4O9HH

Structure of interleukin-6 in complex with a camelid fab fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
200
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYRMYWVRQPPGKGLEWVSAISAGGGSTYYGDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCANRAGWGMGDYWGQGTQVTVSSASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNGVHTFPAVLQSSGLYSLSSVVTTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-6
publication title Combining residues of naturally-occurring Camelid somatic affinity variants yields ultra-potent human therapeutic IL-6 antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 200
sequence length 220
ec nomenclature
pdb deposition date 2014-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hH01
4M7LL 3FB8B 3O9WA 3IDUA 1CG9B 3OKNA 4JFDD 1G7LB 2DYPB 2OJEA 1ZS8B 5J56B 1EAJA 1XF4A 3IF1B 1KXQE 4F7MB 1CE6A 3G5XB 5FYLL 2HJFA 1IARB 1BBDH 4YGAB 2O93L 2PN5A 2HT2D 3IDMB 5KW9H 1G7QA 5F70A 4YE4L 1L9NA 1BVLB 3OKKB 4OFIA 4EDWH 3KYKL 3L9RA 2E7HA 5GRYA 3FFCE 2DQCL 3V5KB 3DXAE 4M6AA 2Y06H 1HH9A 1ZWIB 3LH2L 4FXGA 4XWGL 2R23A 2W07A 5ISZE 1UCBH 1A7NH 2ZCLH 4ODWB 3TN0C 1IKFL 2Y07H 2DLHA 4BM7A 3SO3C 1FZKA 1ZT7A 3UTZA 5EO0A 3SJVE 4M8QA 5DTFB 2FR4A 4UT6L 5FYKU 3RIAK 2BMKB 3E8UH 4JG1L 3UYPA 3V6FA 1HWHB 1IGFH 4JZJA 4Q9RL 3GZKA 7CGTA 3VFPA 2FZ3B 2XPGB 4P2YA 3OSKA 3RAJL 1AXTH 2YA1A 4YC2C 5C0BD 3QIBB 2JK5A 1FNFA 4QYOB 3MRCB 1QLEH 1CU4L 3BAEL 2N7AA 4LOUD 5LCVH 4JVPA 2BNUA 2HMID 4CRPA 3RGVD 4NUJB 3KYNA 3HAEG 1PX3A 3ET9F 1A4KB 1J86A 1E6JL 2H1PL 3IDJB 5DO2D 1HE7A 3EZJB 3MV9D 1BAFH 3BWAA 4X98A 1FLTX 4L8CB 1ZLUK 3L5XH 1WBZA 5GQBA 2XA8H 4NRZB 3WSQL 2DOCA 1V3MA 1HSAA 1NAKH 3QUYC 1KJMB 5IMLB 3KDMB 1T83C 3VI3F 3IKKA 3LAFA 2O5XL 4KUZH 2I5YL 1MHCB 3JUZA 1WJ3A 2VLJB 1MH5B 5HGHA 2OL3A 1QNZH 3DGCR 5FUCC 5IW6B 4XZUA 3AREC 2ADIA 3QUXB 4FQJL 1YJDC 3BGFC 2HJKA 2BNQD 5D1ZB 4RZCA 5E2JA 4C55A 3MODH 3TWCH 5DYOA 4ALAH 2VXVH 5FM4A 1JVKA 2RBLA 2VABB 4N90E 3BSZL 4G9DB 1JYWA 1N64L 1OTTD 1K8IA 2DS4A 4FQXA 3VFOA 3GO1H 3H2WA 3UDWA 3V4PH 1DQDH 1DBAH 4PJDF 2FX7L 2F54D 3NCMA 2ZNXA 1JPFB 3L3HB 1XF2A 5IOPB 1G7HA 4NCDA 4OIAA 3B9EA 4L5FL 4MZ2A 5L88H 1HH6B 4BUHA 1AP2B 2Z31D 1VGKA 3CSYB 4FQQA 5KJRH 2CKBL 4PG9B 1Q9WB 5KS9F 1U58A 1EK3A 4O2CA 2BJML 3C5JB 5ECJE 1A22B 3DVGB 3ZYZA 3IDXH 2C3VA 1A4JB 2QADB 5KZCB 1F8TH 3AU1B 4IDLA 4Y4KB 2C4FU 4PJ8C 2BX5A 5GGQH 4J12A 4OBRA 3FHAA 1XIWC 5IHUL 3VJ6B 4G6JH 4Y1AB 2RQ8A 5EU5B 1HWGB 2EEAA 1QEWB 3AUVA 3LKNA 2IFGA 3ARFC 5BZDA 4Z78A 1CGYA 2VLRE 4YFLF 1KJ3H 3FQWB 2XWTA 4BQ8A 3GDBA 1MRFH 4M93B 1NPUA 3MREB 3MJ8B 4TSBL 1U93B 2CDGA 3OKOA 2XG4A 3WN5C 1J1XL 2NX5A 3NCFB 1G9ML 1NUGA 1HHJB 4PLJD 4JN2A 5IVXF 3OXSB 3DV4A 2V2WB 5CILL 2BSED 1AJ7H 5ACZB 2VKWA 3D69A 5L0QC 2VLKE 4G3YH 1JGLL 2FEDD 4OQTH 4EEEA 2ESVE 2P7TA 2J5LB 3N1GC 4HPOL 3MOBL 4U6TA 5J12B 1W0WA 2V5MA 1J8HA 4PB0H 1T2JA 1A0QH 3L95B 5T3ZL 1QO3A 1D5MB 4WNQB 1I4FA 4S2SB 4K94H 5KVEL 5FCSH 1UVQA 3DIFA 4MS8C 4QRPD 5FDWB 3QQ3B 3WKNA 3MXWH 4WDIA 5IKCB 3X14B 2JJUA 2E27L 2EXYC 2UYLA 4WWKD 2KZWA 3T1FB 4ZUWA 4JY5L 3MCLH 4PJDB 5FM5M 3HZYA 2EE9A 2K3TA 2HVJA 2RB8A 3IXTB 3L5HA 2PUQT 3TZVC 4H1LH 4OCNC 2UZXB 2BOCA 5TDPA 4ELKB 3OTTA 1UXWA 4PJHA 2IALA 4FNLL 4YHML 3F58H 3LCYA 3HC4L 2IBZX 4C56E 1ITBB 3ZYIA 1A9BB 1OAKL 5KS9B 2CGRL 3KXFD 3O2DH 5TH2A 4XCYB 4U1JA 3D2UA 2EDXA 1LK2B 4NQSA 2A6JB 5IEKB 2AQ1A 3HZKA 4P4KD 4KWUA 3GRWA 5FM5O 3GBLA 3BXNB 1QSFD 2WAHA 1T04A 4K23L 5FA4A 4UQ2B 4X9IA 3W9EA 2YXFA 2IAND 5DRXA 2ZZUT 4G8GB 4PJGA 4D9QD 3VWKD 3STLA 1P84J 1SEQL 4G8FA 3SCMD 5I76A 1IM9D 2X4OB 1DDHA 3OPZL 3BEVB 3W82A 4F57L 5I8KL 4MLIA 4CMMB 1P6FA 3CFKB 3PWUB 4OKDA 4HBQA 4K55A 5I73C 2ADGB 1OF2B 1QFUL 1JTOA 5IVXB 1IZJA 4FP8L 4OCSH 5C0ND 4N9GA 4U6XB 3EZ8A 5AD0B 4LLQB 2QSTA 3HN3A 3HG1B 1JN6B 3KYKH 4OZHE 4PJ7E 2YZ1A 3D85A 4OLXL 4OLWL 4FZ8L 4ONOA 4PJ5E 5C0IB 4HIIA 1UM6L 1D5XA 1S7RB 3IU4L 5CD5C 3UJTL 1IKFH 1XGQB 1IQWL 1FL3A 2VH5L 1SJEB 5BCAA 2FL5A 4ZFOL 4B0MM 3VFNB 2PTTB 1HN1A 1TZHA 1HIML 1I3RA 1SMOA 4OB5H 1OP3H 4RNRB 5C0AE 4JG1H 2BNRE 3K2UL 4KI1A 1TJGH 2D7NA 2CRIA 1KGCD 1O7SA 1U0QA 4D9LH 3L5JA 5HYFA 5EBLB 1XF5A 3KPSB 2UVEA 3T77B 1JGUH 3MA7A 2VXSL 4UIMB 4GW4A 1YECH 1MSPA 3DROA 4JFQB 3DVFA 4RMUA 3X3GH 4FQLH 3AXLA 5LXGH 2V2TA 1KN2H 2HLFC 2IAMD 1X4YA 4KHXL 4MXVF 1I7UB 1E6JH 1MI5D 1F4XL 4P3WA 1ZLVH 5D7JC 5FYKD 2I9LA 3EO0B 1LNUB 5SWSB 3Q6GL 2YC1A 5ESQB 1L9MA 3FN9A 3AY4A 5C0EA 4JFFA 1JUFA 12E8L 2XWBB 3U30B 4PUBL 3U9UB 3L6FA 2MCPH 4H5SA 3HCVB 3QPQD 3QDMD 3FOLA 4RFOL 1YPZF 4HLZG 3EOYG 1JWUA 1YMMD 3E6HB 1ETZB 1DBML 4FA8A 4OV5A 3ARGD 3F5WA 3WKMH 1G6RB 3N0PB 1NAMB 1J12A 3FQTA 4G6AC 1AI1L 8CGTA 3HUJF 3SE9H 3TBWA 3MJGX 1JI1A 2A83A 3JWOH 3PGCA 5EU3A 2X6MA 2HT2C 1IMHC 4HULB 1C1EL 5DMIH 2DLTA 3VCLB 2H45A 1FFPB 3PABA 2D3VA 3W2DL 1V8HA 5DURB 1AXSB 5ICYB 2XFXA 4G8EA 3FOMB 4K3EL 4JR9H 4I1NB 3MACH 1AGEA 5J4MA 2ADJA 4L5FH 2G2RB 4LNRB 4N5ED 3PWPB 1WWCA 2D0FA 4G43A 1YNTB 1IGMH 3W9DA 5K9JL 1QSVA 5TDOB 1OPGH 1ORSB 2EC9T 4Y2DB 5JHLL 4Z8FL 3MRFA 5GGTH 2YPLD 3OKEA 3CMOL 4W68A 1ROWA 5ADPL 1BZ7A 3I6GA 2VDOH 5C07B 4XCNA 2CDEA 5EZIL 2VL4A 1CGSL 2ENSA 3KS0J 1W72L 2A77L 5E9DE 5HGBB 5IHUH 4QRRA 3S5LB 4LOUC 2CDFB 1NGXB 1KT2A 3FONA 5IV2B 5CJ8A 2HMIC 3RGVC 2WWKO 2I07A 3WFHA 5A3ID 4OLYH 4U1HB 4EI5D 1BQHA 1OQXA 5C9JB 4Y4HD 5DO2C 1FSKB 3UTSA 2J88H 3LDBC 5EWIL 4TSBH 1YMHB 2DB8A 5J89A 3G5YA 1G9MH 3QIWA 5GHWL 3RWHB 3WBDA 3BUYA 4PY8I 1UJ3C 2H9GB 3U48A 1U8KA 5I17A 3L3GB 3MCKB 2YD9A 3PIQB 5CILH 1NFKA 3KNBA 3CX2A 2J12B 1YPZB 4J3VA 2CIKA 1JGLH 1QLFA 2BVPB 2G60L 4OD1L 3TT1L 3KPQB 1FYHB 7FABL 5JOPD 4WO4D 4LPVA 1CQKA 5D6CA 3WLBB 1PY4A 5HGAB 4FQCH 3DV6B 1GIGH 3L5WA 3HUJB 4GMSL 4L9DA 2XZAL 1A3LH 3ILQD 1L0XA 2VWEE 4WV1B 4R26L 3RZCA 3AVEA 4NO2B 1TXKA 5SX4I 2JB5L 3RA7H 4KH2A 1DP0A 1NBZA 1NANI 1MJ7H 4X4ME 4RAVB 4OD2A 4CKVX 1FVEB 1WAAE 5BRZD 1RZGA 4JY5H 1CTNA 2I9TA 1BWWA 4LMQE 4OI8A 4P46A 3GSQA 1A6UL 4P2RA 4HBCH 2X4UA 4JRXA 4V1DE 5F9OL 4I4WA 1OTTC 3RY6C 4HUVA 4RGMC 4HKBA 1NCNA 1UGNA 3HC4H 4RQQB 5HYSB 3B5GA 2H2SD 4N0FA 3JWDL 1MIML 5EIIA 3P0YH 4KVNH 3C08H 4NO3B 1OARH 4M43L 4YHOL 2Z31C 4QHLB 4R96A 4ZG1A 4ORGB 2XWJA 3I3EA 3QJHB 2Z91A 3AFLA 2VDPL 1N5AA 2ZOKB 5CP3H 1EMTL 4PJCF 1I85A 1PD6A 3SKOA 3SPVB 1F3DH 1S5HB 3Q1SH 4HLZH 32C2B 4PJIE 1H5BA 1D9KB 4FFZL 5DMYA 5ALBH 1UWXK 3CH1B 1DLFL 3VXME 2Y23A 1DBKL 4HH9B 1FO0L 5I8KH 3O6LL 4DAGH 1A14H 3KLSA 2P24B 1INQB 1ZAGA 3LQZA 1CGWA 1XR9A 1VKXA 1SEBA 4YBHA 4K07A 4NRYA 8FABA 1QFUH 4MDJB 1OB1A 2VN7A 4FP8H 4LHUB 4IMKC 1QVOB 2FX8L 2AV1B 2JIXD 3TC9A 3O4OB 3ILPB 4LNVA 4FQPA 4O9HL 4PD4K 4OLXH 1W8NA 4FZ8H 5FYLE 3MBXH 4PLJC 1UB5A 2EYTA 2AJVH 2R4SL 1ZANL 4K7PY 3CJJA 3HC3L 2GTZA 2FRGP 2VH5H 2FEDC 3RX7A 3BFOA 4HIHA 5EG6C 1M71A 5CJOH 5GS1B 3WUWB 3K2UH 1MY5A 4IDJH 3MRNA 3UBXB 5K9OA 4S1DC 1Q94A 3H3KA 5HPMB 2FSEA 5MENB 2FJGA 4ZO7A 3K4DA 3IU3B 2CK2A 3QAZC 3CZFB 4Q2ZB 1YDPA 1F00I 4RGNE 3NGBB 3QSKB 3OKLB 2WUBL 3TYFB 4DVRH 2C5DC 3MX0A 4PGZA 1EXUA 3SKMB 1XGTB 2Q7NA 4KDTA 4QRTA 3LY6A 2DDQH 4WWKC 1JF1A 1MRCH 3NTCL 3RWGA 2MTPA 4L8DB 1DTUA 1HOCB 4EDXB 1IGCH 3C8HA 1EHAA 3U9PH 4QHNA 5AWNH 3QRGH 4ZXBA 1ZLUH 3QXDB 1EHXA 4Q9QH 3B2VL 3TIEB 4JDTL 3D39B 3MMEB 4JLRA 3T3MF 2RCSL 5SX4H 1C08A 4PJCB 1A6VH 5C3LD 4JO2L 1NCAH 5FYJH 3HB3D 3LKOA 2AJZB 4J3WA 1S7UB 3LN4A 4U6YA 3FQUA 4GAJL 4P4KC 4BH7B 4Y7MA 3WIHL 3B9KA 5C2UB 3MUHL 5I2IA 1VENA 1RJCA 2J4WL 5HBBA 4RFOH 3VWKC 2AERT 3SCMC 1KTDB 3UTPD 3SY0A 1WICA 4YDJB 1OT1A 3HR6A 1MCNA 4HWNA 5GPRA 4MWFA 5FB8A 4GAYB 2EDLA 3ZT7A 3K3QA 2NCMA 3QEQA 1MCRA 5FF6A 4E41B 3VXUE 3MRDA 1X7QB 3DWTA 3OAZK 5D1XA 1K6QL 1R3KA 5D7KE 1JPSL 1YUHA 4LK4A 2A0LC 3PL6A 3QHFL 1AQKL 4Y4FD 4PBXA 5C0NC 3MUGA 5C0CB 4LCIL 4R8WH 3W2DH 2W0FB 4HHAA 4A6YL 3T65A 5DUMH 1WBYB 4JCMA 3G6JA 1YJDL 5D70H 3UPRA 3ALWA 3CDCA 2PYEA 3HRZB 5MEQA 4IMLB 5CZVH 1T21B 1P84K 4MNHB 4ZS7L 5K9JH 2NY2B 2O5YH 1U8NA 1T03H 2EKSA 4N8CL 3BHBA 3TVMD 5BVJB 3BYTA 1E4XI 1DBBH 4JM2B 1C5BL 2XY2A 3CMOH 4Z9KB 2DD8L 1IGYB 1U2CA 1WFNA 5HDBE 3QULB 1K2DA 3MGTA 4QLRA 4NP4H 2FB4H 3WEXA 4AQOA 1CGSH 2YPKA 1G7PB 2PR4L 2GSGA 3QHTC 5CP7B 1DCLA 4JREC 5C7XH 3O3EB 4FFYL 3EYFA 2IAMC 2RJMA 3OJDB 4BFBD 4OFDA 4U3HA 1EH9A 4ZUVB 1N2RB 1XCQB 5BV7H 5IMOB 3P4LA 3ARWA 5H94B 4XWOD 5EWIH 4XBGB 1P7QB 2EYRB 4NKQB 1HHKA 3TCXA 3QI9A 1NCBL 2AK4E 3O11B 2MKWA 3TNNA 1K3IA 1YN6A 1XGUB 4WRLA 2H32H 5SV4A 2MMXA 4L4VD 5D7LE 4NQVB 1U3HD 1CLZH 1GZPA 4NFCA 4OD1H 1VPOL 3TT1H 5HYJB 5JPMB 1I8KA 3UTZB 1NCUA 1QSEA 4KK5D 4M48L 3ULUL 3QPQC 3VMPA 4XMLL 2J1KA 5EU4B 5C0FB 1ONQA 3LD8B 4DCQA 4JHWL 4R26H 3CDFA 4D94A 2V7NA 4TOYL 3DPBA 5J1AA 4ZO6A 3ARGC 3ULVH 4X9FA 3OXRA 5EO9A 1SBBA 2IH3A 1M7XA 1I1CA 4F2MB 1JNLL 1NCDH 2IG2H 4BSVA 5T3ZE 1B4JH 1MFEH 3L7EB 5T1KB 4ACPA 2X05A 5E5UB 3BPLC 1A6UH 1RUAL 2GSIB 3V5HB 4P2OA 4LSTH 3STZB 5F9OH 4XNMA 3IFPA 3SGKC 1RJLA 5E08H 4BQCA 3UJJH 1DLHA 3V4VH 4HKZA 5IHBA 4OKVA 4FQXD 1S9YB 4CW1B 5BW7C 2YOCA 1OT2A 2Q8AH 1PEZA 3SDAB 5A43C 2P5WA 2VXUL 1ERNA 3JWDH 5CUSL 3D3VE 3TBVA 3PQYA 1I9RH 3QDJB 3C2AH 4P23B 1R3HA 3MNZA 4R0LB 5D1QA 5EU6D 4M43H 5T33L 4XVTL 4B7IA 1U6AL 4C4KO 3HMXL 2VR5A 5JHDD 4G7YL 3SE3A 3GMLA 3C09B 4HK3N 2ZUYA 1T7YA 1EMTH 4H1LB 4EUPA 5F3BA 4JKMA 4ONHA 5B8CA 4FFZH 1QPPA 1TENA 4P49A 1ZHBB 3U46B 1I3GL 2HFFA 3G04B 1YEJH 5C08E 1IL1A 1DLFH 2L7UA 3HZVB 2HFEB 1FO0H 3CK0L 2CQVA 1UYWL 4G9FE 4ETQB 1VFBB 1Z5LB 5IB2A 4XRCB 2FX9L 5FV1L 5A3IC 5EPMB 2AP2A 4RMVA 3CSGA 1E4XH 2FX8H 4GKSA 3VWJA 4PJBE 4EI5C 1CD0A 4UTBL 4NT6A 2Q6WB 1KJ2H 4Y4HC 1SY6H 4MNGA 4O9HH 1G7JB 4X6DF 1FG2A 1YY8A 2CLRA 4NQDA 4DGYH 1OW0A 4QRUB 4ZNEE 4ODXB 2V2XB 4YDLC 1GGIL 1DQJB 5D7SH 4LLDB 4PYGA 2XTJB 5GS0H 1ZANH 3FRUB 4S1QL 1BX2A 4Y5XC 1NC2A 5E99L 3O8XC 2OZ4L 4X80H 1P2CB 1JYNA 1BD2B 1A6PA 4P5KA 4WO4C 3D48R 4KTDL 1JGDA 4MJIE 5E03A 1MQKH 1I8MA 1KPRA 5T1DH 1P4LB 4KVCH 4WU7A 4YDIH 4U1MB 4FFWD 1GZQA 3LKSA 2V17H 1H3GA 2PXYB 4PRAA 5GS3A 3HE7D 3V6OA 4F15C 1BREA 4FQ2H 3MGAA 4RA0C 3TH3T 1NGQL 1EFQA 3QIUD 4AENA 4K8RC 3UTTD 5DMGD 1MFAL 1JRHI 4F80A 2GY7B 9CGTA 4PRPA 3VXPA 3CVHL 3NTCH 4D0DB 3QO1B 1N59A 3SDYL 2A2QT 3TT3L 1F4YL 4KHTL 2OP4H 1CD1B 4X6EA 3I3DA 1MF2L 3LEVL 4PTUA 1HSBB 4YUEL 4P5TD 3TA3A 1DQQA 3O4LB 2LFGA 1I8IB 3B2VH 1YEIL 5B38A 2AS5M 2GUOB 2H2SC 5ICZA 3SGEI 1NMAH 4ODBD 2UZIL 2VDKL 1KEML 1A7BA 1KC5H 3ARVA 2X9WA 4ZUUB 5EO1A 1ED3B 2HJLB 2VDQH 3KR3H 4GAJH 5B39A 3H7BA 3OJMB 4L4TB 5C92A 1DQLH 5EIVA 4LCWB 4EIGB 2EIEA 2QQKL 1A7QL 5EBMA 4UV4H 1JZ4A 3DYOA 5DVKA 4LRNL 4YH6A 2ADFL 3MV8A 4X7TA 3U1SH 2AV7A 4X8JA 3CPLA 5KSVB 3QUZB 5T5FL 4YWGL 4DN3H 1UENA 2PF6A 4GKNB 1CWVA 4OZGF 3CC5B 4TVPE 1UCTA 4X6DB 1K6QH 3VE0A 2YR3A 4GKOA 2IQAA 2HRLA 3BP7A 4EI6A 5GJTL 1RZ8B 3NN8B 4PG2C 5E00B 5ELIA 5D9SB 3L3JB 1Q8MA 1BGXL 3SOBL 2CLZA 1OVZA 1Q72L 1T0NA 3PJSB 4MYWB 2NY3B 3D85D 5F7LB 1S7VB 1OWRM 2APFA 3DMMD 4RRPG 1BHGA 3B6SB 1CGUA 5FHAL 2BOBB 1FL6A 1OTUD 3ARTA 4WTXA 4Q74A 2KQMA 2X7LA 3WFDH 5ITFA 4ZS7H 2PW2A 5L2KD 4XXDB 4N8CH 4PRDB 4WFED 4BKLB 4MMZC 1NDGB 2A74B 2EDBA 4ZYKB 1GJIA 2DD8H 4UBDD 4QXTB 2OL3H 2R1YA 4RCAA 3VI4E 4DGVL 5IQ9B 4RGOL 1CFNA 1EA9C 2IPKA 4X7EC 1GPOH 1A1OA 4MDIB 4WI2A 4F9LA 4N1EA 5DHYB 1XAUA 2PR4H 5C0GA 4KI5D 1UWGL 2BSSA 4JFEA 5DR5L 4BZYA 2VE6B 1A64A 4HWZA 1CDHA 3BD3A 3VXTA 2GJZA 2ICEB 3U2SB 1QR1B 4MQ7B 1QR4A 3WJJC 1FNEB 1HI6A 4GW5A 3C6SA 4XPFL 4JPIB 4XH2A 1CIUA 5D2LF 1EEZB 4XB8A 4OZ4B 1BQSA 3HG1E 4JB9H 2EXWD 4AIXA 1JRHH 1PKQE 5F3HB 2F53E 5IB1A 3HB3C 4U6HA 1E4JA 4P2QB 4JKWA 3OZ9H 4X9BA 4YHIB 3QNXB 3V6ZB 2Z8RA 4M48H 3G6AB 3QEHB 4Y19D 5HY9B 3VD7A 4Z77A 3QYCA 5I66A 4OZGB 3NCJH 3NCEB 4MD0A 2XI9A 1IE5A 3CMGA 3S4SG 1GRWA 1MJ8H 1D6EA 3U6RB 3KPSE 3GI9H 2QQNH 2YSSA 5C09A 4GG6A 3MV7A 3MR9A 1SHMA 1WVZA 4Y4FC 3W39B 3A6OA 3OX8A 2X89D 5SWZA 5HHMD 4PREB 4N0UA 3EYSH 3RIAF 2X4NB 5EORL 4K9EH 2D7TH 3MBEB 2ZPKH 2DQUL 4WU5B 4FS0A 3DXAD 4XVTH 1AGDA 1U6AH 3TVMC 4JJ5B 4KKCD 1T20A 4LPXA 3BW9B 2APWA 1LE5B 1F42A 1WZ1H 1AO7E 3GBNH 3B3IB 3BZEA 2R0WL 1UWXH 3ARDC 1A2YB 1YYML 1MAMH 1EGJL 3D18B 1G0DA 4ZTOL 1AGCA 1R3LA 3VG0L 1S9VB 3SGJA 2EC9U 3KPRD 4XTRD 1F3RB 2R69L 1BQLH 3CK0H 1UYWH 2R0KH 1JNNH 2GJ6B 1CT8A 4GS7C 1MCWM 1T66D 4XPBH 4QRRD 5D2LB 3D0LA 4HPYH 5FA3B 2FDBP 3QO0B 5C2BL 4OF7A 5JOFB 2VL5B 3MOQA 4MD4A 3V52H 2DYPA 3EKCA 1J0HA 1T1WB 1ZS8A 4XWOC 1EHLL 2KH2B 1JHTB 3IF1A 4F7MA 3G5XA 4QWWC 1T7ZA 5F7YC 5J13B 3QIWD 3S88L 1GGIH 4HIEA 3RIFK 1U3HC 4S1QH 1MFNA 5E8OB 1BVLA 3GNMH 5E6IA 3GMPA 4NNYB 3V5KA 1Z9LA 1ZWIA 1EO8L 2ZSVB 4I0CC 4NRXB 4ODWA 1WIPA 5DUPL 3QNZA 3ARSA 4M9OA 1GGCL 1H8OA 4DUWA 2BY0A 4Y5YB 1MCOL 4NQCD 1J88A 5DTFA 3D25B 3LOWA 4BK5A 3P4MB 1MFAH 2BMKA 2IGFH 3KWWB 4P4RA 5DLML 3CFCL 3WDIA 5HSFA 3TT3H 2XPGA 1U92B 4KHTH 4YXKL 1Y6NR 4P46D 5INDB 4BUGA 3BISA 2P4AB 4DKEH 3HHRB 4JRXD 4ZFOB 2L4OA 4URTB 2Q20A 4TUOA 3P4NB 3PV6B 1HXMA 3WCYA 1BMGA 2AJ3A 3VFRB 1P6AB 4HS8H 1A8JH 4MAYA 4NUJA 5IVOA 2ITCB 2UZIH 5I1CL 2W0KA 5J0BA 2FCBA 5I1IH 1VA9A 1A4KA 4NN5B 2V5RA 4PIRF 3VRJA 2R2BA 5I15L 5HD8D 1URLA 4L8SB 1HINL 3SDCA 4P3CL 4ZFZB 3EDKA 3RHWK 3TO4B 4EJ1C 1W0VB 4L8CA 2RR3A 4S1SL 4MJ5B 1KB9K 1FHGA 1EAPA 5D5MF 2Q1EA 4QHKI 1NCCH 5K33A 4NRZA 1RHFA 2MCG1 4D3CL 3RTQA 2ADFH 3KDMA 5DRZA 1CXKA 2EDEA 1MRDL 1LWRA 3J8F7 1P53A 4KAQH 1JWMB 3KJ4B 2FBJL 1MHCA 5LBSH 4JPWL 6FABL 5IW6A 3ESVF 1F11B 5GJTH 1X5FA 4BELD 4G6FD 1MQ8A 1DUZA 3QUXA 1A21A 5DQJB 5HHPB 2XN9B 3TYGH 1QFWL 1UZ6E 3SOBH 4ZD3H 3C60A 2WNGA 4JDVB 1MCWW 1AD9B 2CMRH 3BVNA 1C12B 5EBWA 2VABA 5FHAH 3T0EA 2CXKA 2DQHL 1OAZH 2VQTA 4QTHB 4M02A 2HWZL 3RWEA 2E7MA 4NFDA 5KAQF 2PW1B 1JPFA 2X4PA 1I9JH 3LMJH 5IOPA 1C7TA 3ULVF 4PFEA 4MHHI 3M1BA 3HE7C 2P48B 4GRLB 1V7NL 4IIQC 4A2MA 3QIUC 1DVFA 4WFFE 4M6ML 3CSYA 3GMOA 4PG9A 5DMGC 4JRYD 2BVUA 3C5JA 5F89B 5C9KA 3DVGA 1SJXA 4LSVH 4YR6B 1VESA 1A4JA 1J10A 4M5ZL 5ACMA 4CU6A 3KPOA 1NBVL 4Y4KA 4FQ1H 1T5WB 1K3ZA 2GFBB 2XQYG 4P5TC 3BQUB 4N1HB 2EDOA 4ZXBD 5HHXL 1S7XA 2BZDA 5DK2B 4XAWH 1Z3GL 3QUML 4LLAA 3EOAB 4XPFH 4S10A 3VJ6A 4DN4H 1X5JA 4Y1AA 1ZGLM 5ANME 5EU5A 5A2LH 1RJYA 1R3IL 2YZ8A 4M7KL 5HHOE 1NFDF 4PRIA 1H8NA 3VXSE 3HNVH 4YBLC 4LVEA 2QEJA 3FQWA 1EEUA 5IB5B 3CH8A 1MY7A 1I1AD 2C1PB 3MREA 5ILTL 3WE6A 3MV11 3QFJE 4HKXB 2ICWJ 1SVCP 4GG8B 1BFSA 3DBXB 4R4ND 4Y16B 1IC5L 5BMFH 2V2WA 4QTIL 5F6IB 1PLGH 5ACZA 2M1KA 5FK9B 5FYKL 5BV7B 2ITDB 4OUUA 3RU8H 3MLYH 2F5BH 3ULUE 1OAUL 3HFML 3O2VH 1YEDB 5A1AA 3QEQD 2VO5A 2ZCKL 3L95A 3FFDA 4Y5VA 2E6PA 2H32B 4AT6B 1D5MA 2DWDA 4WNQA 5DJDB 3UZVB 2RIKA 1OGTB 5D1XD 3NIGF 2IFFL 4RFNB 4IJ3C 3VA2C 3U4BL 3D0VB 4XVSH 5KTEL 2GK0B 5JW3L 3QQ3A 3V79C 4HGWA 5DT1H 3PP4L 3OQ3B 3T1FA 3RFZC 3GSNH 1AXIB 1EEYB 3IXTA 3DMMC 1FE8H 3R0NA 5CWSA 5L8JB 2HRPL 1YC8A 3WXVL 1OTUC 2I25N 1BEYH 2APBA 2LTQB 3QEGH 5IVNA 3D9AL 3OAYK 4OIBA 4ELKA 1M7IB 4H20L 2H26B 1NC4B 1IC1A 5I8OL 4UT9L 3MJ9L 5E2VL 1WFTA 4LARH 3Q5OA 5DD1H 1AGFB 4DGIL 4Y8AA 1A7RL 4UBDC 2VR9A 3VFVB 5IIEB 1LK2A 3IFOB 1R24A 4JQXA 1RVFH 1OHQA 1Q1JL 2BNRD 5IEKA 1N0XH 3RWIB 5JXED 1NGWB 1FAIL 1VDGA 4U6VH 4KROB 1X5GA 3BJ91 1EJOH 1GC1L 1NFDB 4CMHB 2X4OA 3BGMB 3R1GL 3U82B 1QRNA 4NJAL 2H3NB 3MRIA 3BP6B 2JELL 3S96B 1EHLH 1RIHL 3CFKA 3PWUA 5FOJA 5HDOA 4M1GL 4X83A 5T1MB 15C8L 2BY3A 3QEUB 2ADGA 1OF2A 3S88H 2I24N 5IVXA 2D2OA 2EXWC 4PJXE 1T89A 4HGKC 1QBML 5IHLB 4OCWL 4FABL 5AD0A 4LLQA 1FO0B 1YEFH 2VLME 1V5JA 2P5EB 5D7IA 5C0IA 1QSED 4LEXL 3CDYA 2J6EL 4KK6D 4Q7DA 1DZBA 3MRJB 1S7RA 2ARJA 1XGQA 1SJEA 3R8QA 1KJ2B 5DGQA 3VDCA 3QH3B 4C83A 4N8VB 4R6UA 1FYTB 4LBEA 1FJ1B 1B9ZA 1KCVH 5EOQH 2YHGA 5EBLA 4Z7VA 4CVZB 1IEAB 1TCMA 1S7QA 3B8SA 4UIMA 2IADA 5AG8A 4X9GA 2VXQH 3SJVA 2ZNWA 2DI8A 4TSAL 5JUEL 2A9NH 1VGEL 4WEUD 3HA0A 3GMMA 2B1AL 4Q58C 3BPOB 4QNPF 3EDDA 1I7UA 3PQYD 5EN2A 4OF3A 1IFHH 1MIEH 3ZZ1A 4UOW1 5CBEB 1MCBA 5I15H 3O9WB 4KKCC 4P3CH 2OQJB 2B4CC 1CDBA 3OKNB 3EO0A 4ONGL 1LNUA 5SWSA 2OJEB 1OAYL 5KVGH 3FO0H 3BD5A 1XF4B 5ESQA 3SO3B 3RDTD 2B5IB 1CE6B 4XC1L 2HJFB 2H6PB 2QQLH 3VDBA 4KQ3L 2ICCA 4D3CH 3ZYOA 4XTRC 4GXUN 3U9UA 2L0DA 1ZEAL 4LCCA 5EA0H 1CI5A 1IC4H 2DQTL 4X8XA 2AVGA 2IPTL 4HK0B 1U8IA 5DC0A 2DN7A 4W70A 6FABH 4YC2B 1HH9B 3E6HA 1ETZA 2R23B 3PGDB 5FCUL 5E9DD 1G6RA 5GRUL 5A2JH 4WUUE 1MPAL 3K0WA 2XQBH 5EO0B 3ZDZF 3NZHH 3MJ6A 5FDYA 2FR4B 1OGAE 1OQOA 5GGVL 4ZOBA 4JFOB 3EFDL 3QIWC 1IKNA 3S3JA 1LILA 1SM3L 1MWAL 5EULV 5EFIB 2W91A 3VFPB 4HDIA 1C5DB 2XKSA 1NC2D 3F7RA 2ILLA 3DVNA 4ZTPL 2V5YA 4WTZG 1YQVH 5EIQA 1K9TA 3CSBA 5H37G 3CSPA 3QUYB 3HNSL 4JFDE 3LQAL 5L6YL 2RAMA 4ENED 1M6OA 2G2RA 2NTFA 1J5OH 1QBLH 1F90H 4GLRI 3KYNB 3QWRD 1YNTA 1KN4H 1HNGA 4M6MH 3HPLA 3RQ3A 1KCRL 4MCZB 2WV3A 5F7MC 2HKFL 1NGYA 5E4IA 3P2TA 4X98B 1OD9A 1WBZB 3MO1A 2F8VA 2FWOB 2HFTA 2QHRL 2YD8A 1HSAB 1B2WH 1OM3L 4XNYL 4KDWA 4L3EA 1B90A 1Z3GH 2FYYA 4ZFGL 1MNUH 1NGXA 4V1DD 5IV2A 4M7KH 4OIIL 1ZSDB 3WNPA 1GGBL 2OL3B 5D6DC 2ZP0T 3SKJH 5TE6H 2ADIB 4J3TA 5HD8C 4UAOC 2XTJE 2UV3A 4RZCB 1P69B 4F7PA 4CU8A 3P11H 3RWHA 3IXAB 3ALXA 5C0BE 1JP5A 5D72L 5GGRB 2H9GA 3WNNA 5I16A 1H3PL 3S35H 3RWJB 3ECBB 2BVPA 4JZNB 3KPQA 3OKYA 1H5BC 1DN2A 3OGOE 5DJXB 1K8IB 3DYPA 3MV8D 3VFOB 2DI9A 4NFBA 3EYUL 2D31A 3DV6A 3HFMH 4O02H 1RU9H 2ZCKH 1B0GB 4OQ1A 1RUMH 1MCPH 3D6GA 3VXMD 5GZOD 1XIWB 1G7HB 5E4EB 2HH0L 3QPXL 4NO2A 2VLKA 5KTEH 5H35B 2ESVA 1NKOA 4RAVA 5HGDA 2FHFA 3QUKA 2BXYA 1U58B 4KV5F 4O2CB 4MCYB 2J8OA 1PX4A 4NOFA 3ZDXE 2OM5A 1IRAY 2HRPH 2C3VB 3ZTNL 3CUPB 1BVKB 4PS4H 4YQXH 1HYRC 4FG6D 3CU1A 1TLKA 4AIZB 1N6QL 4H20H 1KXVC 2BRRH 2DM3A 4RQQA 1UWEL 5HYSA 3GSXA 3NAAL 5DUBB 1JWSA 2BNQE 4PRHB 4DGIH 4E42A 3DUUA 1TJHH 5IB3B 5JR1L 5BZDB 3QCVL 1ZKAA 4QHLA 3Q5YA 3B2UC 1E4KA 2XWTB 3H3PL 4M03A 4GJTB 3T3PF 2ZOKA 1C7SA 4O58L 3SHSA 3EHBD 3JWNC 2NX5B 4NCC2 4S1RH 3MUY1 5I1HL 4JN2B 3SPVA 32C2A 4JFED 2KBGA 3RP1A 1D9KA 4P59L 4UI2A 3IFNL 1YC7A 3CH1A 3D69B 4NJAH 4NO0D 2F19L 3EFFA 4JO1H 3X13B 3KPNB 4KUCD 2PO6A 3IB4A 3TZVB 3VD3A 3HI5H 2P24A 1N5YL 1J8HB 3X17A 2GYSA 4QEGA 3GHBL 3QXVA 1QO3B 3RL1B 1LVEA 4LHUA 1YEHL 1QVOA 2P8PB 1KG0B 1I4FB 5LWYH 3L3DB 1I1AC 3DIFB 1CFSA 1GHFL 2NY5C 2EKJA 2EZ0D 1C8PA 4WDIB 2APXA 3TPUA 1H15B 1F6AB 4LEXH 3PGFL 5BS0B 2HVJB 3GBML 4CNIA 4LP5A 3BJLA 2AK1L 1L0QA 2BOCB 5IJKC 3UROR 5C70A 4LKXA 4LSUH 5GS1A 4NUGH 3QDAA 1KCLA 2YD6A 4TNVK 3UBXA 2LV4A 4PJ5A 1QOKA 1E4WH 3IU3A 2FIKA 4Q2ZA 5FUZL 1A3RL 1MLBB 2BHYA 3QXAA 1F4WL 1CDGA 4HQQL 3QR2A 5CJBA 3OKLA 4QOKE 5DD5L 4UQ3A 1LDPH 5JNYA 1XGTA 4XPAH 3B9AA 4DZBB 1FNSL 4N9OB 5D7KD 5CKGA 5ADOL 5SWZD 3NZ8A 4L8DA 4EDXA 4I2XB 3W5MA 3C2SA 1FDLL 3W9EB 4K8RH 4WFGE 2B1AH 4MAUL 4UINH 4W4NA 5DRXB 4LIQL 4YDKL 3STLB 3RUGF 3QXDA 2JCCE 4L4JA 4R97B 3W0WA 2ZG1A 3TIEA 3O45B 2YD2A 1AD0B 2DM4A 4ONGH 3S8WA 4QRPE 4PJFE 4TYUA 3MRMB 2WBJD 4LEOB 5HI4C 3BE1H 5IG7B 4I5BA 3RI5K 4XC1H 4MB4A 4HWBL 3VFTB 4WEMB 1S5IH 1UM5L 5FFLA 4NHUB 3U0WL 1S7UA 3K1KC 5FUOH 4BH7A 5JXEC 5HPOA 1ZEAH 4OCMC 2AJXH 5IESL 1FFRA 2DLGA 4HIIB 3BRGC 4ZSOE 4JO4L 5L8KB 4YDJA 1D5XB 3I6LD 3MLRH 4KK8D 1FL3B 3KXFE 1X9QA 3T09A 4E41A 1X7QA 2OI9B 1TZHB 4JFXB 2DYPD 1R5VB 4KKBD 3T0XA 1B88A 4JFYB 1P4BH 4MNQB 3EFDH 3GMNB 2ARWA 4TRPL 1MWAH 4HJGB 4JGJA 1BFOB 4YK4B 3NA9H 5F7HA 5D7JB 1XF5B 4IHOB 4KY1L 5C0CA 1RFDH 2IANE 5JA8B 3MA7B 2DMCA 4U1GC 1BOGB 3DROB 4YX2H 1AC6A 4F7CA 1WBYA 1FGNH 4KK6C 5F9WC 1JHLL 3A6BH 3AXLB 2NY7H 3DRTB 2A6IA 2V2TB 1ZVHA 3FO1A 2M2DA 1T21A 3FJTA 4PPTA 4YFDB 4HV8A 4MNHA 2X1QA 5I1EH 5BXFB 2XT1B 2C1OB 1KCRH 5BVJA 1PAMA 2HKFH 4JM2A 4NOBA 2I9LB 3QHZL 2A1WL 2YC1B 3KVQA 2UY7A 4Z7OE 2J8UE 3QULA 5C0EB 4XNXH 1JUFB 1X44A 4XNYH 3RUGB 3QIBD 4IOFD 3G08A 1WQVT 3CX5K 2HKHL 5CP7A 4OIIH 3B83A 5DI8A 2NR6D 5SWQA 3O3EA 1GSMA 2QSQA 3VXRB 2H8PA 3OJDA 3W11D 4BJLA 1CIDA 3UCRA 4ZUVA 1XCQA 4CU7A 4NQUA 4XCCL 5ESAA 4XBGA 5FHBL 1B0RB 1K4CA 1P7QA 2EYRA 3KPTA 1BF8A 3FQTB 3SE3C 3O11A 2DTMH 3TBWB 1XGUA 3RDTC 1JTTA 2A83B 4ZDHB 5F1KC 4NQVA 3LKPA 3PGCB 5EU3B 1MJUL 1WSST 4QY8A 1H3TA 1LP9F 2F58H 5HYJA 5JPMA 1CFVH 5C86A 4GQ9L 4P9HH 1H8SA 4I18C 2E5EA 5EU4A 5C0FA 4WY7L 2XFXB 3OWEA 3ZT6A 5D2NA 2W9EL 1NUNB 2VLJD 1EO5A 5CSBA 4XNUL 5FYKE 1G7MB 2ADJB 5TE7H 4ZNCD 2OXHA 3C5ZD 1UA6L 3QUXD 1VADA 3PDGA 1OSPL 5I6XC 1VSCA 2YK1L 4F2MA 3NFPA 5D1ZD 3W9DB 4NHCL 3OAYH 5T1KA 2UZYB 3X3FL 3MRFB 1UC6A 3V5HA 4LPTA 5AUMA 2CR3A 2GKIA 3QDME 1AIFB 1TZGL 1JFQL 5BOPA 3QJFA 1UJ3B 1S9YA 1AQDA 4XCNB 5JW4N 1YMME 3SDAA 5HHNB 3OJ2C 5K59E 3WHXB 5DHXB 1CFQB 5HJ3B 3FONB 4S0TD 2BRQA 2X4RA 4ENEC 3MNWA 4Z18A 1U8MB 3QDJA 2CK0L 2I07B 3QCVH 3WFHB 3V6OC 4RX4A 5DD6B 1UM4H 3UTSB 1FLRL 3GSNB 5E2UH 2C7UB 4R4FH 4ELMA 5IBTH 2C3GA 4NWUL 2QADD 5F7EL 3HAEA 1AE6L 1U8KB 5CGYD 4P59H 3U46A 4E9LA 4Y4KD 3G04A 1QFPA 4JFPA 2HFEA 2CIKB 2EDDA 1WITA 3R4DA 5FYJE 1NLDL 4ETQA 1N5YH 2WQ8A 1VFBA 1Z5LA 4Y1AD 3O2DA 3GHBH 3A6CL 4CBPA 1QKZH 4HXBL 5EPMA 1IEHA 4UV7L 1BFTA 3WHE1 2JLLA 3PDOB 4OI7A 3DUHA 1LP9B 1G7JA 4M5YH 1NBZB 2P44B 5DJ6A 1MFCL 4QRUA 4ODXA 4OD2B 1MCJA 3PGFH 4F58H 5KN5B 4LLDA 2OTWB 2XRAH 4HW6A 2I9TB 1VFUA 1U8OA 3GSQB 3RKDC 4P2RB 1FV1A 1P2CA 2F8OA 1FC2D 1PBYA 3RVTD 4PB9L 3E2HC 1X4XA 2CUMA 3ZSTA 3CIQA 3ETBF 5EOTB 1Q0XL 4U1MA 2W65B 3WNOA 1S9KC 1A3RH 2PXYA 5GZOC 3GEWB 4HQQH 4EN3D 5AYUL 1SBSL 5DK3A 3GGWB 4CVUA 4TVPD 5M7QA 3HZMA 5TF1L 1KV3A 1FNSH 3OHXA 2XWJB 2CLVB 2Z91B 1N5AB 3H42L 4D0DA 3QO1A 3GI8H 1FDLH 1MAKA 5E6ZA 4MAUH 2D7OA 3SE4C 1Y0LA 1HSBA 4BYHA 4YDKH 3BIKA 1GOHA 4LSPH 3O4LA 4YXHL 5D5ME 3KAAA 2WWKT 4NKOB 2GUOA 5I1AB 4HFWB 2YA0A 1MELA 1XR9B 3WO4B 2IQ9L 4HWBH 1SEBB 5IFHL 2R9HD 4NRYB 8FABB 4AH2A 2YUVA 5BRZE 1OB1B 3I02B 5F44A 4UTAL 4X6CE 3DGGA 3QAZB 4L4TA 2FECL 4F9LC 3MLTB 4LCWA 3EHBC 4ORZC 3DLQR 3MLSH 1CLCA 5IESH 4NQXA 2NLJB 1KYOK 4XP4L 4LPWA 4LU5L 3EYVB 4G8GD 1HEZB 4JPVL 3ALPA 1DFBL 4DW2H 1EVUA 4NQEE 2OBGA 1J1PL 1L6XA 4B7LA 3T0AA 3G9VA 5ESVA 3F12B 25C8H 4X6DA 3VDAA 3G6JF 2YRLA 1Q94B 5J57B 2FSEB 3QG6A 4TRPH 4NBYB 3NN8A 3BYYA 4ZFFA 1YDPB 3LZFH 2HT4D 4OV6F 5E00A 4YXLH 1MCIA 3ZKXC 5D9SA 3L3JA 3I2CH 4LVHB 2CRMA 3MRPB 2KQNA 3PJSA 3HG1D 3VXUA 1MREH 4UU9B 4AMKH 3N50A 1JF1B 5F1IA 1PY9A 3B6SA 1PZUB 3U79A 1FZOB 2BOBA 4GH7B 3BKCL 4OZIE 3JTTB 1MHEA 2WUCL 4C57C 4XXDA 4AJ0A 4PRDA 5A16B 3HNTH 1P7KA 1NDGA 5C6WH 1IM9B 2DLFL 3VFSB 2LVCA 3KYAA 3QHZH 4ZYKA 4HWEL 4LSSL 5CHNA 3MRHB 1MCHA 3NABH 2XNAB 4TUKH 5CZXD 4NWTH 1C08B 5C0RL 3KPSD 5IQ9A 5CSGA 4MDIA 1V7ML 3KJ6L 3LKOB 1K8DB 4X7SL 3BGAA 5H8DA 3LN4B 5DHYA 3VD9A 4U6YB 3FQUB 1N7MH 2HKHH 3B9KB 1BJ1H 1TVDA 3NIDE 3ZLQC 2AEPL 5I2IB 2ICEA 3U2SA 1QR1A 2VIRB 4GT7A 4MQ7A 4OD3H 3M8OH 3SY0B 1UT9A 4MWFB 2UWEF 4JPIA 5FHBH 4AL8H 4G42B 5B4MD 5GGTA 3WUZA 5C1MB 1YNKH 3H9SB 3QBTB 2WBJC 4OZ4A 3ZHKA 5SWSD 2GEEA 3N1MC 4XP5H 3ZE0F 1R3KB 1NEZG 1YUHB 1RULL 3PL6B 1MJUH 4P2QA 2C26A 4YHIA 4G7VL 5IQ7L 5HVFB 4OLVH 3MUGB 3V6ZA 5I1KH 1INEH 2BDNL 3G6AA 3QEHA 2EIZB 5F71A 3NIGE 3QZWG 2AK4A 2VQ1B 3HE6D 4WY7H 1WFOA 3NCCB 3QWOA 4OZGA 4JN1L 1U3YA 3G6JB 5D7LA 3UPRB 3QP3A 2PYEB 4PRBB 3RIFF 5E56A 5MEQB 4KK8C 3GKZA 1OSPH 1SVZA 2YK1H 4UB0H 2CXGA 5GSRA 3BHBB 4PV9B 4KMTL 5IBUB 1DBJL 1IGIL 1LO0L 1TETL 4Q0XH 1MI5B 4MJ4A 2EDJA 1JZ5A 3C6LA 3W39A 3MLXL 1OWWA 5I1LA 2P1YA 1K2DB 1ZTXH 4PREA 4PJAE 3AM8A 3MGTB 2WIIA 2ENYA 3GK8H 2YPKB 4KTEH 2X4NA 3F65A 2JKXA 2QTEA 4LAQH 3MBEA 2HT3D 5E1HB 3MLVL 4WU5A 1FVCB 2FEEL 4FFVD 4W4OC 3PWPD 3FMGL 4JJ5A 1YNLL 3DECA 3U4AA 3ZO0A 3BW9A 1LE5A 1FLRH 3B3IA 4Y2DD 4M1CD 1HHKB 2GT9A 3D18A 3QI9B 3RVXC 3TNNB 3MRQB 3H0TB 2ED8A 4GSDL 1YN6B 4NJ9H 1KPUB 3EGSA 5GGRY 2X9YA 4WTWA 4F8QA 1CLYL 4LHQB 1GZPB 4NZRL 2WLZA 4JGMA 2G5RA 5HHVL 5C07D 4KZEL 4LCYA 3QIBC 4OCRH 4IOFC 5DDHB 4AEIL 4BZ2H 5E7BA 2UWEB 2HA1A 3UO1L 4FXLA 4NO5B 2HN7A 4WGWB 1CVSC 1F58H 5D2LA 5FA3A 3VGHA 4AM0A 3QO0A 4IRZH 4FQHA 4UV7H 3W11C 1LMKA 2Y4SA 4LSQH 5JOFA 3NFSH 4XPTH 4ZO8A 5J1AB 2LU4A 1EFXD 2HG5B 4O4YH 1FGVL 4G9FA 2DQFA 2DLEA 2HTKD 3AS2A 5JMRA 1I8LC 4L3CB 2ZJSL 4OTXL 5GJSL 2VTFA 3RY4A 3BN9D 5E8OA 2VNCA 4P2OB 5FKAA 4PJBA 2YPLB 2W9DH 1RJLB 1TNMA 1UADC 4PB9H 3TV3L 5CEZD 3EOTH 3LKRB 4NNYA 1IGTA 1MHPL 1VCAA 1JE6A 4HKZB 4MXWL 5FKPB 1EZVY 1CD8A 4RISL 3BMVA 2ZSVA 1K5NA 35C8H 4JKPL 4NRXA 1IAIM 1CFTA 2NY5L 5CGTA 1RJZA 2R8SH 3O0RL 3C5ZC 4Y5YA 3MNZB 3UZQA 5D1QB 3EO9L 3L5IA 3GB7A 4IRSD 1YEKL 4L4VE 3P4MA 1GOFA 5D1ZC 1PYWB 4XHQA 5GISH 5I18H 1RUQL 4I3GA 1IAKB 4KJQD 4EI5B 1U92A 4Y4HB 4KFZC 4G8IB 5IBLD 5D8JL 4ZFOA 5F3BB 3AAZA 4GRWH 3MGOB 2L7JA 4ONHB 3CFDB 2BERA 2HFFB 4YDLB 3FB6A 4O2EA 4YZFE 5CMAB 1BM3L 3PV6A 3O8XB 2E7LC 3VFRA 1RK1B 5EUKB 3QWQB 2P47B 4HMCA 3I50L 4YO0B 5HYIA 4GFTB 2VLLB 3S36L 4LIQE 3UMTA 4MB3A 2VXTH 4OLUL 1OOAA 3S34H 4L8SA 4GKSB 4QF1B 4MJ6B 2P43B 4AYFA 3KHOA 4R7NB 4Q6IC 3TO4A 4MNGB 4PJ9D 3SDXE 1FG2B 1YY8B 2CLRB 5JIKA 4NQDB 3GMRA 3T8XB 1WZKA 1FP5A 4XP4H 2QADC 1L7IH 2B4CH 2EEBA 1DFBH 3PXJA 5CBAB 5L8LB 4Y4KC 1BX2B 1IILE 4AEEA 1D9KD 3INUL 2NW2A 2BVYA 2UUDK 4ODTH 3VG9B 4P5KB 5EU6E 1Y18A 1M1SA 1HKLL 4OSUL 1KPRB 3PHSA 4WU7B 3U7YL 1N4XH 4P48A 3OG4B 1GZQB 4PRAB 2AEWA 3IAQA 4LHUD 3ZE1F 3S3PA 3VXSD 4AENB 4I0PC 4JDVA 1A02N 4LVNC 4M93C 1AD9A 1TPXB 3TH4T 3CLFH 1C12A 5IFAL 4UILH 4Z7QF 3MXVH 3VXPB 1CF8L 1N59B 3BZFB 1X5XA 5KSUB 3ZL4H 3I9GL 3WFBL 1T2QH 3QQ9C 4X6EB 4BZ1L 5JW5B 3RVTC 2BC4B 3TA3B 4TPRL 2J5LC 4DQOL 5F72S 1CXFA 5J12C 2PW1A 1ZT4B 5KANI 4NYLB 5B38B 4HWEH 1MWAB 2V9TA 5D96B 5MEND 2F74B 1U2HA 5I19H 4GRLA 4QXUL 4EN3C 4PP2A 3ESUF 2NX5E 5GGSB 5FGCB 5K9KA 2Z8VC 4PJEE 5F89A 3IAGC 3VGAB 2FO4B 3H7BB 4WEBL 1FBIL 5DJYA 2EDFA 4X7CC 1CGVA 4ODHH 5CJXC 4YHYC 2AEPH 1T5WA 2GFBA 1X6LA 2X09A 5SX5K 4QCIA 5MERA 4TNWF 4LASH 4FTVB 3UPAA 5DK2A 4X7TB 1U8PB 1JPGB 4X8JB 3CPLB 1T1XB 2E9WA 3D39D 2YWZA 2CJUL 3BKML 1ZXQA 2B0SL 2ZCHH 3VE0B 1RIVH 3VH8G 4EI6B 5IB5A 3NVQA 3TPKA 2C1PA 3SBWC 4AQ1B 5IQ7H 4L1DA 3VXQB 1W72A 4QHUB 1GAFL 3FO9A 2D9CA 5E94B 1ODAA 5E7FA 1MCKA 2CLZB 4GG8A 1UB6B 4WCYL 2Y9RT 2AJYH 5GIRB 3NIFF 5IWLC 2OMBA 1LO2L 4PJHE 4DTGL 1EBPA 1WEJL 4Z0BL 5FK9A 2F53A 5JDSB 5HVHC 2X7LB 4HF5L 1C16B 1KEGH 5CINL 3FN0L 4NZUH 4KMTH 2H32A 4AT6A 1FN4B 5I1GL 2BHUA 1G7IB 2PYFA 2HT4C 3RBGA 5F7DB 5ITBH 2R1YB 4EXPX 4J4PA 5C0CD 2NY1D 4GUPA 4Q97A 4PJGE 4JAMA 1EEYA 2VDNL 4NM4L 5C0GB 1BBJA 3EAKA 4KKNA 2VUYA 1JPTH 2VR4A 3MLVH 3VXTB 3T3PE 5C6TH 4XMPL 3GSOB 3F7QA 4G6KH 4JQVA 5IT2L 4Y0GA 3FMGH 4QXGH 1YZZA 3D87B 4GW5B 4XH2B 3DSNA 2B1HH 2NQCA 5IIEA 5CZXC 2YMXL 1CQYA 5KSBF 5DFWH 1II4E 3FTGA 3RWIA 1D6VL 3IT8D 5CJ5A 2FD6H 2JJSC 4OLEA 4HCRL 1SJHA 1EDQA 4CAGA 4NKDB 4KKAD 3MYZA 3AB0C 3NBNA 4WFEE 1XCTB 4MD0B 4CJ1A 3TBSA 2H3NA 1U3JA 3IDNB 3F6LA 4LPYA 3S96A 5B4MC 4ODSH 1T0MA 1P7QD 5T1MA 2EECA 2NZIA 2YSSB 3QEUA 5C09B 4QO1A 5FO9A 5I71C 1TIUA 3K8MA 5ID0B 4FMKA 3MR9B 4NN6C 4KI5E 3MFGB 5HDLA 4UIKH 1P9MA 1FO0A 3ARDB 2A6DB 1A6AB 2P5EA 3U30C 2OJZL 3A67H 5EZJB 4HGMA 4OGYL 1LHZA 1JGVH 3HE6C 2OTPA 4N0UB 1NLBH 4QGTA 2NY5H 3E1F1 3O6MH 1KJ2A 1YA5A 3QH3A 1CL7I 1LO4L 3QB7C 1NMBL 1TQCB 2ZUQB 1KTRL 3H3BC 3BRFA 1CLOL 1T20B 1RUQH 4R90L 1BZ9B 5GSVA 4JFFE 5T1KD 3BZEB 3Q6FA 4WUUD 4WI8A 4CVZA 1IKNC 1R3LB 1I9IL 5DEGB 4ONFL 4LLUA 3DO3A 1HZHH 1S78D 3WXWL 1U3HB 4MA7H 1BM3H 1NCWL 1ZA3B 5CCKH 4KRPB 3SDAD 5AZEH 1CT8B 3WL9B 4ZUTA 3S36H 4LFHD 2HT3C 1ADQL 3HMWH 4FFVC 4H25A 4YHKH 4P23D 5TFSH 5CBEA 3WJLC 4OCYL 4RDQF 4HUMB 4MD4B 5KSBB 2OQJA 4M6NL 5K9QI 1WF5A 4O5LL 3TN0A 3DUSB 4OBSA 4Y2DC 2PKDA 4M1CC 2H6PA 5HHME 1RIUL 2CIIB 2Y5EA 4HIEB 2WSKA 4ZAKC 5I30H 5FO8B 5M95B 3QDGB 5E6IB 3GMPB 3NA4A 4S11A 2A6KB 4HK0A 4IRJC 2X4SB 4LQFH 3DETD 3M17B 5DD3H 4LQ1A 1PQZB 2UVFA 3PGDA 4CADA 3QNZB 5DFVD 1FPTL 2E9IA 1P7HL 5JO5A 3EO1A 3CXHK 3BI9X 4DWHA 2NZ9D 3WIHA 2P49B 1FSKC 2X40A 1FL5A 3KPRE 5D71H 4HXAH 2HTKC 4JFOA 4P4RB 4PRNB 2EH8L 3LS5L 1MFDH 5JHDB 1X5AA 4J3OC 5EFIA 3BN3B 3BN9C 2XTJD 4WHTB 2IPUK 1C5DA 3NH7H 4PGEA 4NNXA 4QRRE 1WCQA 4PLOB 2NXYC 1FORH 1BD2D 4DQOH 3LHPH 5MI0C 3QUYA 4TUOB 1HXMB 3FQNA 4JHZA 2DQEL 5F1NB 2AJ3B 3GJFA 5KSAD 3BEWB 4CN6A 4MAYB 4WV1C 3UTSE 2PXYD 3Q2CA 3HS0A 4EBQH 1G9NH 1QA9A 4IRSC 4A6YA 4MCZA 3VRJB 2R2BB 2DQGH 1PFCA 4LMQI 1FFNA 5EUOF 3SDCB 2QL1A 1QHOA 5F7NC 4WEBH 3ROOB 1RZKL 4KJQC 1FBIH 1AKJA 5DS8A 4ZPTA 1EAPB 5IBLC 4HK3J 2FWOA 2ZUXA 2MPAH 3S36X 1KENH 1CDCA 3UP1A 3RTQB 3BT2H 5DRZB 3O4LD 5E5RB 3O2WL 2JJVA 3TFKC 1ZSDA 2CJUH 4NQCE 5E5MB 1CL7H 4WI3A 4E5XA 5AZ2H 4KXZI 5FYJU 2ED7A 1DUZB 2DMBA 1OAXH 2FH6A 1HQ4B 1RSFA 4K7PL 3HE7B 1KBGL 2MWCA 1EBAA 3IXAA 4L4TD 4M7ZB 1OCWL 3C60B 4JRXE 4P2RE 4PJ9C 4IIQB 5HHOA 5GGRA 4LCWD 4XP9L 2Z93A 4F7EA 3UTTB 3BVNB 3RWJA 1D5IL 3ECBA 4U05A 4XP6H 5DRWA 5EBWB 3N9GH 3T0EB 5EC1B 3LPFA 4JZNA 5DJXA 2K9UA 2NMSA 4KJWD 3RWEB 3QFJA 3QUZD 4PJ8A 1B0GA 4D9RD 4NQTA 2QSCL 1XZ0B 2DI7A 5FGBC 2VZVA 2X4PB 1XIWA 3AROA 5F1SA 2RHEA 4Y8DC 3M1BB 3MLWL 3QISA 4M7JL 5H35A 2YPVL 5JXAL 3ARFA 1DVFB 3O4OC 5F6HI 3UJIL 3GMOB 4K3DL 4BH8B 2R15A 4MCYA 2NY3D 3CNKA 3DTXB 4PGCA 3MLPA 4TNVF 5IJVB 3CUPA 1YEGH 1ZV5A 1T2XA 2MJWA 2Q3AA 1BVKA 4NKMB 3KPOB 4AIZA 3HPJB 4IEFB 5IGXH 5CZKA 5IT2H 5MP6H 3QXTA 3L3IB 5IMMA 2X4TA 5HDQL 5I75B 3WFCH 3P9WB 1S7XB 1ORQA 1FH5H 5DUBA 4HIXL 2F9BT 4PRHA 5EUOB 4BSWA 1CICC 1KOAA 5IB4B 1RJYB 4IBLT 5IB3A 4PRIB 1A7PH 3ULUC 2YMXH 4XPGH 3QQNA 5DJAB 1A3QA 4IJ3B 3LSOA 4HCRH 3WE6B 3C87A 5ALCL 2X1OA 4QOKD 3ARBD 4ZUSA 3FB5B 1CR9L 2YN3A 3RI5F 3SDXF 3GHEH 3HMXA 1E28B 3QCTL 3X13A 3KPNA 2VC2L 2HLAB 5D7IF 3BMWA 3TZVA 4OUUB 3ARPA 2Z8WC 4WFGD 5CEYB 3FFDB 4Y5VB 3P77A 4JRYE 3RL1A 5C8JA 2VDRH 1SMAA 2DWDB 5DQ9B 2JJWA 2P8PA 1KG0A 3O6KL 5BVPL 3L3DA 2R4RL 4P2QD 4TULH 4LDEB 4HGWB 3BPNB 1H15A 1A6WH 1F6AA 3QCUL 1KELH 5BS0A 4Z7VF 2BVTA 3TP4A 2DBLL 3UX9B 1J0YA 5CWSB 4EOWH 4PR5B 4OT1H 2F8XC 1A47A 5JQHC 1ND0B 3HAEH 3CVIL 4JM4L 4NNPL 2J8HA 4FQIL 1NMBH 1DL7L 3MLZL 4ODVL 4KXZH 4RWYL 4CJ0A 4LLYB 1V3KA 1ES0A 3LN9A 4RRPA 5M94B 1MLBA 3TIDB 1UH4A 2OZ4A 4X4ZA 1R24B 1UACH 1I9IH 2UY6A 4ONFH 4DZBA 3UYRH 2I60H 2NY1C 5JDJA 1B6UA 4XCFH 4JQIH 1ACYL 3T2NL 4I2XA 1QFWM 3THMH 3JV4A 1HDMB 1D3CA 2N1KA 3QEQE 1ADQH 3U0TA 3MBED 2VDML 2ICWB 3TBTA 1DBMH 2JB6B 2X1XR 4Y19B 4M7LH 3SE8L 3REWA 3O45A 1LGVA 1QRNB 3QDHA 3MRIB 1AD0A 3CVHA 4Z7UE 3MRMA 1KTLA 4LEOA 5IG7A 1G1CA 2UUDH 5FYLH 1AGBB 3VFTA 2YD1A 4OFYA 4GRWB 4NHUA 2R2HB 4RMRA 4YE4H 3ARZA 3SDXB 4WUKL 1OAQL 2QR0B 3GM0A 4UMGA 4DUVA 2ED9A 4Y2OA 3G6JE 3F7YA 4AEHL 3L3OB 3V7AG 1HK6A 2DQCH 5D7IB 2GJ6D 4KKAC 3LH2H 4FMFA 4XWGH 2BXZA 1NEZB 4XBEL 2ARJB 1KF9B 2VZTA 4X5LA 2JF1A 1Q9LB 3NPSC 4JFXA 1JHKL 2GK2A 3V4UL 4C83B 1R5VA 4UT6H 3FFCB 3QZWB 4JFYA 3DXAB 5F7WC 1O0VA 4LBEB 4MNQA 4KGJA 2XACC 3GMNA 4Q9RH 4HJGA 4X5XA 1BFOA 5D7JA 1MOEA 4Z7VB 5ISZB 4IHOA 1NFIA 5EB9A 4OLZL 3RAJH 3D1MC 3O41A 3S4SA 1S7QB 4X4XA 3NCBB 2IADB 4N8PA 1HHIB 1BOGA 1QLRA 3SJVB 2D7PA 1CU4H 3BAEH 2IBGA 1OGAA 1OLLA 5DF0A 5TPWL 2DQEH 4I3SL 3DRTA 2EICA 1DQML 3GMMB 5BXFA 5EN2B 2C1OA 4QRSB 3P0VL 2H1PH 5GZND 1T0PB 1Q0YL 4JY6A 2N56A 5SX5H 2EYSA 3RPIB 5DJZA 3RL2B 1YY9C 5IW3A 3R06B 3NFNB 3P4OB 4ZPVA 3VGGA 3WSQH 5DQDL 1QSEE 3E3QE 3RUGA 3DSFL 1S78C 2O5XH 2EC8A 4I13B 4LCCB 4U1SA 1I7ZB 3ZE0E 1LEGB 2I5YH 3SDAC 1U8IB 4HUKB 5LGJB 3VXRA 4TVPL 1OTSC 2WP3T 4YJZL 1U8LA 2IJ0C 4P23C 4R0LC 1RHHB 3N85L 3Q5TA 2I26N 3B9VA 4FQJH 2AGJL 3LV3B 1B0RA 2D7MA 3CFJB 3MYJA 4K7PH 4GBXD 1DANT 3QRFM 2EO9A 3TO4D 3GIVB 4ZDHA 1KIRB 4XP9H 1L7TL 5F8RC 2YD4A 2OR7A 3BSZH 4MD5A 4U0RB 1N64H 4HDIB 2P5WE 3OR6B 1WT5C 4FZEL 4MA8L 3T1WA 3K7UA 5DD0L 3DVNB 3GKWL 2FX7H 3PQYE 3GJFK 2QSCH 5C0BA 2V5SA 1PDKA 1LEKB 3DETC 1UEYA 2IWGA 3IRPX 1E27A 1G7MA 1EIBA 4I0KA 1M6OB 2NTFB 3WMSA 5DFVC 2JJTC 3FQRB 4M62L 5FYJD 1W0YT 4HUWB 2XN9D 1IBGL 3GSUA 3RGVA 5JXAH 3UJIH 1IAMA 2NZ9C 3HPLB 2IPUG 2CKBH 3VXOA 1WBXB 3IKCA 3L1OL 5HXMA 2BJMH 3J7HA 3VFGL 4HJ0D 2AXFA 1NGYB 3EJYD 4HS3A 3MV9A 5BZWB 3MRBA 2XTJC 3MO1B 2RFXA 1MFBL 1VACB 4NC1C 1AIFA 4GAGL 5C6PB 4Z7WE 1UJ3A 5HDQH 5HI3D 1XH3A 2W92A 4L3EB 3CZJA 5HHNA 2FYYB 3WHXA 1CFQA 4HIXH 5HJ3A 1P4IL 4NZDA 1WWWX 3M07A 2B39A 3FZUD 1U8MA 5KSAC 1ZMYA 2PXYC 4GRLD 5DD6A 4NQDE 1H9VA 1INDL 4OM0L 2YD3A 5DMKB 3DHJA 3NOIA 3GSNA 1J1XH 4F7PB 1ZGLP 2C7UA 1HHGA 1LEIB 4NN7C 1MHHB 1GGTA 3OJVC 5I16B 1CR9H 2VLRB 4JDZB 1ZLSL 1CBVL 3BQUD 4HPOH 1JYXA 3MOBH 1FQ9C 1RUPL 4NGHL 3V6OE 2D31B 1EGJA 4K7PX 5I0DA 1I7TB 3RY6A 5GGUA 1SYVB 5T3ZH 3JZ7A 2F54A 3PNWB 3O6KH 5KVEH 3LVEA 3PDOA 4PRPE 5CJQL 2VLKB 4PJ7F 2R4RH 1LP9A 2KZ1B 4M9PA 2ESVB 3VD4A 5E0QA 5HI5D 5HGDB 4TTDD 2E27H 2Z31A 3QCUH 1W8OA 3QUKB 5KN5A 2OTWA 4Y16D 2DBLH 1Z2KA 3BP5A 1KCUL 5JORB 1JV5A 1AY1L 1IT9L 2WBKA 3CVIH 4J3UA 3DVIA 4KJWC 4FNLH 4YHMH 3MLZH 1RZFL 3QUZC 4ODVH 5EOTA 2W65A 1OAKH 5FGCE 3GSXB 3KPPA 2CGRH 1JWSB 2W0LA 4NQED 4E42B 3DUUB 3GGWA 5E70A 1RD6A 4J7RA 1U41A 1XGYL 2NYYD 2CLVA 4XP1L 3BZ4B 4IMKA 3T2NH 2NY3C 4C56B 4X4YA 1OP9A 2MNUA 4K23H 3MV8E 3DX7B 1G6RL 1NAML 1SEQH 3ULVD 2VDMH 1CXIA 4PTTB 3OPZH 1M05B 3QT2A 3TJEL 4I3RL 3EFFB 4NKOA 1NC4D 2Q76B 4F57H 2PO6B 5I1AA 4HFWA 3EYQD 4DEPB 1PZ5A 1DUYB 5CAYB 3I02A 2JCCA 5BO1L 4S0SD 3MC0A 1I7RB 3LN5A 3MLTA 2ORBL 1CFSB 4ZOEA 4OLWH 4UT7L 4KROD 2NLJA 3ARBC 3TPUB 4XGZB 4ZMAT 4R7DB 3EYVA 1HEZA 4WWKA 1UM6H 3IU4H 4DJMA 1RY7B 2XZQL 1MCDA 3O6FD 4XBEH 5I8EB 3UJTH 3VH8B 1BIIA 1IQWH 4CNIB 1J0IA 4APQD 1MUJB 5HTSA 5KG9B 3FAXA 4O2FB 4CVWA 4Z7QE 4OZHB 1HIMH 4PJ7B 4LKXB 3F12A 5TGBA 3VFUA 1EUTA 1WZLA 4PJ5B 4WI6A 1KLGA 3HC0A 1F3DJ 3K2MC 4OZFG 2FIKB 3OF6D 4ZSOA 5A2KH 3QXAB 2BSTA 3DNKA 2R2CA 1RUKL 1G1YA 3MRPA 2VXSH 3KXFA 4UQ3B 5L7XL 5JNYB 4JFEE 4UU9A 4JM2F 5I1JL 5DHVA 5C0AB 3NZ8B 2OR9L 3VMNA 1FZOA 43CAB 5IR1A 4I3SH 3JTTA 3LEXA 1QSFA 1DQMH 1GL4B 4WWID 4TSCL 2DIJA 4KHXH 2IANA 4HC1L 3VWKA 5A16A 4U1NB 1F4XH 1NSNL 3W0WB 1QACA 4HJJL 1IM9A 1RI8A 3MUJA 3VFSA 1FYTD 3MRHA 3Q6GH 5JQ6L 1FNAA 2XNAA 4I5BB 5CEZL 3CFEB 5GS0D 3DHMA 4LSRL 2O5ZL 5L9DL 1T1YA 4WJ5A 12E8H 1K8DA 2DL2A 5KVFL 3RNQA 4PUBH 5A2FA 1IAIL 2DKMA 4P5MB 1C5CL 3C8KB 1FCGA 3BPCB 5C3TA 4TVPH 2VIRA 4KPHL 3JVGC 1PKOA 4GG6E 3JBG7 4PY8J 3MV7E 1QFOA 4G42A 1R5WB 4U0QB 3V0WL 3O9WD 1NUFA 1AI1H 3H9SA 1U91B 1L7TH 3MCG1 5SWZE 1C1EH 3RNKA 1TITA 2VISB 2EIZA 2EDWA 4HAFA 4HS6B 2CPCA 2VQ1A 2JTDA 4K3EH 5DEZA 4F7CB 2YEZA 2Z9TA 4TQEL 4PRBA 5F9AC 5JW4R 3B5HA 4Z6AT 2A6IB 4M62H 4M8VA 3FO1B 2XKNA 4J8RB 3MFFA 2O26U 4MXQD 3IYLW 4HV8B 1IAOB 2IAMA 4PV9A 1WAAF 5GRJL 4BFGA 5AYQA 1JYVA 4U7KA 5JHLH 4Z8FH 3BIAX 3L1OH 1FRGL 1I1FA 3QQ4B 3VFGH 3PWVB 1MI5A 4D0BA 2M8XA 4DOHE 2YS4A 5ADPH 5DFTA 3S5LG 6CGTA 5E2TL 5IMKB 3RDTB 5HVGB 3U7WL 3MRKB 5EZIH 3RJQB 3I6LE 1W72H 2A77H 3G08B 3VRIA 3PV7A 4ELMF 2QKIA 2OYPA 5DI8B 3EDEA 5SWQB 1A5FL 3O3DA 2APVA 1FVCA 1YN7B 2H8PB 4MSWB 3QDMA 4XPHL 4DKFL 4OM0H 4K3JL 3DX6A 5LAXB 4LLMB 5ESAB 1K4CB 1MVFA 4LPCA 5GHWH 3MRQA 3H0TA 1KPUA 1R0AL 1B6DA 3LKPB 2GIYA 4QY8B 1ZLSH 7FABH 2G60H 4X5WA 5DDHA 1CBVH 1BBDL 1QG3A 3V7AE 2UWEA 5KW9L 3SGKA 4N0CD 4NO5A 1GXEA 4F8TA 2MKLC 4GMSH 4XNQB 3CCHB 2XZAH 1WISA 5D2NB 4EDWL 5BW7A 4OZFH 1P5VA 4NN5C 4XAKD 1V05A 3VGEA 4PBWD 5ENWA 1VADB 2HG5A 2Y06L 1FFOB 2JB5H 4GBXC 4WW2C 1UCBL 3NFPB 2Y07L 4L3CA 1B3JA 1AY1H 1RPQA 2BVQB 1HYSD 3GMQB 1WTGT 3SDDB 2YPLA 4YHPA 5AUMB 3S98A 1IGFL 3WIFB 3BX7C 2COQA 3LKRA 5EBGA 5DC9B 3QJFB 5FKPA 1AQDB 3BIBX 3KJ4C 3STBA 2VMFA 1AXTL 4OF5A 1MIMH 3NCYS 2B8OT 5H2BB 2X4RB 3MSPA 1MVUA 1QLEL 1XIWD 3MNWB 4N5EC 1EERB 5GRVK 4YHOH 1GC1C 5LCVL 4WTZA 1WIOA 3IVKA 1PYWA 3IDYB 3VW3L 4XP1H 2VDPH 1IAKA 2J6EA 1S7SB 1F3JB 1FCCA 3G5VA 4EI5A 4HJ0C 5BQ7A 3EJYC 4Y4HA 5FOBA 4G8IA 1VFAB 4WIQA 4LPUA 4ELMB 2CD0A 4ZOCA 1BAFL 3HAEB 3MGOA 3CFDA 2VLJE 2OTUA 3L5XL 5HI3C 4JFPB 5CMAA 1DBKH 3TJEH 2XA8L 4Y5XA 3O8XA 4XBPB 3O6LH 2NY0D 1RK1A 5EUKA 5D93B 1NAKL 4YO0A 5CGMA 4WO4A 1KJVB 2VLLA 4PRHD 3ZTJG 1J1OL 2XYCA 4U31A 4KUZL 4U1KB 5BO1H 4QF1A 4MJ6A 4XC3L 4R7NA 3VXMB 1KNOA 1QNZL 5CKAA 2BVOB 5CFHA 4UT7H 3T8XA 5DJ6B 2V6HA 2NX5D 2AQ2A 2R4SH 3MRLA 5CBAA 1U8OB 2XZQH 5BRZA 3HC3H 1EVTC 2DF3A 2EXYD 4XXCC 1IGJB 3WUWG 1FV1B 1KPVA 3TWCL 4X6CA 4ALAL 2H41A 3BQUC 2VXVL 5GS2H 1BLNB 4YBQD 5J06A 3TZVD 3V0AC 1Q9KB 1U95B 1TVBB 5I8CB 3BUTA 1J8HD 5F7KC 3ILQC 3GO1L 1RQ5A 2NNAB 3V4PL 3LKQA 4XCEA 1DQDL 2B20A 1J7VR 4IM8A 5JIPA 1RUKH 2WUBH 2DQJL 2VQUA 4KU1A 3BDYL 3HZMB 5HI5C 1ACZA 4TTDC 5L88L 3OHXB 4WHDA 4F9PC 3WS6A 4Y16C 5IEHA 3BZFA 5KSUA 5BS0D 3QXUA 5F6IC 5ID1A 1FZMA 4RGNB 4Y1AE 5JW5A 1Y0LB 2BC4A 1A1MB 3BIKB 1S7WB 4GXVL 5BV7C 1X5LA 2ATKB 3BZDA 3IDXL 4NSKA 5DVMA 3LPWA 4HJJH 4JDTH 1ZT4A 4YIQB 1QBBA 4NYLA 5JQ6H 1MWAA 2XQYK 5GGQL 2F74A 4NO0B 2RCSH 5HDBF 3ZHDA 3VI3E 2AXGB 3T4YA 3V95A 4JO2H 4G6JL 3G6DL 5GGSA 4HIJB 4AH2B 2C4XA 3D2UD 2VZUA 3DGGB 1TCRB 3BKJL 2FO4A 1IAIH 3OG6B 2JIXA 5KVDL 4PG2A 5C71A 3WIHH 3ZKXB 1IEBB 4X6FA 3NPZB 2J4WH 4NQXB 2FJHA 2ZOLA 4KPHH 3G5ZB 2LTQC 4FTVA 3VGDA 1KIUA 1JNHA 5ERWB 1X6NA 1U8PA 1JPGA 4JQVC 1T1XA 5CD5D 3EYQC 1AJ7L 4L1HA 1EX0A 1KIPA 2VB5A 5ESVB 3K81A 4G3YL 5MEPB 3MZGB 4OQTL 3IS0X 1JPSH 3QG6B 3QHFH 3RX5A 1J0JA 1AQKH 3GJFH 4PB0L 1FG9C 4ZFFB 2VERN 4H0IA 4PJDE 1A0QL 3VXQA 4QHUA 3LQAC 4LCIH 1DE4B 5E94A 3N1PC 4A6YH 1UB6A 4K71C 3VXUB 1X5ZA 3ZYJA 4KROC 5GIRA 5F1IB 5DJCB 1YJDH 3DARA 3MNVA 4TQEH 1D5ZA 5JDSA 3U0PB 3O6FC 4LLVB 1MHEB 4APQC 5KS9E 1C16A 3MCLL 4M61B 4X99A 5GRJH 3UTQB 3WJJA 1FN4A 1P7KB 3ZMRA 1C5BH 1EV2E 4MNQD 1G7IA 5CHNB 4YLQT 3F58L 5F7DA 4UDTB 1CXLA 4XVJL 1TFHA 2WBJB 3U83A 1QSZA 1AHWC 4XNZC 3U7WH 2Q7YA 2IMNA 4J1UB 4G8GE 3O2DL 3EJZD 5HYQA 4FFYH 3ZTJH 5I0ZA 4LRIC 4WENB 3GSOA 1BQUA 4CVXA 4K3JH 4KRLB 4PJAA 5EZLB 2CKBB 3GSRA 4YAQA 4R2GB 2QJDA 5IVXE 3KGRA 1KB5L 1NCBH 1NKRA 5GS0C 1R0AH 4G6AD 4HZLB 5D7IE 3RVWD 1VPOH 4JFFD 1RZIB 2EIDA 4Y4FA 1DJSA 3DJ9A 4H88L 3ULUH 4NKDA 4OCSL 4XMLH 3QG7L 2AK4B 3QWOB 5E1AA 4JHWH 3VXRD 1XCTA 3BPOC 5D7LB 4PJBF 4TOYH 1JZ7A 3IDNA 4HKJA 1PG7W 4Z7VE 3O9WC 1U42A 4RMSA 1F13A 1JNLH 5GSRB 2R0ZL 4JANA 5ID0A 1K4DA 2B5IC 3TVMA 1RUAH 2VAAB 4HT1L 2X1WL 4OB5L 3KLAA 3C6LB 4BSJA 3BH9B 1DANU 3ARDA 4U1LA 1TJGL 2A6DA 5I1LB 1A6AA 1MJJB 4LFHG 4D9LL 5EZJA 2WIIB 5GRVL 1JGUL 1UFUA 2VXUH 1KIQA 1YECL 5CUSH 1BOYA 4PGDB 5T33H 5SWSE 4J2XA 2BCKB 4LGPB 4MXQC 3X3GL 3Q3GA 3HMXH 2E6QA 4FQLL 4G7YH 3VW3H 5LXGL 4H1LG 3MROB 1KN2L 2Y6SD 1BZ9A 3WO3B 5IROA 2GT9B 3JTSB 4JZJC 1CDUA 3FRPA 3D3VB 3EGSB 5F96L 4WGVB 5DEGA 1I3GH 4L4VA 5E24E 4XT1C 1U3HA 4UOJA 3H9ZA 4LCYB 1ZA3A 2EH7L 5DGRA 4NZTL 3WL9A 1QRKA 4CN4A 2FX9H 2HN7B 5LGKA 3OBAA 2MCPL 4AM0B 1J1OH 4FQHB 4N68A 5JOEA 4UNVA 3GSVB 4M1DL 5KSBA 4UTBH 5C08B 4XC3H 4BQ9A 3DUSA 4X0KA 4KGLA 4KKLD 3UTSD 1NMCC 3C5ZB 4G9FB 4QXWA 2DQFB 2OR8A 3WKML 1N8ZB 2CIIA 4RFEA 3SE9L 5FO8A 5E99H 5FKAB 2OZ4H 3QDGA 3JWOL 4NCC1 5I9QB 5BJTA 4PJBB 1S9WB 1VEOA 1GGUA 2A6KA 1IGTB 4KK5C 4KTDH 4EZMA 2Z35A 3PWPE 4N0CC 4N0RA 2X4SA 5DMIL 2EIBA 3M17A 4OCLC 5DVOA 4HWBA 5FO7B 1PQZA 1K5NB 4CUCA 1CFTB 5IK3B 3RZCD 1RJZB 1NGQH 2DQJH 4JR9L 1UXSB 3MACL 2FGWL 1ZVSA 2ARJQ 3BDYH 3GB7B 5EU6A 1QFHA 3OKMB 1N6UA 3KPLA 4PRNA 4MJIB 2HVKB 3CVHH 5C07E 5JHDA 2W9LA 4PD4J 3SDYH 1IGML 1F4YH 4MXVE 4L3EE 4WHTA 4Q6IB 1OPGL 1HYSC 1G9EA 3PUCA 1MF2H 3LEVH 2JE8A 4P2RD 4YUEH 4GXVH 3AAZB 5GGTL 4B53A 1IM3A 5DEFB 1A9EA 1L6ZA 4FQXC 5TF0A 1KLUA 3FB6B 4O2EB 3UDWC 1MCSA 1YEIH 2VDOL 5DVLA 3ZE2F 4KJPD 5MEOA 1F2QA 4KRMB 5F1NA 1IC7L 4JY4B 3BEWA 3VI4F 1DEDA 4D8PB 5E4EC 2VDKH 1KEMH 5AG9A 3G6DH 2GHWB 4OJFL 5JLZA 2AXHA 3BKJH 5EOCJ 3ROOA 5KVDH 3FB7A 1YPZE 1IJ9A 4OLYL 5CEZE 2QQKH 3GMRB 2DTSA 1A7QH 1HHHB 3KPMA 4I0PB 4LVNB 2J88L 4PBVC 3OAZH 4LRNH 3HUJE 5GRZA 4R4BA 3FO2A 2NW2B 4PJEA 1D5BA 5T5FH 4YWGH 2NY0C 4XHJD 5E5MA 1Y18B 1NBQA 3O3BB 4FQCL 1GIGL 5DVNA 4DVBA 4HUUB 2YXMA 4S1DD 1HQ4A 1A3LL 3HE7A 1BGXH 1Q72H 4EN3B 4IIQA 1T7VA 3QIUA 3UTTA 1X4ZA 4L9LB 2R2EB 4K9EC 3RA7L 2OSLB 5EC1A 1MJ7L 4IOSD 4U4BA 4YHYB 4YBQC 4HBCL 4P5TA 1XZ0A 5AEAA 1UJTA 4FFWC 4LP4A 1ZK9A 4DGVH 4XVJH 4PP2B 4RGOH 5T3XE 3LEYL 3P0YL 1TVHA 4KVNL 5K9KB 4BH8A 3C08L 1LO3L 4WI4A 3DTXA 3ARYA 1OARL 1UWGH 1JBJA 5DJYB 5T1LB 5DR5H 5IJVA 4MQXD 4HX1B 3T0BA 4NKMA 3WNKA 4F33A 2LE9A 3RWFB 3HPJA 3L3IA 4CGTA 4QCIB 5MERB 2VDLL 1XGPA 2GAZA 3Q1SL 1KB5H 5EUOA 5IB4A 4B5EA 5DJ0A 5HVHB 3NMEA 5ALBL 2BP3A 4DKDC 4KMQA 5AAWA 3VMOA 4DAGL 1A14L 5DJAA 4J6RL 1QYGL 2K7PA 1W72B 3FO9B 3OMZA 4H88H 5J11B 2A0LD 4JVUA 1JZ3A 2R1WB 2VYRE 3QG7H 4XI5D 5TE4L 3B9KD 3FB5A 3IFLL 4GW1B 5MHSE 3LRHA 1S9XB 1PKQB 5DSCA 1WUNT 1E28A 2F53B 3DMMA 3MBXL 4ISVA 2R29L 4W6WB 2HLAA 5MENE 4HZAA 4R97C 2AJVL 5CEYA 5DRNB 4N5UA 1IVLA 3H9SD 2R0ZH 4Z76B 5L2KA 5LKNA 5DQ9A 3GUTB 1T5XA 3V8OA 4HT1H 5CJOL 5FEBA 4BA8A 2PYFB 3PL6D 2H2PD 4IDJL 4YHLL 1UKTA 3E6FA 1AFVL 1YQ2A 5ETUA 4GUPB 1PVHA 3RJDA 4JAMB 4EXKA 3P9LB 1GCFA 4DVRL 1H3XA 2VKXA 1BBJB 2OLDA 4PR5A 5EORH 4OZFB 3W0WE 2X41A 5J9PB 2XZZA 2DDQL 1QP1A 3D39E 1ND0A 3BRDA 2DQUH 1ZHNB 2PYED 5GRWA 1MRCL 1QTYT 1FIEA 1X3DA 1LK3L 1IGCL 4BK4A 3AB0B 4PJCE 2IBZY 3U9PL 1ZVYA 2OI9C 3VFMA 4LLYA 5AWNL 3QRGL 3WNLA 2R0WH 3TIDA 1QFWI 1YYMH 4HD9A 4U49A 2FHCA 1EGJH 1M7DB 3LRGA 4ZTOH 4Q9QL 4YK4C 5F96H 1FZJA 3VG0H 5I71B 2R69H 3ZDYF 3FTGB 5E8NA 2ZSWA 4NN6B 2EH7H 1A6VL 4KI5C 1HDMA 4NZTH 1AO7B 3EJZC 1NCAL 1SJHB 5FYJL 1B0WA 2NXZB 4E41E 1TQBC 2ICWA 2WIMA 5B21A 4QRQB 5C2BH 2JB6A 4Y19A 3HE6B 4M1DH 5CD3B 4LVOC 4FOMA 4QHKJ 3TBSB 2WP3O 1KCKA 5J6HA 1T6WA 3MRGB 1T0MB 4U7SA 1AGBA 5C0CE 5FO9B 3OAUL 1EPFA 1HCFX 3QI9D 1FNGA 2R2HA 5E8PA 3SDXA 3AY4C 3KS0H 2QR0A 1GH7A 3RVWC 4HWUA 4BFIA 1R5IA 5EU7C 3L3OA 3KLDA 4KMLB 2NY6B 1LQSR 2X89A 1EO8H 3VXNB 3HLAB 4R8WL 3N06B 1NEZA 5DUPH 3BO8A 1GGCH 1U36A 1J87A 2A73A 1Q9LA 1UZ6F 1MCOH 5DUML 2FGWH 5D70L 1F97A 1XF3B 2DJ4A 3FFCA 3TNMA 4CL7A 3QZWA 5DLMH 4ZQKB 3DXAA 3CFCH 5CZVL 5GSVB 4H0HB 4MX7B 5ISZA 2O5YL 4YXKH 1T03L 3Q6FB 4YDVB 1MLCB 4U3XA 4P2OD 1DBBL 1HHIA 4LLUB 4G80A 3T3ME 4AEFA 1Z0NA 3KPRA 4W81A 4ZAKB 1VFOA 4HEME 5C0DB 2PCPB 4NPYB 1IC7H 2P5WD 5I1CH 4NP4L 4ZUTB 2FB4L 4IRJB 2X5PA 3JV5A 4H25B 4OJFH 5DXWA 1UG9A 4QRSA 5D1QD 1XF1A 5C7XL 1HINH 4Q9CA 2Y6SC 4H8WC 4UOW0 3TN0B 4GQPH 3RPIA 4S1SH 3RL2A 5HYJ