N9GH 1OWRM 4LRNL 3FT4A 5JTWA 4GW4A 4AJ0A 2AEWA 3SCMC 5GGVL 1WWWX 2HKFL 1NCWL 1A0QH 1KLFA 4PJFF 5EU4B 3GI8L 5DUMH 3N85L 2X4OA 4RQQB 4XBGA 5D1ZD 3IDGB 3BP6B 4RISL 3BT2H 3D69A 3FMGL 4L3CB 1YC7A 3U0PB 3HZMB 3DUUA 3S3PA 3B9EA 4F15B 1NDMB 3RVXC 4TYUA 2WWMD 3FB5A 3QWOB 2C26A 4OGXH 3C5SB 1NGPH 1HHJB 3V7MA 5JOPD 3O3BA 3LSOA 1A1OB 4LBEA 3GHEL 2BJML 1HHHB 1T7VA 1U8LB 1Z9OA 4NKMA 4L8DB 1PG7X 4H8WH 3VI4E 3I02B 4TQEL 5C0EB 2L7JA 1WFOA 2CMRL 3S4SA 3B4NA 4GJTB 2VDRL 4KTDL 5C0DB 4DVRH 2AJYH 5A3IC 5CD5D 4JDTH 4L8DA 5E03A 1AO7E 3WSQH 4DVBA 1XAUA 3GI9L 4I0PB 1A9EB 5DJ8B 5C08D 4XPFL 4I18B 3K4ZA 4XPTL 4FQXD 4WUUB 1YDPB 2R23A 3IFPB 2BHZA 3MREA 5DEGB 3EJYD 5KANG 5KS9A 1E6JL 1RZFL 2HTKD 3BH9A 5GRYA 4UT6L 4GLRI 5A2KH 1QBBA 5DK2A 3S96A 1CK0H 1G6RL 4HLJA 4KVCH 1UQSA 3MRQB 4DKEH 2NNAB 4WCYL 4K8RC 1H5BA 1M6OB 2XQBL 3QIWD 4PJ9A 3V7AG 1C08B 5EZIL 4ZYKA 1MRCL 3O41B 1X5FA 2PXYB 4HF5L 4Y1AE 4HUMB 1AXTH 4MJIE 5IG7B 5DTFB 1QSFB 3GNMH 2Y5EA 3RPKA 3TJHC 2QR0A 5F6HI 2NTFB 2XZZA 1QLEL 5C0FA 4PJHB 5E4EB 1QBLH 4RGMB 4Q9BA 2ZWLT 2HA1A 4RRPG 3LH2L 3G9AB 3QDJA 5B4MC 2ICWA 4EDXA 1TETL 4P3CH 3HNTH 2PNDA 4OV5A 3MRIA 1S78D 4PB9H 5E08H 2OTPA 4ZUTB 3MV7B 1U93A 4MAYA 3WO4C 1RU9H 2R56H 2R8SH 3BH8A 2DMKA 1MCPL 3L3HA 3FHAA 5CZVL 3I3EA 2W65A 3T04D 5T1DL 3PNWB 3GBNL 3FQUB 3S3JA 2K3TA 3I6GB 2DIJA 1P4LA 3RL2A 1XF3B 5E5UB 2MPAL 3W9EA 2VDMH 3DWTA 5BVPH 2DM7A 2VZUA 5T3ZD 1GGIL 1T1YA 1PYWA 4KY1H 4ZNEA 4LLVA 1JNLH 5FECB 2WIMA 4HIJA 1PAMA 5LQBL 3DO7B 4JQVC 4YDVB 4WW1B 1KPVB 4FFYL 3ILPA 1AGDB 1MF2H 3GSRB 3KPQB 3VXTB 1F6AB 1MCQA 4NYLB 4Y4KC 3BEWA 5BO1H 5ICZA 2XWTA 4RGMC 5ALCL 1KF9B 1G9NH 2DWDB 2LQRA 3GI9H 2YPVL 4LSDA 3ILPB 2AV7A 1OGAE 4UV7L 5A2JH 1QLFA 2ZSVA 4HUVA 3O6FC 1FRGL 3OKMB 1AJ7L 1T2QH 1QFWH 5BS0B 1I9EA 3T0BA 2B4CC 3VFPA 3P77A 1HH6A 4OSUL 3SDDB 3U7AA 4FQCH 3HR6A 4ZMAT 2NZIA 5IMKB 1X44A 3C6SB 1DVFD 3EYQC 1G7LB 1KEGL 3QDHA 4AY0A 4AG4H 1I3RA 2GKIA 2ICWI 3B9KB 5E99H 3TT1L 3HG1E 4WTZG 4K7FA 4U7KA 5SX4I 3E6FA 2G9HA 1LK2B 1UJ3B 2HT4C 1OQXA 1VADB 1HINH 2HVKB 2A9ML 3EYUL 4KHXL 1QKZH 5T1MA 2BHUA 2JELH 4I5BA 1FNEA 1JF1B 2H2PC 5EU5B 2BP3A 2VUOA 3ARFA 4LEOB 1NUGA 5L2KA 3WS3B 4XI5C 4I3RH 4JGJA 5I15H 2Y72A 5KSUB 1S78C 3WN5C 1Y18B 3U30C 1RUAL 1W72L 4LOUC 2BSED 1E4KA 4RIRB 1U3HB 5JW5B 2R69L 1EJOH 3TIDA 1IEBB 4X9GA 1FNEB 4I5BB 4O2CB 4PRID 2EDOA 1QYGL 5IB5A 4JM2A 1T89C 1DBKL 1MAMH 1F3RB 2FATH 3F7VB 1FNLA 4PG2A 3VXQA 1A6UL 2PETA 4F7PA 4AT6A 1R0AH 5ALBH 3CH1B 1KACB 5JW4M 1NGWA 3SKMB 4ZSOB 3UTQB 3L6FB 1RZ7H 1LEKB 1NLBH 4WNQB 2NXYD 5DXWA 3WNOA 1WFTA 4OAWB 4EN3C 4DFIA 2A74A 1HQ4B 4MD4A 3MRPA 2V2TB 4N0CC 4HPYH 3VMPA 4L3ED 4F33B 1FO0A 3TM6A 3SKMA 4P23C 2XTLA 2MFNA 2V2XA 4OCNC 2OSLA 1I1AC 3DJ9A 2FJGB 3QHFH 1DQML 1UB6A 5C0CD 1QLRA 3JTSA 5IW3A 2HLFC 2P47B 2CIIB 2EDJA 4KK5D 1HH9B 3QCUL 5KSVB 4OM1L 3TWCL 2R1YB 1AQKL 1HWHB 2OP4H 1BFVH 3CXHJ 3OMZA 1BD2B 5GGRB 4G8IB 2VQTA 4L9DA 2AABL 2YD5A 5EO0B 3ALXA 4KV5F 2YXMA 3IJHA 5IEHB 5DURD 1NANH 1SJHB 4K7PL 5EFIB 3DVFA 1DBML 1KN2H 4OLWL 3V2AR 1D9KC 3UTPD 4OKVA 3ALWA 3LMJL 5JOFB 5IB1B 1LEIB 2D0HA 2KBGA 4HWEL 4HUUB 3R1GH 2DQCL 1BBJB 2JIXD 3MRRB 4G6FB 4KDTC 5AYQA 4GKOA 4PJ7B 4HUWA 3VG9C 3LPWA 3LV3B 2E9JA 1CXKA 4XMKL 5HGDA 5T33L 1OVZA 2NY1D 2HT4D 4NKIL 2Q87A 3CDGB 3JWOH 4S1QL 5HGAA 3EYVA 3WDJA 3EHBD 1KN2L 4OLWH 3TBVB 1BIIA 1CE1L 4PP1D 3PV6B 1A1NB 3TNMB 3PNWA 1IC5L 1DLFL 2EXWC 4J6RH 4NKDA 4OCLC 1S9XA 3V5HB 4LLUB 4XHJD 4LPUA 3ZL4H 4LLDA 4LP5A 5DD1L 2MHAA 1N59B 4PREA 3RY4A 5C0FB 4LIQH 3REVB 4Z9KB 3R8QA 2CIKA 3KAAA 4QGTA 5DWUH 5LCVL 3F65A 2WBJD 1OSPL 4S11A 3VGBA 4O58L 4F2MA 4Y4HA 4HH9B 5IIEB 1TPXB 1NLBL 4MNHA 3BO8B 4DZBA 3CCHB 1LNUA 1CQYA 2Z8RA 1NC4D 5F7UA 5IT2L 2AXFB 3IKKA 1F11B 2FJHB 1NAKL 3TA3A 5IB4A 3UDWA 3MJ7A 4OLZL 1DZBA 3CX2A 3BPLC 4M7LL 5IVOA 5JXAH 4DVBB 1G7HB 5DD6B 1KCKA 3SDXE 1U95A 3G08A 4DGVH 1IBGH 2XQYG 1RUKH 5KZCB 2YMXL 4U6HA 3MV8B 5I71B 4WUUA 3GSQA 4O51A 3MREB 3U9PH 5BO1L 1FO0H 3IU4H 3BP7B 1OAUH 4MXQD 1UWEH 4P3DB 3WN5B 4M5ZL 3FHQA 4HMDA 5I30H 43CAA 5F6IB 4WUKH 1BX2A 5HHOD 1ZLUK 2C7UB 5L2KB 5J3HC 3A67H 4U1IA 4L5FL 5IBTH 5B4MD 5CEZE 5JQHC 2I9LB 4OGZA 3UYOD 2AEPH 1YEGH 5DTFA 3MROA 4G80B 1KXQE 5MEQB 4KKLD 4Q7DA 3DBXB 2AJYL 2CDEB 3TPUB 2X4NA 2C7UA 5C09E 4YK4C 4YR6B 5E9DD 4BQ8A 3WEXA 2PXYD 3MJ8B 3UYRL 5EO9A 4P46B 3DSFH 1JV5B 4EI5B 3CZJA 5FF6B 3CZFA 5IFJB 4MJ6B 3QNXA 4XBGB 3K3QA 5DMIL 3GBML 1MVUB 4KTEL 4L3CA 4X5LA 5MHSD 3EJZC 5J9PA 3RI5K 3CJJA 1RUMH 3UTTB 5ID0B 1KUMA 1FE8L 3ARDD 1EX0A 1OD9A 4G9FB 5I0ZA 4XNZC 1L7IL 2M26A 1RMFH 4QOKD 3W5MA 4PJGA 4W70A 3C60C 1FAKT 3Q6FA 4OZFA 1EEUA 2ADGA 5DEFB 5D7JA 1KPUB 3L9RA 4GBXD 3HRPA 4QY8A 1KJ2L 3MACH 3DO3A 4HJGB 4G8FA 2FRGP 1YEIL 3OR6A 5GSVA 4GG6B 4JRYE 5HI5D 1HCFX 3OGOE 3RAJL 4GRMB 1ZVHA 5FGRA 3TWCH 3H3KA 4KDVA 5DJCB 2NW3A 1B90A 3FT3A 1P7HL 4X5WA 5DJYB 1WEJH 5CLWA 3BIBX 3O6ML 1B2WH 2G2RA 5HGBA 1UKTA 2VR4A 1I3UA 5C0CE 4YBQC 3WFBH 1CFSB 3GGWB 1KENL 3PWPD 5EBGA 2DQDL 1WIUA 4Z7QE 4OD2A 3BDBA 3D0LA 3FT3B 4MJ4A 4H26A 2DQIH 5FKPA 4N68A 4PY7B 1T22A 3HAEG 4I2XB 3GJEA 5K59E 4S10A 5C0CB 1FNGB 3CU7A 3NMEA 1EEYA 3O3BB 4LBEB 2NY0B 4WUKL 1VKXA 2VOTA 4Z0BH 4Z5RA 2B1AL 4PJ9B 4X6BA 3PGFL 3TBTA 2Z9TA 5C70A 1CLCA 1HNFA 4JB9H 4JR9L 3IDIA 4X0KB 1JJUA 5J1SC 2KQMA 4D2NA 3RIAK 5DEZA 5CS7A 4GG6E 4YH6A 3CVHL 4YHKL 1DVFC 4Y5VB 4IDLA 3V5KB 1AXIB 1UCBL 3ARFC 5DS8B 2QSCL 4B5EA 5EORL 3GIVB 1B6DA 2OL3B 5JORA 4YDIH 5FYJE 4LOUD 3BMVA 4TRPH 4NQDB 5FYLL 4U3CA 4ORGA 1F4YL 4CMHB 3FFCA 2H6PA 4ZS7H 3CFEA 4GAYA 3ULUE 1FZOA 1IGTA 4M4RA 4O9HL 5AUMB 5C0AA 3Q48A 3VRJA 5CZXC 5IK3A 5BRZB 3BPLB 2IPKB 3B3IB 4BSWA 3OAYK 1J0IA 2ID5A 2UZXB 1L7TL 4NNPL 2D7TL 4JG0H 3ZHDA 3QQ4A 2R2HA 3NFPA 2MQCA 1EGJL 4G8GE 5FYKD 4JM2F 1CGUA 1VGKA 4U2YA 5J1AA 1JHKL 4H0IA 5DQDL 2LFGA 4JJ5B 1YQVL 2EIEA 3NAAL 3X3GH 3THML 4NM8L 1CDUA 1I85C 1I7RA 4PRPB 3ZSTA 4BUHA 3KS0J 4RMSA 3RI5F 5TPWL 1RURH 3V8OA 1EHLL 5SX5H 2I9LA 5JUEH 4BH7A 3RDTB 2BRRH 1BZ9A 4PLJD 4WHYG 5T3XD 3VFRB 5CIPB 5FECA 1R5IA 1OP3K 1JUFA 1S7WB 2EDWA 3MLYH 4MMZC 3QNYA 4WFFE 2VE6A 4F7TB 4ZXBB 1FJ1B 3MJ8A 3O3AB 32C2A 3QQNA 3FQWB 5EA0H 3MRIB 2YEZB 1MNUL 2GI7A 2N1KA 4PTTB 1CGSH 3ROOA 5ADOH 3RWDA 2FB4L 1UACH 4NRZB 1GPOL 3SDYH 3QHZH 2IANB 2VE6B 4JRYA 1M7IB 4M1CC 5KOMC 4RNRB 5SWZE 7CGTA 4UIKH 4Z0BL 1FIGL 3QDME 2XNAA 4Y1AA 4CU8A 2DQHH 4N1HB 5DYOB 5TDOA 2HP4A 2DTML 4N90E 2VXVL 3ARED 3VW3H 1U58A 2Y36H 4NN7C 1CXFA 3HZMA 2VLRD 2FYYB 1EERB 1CDGA 2W9EL 1BEYL 4EBQL 5GGRA 1T5WA 5CKAA 4LLYA 6CGTA 3AUVA 1TJGL 4M7KH 3BIKA 5ESAB 4WFFD 4OBRA 3MROB 5C6WH 1NH6A 2W91A 1MRFH 4K9EC 4XBPA 1YEJH 2DKUA 1MI5D 3BPOB 5KN5A 1OP3H 5DFTA 4Z7VF 3OKYA 1UGNA 2KZWA 3SCMA 2FX7H 4MQ7A 4ODTL 4PGEB 5EOCJ 3FZUC 3V4VL 4HWZA 2V5SA 4IRZH 5JHLL 1R0AL 3HMWH 3DXAA 2APXA 4H26B 4M5YH 1IGYB 2NXZD 1F4YH 1PDKA 5EULV 1EK3A 5E6YA 1CT8A 7FABL 3LV3A 2YHGA 1IC7H 1BPVA 1NMBL 5GZOC 2YD7A 1HNGA 1TJGH 1Q94A 3C8HA 4JN1L 5CHNB 3NIGF 3DV4A 1I85A 4W4NA 4ELME 3M17B 2CDGB 2Y36L 4XCNB 3EUUA 1TQCB 4BKLB 2X70B 3WNKA 1QSEA 1WBZB 4JPKH 1HILB 4QOKB 1KEMH 4XCEB 5H37H 1TJHH 4Y1AD 3DV4B 1MJUL 2FHCA 3RY6A 3SDCC 1KXTB 5K9JH 4WI9A 4U1MB 3BYYA 2NY4D 1MVFA 2D0GA 3HC4L 2VITA 3TFKC 5D4QA 3QUXC 1YEEL 4D8PB 3PWJA 4R4FH 1FZKA 1N6QH 1OTUD 5TQ2L 5BRZA 3VRJB 4Z7OF 3UTTA 4BSWB 1NFIA 5I1EH 4OGYL 4YBLC 3DURB 1RZJH 2AK4D 4POYA 4QHUA 2VN4A 3HAEB 4UTBL 1OOAA 4OF6A 1IM3B 3DIFB 3UTZB 1I8IB 3HNSL 2QHRH 1ULVA 3NACH 4UT7L 3QWRA 3MRCB 3DURA 3BHBB 5GRWA 4HK3N 3EDKA 4MA8L 3X14B 4PLJC 1MFBL 1LHZA 3F7QA 5EBLB 1N64L 2JJSA 5D7IF 3QEQD 5BZWA 3FMGH 1JNHA 2WIIB 4HT1H 4U1GB 1JYVA 3S36H 5JA9A 3WYRA 4RFEB 3MV8A 4EOWL 1R5WA 5I74B 4QWWC 3CSYA 3ECBB 5H94B 5HHQA 1D6VH 4NFCA 1HQ4A 1ZA6B 4U6YA 5ANMB 5C71A 3LH2H 3V95A 3D0LB 5T5FL 1IAIL 4KTYA 4NQXA 3JWDC 2K1MA 3DYOA 1MWAA 4WW2B 4QNPF 4PJEE 4S1SH 4EDWH 1A6VH 3W39B 2Z31A 4M7LT 1U8MB 3ARBC 3N06B 3UROR 2NX5B 4HFUH 2FSEB 4PGCA 4UQ2A 4KK8C 2X7LA 2HFEB 2CQVA 4GKSA 4G80A 3HNSH 4NO5B 4R4BB 1AKJB 3T4YA 1MWAB 3CDCA 4WW2A 3P4MA 5TDNA 1UCBH 4RA0C 1NC2B 1RSFA 4XNYH 4Z7NE 1XF1A 3MCG1 5INDA 2Q8BH 2DQFB 4PJ8A 1QEWA 5FUOL 4HKJB 1HIMH 2YD2A 1C1EH 4BK4A 1E6JH 4FFWC 1NBYB 3C6LA 4NM4L 4PRAB 2HWZL 4XBPB 3VGDA 3V4PL 2WWKO 3QDGB 4WY7H 3W11D 2EDEA 1SM3L 5CEZD 1NCNA 3QA3B 5DHVH 5GSRA 3B9VA 5DD5L 2HLAA 1UZ8B 1T03H 4U0QB 3LN9A 3KHOA 3B9KA 4OQTL 4Z7VE 3IFNL 3K7UA 4JM2D 4F7EA 3EZJB 1ZMYA 3EYVB 1T1WA 2IJ0C 3U9PL 4P46D 4A2MA 2VC2L 3KG5A 1TETH 4P3CL 3MUGA 3HUJF 5CKGA 4PJ5B 5IFAL 4M6ML 1FNAA 4C59B 1JNNH 1FV1B 4FXGA 3GSOA 4TTDD 4HZLA 3BPCB 1GJIA 1CFVH 2BY3A 1MFCL 3I85A 3DTXB 2QQLL 3KYNB 5MERB 3IJSB 5D5MA 1CFBA 4ALAH 3WKNA 2VLRA 1GGCL 3T0EA 3QDGE 1JGUH 2B1HH 5F71A 4JFEA 4U1LB 2X4UA 1RUPL 1ROWA 5T5NG 1EA9C 1J5OH 2ZSWB 2I07B 5DD5H 3BGMB 3GMMA 4OB5L 2MTPA 1KT2A 3VXSB 2WWMC 1A6TB 1Q9WB 3QPQD 1FGVL 2Q6WA 3V5DA 4HEME 1FL6B 2EYTB 4YC2C 3SDYL 1FG2B 1AHWB 3CSBA 4PJCB 4PJAF 3W81A 1DQQB 4PRDA 2NX5E 5FCUH 5FCSH 3M8OH 1ZGLP 5T33H 2VIRA 4X83A 1NPUA 4AQOA 1YNLL 3LHPH 4Y19D 1Y6KR 1CE1H 4KRLB 5I1DB 4G7VH 4P9HL 2E7MA 3O8XC 3QIBD 1WC7A 1C7TA 5BV7H 3ZDZE 4Q6YA 4HIEB 3RP1A 2IF7A 2EC8A 5B38A 3CVIH 2FBJL 1KB5A 2M2DA 3V6FA 3V6ZB 4L1HA 4WENB 5F3BB 4C58B 5E2UL 3VGAB 1XGPB 2PUQT 4RBPK 2P7TA 3LKOB 2ZOKA 4DUWA 1F2QA 3JV6B 4M7JL 3BDXA 3EYUH 4ODBD 5E6IA 5ID1B 3O6FB 4D0CB 3GM0A 3KXFA 3RDTA 1QBML 1B0GB 1JCKA 4LCUB 1U8HA 1NSNL 4BKLA 1YYLH 4ONHB 1FZMB 2CLVA 5ITFA 3U6RA 1FL5A 1MFBH 5DZNA 3HI5H 2AABH 4PJ9D 5E0QA 4CW1B 5ID1A 2MMXA 5F7WC 4HT1L 4MNQA 4BSVB 5IMLA 4H88H 4QT5A 5IVXB 1Z9LA 1Z3GH 3MLZH 4HCRA 4IIQB 3PL6C 1Q9OA 5D8JL 1I7TB 1ORQB 3MC0A 4OGYH 2GFBA 1HEZB 4MDJB 4ZOCA 4MNQB 2VLKA 3QEQB 4L8BA 4G8FB 2MCPL 5EZJB 3FCTB 3GSWA 4IOIA 3CSPA 2YRLA 5J12B 4N8VB 3FB5B 3QWOA 4R8WL 4FNLL 1JPSL 3OKLB 3JWOL 4LIQE 3UAJD 4D0BA 5SX5K 5BOPA 4YGAB 3H9SB 1YN7A 1GVIA 3CCHA 5DJZB 4PP1C 4ORGB 4JCLA 3WIIL 4F7CA 1X6NA 3PWLA 1AXSA 2B4CL 5BZWB 4MS8D 1CDJA 2YPKA 5JPNA 3MOBH 4XNZB 4CN1A 5BVPL 3UTSE 3FTGA 3NCJH 1OPGL 15C8H 5IR1A 3S5LG 3C5ZC 1U3ZA 4OI9A 4GQPH 3IETB 4BH8B 1DBMH 5CJOL 1HQRA 3TIEB 1DQTA 1J1PH 3HMWL 3WKMH 3PP3K 3K0WA 4S1SL 5HYIA 4X0KA 5E8DH 2YK1H 1IAMA 1JWMB 1MRDL 4OFDA 1H3PL 3PIQB 2YZ8A 4PBVC 2E27L 4JPWL 3MOAL 3EFDL 1LVEA 1U8MA 1ZHKA 4P2RD 4YDKL 1L7IH 2FO4B 3I6KA 4QHLB 4BH7B 4ERSL 1C08A 5J11C 4W68A 4R4BA 4CU7A 4OCXL 4QXTA 4WI5A 3FB7A 3GBMH 1X4ZA 4KDTA 4KZEH 4M7JH 1ZHKB 3FAWA 1INEL 3NFNA 2FEEL 3OJDB 5GZND 4UUJB 2BOBB 2E9IA 3Q5TA 3MCKB 1UVQA 3MLRL 2X4NB 3FB7B 1RZGB 5J56B 2K7PA 4WV1B 1B0WA 1MOEA 1C16B 1TTGA 4UOW0 2HKHH 4M8QB 4WFGD 1C1EL 4KK6D 1R3JB 4G8EA 4CVXA 3T65B 2V5MA 1BF2A 1EFXA 4LAQL 4BQCA 3KPNB 1RZKH 4NQVA 5ABDE 1U8QB 1GRWA 2E6PA 5JW4R 2IALB 3O6FA 2YSSA 1HYSD 4KU1A 2MSPA 3G5ZA 1AC0A 3UZQA 5JUEL 1XGQB 1V3LA 1IGMH 5C9JB 4OZHA 5A3ID 3E1F1 4NO2B 3I2CL 5E8NA 4D9RE 3CVHH 4L3EA 2RCSH 4EUPH 5FO8B 1CBVH 2IH1A 1JHLH 4YBHA 4PRBB 3X11A 4OI8A 4OLZH 5EU3A 3QZWB 1A6ZA 3WFHA 4I0PC 2QQLH 1TCRA 3MNZA 3GMNB 3VFOA 5AD0B 3LPFA 5C0GA 3KHQA 1IRAY 1CFSA 1Q0XH 3GGWA 1JP5A 2ATKB 4Q6IB 1HHIB 3OJVC 4K9EH 4O9HH 4GXUM 3HZYB 1XGTA 2EXYD 3D1MC 2AV7B 3FCTA 4XPGH 4Y16C 1C7SA 1P84K 4TNVF 4HDIA 2MWCA 3ARVA 4OSUH 3HRZB 3KPMA 4HJ0D 2OJZH 1WBZA 1QSEB 1FNGA 3MYJA 4ELMF 3MBEB 3IS0X 2OQJB 1NGQL 4FTVA 3QUXB 3LKNA 3TO2A 1EFXD 4NJ9L 3F8UB 4JHWH 3HS0B 1ZLVH 3UYPA 4YAQB 1BAFH 2VSCA 1DN0A 3KPMB 1AI1H 4DN3H 4WI3A 2E6JA 2Z91A 2KUTA 2APFA 2KH2B 4OZHF 3QUXA 3DXAB 2ITDA 2GJ6A 1HINL 3NIFE 3OPZL 1UZ8A 5IHBA 1R3HA 5F7LB 5CEYA 3OQ3B 1LK2A 1UJ3A 3WJLA 1FVDA 3K1DA 2D7QA 1IT9L 4ZPVA 4YHMH 3V9FA 3DMMC 4XB7A 4LEOA 2F5BL 1TZGH 5F3BA 3AU1A 5TQ0L 4UI2A 2Z35B 4LHQB 4LP4A 4R8WH 4OTXL 4EN3B 5FUZL 1FV1A 1FVDB 4X4XB 3RWJA 3QUYA 4PV9A 4AL8H 1P7KA 3FQTB 1I1YB 4YEEA 4S2SA 4I77L 1X3DA 4OLXH 1ZANL 4OLUH 3MLSH 2I26N 5TDPB 2WBJA 4OBSA 3MUZ1 1T21B 3KDMB 2Q7YB 3OJDA 1NSNH 3C9NB 1ZLVK 2HJKA 1FLRL 4YFLF 4TOYL 2Q8AH 1U93B 4BZ1H 2W9DL 4X7TB 1DANT 3VH8A 4O51B 1YDPA 2R23B 5IBUG 1CIDA 1IM3A 3DIFA 2YR3A 2B20A 2DQEH 2HVJA 5FIEA 2Q6WB 4ZS6D 1U8PA 2R0WH 4DJMA 3UTSD 2HJLB 5JHDD 5HYJE 4C56E 4JFHD 4AMKH 3MO1B 1JWMA 4LMQE 4E0RB 1VEOA 4JKWA 4LSUH 5EBLA 1NC2A 3QIBC 5B8CC 1IQWH 4KAQH 4M6OH 4EJ1C 3U9UA 1B0RB 6FABL 1PKOA 4JDVB 5CBEA 2ITCA 2XA3A 1E28B 3D18B 4GRWF 1TENA 4HK0B 4HC1H 1JTOA 4FQJL 3P0YL 1SJHA 4JFOA 4NUJA 4X6DA 4JZJC 3QUYD 2FATL 4UT6H 3MV9B 5C0JA 2EKSB 3C5JB 1E27B 1QPPA 3HC3L 4PV8B 2NY6C 1RIUL 1WV7T 5K9JL 4PJBE 4TUKH 1EJOL 1NFDB 1IM9D 5DRXA 5E9DB 2GSGB 4GG8A 4FG6C 4WI7A 2ZOKB 4MAYB 4KI5D 4XWOC 4MAUL 5MI0C 3UPRA 4G6FD 2O61A 3ILQD 1T4KB 1IAII 4TPRL 1AY1L 3HUJE 1PY4A 2ZUUA 3GRWL 3LIZL 5B3JF 5INCB 1MY5A 4CMMB 2O61B 3C6LB 5I73B 2JIXA 5FA3A 3UTTD 2ZUQC 1FBIL 1L9NA 4PBWD 4JFEE 4LLVB 4MA1B 5EH1A 4DAGH 3REWA 3GJFA 3OKEA 5DC9B 5HGBB 3AMLA 1S7VA 2AJUL 1T3FB 4NZRL 4WU7A 4B0MM 2WUBH 5K9QI 1AD9A 1PBYA 4Q9CA 3GSRA 1QZ1A 4JO4L 2UV3A 5F7DA 1R3HB 4A6YA 4OFVA 3MRBA 3QUMH 4TPRH 43C9A 3HC0B 1XF5B 4FOMA 4Z7WA 4CVXB 1DVFA 1XCTA 5TE4H 4HEPG 3SE8L 4P5KA 4P5TD 2PTTB 4YXLH 3VFMB 4KJYB 4Y2DA 1WCBA 1NCBL 3BPCA 4WJ5A 4Y16A 5I75B 1T2JA 2ARJB 4O4YL 4BM7A 3LEXA 4IMLA 1OAYL 1IGML 5FAAA 3JV4B 5HYQB 4PJEF 1U6AL 5JIPA 5ADOL 5D5MF 2VLMD 5EO1B 4Y4HD 1G7MA 4W81A 5DJXA 1IEAA 3HPJB 3MLWL 4RFNC 5E24E 2V7HB 4UIKL 5IB3A 2NY0D 3ORJA 1LO0L 3BGFB 5LGHH 1T5XA 4POZC 5EBMB 5ESVA 2C1OA 4JQIH 3UBXG 3MV8D 4U6TA 4PY8J 3LKQB 2VZVA 4BA8A 1I7ZA 1X5GA 2BNRB 5F70A 1IGFH 3WHXA 1JZ6A 4QXUL 3FJTA 2AAVA 1OLZA 4OZ4A 4O4YH 2OTUB 2X40A 5JR1L 2BRQA 2A2QT 2VL5A 5IESL 3MJ9H 4IHOA 5IJKA 3GSUB 3STLB 4CN4A 4LLQB 2OLDA 1ZVYA 2LU7A 2VIRB 3LRGA 2FWOB 1RV6X 3OXSA 4X4XA 5J6GA 1W0YT 2VDLH 3OJMB 4UQ2B 4XNQB 1D5MA 3T08A 4O00A 4BSVA 4U31A 5IMLB 1IFHH 2Z92B 3VD4A 1CL7L 4JGMA 2HKFH 5I1HH 3U36A 3BKMH 2IFGA 4H1LB 4AT6B 3MA7B 2BERA 1VHPA 4P2RB 1KEML 4ZSOE 5C0IB 3NIDF 3Q3GA 1HEZA 1ZT4B 5JR1H 1RUAH 2V5RA 4TUOA 1F97A 3FQUA 4IOIB 3P9WB 5EB9A 5IROC 4DGYH 1NJ9B 4ZS7L 2A83A 2D7MA 4JO1L 2DBLH 4YHKH 3CMOH 5K59F 1D5IH 4HGKC 5ETUB 3WS6C 5DK0B 3QXAA 3ZKQD 1WWAX 5ITFB 5JW3H 3HNVL 5BZDB 4E0RA 2A6DA 1TVBB 3ARDA 5LGJB 4RGNC 1DBKH 1U6AH 3NFSL 3IF1B 1L6XA 2KKQA 4AQ1B 5KVFL 4R97C 4FQ1H 4XMPL 4QCIA 3FOMA 1BIHA 4G5ZL 1JHTB 1J0JA 2OTWA 1A4JB 3CMOL 4MDIB 3CFCH 2P42B 2Q76A 2ICEB 3FQRA 2B5IB 4PRIB 3MLZL 5KJRH 3OR7B 4JFHE 1I4FB 4MCZA 2H8PB 3IU3A 5JHDE 3BGFC 3SDDA 4UBDD 2FLBT 2P8MA 3NZ8A 3SDAD 5I8CA 1F5WA 4PR5B 1BVLB 4NC1E 2GK2A 5IHUL 4U4BA 5EG6C 2NY5C 4HKZB 4XCCH 5JZ7D 5GJTH 2VKWA 3MUJA 4JE4B 4NJAH 1OGTB 5CGYD 3B8SA 3RWCB 3QEQE 1YYMH 5HYEA 4P2CG 1IM9A 1KIPB 3O2WL 4LVNB 4PGBB 3L7FA 1B0RA 5KZCD 2J4WH 4F57L 4HXAH 1I1CA 5C07E 4L8SA 4PTUA 4NNXA 4OD3H 5GGUA 2BOBA 2EYTA 3S5LA 5H35B 4S1DC 4JFFA 4ZAKC 5HYFA 4IRSD 4MGXA 2F54E 4RWYH 2V17H 2Y7QB 2VQ1B 1XGRB 2YD3A 4NOBA 1A02N 3K2UH 1VEMA 1S7QA 4FQLL 2J6EH 2ED9A 4QLRA 2I25N 1UENA 4EKXA 5E4IA 5E6ID 4XC3L 3TIDB 4ZD3L 1AGFB 2L7UA 1CDBA 3C6LD 1TVDA 3GMPB 5LVEA 4NRXB 5DURB 3RNKA 1U8OA 4QEGA 3ARGA 4PUBL 2HH0H 1VGKB 1JE6A 4L5FH 5IBTL 4LASL 3RIFK 5GHWL 4JPWH 1CR9L 3JVGC 4OZFH 4X7SL 1WBXA 1P7KB 4HD9A 3DMMA 2XRAH 1IEHA 4JCMA 5HVFB 1ZKAA 2NYYC 4PIRF 1CLZH 4KFZC 5EOCH 3RUGE 2ZG3A 4GO6B 3RVTD 3BAEH 1BHGA 5GGQL 3WMSA 3OJ2C 3MV7E 5BMFH 5E8NB 5CIPA 1F8TH 1QRKA 3JUYA 5EBWB 2P8PA 2YC1B 5I71C 2WLYA 3BZEA 4GW4B 4JY6B 3PP3H 4YDLC 4HWEH 4P99A 3L7EB 5BW7C 3Q5YA 3ZE2F 2D0FA 4PJHE 1AI1L 4DN3L 4X7EC 2WQRA 1QO3B 4K3DH 4PFEA 1ZEAL 3MFGB 4G5ZH 2P8PB 2YC1A 3BZEB 4ZO9A 4Z76A 2BCKB 3CU1A 3TESA 4Y1AB 1P4IL 5HJ3A 2IAND 1KCUH 2J8UB 5BRZD 5E2TH 3VFTB 2O93L 3W39A 5EFIA 3WHE1 2BK8A 1F4XL 1FFPA 3FB6B 3TO2B 4PRNA 2FYYA 4XVSL 5DMGD 5IT2H 1BZ7A 3T0ED 2FO1A 5HDBE 2FEDD 5F7YC 1IMHC 1MAML 3EYFB 3D87B 3EJJX 2QHRL 5HI3C 4UOJA 5HYQA 3H3PH 3NPZB 2H1PL 2A77H 1FVEB 4PJBB 3BWAA 2R4SH 2H41A 5HYJD 1KV3A 2DWEB 2VISA 1NMAL 4M1GL 5A2IH 4NN5C 3LEVL 4EIZC 1UYWH 2G75B 4E41E 5HGAB 5FGBC 4P2RA 2VDQL 5I1KH 1BLNA 3GSVA 5T1LD 4MWFA 2Y9RT 4Z5RB 3KS0H 3ULVL 4QXUH 3A6CL 4PJ5E 4G6MH 2GT9B 4LHUG 2VDKH 5DHVB 2ADGB 3ZTJG 1KTLA 1RIVH 1XR8B 3QBTB 4ZAKD 3VA6A 1E4KC 2OXHA 2GEEA 5GGVH 1KBGL 3BFOA 5MEOB 2MPAH 4LGSB 4QRUB 3D48R 4XCFH 5FA3B 3VDAA 4ZG1A 2ESVE 2H6PB 2OCFD 3P0YH 2Y5TA 1LE9B 4LSUL 5DK3A 3H3PL 1MWAH 2NY5L 5FGCB 4ZOAA 4DEPC 1M1SA 3MR9B 4KI5C 3H42H 4RFOH 3C6LC 4LHUB 2MQ3A 4R7DB 3SY0A 12E8L 1BREA 2YPLA 1FZKB 1A4JA 1S7QB 4TUOB 4NWTH 3PHOB 3QUML 3HE6C 1FYTD 1CLYH 2YK1L 4KJYA 4Y2DB 5FV1L 3DRTB 3G9VA 4ETYA 2EIBA 2W0PA 1E0OB 3FO1B 4F8QA 3VG9B 5DEGA 2R0LL 3ETBF 1MEXL 5A40E 2IBGA 4X99B 2DOCA 1A1NA 3F7RA 3TNMA 4TSAL 1XGUA 3G6JE 3MLXH 4PB0L 5GJSL 1QR4A 4PJCA 5HDBF 4I9WE 4U7MA 2OI9B 1KJ2A 1DQLH 2DF3A 4X6CA 1LD9A 1I8MB 3MNWB 3NA9H 5DVKA 4NO0D 3WIFA 1KPRA 1Q1JL 1X5ZA 2BSTA 4LKCA 3ROOB 2VXUL 3CXDH 1EXUA 2DI8A 3OKNB 3VXNB 4F7MB 1K5NA 3PGFH 5GGSB 4YHZH 35C8L 1C5DA 3I9GL 1DBJH 1JPSH 1CDYA 2HJLA 4I18C 1ED3B 1QSFE 3PGDB 1ZT7B 2IH1B 2CO6B 5CGTA 2C1PB 2C3XA 4DZBB 3UPRB 4HK3J 5C2BL 4PLKC 2W60B 1WAAF 3GKWH 3T0DA 5D7IA 3QUZC 5DZLA 4Z76B 2EKJA 3S8WA 1MHCB 4HCRL 1CI5A 2I27N 2LE9A 4P23B 4WHCA 3DI3B 3FAXA 4X6EA 3PWVB 5E56A 4X8XA 3L95B 3PWUB 5D7JC 3AAZB 2JCCA 1N3NB 5GS1A 3SE8H 1MI5B 1KLUA 3OHXB 1JPST 3OBAA 2EEAA 3NGBC 3DV6B 2C3VB 3CSGA 4JRYD 2DJSA 2D7NA 4LAJH 5K9OB 2HYMA 3D0VA 1KXVC 3O9WB 1J05A 1BGXL 3RU8H 3QIWA 1QRNB 4CDGC 1WAAE 4H5SA 3SE4C 3UAJC 4HGWB 3OKOA 2DIAA 4X6CF 1QRNE 3LKNB 1AO7B 1J10A 1NGXA 1O7VA 3K8MA 5C3LD 4UQ3B 1FAIH 3L5XH 2VAJA 2A6JA 3TBYB 4K3EL 1RIHH 1DBJL 4GUPA 1YECH 1DUYB 3D9AH 3T2QA 4OF7A 1M7IA 4R9HA 5EZJA 4P59H 1FH5L 1PQZB 3C5SA 1P4IH 4Y19B 1IVLA 2JB5H 5MEQA 4TULL 5MENA 4L4TD 4L4JA 4GUPB 2XKNB 4CMMA 1H8NA 4KROB 3C09B 3TN0C 4O2CA 1FFNB 4HIXL 3RIAF 5A1AA 1DN2A 3D25A 1G7MB 5GRJH 1XGYL 1NMCC 4YZFF 5IFJA 2GUOB 1INDL 3OL2A 4ODHH 2XRAL 4F7CB 3RIFF 1CQKA 4FTVE 4PRPD 4S2SB 2WP3O 1H15A 5CCKH 1MNUH 3IU3B 3PUCA 4OAWA 4PD4J 4M5ZH 1I3RB 3F6LA 4P5KB 3UTZA 2XWBA 1MPAH 1GC1C 2VXUH 5D2LB 4HKZA 2CKBA 1T1XA 3OXRB 2N7AA 3H9SD 3QG7L 1OP5K 3GIVA 3IDXH 4G7YH 1RURL 1TPXC 1TZHA 4KKAD 5CINL 1HKFA 2JB5L 4LU5L 4QYOB 4BQBA 3VE0A 1XF4B 1MCBA 3QCTL 3VGAC 1ZOXA 4PJHA 1KULA 4ZFFA 1I9RL 4NGHH 2PYED 3ZYOA 5J6HA 5JW5A 3VWKC 3MGTA 3HI6H 4KK9D 2JELL 3NFPB 1NCAL 1ES0B 5D2NC 3U2SA 4U0RC 4Z77B 2P8LA 5IQ7L 1CFVL 3F7VA 4GBXC 1CGVA 1WZMA 4H8WC 5DJ8A 3AGVA 5FOJA 1OT1A 5GIRA 3W2DH 3HE7A 4U1SA 1GGTA 4ONFL 2EICA 4NUJB 2JJVA 4DAGL 3U2SB 5ETUA 3GRWH 5DK0A 4PRPE 5DO2C 1EZVX 1ED3A 4G8EB 1TVHB 4JQXC 3TC9A 4LCIH 4FABL 1XGPA 2NXYC 4O2FA 4DTGL 5GIRB 3SDCD 5D1ZB 5L7XL 4OGAD 1G9EA 1MCRA 3KYKL 5J13B 2F5BH 2ZUVA 2H26B 4QF1A 1UB6B 4H1LA 4QO1A 4P2YA 3DUUB 1ZWIB 1F6FB 2Y5TB 5CEXA 4GS7C 5DT1L 3B2UC 5TFSH 1WLHA 3ZZ1A 1Q72L 1CFQA 3P4NA 3VFVB 2L4OA 2X6MA 2DM2A 2QL1A 3OAUH 4NKMB 4LPXA 5EUOA 3QDJB 1IKNC 4KJWD 4NYLA 2NY7L 3NPSC 1DL7H 3SQOH 4IJ3C 3SPVB 5L7XH 3RNQB 5I15L 5IEKB 5CMAA 3E3QE 3GSWB 4QRQB 4FABH 2V7NB 4AH2B 3VXPA 3MLYL 4KMQA 4POZD 3KPSD 3QUZA 3ARBA 3P30L 2CLZA 3GBNH 4M7ZC 2NY0C 2BOCB 4P23A 1DUZB 2XPGA 3UTSA 1DQLL 3CDYA 4FHBD 4LLMA 3SGKA 4I18A 3MYJB 4B7IA 4PGEA 1P2CA 4BZ1L 2B5IC 5E95B 1LO4H 2AJZB 1IAIH 4NBYB 4JLRA 2VMFA 3LKSB 4G43A 3RVUC 1A3RH 4HMCA 1FNFA 3RVVD 2DQEL 4OT1L 3QAZC 1DLHB 2AV1A 4HLZG 3LEXB 2QLVB 4IMLB 1D6VL 2ZSWA 5CJ5A 2COQA 2H3NA 2APTA 4M1CD 2A6KA 5E6ZA 2B39A 4XPHL 3SKJH 1NL0L 2G9HB 4A2LA 1VEPA 1KJ3L 2DQTH 1RMFL 4JRXD 5FM5O 2YBRB 5L2JA 4PJIB 5DVLA 3D85D 3G6JA 4PJDB 4M62L 1H3XA 4UU9A 5SX4H 1QFWL 2QEJA 1N26A 1FHGA 1A4KB 2XZCL 4DW2L 1KCSL 5HYSA 4F58L 3WUZA 3QQ3A 3FQXA 4QHLA 4GKNA 3S97C 1IEBA 3ET9F 4DQOL 3T0XA 2BNQE 5B8CB 1NBVH 3RBSA 3MFFB 5T3ZL 4HIHA 2NPLX 3DYMA 2DLHA 3ROLA 1R24B 1U41A 1N7ML 4HKBB 3J8F7 2F19H 1N0XL 1D5XB 3CH1A 3MLVL 4QHUB 4OIIH 3ZKXC 4N9OB 5IMOA 1IQDA 5DJ0B 4CBPA 3T0EB 4YO0B 3K4AA 4FNLH 3ZO0A 5J9PB 3WFCL 3G5VB 4KI5E 3D3VE 4FQIH 3U4BL 1XCQA 4KKBC 3BWUC 2OXGA 1A7NH 3P3YA 3MRQA 5C0BE 5F7EL 1YPZA 1PZ5B 4KROD 1FO0B 3G04A 1QVOA 4P4KD 2NXZC 2X4RA 4J8RA 4M1DH 4MCYA 1A3LH 3QXUA 5FYKU 1GGYA 1MLCA 4ODUA 3TP4A 2EYSB 3L3JB 5CFHA 4J3XA 1PZ5A 2A0LC 3WFEH 5TH2B 4IRJA 4U1IB 1GZPA 4GAFB 1HHKB 1MCWW 2VB5A 3AREB 1T0MA 4XHQA 3NBNA 3W0WB 1SEBA 4R2GC 2EECA 3BI9X 2ZUQB 1Q1JH 3ELAT 4DVRL 1UG9A 3VRLF 3D39E 2NY2B 4M3JA 5KSBE 2CRMA 5IV2A 4XAWH 4C56D 1A6ZB 3IAGC 2QBWA 3WFCH 1A8JH 5DMKB 4PV8A 3EO1B 5TF1L 5I75C 5EDXA 2OTWB 2X4PA 4P2OA 3EDDA 5F1NB 1A7NL 4BFIA 5INDB 3HLAB 1TTFA 4PLNC 1MCJA 2YA0A 3HZYA 4R26H 1MEXH 2BDNH 2I60L 1M7XA 3LS5H 1BZ7B 2A6IA 1W0WB 1ETZB 3TO4D 2UYLA 4R90L 3S37L 4G7VL 2EDBA 1MCEA 1TZHB 5DC4B 2NXZB 3QDGA 4DCQB 5CSGA 4ELKB 3CAFA 5EUOE 1QUNA 1OY3B 3JWOC 3G5XA 2RAMA 2XZCH 1UACL 4OFIA 4DW2H 1KPVA 1QHOA 4H20H 4MD5B 2D2OA 2HG5A 2NR6D 1O5DT 3GMOB 3BYTA 4MWFB 3ZHLA 4Z7UB 2AK4E 1JRHL 1FZOB 1IGTB 5C0AB 3RUGB 3LEYL 5HD8C 1ZT1B 3EW3B 1N7MH 4WWKC 5FHAH 4RMWA 3E0GA 3T77A 4HUKB 4RAUA 4OLEA 4Y4FC 5CZVH 3FO1A 2AERT 3TNNB 2E7LC 4YDKH 3I75B 1A21A 4YHPA 2HRLA 3KXFE 1WTLA 3GHEH 4L4VB 1IJ9A 4MQXD 4H0GA 2E7CA 1YUHB 2OP4L 5KS9F 3ARSA 3HZVA 3EYQD 4K71C 5CJQL 4MJID 1F11A 5I9QC 3ARWA 3H7BB 2VWEC 3VXOB 4XXCC 3MR9A 4Y88A 5DJ2B 1KNOA 3GMMB 1P2CB 3BQUD 3LKRA 2XTJE 3R8BB 1NDGA 3LB6D 1C16A 1ZLWH 3NN8B 1D9KA 3LQAL 1KJMB 3MBED 5ISZE 1QHPA 1FCGA 5J06A 2HFFB 3V6OC 2VC2H 4GMSH 3MLUH 3RBGA 3MODL 2Y6SD 5DJ2A 2OJZL 4Y16D 1IGJA 2X9XA 4MA3A 3VI4F 1KCLA 3IDMB 4GAYB 4LCWD 1J1OH 2YUVA 3MUGB 3EDEA 3WHXB 2IG2L 4AENA 3BXNA 3G5ZB 4LASH 5D1QA 3QQ4B 4DUVA 2JCCB 5TE7H 5JIKA 1IGJB 4YFDB 1MIEH 2QR0B 1XIWC 4YHML 3V52L 4D9RD 2PW2A 1XGYH 1MRFL 1MCOL 5DQ9B 4S0SD 4AENB 1K8IA 3CC5A 4W6YB 3R06B 3S3SA 1GH7A 3QNZA 4S1RL 4XP9L 2IAMA 1INQA 4Y4KB 4L8CA 3VXRE 1HHKA 2ICWB 3IYLW 5FDWA 4L4TB 4Y5XA 1T0NA 4QRPA 1EAJA 1CICC 3GSXB 2WSKA 4IBLT 3VWKB 5KN5B 4KGLA 4HS8H 1EMTL 1MVUA 3BZ4A 2ENSA 1KIQB 2EC9U 4PP2B 3V8CA 4RAVA 2FH8A 1BM3H 2AQ2A 3H0TA 1MPAL 5IV2B 1YJDH 4K9EL 3S88L 1KIRB 3Q6GH 1RK0A 2AJ3A 3GFUA 4DK6A 2W65B 4MHHI 1MRDH 4QHMB 4Z7NF 1DSFH 4HSQA 4HWBA 3S6CA 4LLUA 4NQEA 4M5YL 4UDUB 3H0TB 1CE6B 4Z7UF 2ATPA 5GGTH 2VWEE 4YBLB 2ZOLB 5HPMB 4LARL 2DQUL 5F1OB 1KB9J 3CFDB 4KJPC 2YSSB 3TJEL 5MP6L 5SWZB 2E9BA 1E4WL 4P9ML 4WU5A 8FABB 4R7NB 1XGQA 3QULA 5DFVD 5EN2A 5C09D 4P4KB 5D2NE 4XAKD 5L2KD 4KQ3H 2HFTA 5HDQH 4XVUD 1KYOJ 1H3UA 2DQHL 3QPQC 2EO9A 4C83B 3BAEL 5BXFA 4URTB 3OF6A 3AXLB 5D1XD 4ZUUA 3QZWA 4UBDC 4Z7UA 2Q76B 4R97B 4U6VL 2FB4H 4HWBH 4PRIA 3U48A 5CP3H 1LDSA 5BS0A 2QADB 2Z35A 4XNYL 5IVZA 1X5KA 4XP1L 4NFBA 4XB8A 4X5XB 2DMBA 5TQ2H 4QHNA 1ZAGA 3S35H 2WW8A 3CFIC 2MCG1 1LEGB 3C6SA 1K2DB 3MRCA 4I77H 2L0DA 5GS3A 4GQ9L 5E94A 2JK5B 3JXAA 4M48L 2FR4A 1AP2A 4KXZI 3MRLB 2X09A 4QHNB 3ULVF 3TVMD 4PS4L 3KPRB 3ZKND 3MYZA 4LNRB 4XP9H 2WWKT 5J8OA 1JGLH 2HT3D 1JZ5A 3VD9A 4OZIB 5DO2D 4KZDH 43CAB 1J18A 4D0DB 5CP3A 4N0CD 4X98A 4GOSA 1JYXA 4I0CC 5I1JL 2FGWL 5GXBB 3QIUB 3P73B 1YMMA 2O26U 3PXJA 2DDQL 1PG7W 2VITB 4MXVE 4YLQT 2R1WB 3KYOA 3SGJC 1XIWA 2UUDH 4P9HC 3IDMA 1YEDA 4L9LA 1P69B 2ADIB 1WJ3A 5CILL 3GJFK 1MFAH 4M4PA 4ZUTA 2P44B 2QADC 3O2DL 3ARRA 3MJ7B 4OM0H 1OM3H 2W60A 1RZGA 4J3TA 5T3XL 5J7CC 2VUYA 3HCVB 4UINL 4DKFH 5ENWB 3VFRA 4I2XE 2RCSL 4MSWB 1JUFB 4J3UA 3RAJH 2Q3ZA 5HHME 4OZFB 2P5EE 4IS6A 1TJIH 3MOBL 1DLFH 1TIUA 1NMCB 1KLUB 4JG1L 2I9TA 3IETA 4BH8A 2CO7B 5B39A 1J11A 4EQ3A 3CPLA 4GAJH 1MHHB 2WNGA 5HHNB 4ZUSB 1ZGLA 3OX8B 5IK3B 35C8H 2XT1B 5MEND 4N1EA 4JO3H 4JN2A 4OCSL 1ZK9A 4I0KA 3SGEI 4JRWA 3O3UN 1U58B 2I24N 1QSEE 5L6YH 4NQSB 3JVGA 2XNAB 1T1WB 4NC2B 1G6VK 2EYSA 1QFUH 5B3NA 5HVWA 5E9DE 4QF1B 1K4DB 1FSKB 3EYSL 5IVXF 3K74B 3IXAA 3W9DB 4E41A 1V3MA 3UXFA 4KK8D 3JV0A 3MBXL 4HFWA 4G9FE 5JXEA 1X5HA 5AWNH 3L3DA 5F7HA 3ARBD 4WU5B 3MUHL 1KG0B 1CDCA 4HK0A 4ZNCD 3QULB 1HHIA 1AKJD 3EKCA 4OZGB 2H45A 3UBXI 4A6YB 4X4YB 3WFZA 1DR9A 2PYFB 5KS9B 2Q8AL 1V7NH 4MQSB 1ZE3C 2DS4A 5D9SA 3AS3A 2NY3C 3BKYH 3VWJA 2VXQH 1QSFD 1MREL 5C7XL 3IDYB 1V7MH 4ZFGL 1N5YH 1PY9A 1KIRA 4UT7H 5ACZB 1AJ7H 2BVYA 1S9VB 2AJ3B 4G3YL 3O4LD 3FQXB 5T1MB 4PJGE 4AL8L 4LLMB 4PJCE 3QG6A 2HAZA 1RVFH 5KTEH 2GTWB 4WHDA 5E1AA 1CLOL 4XMLL 1BFOA 4XX1G 3RWCA 4XCNA 2VDNL 3FO0L 2Z93B 4JLRB 1Y18A 4KK9C 2G2RB 4HWNA 4I3GA 1DTUA 3VWKD 3SDAA 2OZ4A 4U3HA 3C60B 3SDDD 5FUOH 1MCIA 2MNUA 2HTLD 4NNYB 4R3SA 4YHLH 3IFLH 1HXMB 4Z78A 4KRPC 4RRPA 2XA8L 3GHBL 1T0NB 4J3SA 4QRPB 1E4XH 1F4WL 5KVFH 4LEXL 5DRNA 4K2UL 2CH8A 2ZUWA 1OF2A 4FZEH 1ES0A 1OSPH 1LE5A 3G04B 3DPBA 3UTQA 5GPRA 3RZCB 1FGNH 4XAWL 3RHWF 4JZOB 4QXGH 4PJCF 5DRNB 4GG6F 4D9QE 4GRWB 4MD4B 2V2TA 4Y5VA 5DD0H 1B4RA 3KWWA 2BVTA 1SMAA 2ORBH 4XAKE 3U0TA 1ODAA 4FQXA 3I84A 5CIPH 2ZOLA 1NAKH 3LKPB 4HXBH 4XP6L 4NZUL 4HPOH 1FL6A 1D5XA 4O2FB 4LRIA 1KNOB 1EH9A 1J9CT 3TZVC 3Q0HA 3JSSA 4JY4A 5EC1B 1FBIH 1QFHA 4U1MA 2UWEF 2UY7A 1EO7A 2Q8BL 5FM4A 1F58L 2BNQA 3SHSA 3BJLA 2X9WA 2HMID 4HKXA 1SEQH 1D6EA 4OQTA 2R2HB 3LAFA 3WUWA 5L9DH 5DJDA 1OGAD 1VERA 5EC1A 2J5LB 1R3LA 1CFTB 9CGTA 3VGHA 5DQJA 2CMRH 4PJGF 1EO8H 4Z18A 1JPFB 1MSPA 3BKCL 4D3CL 3D3VA 4UILL 4LPCA 1KGCD 4PPTA 5H37G 2P5WB 3DX8A 4NO3B 1OARH 2OZ4H 3K8LA 1KJ3H 4BQ9A 2F15A 1I3VA 5K33A 1G7PB 4ZDHB 1T2XA 1GAFL 1I8LA 2VXQL 4OFYA 4JKPH 1QR1A 1VFBB 1MCDA 4EI6B 4K23H 5E4EC 4HKJA 3AREA 4XPTH 3H7LA 3WL9A 4KUZL 4MJ6A 4WI6A 8CGTA 2NTFA 4LGPB 4YX2H 1YN6A 4WFHD 3LVEA 1IGIL 1QPXA 1SY6A 4XX1E 5FXCH 1CGXA 4Y2DD 2YZ1A 5IM7B 4NRZA 5DI8B 4L3EE 1WUNT 4HGWA 4F3FB 3ZDXE 4RQQA 1G7IA 4PJDF 4LCWE 4G9DB 1IQWL 3QUMB 1YN6B 5CINH 1VACA 2V9QA 1A6WL 4WEUD 4ZUWA 5I8KL 4WFHE 3SE9H 4JN2B 4NM8H 1FO0L 3IU4L 5F89A 5CILH 5FUZH 3DXAD 4HFUL 4X80H 4ACPA 2EH7H 3DX7A 4NQUA 2BX5A 3VI3E 3DYPA 1IBGL 4NZDA 3UP1A 5D7KE 4FFVC 2DKSA 1II4E 2J4WL 3VWJC 4OI7A 5MENB 2YD9A 3OGCB 3D85A 5ICYB 2HG5B 2NY4C 3NIFF 3STBA 2AXHA 4XBEL 5M7QA 5DDHA 3QJFB 1GSMA 3UMTA 1RZJC 1ZEAH 4MA8H 4NN6B 5FKPB 3B5GA 5BXFB 1FYTE 1UB5A 5I16B 4HWZB 2AXGA 5EIIA 5SV3A 4HV8B 2EDHA 3DSFL 1FZJB 2JJUA 4YQXH 4Z0XA 1UM5L 2YPLB 1RULL 1IGFL 1U8OB 3TV3L 4X6BB 3RWGA 1PD6A 1U95B 1GGBL 2NW2B 2R4SL 3G08B 3TBTB 1IKFL 4O58H 4XNMA 4QKXB 3ZTJH 1CXIA 1ND0B 1C12A 3INUL 5ESQA 4L4VA 3KPLB 3O81A 3PHOA 3L3IB 1YC8A 3M45A 2XI9A 4UB0L 3EJYC 5F1KC 3G5VA 3QHZL 4QRRA 4R4NC 3RVTC 2X10A 4JO3L 4KRPD 3CNKA 4PGJA 1U3HA 1G7JB 4XCEA 4LAQH 5IHZA 1AO7D 1FC1A 2R4RL 2XZAL 5E1AB 5D96C 2I60H 5E2WH 4Y4KA 3CFEB 1MJUH 5CJXA 4L8SB 1P5UA 1K85A 3OWEA 5D6CA 5EUKA 4NT6B 1JWSB 5TF1H 3CFKB 3ZSSA 4NKOA 3AC0A 1ADQA 4PJ5D 3J7HA 1X5JA 4MA1C 1J8HE 4YNYB 5HD8D 2EE2A 4N0YH 1JV5A 2RQ8A 3T4YB 1KENH 3HAEA 3KJ6H 2J8UA 3PGDA 3WE6A 1CGWA 3T1FB 4F37F 1JPTH 3FFDA 3HKFA 3UZEA 1EEZB 3GMRA 4NRXA 4MB5A 4NPYA 2CGRH 1FNSH 1RJYB 1F4XH 2E27H 2HJFA 5KVDH 4OF0A 2ARJA 3L1OL 3P4LA 4WI8A 4NO3A 4XPBL 4Z7VB 1LO2L 4LCCA 2W1NA 5D1ZA 5C0IA 4MAYC 3PQYA 3PG2A 5CGYC 3ECBA 4GLRH 5H94A 4RDQG 3SJVB 4HW6A 5K9OA 5F88A 5FK9A 5M94B 4NWTL 2DJUA 1K4CB 2VDNH 3FO0H 4LCCB 4KROC 5HHPB 4APQD 1UH3A 5D96B 4PY8I 3HA0A 5IB2A 3ME0A 2N4IA 4X8JA 4NGHL 5JXEC 1C5BH 1AO7A 1NGXB 3K2UL 3WIIH 2YD1A 1RUML 4OZFG 4YQXL 5IB1A 1I7UB 2BNQB 2Q1EA 5TDOB 1HOCA 1RZKC 3RPIB 1TZIB 5F88B 3O4OB 4TSAH 5FYKE 3MLVH 2OTUA 1Q38A 3VU2A 5FYLD 4RMQA 1E4XI 4UTAL 2XA8H 3GHBH 4JVPA 2X1QA 2BVQB 3HE6B 4JHZA 3W5NA 3GMNA 5ESAA 3TA3B 5B21A 4J3OC 1OTSC 5I30L 3QUYB 1PSKH 1D3CA 1FN4A 4MDIA 4FFVD 1CDHA 5DD6A 3IKCB 2OMBA 3MLUL 5F9JA 5ANME 1N5AB 5ISZA 1A2YB 5E70A 3X3FL 3O6FD 2FHFA 1JPGA 5FHBH 5JNYB 3LOWA 2JCCF 1EDQA 5MENE 2AXGB 5EIIB 5F7FA 2XWJB 1PEWA 5HPOA 2H32H 4NQDE 1ORSB 3MRMA 4WEBL 4F7EB 3RA7L 3K80A 3TH4T 4X5XA 5GS1C 5C07A 1TCMA 4CU6A 5F9OH 4NQEE 2F54D 3P2TA 5L8JB 3PIQA 5DR5L 3UJTL 2NY4B 1OLLA 3H9YA 5BZDA 2B0SL 4K55A 2FR4B 3PWPE 1YMMD 3QDAA 1H0DB 4FQ2H 5EOTB 4KTEH 4G8GA 3LIZH 3QDJE 4RWHA 3WV0A 1FH5H 5GRZA 4ETQA 5FDYA 1CXHA 1JGVH 1BAFL 3FOMB 1VPOH 1AD0B 3D85B 4YHIB 3EOAA 5BVJB 2NY1C 1SMOA 5CBAA 1YECL 4J1UA 5F6IC 1JI2A 5D6DC 3KPSE 3B6SA 1BF8A 1CD8A 3LD8B 1SY6L 2EE6A 4NQED 4PLKD 5CAYB 1AC6A 4R7DA 3H2WA 1X5XA 2CXKA 1IL1A 1ZLSL 4HJGA 2M8XA 3SGDH 1Z9MA 2JF1A 3C60D 1KCUL 1VENA 3ISWA 4ELMB 2UZYB 4UMGA 2SEBB 5F9OL 2WLZA 1YNTA 5IP4A 3U0WL 5GS1B 3WO4B 1YEJL 3F58H 4JRYB 5BJTB 4J8RB 1ZTXL 4JM4H 3BVNA 3RZCC 1T6WA 5I8EA 5IROA 2Z4QA 2X1PA 3B9KC 4RFOL 5K9KB 4ELMA 5T1LA 1MJ7H 1KCRH 4OGAC 1QD0A 3V6OA 1QKZL 5E2WL 1CU4H 4F58H 1ZXQA 2F8XC 3LMJH 1BVKB 1JGUL 2K9UA 1F3JB 1NEZG 3L3OB 2OL3L 3BIKB 2QQNL 1MFDL 3QFDA 4I2XA 3GJEB 2UUDK 4PJ8D 5AYUL 2J88H 1N0XH 1GPOH 3O3DB 3GJFH 4X6DB 5IQ7H 4GRWE 4FQXC 1NGPL 3IDIB 1MELA 1PQZA 3RPIA 1D9KD 3HC0A 5KBNC 3EO1A 1DVFB 4Y5VC 5KW9L 2R15A 1P9MC 4TSCH 3VD7A 3P4MB 4L3AA 4ZUUB 2Y07H 5TJWK 1UCTA 3QXWA 2E7LA 3MRDB 3O4OC 3F7YB 3QDMB 4H1LG 3ARBB 2V9TA 4Q9QH 1FORL 5CWSA 1NEZB 5JHDA 4AYFA 3ILQC 5EBWA 1A14L 1XF2B 1NEUA 2AJZA 3FB8A 3KYAA 3SOBL 5F9JB 5EO1A 3D0VB 3ARGD 1VADA 4OCXH 3QSKB 4ODVL 3SGEH 4DN4H 1NEZA 2E7HA 1U8LA 3MV8E 3A67L 2ZKHH 5E5MA 2IAMD 3I9GH 4HWBL 4JJ5A 5EU4A 3AU1B 3LQZA 3BN3B 3W11C 1H3TA 5IIEA 4KKCD 4KI5F 3CK0H 1CCZA 2R69H 3KPOB 4PRHA 3WLWD 4APQB 3U4EB 3DX7B 2VLME 1NFIB 1AXTL 3MRBB 3KJ6L 4OF3A 2HJFB 3ZKMD 1ZLSH 3QDJD 5KOVC 3GMLA 3SJVD 5GRUL 4RGNE 4Q9QL 5FEBA 3BISA 5JXAL 1AXSB 4WO4D 1AGCB 4GBXB 5C3TA 3VMOA 4F7TA 2ADIA 3AY4A 2VR9A 1F45A 2NY7H 3SQOL 5GGTL 2CJUH 3BE1L 1GHFH 2GUOA 3D2UD 4L4TE 3B8YA 5FOBA 4ZFOB 1Q9LA 1E6OL 3E2HC 2BJMH 5D93C 1ZT4A 2BXYA 1LO5B 4X8JB 2H32B 1RJCA 1ND0A 3P0GB 2A38A 5D71H 3PDDA 4C4KO 1P7QD 4JZOA 3QHFL 4KV5E 5DRZA 3A6BH 1IAKA 3N1FC 1U8PB 4WTZA 1R3KA 1XR9B 4WI2A 1G7PA 4ZDHA 5FO7B 1Q9KB 3L3GB 1I7ZB 3RX7A 3BQUC 3CFBB 4FQCL 1MY7A 4NCDA 5JQ6L 1K9TA 2R2BB 1H3VA 1Z5LB 5EU6B 1WAAA 4XZUB 1SM3H 3BD5A 3DHJA 3V4UL 4YGVB 5JO5A 5FB8B 5D7LB 1F3DJ 2AEIT 3RWEA 4FQ1L 5D7IE 4NDMB 5F6HJ 5HHMB 5HHOA 1Q72H 4OLVL 2Y1VA 4Q0XL 1DBAL 5ERWB 2DJ4A 2RR3A 1CFNA 3RTQD 2LVEA 3BPNC 4ZAKA 3WNLA 1UH4A 4HDIB 4L4TA 3LN4B 1LO0H 2F53A 4Z7OE 1U91B 2XACC 3ULVH 4R96B 3S35L 3FRUA 1SJVA 1S7UA 3BSZL 1ERNA 2D7OA 2NY2D 3F5WB 4XCCL 2P5WA 3DX8B 3WD5H 1YMHB 3IXTB 2BVOA 5E00B 1OT2A 1IL1B 4XPAL 1T1YB 2D3VA 5GGSY 2ZCKL 1UM5H 3F7PC 1JF6A 1FLTX 1DQJA 3QO0A 2F19L 2E9WA 4OCYL 1W0WA 4XP5L 2BC4A 3MLXL 4LCWA 5GRJL 3QDMA 1RZ7L 4N5ED 1PLGH 3U9UB 1ZA3B 4AIXA 1YY8A 5EUOF 3MRNB 2R1XA 2AEPL 4OZIE 1BQHB 1MIEL 5JHDB 3WJJA 2AW2A 1F6LL 4PRIE 4Q2ZB 1TVBA 3GUTA 5F9AC 3IS1X 3PDGA 1UADC 3OAYH 2ESVB 1IAOA 2DLFL 25C8L 2YEZA 1AD9B 4IRJC 5I1AA 3SCMB 4BZ2L 4K3JL 2W0LA 3O6LL 4P4KC 3RWFB 4PG2C 4WTWA 4WWID 4OCYH 4Q97A 2BVPA 1EJ6A 1A6WH 1B6UA 1CT8B 1QFWM 1EZVY 3IGAB 4YUEL 4K3GA 4D0BB 5CMAB 5IUSA 4N0UB 4MXVF 1K8DB 3TEUA 2I5YH 2CRIA 3AAZA 3G5YB 5LG1A 3ZHKA 4JO2H 5E2VL 2Q7NA 1T4KA 2FECL 3A6BL 1CG9B 4JHAL 1T7WA 2LVCA 5D6CB 2A0LD 25C8H 3EIFA 5T1LB 4PG9B 5C92A 1P4BH 5IBUB 4RMTA 2DTSA 3TN0D 5KSUA 2Z8SA 3QO1B 4P2RE 3RVXD 3RWGB 1UFUA 3D3VD 1A1MA 3GJFB 3OKEB 3P40A 1HIML 1RHFA 1N8ZA 4NP4L 2ZP0T 4WHTA 1JMXA 3TF7C 4XNUH 1JRHH 2WQ8A 4E41D 5GZNC 4W6WB 1XF5A 5DK2B 4CAGA 4DKAA 1HWGB 1YQ2A 4PV9B 4J3VA 1AGFA 5CD5C 7FABH 1FFNA 2DBLL 4ZYKB 3EBAA 1FG9C 4ZSOA 3SO3C 1WCBB 5BV7C 3EFFB 3S98A 4P46A 2FWOA 1IC5H 3QXDB 4ODTH 5I0DA 4K7PY 3MCKA 2R4RH 2XZAH 4YHIA 2W92A 1YNKH 3MRKA 5D72L 4HIHB 1S7WA 4N8PA 1M05B 5DRXB 5D93B 4UNUA 3T0EE 1AGCA 4GBXA 4JKKA 4X7FC 5EA0L 1PG7L 3CLEL 5JLZB 4JM2B 5E99L 3WXWH 5DA0B 1GHFL 1ZLWK 2CLVB 1OTTC 2CKBH 1FE8H 1AR1D 4FQHA 3OKKB 2IQ9H 4LGRB 5KSAC 3VWKA 3Q3GB 4ZFOA 2GQHA 2EXYC 4HUXA 1F00I 2JCCE 4YDJA 1CYGA 4G6JL 1EUTA 4XRCA 1HYRC 3ZKSD 1EO8L 1RUPH 5E2JA 1X5YA 1XH3A 1YMHA 2JIXB 2LTQC 3IXTA 3EDFA 5BMFL 4EUPB 2E8ZA 4ELKA 1W8OA 1FN4B 3DUHA 4NIKB 1VCAA 2KZ1B 2F74A 4I4WA 3UO1H 1U3JA 1MQKL 2CUIA 1N5AA 3QCTH 5ISZB 4DQOH 1SYVA 4H20L 3DX6B 2HT2D 4YXHH 1JN6B 1J8HA 1KGCE 4ZFZB 1EV2E 3A0OA 2IQAB 5TF0A 4WRLA 5JO5B 4PRNB 3H9SA 4YX2L 3M8OL 3WNNA 1XCTB 1AGEA 1XZ0A 4M8VA 3GMQB 3MNZB 4Y4FD 1AFVL 3R4DA 1HOCB 1SHMA 4OLXL 1WZLA 4U0RB 3VXPB 5ERWA 1F6AA 4EI5C 4ZQKA 5I74C 3IFPA 3N1PC 1CF8L 2ESVA 4ZFZA 4DZ8A 2VSDA 5JIIA 3I3DA 5DSCA 2QV2A 4HX1A 3VCLA 4PR5A 3VD3A 1LP9B 2A83B 4JPIA 2DL9A 4HQQH 4PJ9C 1OWWA 5IGXL 1LDPH 2ILLA 4GFTB 4OCSH 4JFQA 1O0VA 1K8DA 1AKJA 3V4UH 2IWGA 4Z7UE 5C0RL 1U8IA 1FNSL 4G6KH 2VXSH 4M6NH 1A2YA 3I6KB 1QFPA 2Y7QA 5I1LB 1QOKA 3MJGX 1MUJA 1BGXH 5DUBB 5JZ7C 3SE4A 5D2NA 3FQNB 2APVA 4RMRA 4GMSL 3UEZA 5EUOB 5DZOA 1FL3B 2IADB 3SDAC 4MJ5B 5KSBA 4DOHB 3SKUD 4UUJA 4MYWB 4NRYA 2APWA 4LSRH 3RVWD 4XPBH 4HCRH 3WS3A 1KC5L 1FRGH 3LDBB 4S1DD 3BZDA 1FL3A 3ROLB 5TE7L 2VXSL 2LABA 4M6NL 4HQQL 3GMLB 4HZAA 2P49B 4X9HA 1Q0XL 1YUHA 1DQJB 2FD6L 4MNHB 1M71A 5HYJB 1MJJA 1G6RA 5L88L 1SJXA 3G6DH 3D39B 2IAMB 5JA8B 1U36A 3OTTA 3DTXA 3O4LE 5H2BA 1JFQH 4KJQC 4UOW1 4AIZB 4LSRL 3AB0B 4AK1A 1U8NB 1AFVH 1FSKC 1G9MH 1T5XB 2DQCH 5I8KH 3KLHD 1KJ2B 4JY6A 3DETD 3KPQA 4JFYB 1MHHA 2LU3A 3TYFB 1FPTH 5IVNA 1CIUA 2PF6A 3JV5A 3DROA 4U6HB 1CLOH 4XMLH 5ILTH 3FN3A 4FTVD 3P11H 3CK0L 3UCRA 4K7PX 2PCPB 4DN4L 4PJBF 3QEGH 4NHCH 4J2XA 1F4WH 5TH2A 3SDXF 4PYHA 4G9FD 2ITCB 5AD0A 3UX9B 3A6OA 3PGCA 2CK0L 2X4SA 3T2PA 1PZUB 3HC4H 1IKFH 1JHTA 2GITB 4WFEE 4R0LC 1M7DB 1HZHL 4WV1C 3UC0L 2GJ6E 2NY6B 3EFDH 3WJLC 4W4OA 5B39G 3U36B 1ZS8A 3ZMRA 3ZYZA 2C5DC 1T83C 1UM6L 3HTLX 3WCYA 2NYYD 5D7JD 2YMXH 4FQLH 4OF8A 4ODSL 4YR6A 1NANI 4KC3B 5E5MB 4X4YA 3S36L 3X3GL 3ARYA 1J05B 2V9RA 1ETZA 2KQNA 2QSVA 4PB9L 4RCAA 5CZKA 5E08L 2AGJH 2KPNA 1QVOB 2OI9C 1JIBA 2Z0BA 4G9DA 1A7QH 3V6ZA 5E8OA 5HHMD 3SO3B 5ELIA 2E6QA 2BVEA 3L3JA 5CLTA 5E94B 2YD8A 5E6IB 2XICA 4LKXA 3VXRD 1BIIB 1JPTL 3PV6A 1W72H 4NSKB 2YWYA 4N0FA 1BWWA 4HS8L 3DO7A 3QXDA 1JGLL 4I0PA 2XG4A 4H25A 4Y2OA 1OTSD 4R7NA 1OAQH 2Z8VC 4LKXB 1T7ZA 3MGOA 1OAZL 5F93C 4H0HB 4XNXH 3VW3L 4KUZH 1LEKA 1A47A 4F37K 3RUGF 4XCYB 5LXGH 1OAXL 1ACZA 3RRQA 3OAUL 3QJHA 3C5ZB 4LSQL 1VA9A 2EEBA 3MBEC 3NH7H 4HUVB 4NM4H 3HZVB 1U92A 5BVJA 3VFMA 4LL9A 5F21B 1I8LC 5MEPA 4RGNB 2AEQH 3QEQA 3CDFA 1KT2B 3VXSA 1BFSA 3W2DL 2R39A 4WO4B 4K3HA 3P9LA 5AWNL 4FQJH 3H9HB 4N5UA 4QNPE 1DBBH 1JHLL 2BSSA 4GAGL 4X99A 2Z8WC 3KWWB 3CUPA 1D5IL 5IOPB 3LQAC 4GKZB 3GO1L 2DLIA 4S1RH 1YNTB 1Y0LB 2VLLA 1WEJL 5IEHA 1VESA 4F9PA 1HYSC 3QEUB 2DQTL 4U1HB 5DUPH 4NQXB 4RWYL 1KJVB 3LN4A 1TCRB 4A6YL 1BQLL 4WWKD 1CXEA 3FTGB 4XXCA 4HUUA 4LHUA 1K5NB 3EO9H 5I18H 1LK3H 4EVNA 4WV1A 4JQIL 3IFLL 2VL5B 3QUXD 5FO9B 1S9WA 4WW2C 5BS0E 2EDTA 3OB0H 1FAIL 1KELL 1UWGH 4PUBH 1K8IB 1OGAB 4NZTH 4Y5YA 4G42A 3BD3A 4D0CA 2FIKB 2CPCA 1ITBB 4X6DE 5C2UB 5FHBL 2X4QA 5HHOB 1B88A 2Z91B 1E4XL 4M48H 1R5VA 4QRTB 1UM4L 3U82B 3VD5A 4BUGA 4GRWH 3R0NA 5DRWA 3H8NA 1ZS8B 2FEDC 4CW1A 5JW4N 3NCBB 1I8MA 1HHGA 4FQHB 1EPFA 1JHKH 2VLRE 3UJJL 2IFFL 4OD3L 5D9SB 1NFKA 2OR9H 4M00A 1UH2A 3MOAH 1NAMA 2DD8L 3HB3D 4V1DA 1IARB 5I17A 3C8KB 1G1YA 1MHPH 3ULUL 3QFJA 3BD4A 4Z95H 3C09C 3TN0B 5SWZA 4QY8B 4UIMA 2OJEB 1ZANH 4OLUL 3FO2A 1FFPB 4KGJA 3TCLB 1L0YA 2NZ9D 4ONGL 2ENYA 2F9BT 3DX9B 4MMXC 4JDZB 4GAGH 4HS6A 1I1YA 4I4WB 4P2OC 4Y8AA 2ZNWA 3CGTA 1MCNA 1E4JA 3BESR 3QG7H 1T21A 3B43A 3KDMA 4TRPL 2MQ0A 4R3SB 5ICYA 5HBBA 1YEHL 4ZTPL 4E41B 3L1OH 4OZHB 1TLKA 5BW7A 2CSPA 4KDWA 1EVTC 1A1MB 4FFYH 3DLQR 5TFSL 3IAPA 4PP2A 1N2RA 1NCDL 5AZEL 1FPTL 1YNKL 5D72H 5I19H 4CMHC 1K6QH 3O41A 1MLBA 4G43B 3VGFA 1MHEB 4HX1B 5C0BD 3GM8A 3OXRA 4XVJH 4MD0B 3BDYH 4PJIF 3VH8G 2V7HA 1KSRA 3PDOB 2Q20A 4A6YH 4I48A 4D9LL 4YXKH 1U3YA 2JK5A 1REIA 1C12B 4X4ZA 3TPKA 3TYGL 5T1DH 2YPLD 3CXHK 5DD3L 4S1QH 5L0QB 1I1FB 3BUYA 5IW1A 5KG9A 1EHLH 4UAOC 4DGYL 3C08L 1BQUA 4Z7WF 1BEYH 2BY2A 4H88L 3OKNA 4MAUH 2GITA 5HDOA 1BFTA 2PR4H 3TH3T 4UNTA 4PJDA 1WITA 1UJ3C 4ODWB 1XMWA 1P7QB 2FNBA 3O6MH 4IOSD 2YPLE 1GZPB 4NWUH 3SEPA 2IEPA 3MGTB 2IBZY 1HILA 1QACA 4RISH 2IADA 1QNZH 3L5XL 5T5FH 1HXMA 5IFHH 4U1SB 4Z8FH 5LAXB 2WUCL 1YJDL 4U1JB 3NZHH 3FN0L 2P5EA 3TZVB 1J88A 5I6XC 5DVMA 3I50L 3U1SL 1OAXH 4XRCB 4XWOD 4UT9H 3WNMA 3DNKA 4ODVH 5DF0A 4LVOB 1FDLH 3KLDA 1OPGH 2AI0L 2CKNA 2PW1A 5F7MC 5BV7B 1OARL 2OZ4L 1MH5B 2CKBB 2HMIC 2F8OA 1H8SA 4ONHA 1FZMA 2H2SC 1S7UB 3MO1A 1MHPL 5E7FA 5HHQB 4GW5B 1M71B 5HYJA 3IDUA 3OKOB 2NQCA 5D1XA 1F3DH 4P59L 4PJ7F 3N1GC 5H2BB 2IMMA 3LN5A 2CDFA 4OT1H 4K8RD 1A7BA 3VMNA 1UEYA 2BXZA 2Z31D 2VO5A 2A9NH 3IRZA 3EOBB 1WCQA 2F54B 2HJKB 3DGGA 1N6QL 4NJAL 5EZLB 1KJVA 4KK6C 3WFBL 3BE1H 5I1GL 3S35X 5HHXL 3VFWA 3B2UD 3DRQB 2ORBL 5C0GB 3SPVA 2X2YA 5E8EA 3EAKA 3LEYH 1MCPH 3PF2A 3RKPA 3NCCB 1GC1H 1FGNL 1P9MA 1G7QB 3C08H 1EBAA 2IMNA 3WS6A 2FD6H 3RWFA 5HI4D 5ICXA 3ZKXB 5EZOH 1SBSL 4OZGA 4YXKL 1MIML 3WXVH 2HFEA 5GS0C 4H5SB 3VXOA 4WGVB 1MCHA 4KHTL 4UZGA 3BP4B 5B39B 4RZCB 1NCWH 1MJ8H 2XZQL 3SDCB 4AM0A 5I73C 1J5OL 1TMCB 4DZ8B