4O9HH

Structure of interleukin-6 in complex with a camelid fab fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
200
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYRMYWVRQPPGKGLEWVSAISAGGGSTYYGDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCANRAGWGMGDYWGQGTQVTVSSASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNGVHTFPAVLQSSGLYSLSSVVTTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining residues of naturally-occurring Camelid somatic affinity variants yields ultra-potent human therapeutic IL-6 antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-6
total genus 38
structure length 200
sequence length 220
ec nomenclature
pdb deposition date 2014-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hH01
1NGWB 2AXHA 4L3AA 2MSPA 1ZLUH 2VDRH 1A1MB 1KGCD 1HSAB 3LV3B 5DA0B 5D72H 3UPAA 1IGIH 1TQBB 1QBMH 4QRPE 4XT1C 4MNHB 3NIDF 1G9ML 2BNRA 3IFNH 5TE4H 1CDYA 3BPLB 5ID1B 5E1HB 5IESL 3QULB 5EG6C 3BPNB 5IHBA 2GCYA 5IFJA 4M43L 1SQ2N 5DHVA 5HGBA 4NQSB 1H3WM 4S1RL 4WWKC 3HKFA 4X6EA 2B1AH 5CGMA 2BHUA 2VXTL 3FZUD 1N26A 2ZOKB 4HFUH 1DZBA 4K7PY 4RGNE 4P46A 3RPIB 3OQ3B 2MCPL 5T5FH 3GMMA 4LVHB 2A6KB 5D72L 3K2MC 4ZUVA 1EHNA 2UWEE 3GHBH 1GSMA 1RIUL 1G7LA 1JPFA 3HCVA 1WWAX 2K9UA 4M5ZL 2PYEE 3DX7A 2NY7H 4WFGD 1DBMH 4Y5XA 3LSOA 4U1SA 4M62H 1QFHA 1XGUA 3U9PL 4U1NA 5TDOB 3TJHC 3GSUA 4Z18A 5JQ6L 4PRIB 3T0XA 4OCSL 2AK4E 2GAZA 5D9SB 5JR1L 3HE7B 1EAJA 2DQTH 2E8YA 5IHLB 4WO4A 1XGTA 3BN9D 1XF5A 5JA9A 5DJZB 1CIDA 1V7NH 1VGEL 1ZLWH 3WE6B 2APWA 2ICEB 3WMSA 4BFBD 5MEPA 5LGJB 5F3HA 1Q9LB 1QSFE 1JGUL 1CFSA 1I3UA 1LP9B 1YC8A 3IDXL 1BEYH 1I1YA 3G5XA 3GHBL 4E42B 3T8XB 1DR9A 4BZYA 1JI1A 4NQEE 1MFNA 2N56A 3BD5A 9CGTA 1CDGA 2BY0A 3VG9B 1NANH 1UM4L 1SBBA 3MLWH 4IOIB 1FDLH 4TYUA 2R1YB 1RI8A 1OSZA 3B3IA 1D6EA 3QRFM 3KYNA 1CXLA 3QCUL 2YK1H 3W2DH 4WU5B 4K94H 4NRXA 4OZIA 2AK4B 1AI1H 1V05A 1EFQA 2GITA 4PJDA 4Y5XC 3VD9A 3ARVA 3JXAA 3QHTC 4U6HA 3S88H 1Q9OA 3FRPG 4POUB 3BIAX 3X3GH 2ICWI 5JNYA 3CDFA 4E0RA 4FZ8H 1IZJA 5GS1B 1U8LA 3WV0A 2A9NL 1MCOL 3FJTA 2VLJA 1C7TA 4OZFA 4H26A 5DGRA 1MJUH 3V2AR 2CKBL 4JM4H 2OP4L 1OP3H 3QP3A 2AW2A 3VXTB 5HYJA 4GAGH 2ZUXA 1N7MH 3PL6D 3QEHA 4M7JL 1U3YA 3PGDA 5ICZB 4H0IA 3ARPA 5I1IL 3TJEL 5DUBB 1QRND 1MIEL 3R0MA 1A6TA 5EU4B 5CEXA 4R96B 3FKUS 4EKXA 1BQSA 2YS4A 4ZUWA 4PREB 1MQKL 3PWJA 3DRTA 4U1MA 3QPXL 1ITBB 2EDRA 2NR6C 3HC3H 3MLYL 4MD4A 4OKVA 1XGTB 3BQUC 3M1BB 5DJXB 5C71A 3HE7D 5E2TH 3VGGA 5C8JB 2CLVA 4LF3B 3TO4A 3FTGB 1MEXL 4KZDH 3EYQD 1J18A 3QXAB 4LNRB 1KJ3H 2UZIH 3WHE0 5ADPL 3CLEH 2W91A 2YSSA 4KUCF 4XXDA 2YC1B 5GS3A 4C56E 3BZEA 3BN3B 3ZL4L 3MYZA 1P1ZB 5CEYB 4JREC 5GISL 3D3VD 4Y4KC 5ANMA 3TV3H 3BE1H 3ZT7A 6CGTA 4XC1H 3BDYL 5SX5K 4FABL 1ZLSL 1WAAF 1JPFB 4Q6IC 2X4SA 1JGDB 1LK2A 1NUDA 3F62A 4TULH 2VYRE 2D31B 1CCZA 5BZWA 4J1UA 2PO6D 2CPCA 2D7NA 4PBXA 3CFDA 2Q6WB 3GJFH 2IMMA 1HHKA 1N5AB 2B4CC 2A6DB 4NSKA 4N9OB 5TE4L 4YEFA 2UV3A 1AY1L 5J89A 3JTTA 1F4YL 3SY0A 5GJTL 5EZLA 2QSQA 3N1PC 4MJID 1JZ4A 1V3MA 3JZ7A 1GPOH 2EICA 3S34L 3QFJD 1UZ8A 3WYRA 4XP5L 3QPQC 1GHFL 1R5VB 5DEGB 1PYWB 1BF2A 5J9PB 3UTSB 3NCJH 2P8PB 4N8VG 2XKNB 4ZAKA 4W70A 5C2BL 4RMTA 1XIWC 1FFOA 1UJ3C 3IDJB 4ZDHA 3UC0H 3ZKQD 5IEKB 3SDAD 1Y18B 3RWIB 3MV01 5DLML 4JY4B 4OBRA 1F4YH 4D94A 1JPSH 4F9LA 1NDGB 3EYVA 4V1DA 5FA4A 3FB8A 4E9LA 3C8HA 1RHFA 1BQLL 1FFNA 1J1XH 1N2RB 1A7OL 5IB1A 5BQ7B 4IJ3B 2XTJC 4X8XA 1YMMB 4MX7B 3F5WB 2YPKA 4JO3L 4LP5A 3RBSA 3S3SA 5A1AA 3MRFB 2OK0L 1OB1B 1LEGB 1A7RH 4LASL 4X6CF 5ESQA 1BIHA 2KZ1B 5DUPL 1HOCB 2CRZA 1WWWX 5FYKL 3TVMC 5DF0A 3RWFA 1S7SA 1FNGB 4ODHH 1P5VA 1RJZB 3EO0A 3WXWH 3BDBA 3RU8H 3CMOL 1HXMB 5I76B 1T03H 1OTSD 1G7MA 3IJSB 3ZHDA 4NC1E 3KS0J 1YEJL 3FOLB 3TYFA 3V7MA 2XZZA 2C3VB 1PG7H 5E8PA 4NRYB 1K3ZA 2AI0H 3BT2L 1IAII 2WBJA 3LH2L 2ESVA 4YHYC 1XF3B 3V4UL 5B8CA 3BAEL 4JQVC 3B2VH 1E27A 3DO7A 1T20B 4YUEH 1TFHA 3BJLA 1T7WA 3CFBA 3EYUL 1H15A 2DAVA 5J57B 5CSZB 3DX8B 1FNEA 1FJ1B 2ID5A 3SKOA 5TDNB 1BD2B 1TQBC 3OSKA 4OUUB 4Y4HB 3UCRA 1LD9A 3L5XL 3OG6B 4Y4KB 3GB7B 1NGZB 3C5ZD 4IRZH 4JM2D 3G5YA 5E7FA 3VGBA 5JIPA 3PP3K 1UA6H 3C08L 3TIDB 1FV1B 5D70L 4TSCH 4IIQA 1ZVHA 1ZOXA 4FMKA 5FYJD 4YQXL 1CG9B 4U1KB 4W6XB 3LB6D 4L3EB 4WO4D 4XVJH 3E1F1 5DFVD 1CTNA 1TVDA 4LSDA 5DRXB 1PZ5A 1OAUL 3H9HB 4KK5D 4F15B 4R96A 5FUOH 3Q6FB 2NLJB 4I48A 4F7CA 5FO8A 3A6BH 5IB4A 3KPRA 4G7VL 3C60B 3LKRB 3LN5A 3HS0A 4JCMA 3HMXL 4PBVC 5E4EB 4G42A 1U58B 4P4KC 1PKQE 4JPIB 5HGDB 3KPLB 3H42L 1MLBB 1WGOA 2DIBA 1ZTXH 5CHNA 2J8OA 4S11A 4KRNA 4PJXE 5ESQB 3FRPA 3N0PB 1GGTA 3NIDE 1J5OL 4BFIB 1DBJH 3GMQA 4I4WB 1DLHB 1HHIA 2R2BB 2C9AA 2XY1A 1SEQL 1EFXA 1K85A 3DETC 5LG1A 4JPVH 1X5GA 3MJ7A 1MFDL 1ROWA 4JKPL 1ZS8A 5EUOF 4I13B 3N85L 3KPSB 4NNYA 1O7SA 1FNLA 2DJSA 3P77B 25C8H 3G04B 1U41A 5DHYA 3LHPL 2J6EL 4DK3A 3Q5OA 5I73B 2R69L 2XWBB 5D93C 5DC4B 4D0BA 2DLGA 1BZ7A 5DWUL 5IVXB 1QYGH 4Z0BL 3X12A 2ZUSA 1E4KC 1KIRA 1KJMA 3BKYH 4LKCB 3BP4B 1F3DJ 1JWUA 3GSRB 4L4VB 4U1LB 4LHUG 4FQXD 2XOTA 3UYRL 1KLUB 1KJ3L 1FH5L 4TQEL 3FRUB 3W82A 5E00B 1C1EH 3BEWB 3MGTB 4PJ8D 4OZHE 2J5LC 4JFDB 1AKJB 1AY1H 1RZ8A 4PGBB 3ZL4H 2H1PH 3WE6A 3OJMB 3RUGB 4MWFA 1NBYA 2G75B 2AV1B 5E5UB 4HMDA 1ZE3C 1QBBA 1DP0A 2ADFH 2FHFA 5TJWK 4PJHE 4ELKB 5IFHH 1KCRL 4XXCC 3F58L 2V9RA 3U36A 1IKFL 2NY7L 1BJMA 5F7KC 1JN6A 1INEH 3TVMD 1WC7B 4N0FA 5K93A 1T2XA 1FIGL 4K7PX 4JLRB 4O9HH 3GSRA 1Z5LA 1T5XA 3BUTA 5GSVA 1CFVH 5IKCA 3ARSA 2J12B 1QVOA 3SDYL 3QIUC 5C07A 5M95B 2UZYB 3QEUA 5CGYC 4GKSA 4C57C 2J7LA 2VL5A 2WNGA 3I02B 3NGBC 5JPNB 2V9TA 3HNVL 1CGYA 2AV1A 2YR3A 5GZOC 1S7QA 3I2CL 1IEAA 3OKYA 4EI5B 3HNSH 3QFDB 3HE6B 2DBLH 3UBXG 3DGCR 4HUUB 5C2BH 3A6BL 3TC9A 2BCKA 4GBXC 1VFBA 4D9QD 1EEZA 3MNVA 1WAAA 4WWKD 3V6ZB 1MCNA 1HIMH 1QFUH 5DRNB 3SKOB 1GIGL 4EEEA 3TBSA 3MFFB 4QHNA 2F5AH 4PTUB 4QHLA 5J7CC 3LS5H 4DOHE 5H2BB 1UKSA 3D0VB 5HHQB 1RK1B 2YD6A 3K1DA 4Z5RB 2DTML 2VLLA 2D7PA 2DL2A 5IMKA 2CK0L 4QRPA 1F3RB 1KPRB 1BECA 1YQVH 4M6NH 5D5MF 4PLJD 4Z77B 3T0EA 2PYEB 4UUJB 4YZFE 4FQ1H 4BSVA 5CEZL 3RWGB 3IS0X 1G6VK 1WT5A 2XZAL 2VLJB 1ZVYA 3L5IA 4PD4K 2GSGA 2OL3A 4F9PC 1U8LB 3OAYH 1I1AB 4C58B 5JOPE 2F8XC 3BIBX 4U33A 3QQ9D 1QSEE 5JOFA 5KVGH 2EEBA 4FXLA 4X5XB 1RZKH 1YJDC 5L2JB 3RZCA 1C7SA 1SMAA 1FZMB 3PQYA 4K2UH 4P23D 2Q76A 1KB5L 4UIKH 2NY3C 3QFJE 1UZ6F 3KPOA 1K4DB 4KY1L 5BRZA 4WV1C 3QUYA 5TE7L 2W60B 4MD5A 4ZXBC 4UV4L 4RAVA 4FXKA 4U0QB 5A2LH 1YEHL 2C7UB 4B0MM 1TTGA 1K4CA 3VFSB 4G8EB 2JF1A 3IDIB 3QWQB 4MMZC 4CMMB 3QG7H 1GZQB 3IVKB 5GIRA 1KLFA 4HS8H 2GK2A 1T80A 4X99A 5DS8B 4PP2A 1F42A 2X9XA 3CH1A 2DM7A 2X10A 1GOFA 1NEZB 2FYYA 1QUNA 5DD6B 3WBDA 4OCSH 4GMSL 1RZIB 5DJAA 5KVFL 1CYGA 2GUOA 4JRYD 4Y2DC 1U8PA 1FJ1A 2F8OA 4JN1H 3QJHA 1UZ8B 3BSZH 4H8WC 4I0PB 4O4YH 3WLWD 2QHRL 4Q2ZA 5D8JH 5IT2H 4L8BA 5HHOE 3GHEH 5I1DA 1J0IA 4YDVA 2AV7B 1D5XA 5EZJA 2B1AL 2BRQA 5INDB 4OZGE 3MRDA 5GZOD 2A83A 5ICXA 5DC0A 3EHBD 2FBOJ 2Z8VC 2EIZA 3KYOB 4UAOC 4JFDD 4G8EA 4GQ9H 1FHGA 1H5BB 4GBXD 1KJVB 2R0LH 2WUBL 5EU6D 3QO0B 1A6UH 1VGKB 5C0CB 3TBVA 3T1WA 4ZUVB 3O6LH 5DZOA 3QDMA 1A2YB 3SJVA 8FABB 4KMQA 5AWNH 4XCCL 5I1HL 2XV6B 2AXFA 3QUKB 4XPHH 1AXSA 1CT8B 1FNSH 3BEVB 1GC1L 1LEGA 2AJ3A 2VERN 1T7XA 5CGYD 5BVJB 1CT8A 3MPCA 2MFNA 5CJXC 2F58L 2BHZA 2W92A 3IVKA 4ZYKB 1QSED 4LBEB 5GSRB 5DDHB 1J1PL 4LAJH 5FUCE 5I1EL 5IFHL 3V8OA 2I60H 1EH9A 1W2KT 2DQGL 1AR1C 4MVBD 3L7EA 3O41A 4XNMA 1TQCB 2CGRL 4XNXL 3MV8B 3D25A 2D7MA 2YXFA 2FJFB 5E94B 2R2HA 4S2SA 1I3RA 2VABA 1IGTA 4TQEH 5KAQG 5IEKA 1FFQA 2VLLB 1YY9C 3PHQB 4HPOL 4AG4L 3MRPA 4EUPG 3U0TA 1NC2B 4PTUA 5C0BA 3RX5A 3ILQC 2W0FA 3BZEB 1VFMA 3IAGC 2E6JA 3B9KA 3AGVA 2QADC 4J2XA 2G5BA 2H32H 1R5IA 1PLGH 3LKNB 2XICA 3BWAA 4JN2B 2HAZA 3CXDH 4JFED 3BQUA 3QXUA 1EEQA 3HUJB 3R1GL 1KC5L 4HKXA 3TO4C 4NRXB 5I9QC 4F2MB 1I75A 1NFDB 4PGDA 4NQDD 3GKWL 2EDFA 1YN6A 3ZSTA 4M93C 4OV6F 3QQ9C 4EDXB 2PTUA 1JF1B 1QBAA 3RWJB 4HWEH 3RQ3A 2A9NH 1ZGLA 1FRGL 2YPLA 3OZ9L 1RIUH 4J23A 4PR5A 1P4LA 1T0PB 3EYOA 4QHUB 1IAKA 4TNVF 3V6ZA 1C5CH 4R8WH 4CVXB 5EC1B 4GW4A 5L7XH 3RDTA 5K9KB 3MJGX 1XH3A 3WFZA 5J4MA 4U6VL 5EBWA 2Q87A 1U8NA 3V6OE 2OXGA 5JPMB 1IEAB 4R7DA 4NFBA 4GRWE 1G1CA 4OGZA 3V7AG 3C6LB 4PS4L 4Z0XB 3SBWA 4NQDB 2Q8AL 1G9NL 3OZ9H 1MFCL 3V0AC 5JNYB 3QZWA 3MLZL 5E03A 4O58H 1FLRL 2ATKA 1QSEB 3PIQB 4UNTA 2M2DA 4EN3A 5D6DA 2CO6B 5GS0D 1WLHA 3STBA 2WIMA 4CADB 4FOMA 2IBZX 3NCBB 5CCKL 2ZKHL 4OFDA 4HG4J 3VXRD 1CD1B 3JUZA 1C16A 2R2HB 3MOAL 3MLWL 1J88A 4JZJB 4XWGL 5BO1H 1C5DA 3P4MA 4FQCL 2R1WB 2D03L 4XMKL 1NAMH 1EHAA 5AZEL 2AGJH 4R4FH 1TJHL 3D85B 4W4OA 4WU7A 2VLRB 2VKWA 3FFCE 1LO2H 3V5HB 4MDJB 3VFGL 4IRJC 1PSKH 5IIEA 4Z7QE 5DI8A 4NN5C 4QHMA 2AKRA 4GXUM 2KPNA 4BQCA 3LIZH 5D71H 5FECA 2NY4D 4MNQB 1L0XA 4XP4L 4P46D 5AZ2H 1YNTB 3GI8H 2BK8A 4K2UL 4FFWC 3X12B 3RU8L 4Y19D 4NKIH 1JPTL 1DSFH 3A67H 5F96L 1RFDL 4NC2B 4HFWB 4Y7MA 3QUXC 4P57B 3O4OC 3HPJA 1ORQA 5TF0A 3ZT5A 5DD1L 5GSVB 4OD1H 5JUEL 3MACL 3OBAA 2V5YA 1DBAL 2ERJB 4D0CA 1QFWI 4NZUL 3VFOB 3BMWA 4JFHE 2XNAA 3D2UD 5F70A 2V7HB 2FGWH 1AR1D 2IALA 3U9UA 3CH8A 1S5IH 5F89A 4PJFE 5BRZD 1X5JA 1KG0A 3BO8B 1JZ6A 5IB2A 1AO7E 4LP4A 1HHGB 5DJ8A 4P48A 5GGUA 1RQ5A 2OTWB 5IFAH 4XPHL 5CP7A 4LGPB 3HTLX 3DUUB 2QR0B 4O51A 4X5LA 3I3EA 1DLFL 5J6HB 1VSCA 4PRBB 3WIIL 3VG0H 3OG4B 4CL7A 4QXWA 4C59B 4X5WA 1HINH 3EYOB 4QHUA 3FAWA 1S9XB 1NGPH 1UFUA 5EO0B 1LO0H 1IM3A 1S78D 3SDDA 4HUKB 1OTUD 1D6VH 1I7RB 3BYYA 4I2XB 5FGRA 3MRBA 4Q74A 1HQRA 3SGJA 3EUUA 5GGVY 4N90D 3QI9D 2VDMH 1IGMH 1A1OA 4G43B 4WI2A 1CXFA 2W65B 4DKDC 4JO1L 5LCVL 4YXKH 3PABB 4I77H 3U7AA 3K7UA 1I9RL 2IG2L 2ZJSL 4LCIH 3GMRA 1IAMA 3RPIA 4WTZG 4OUUA 3LZFL 4ONHA 1VERA 4QCIA 3LDBB 1NL0H 4LCWD 1DTUA 3FT4A 1RK0A 2IPKA 4GUPB 4ZSOB 4I0CC 1P7KB 1LO3L 4WJ5A 4X6DE 3JTSB 4HDIA 3EO9L 1KIPB 2VSCA 4BSWA 3WIFB 4RWYL 4ZAKC 5EO9B 1PBYA 1RJCA 2GIYA 4UV7H 1NCWH 1UXSB 1MRDL 2YPVH 3N1MC 3L3IB 3R1GH 4XWOC 5L88L 1P6FA 4ODSH 4NJAH 4HS3B 3L3IA 5JIKA 3UTTD 5GZNC 4HPOH 2WP3T 3LKQB 1ZLVK 4RGMC 2DMKA 5CEZH 4Z5RA 4DK6A 1EJOH 5CJQH 2IFFL 1MY5A 4NHCH 4MB3A 5F7YC 5FHAL 5CD3B 2ITCB 4JHWH 1QACA 4MDIB 3F7QA 3GO1H 1U42A 3L5JA 4BFGA 3MYJB 1RZGA 3ARGB 1FNEB 3EYSH 2BCKB 1S9WA 4PGEA 4U1HB 1FVDB 3RVXD 4DCQA 1QSFD 3WS6C 4LGRB 3WNMA 3WNPA 3OKOB 1PX3A 3D85D 2DI8A 3WUWA 3BOVA 2FSEB 5FOBB 4OZIE 2X70A 3K8MA 5DK2A 2BDNL 3FT4B 1UEMA 4JO2H 2VXSH 1BD2E 4U31A 3CDGB 1WBZA 3MSPA 1GXEA 3BIKA 5MP6L 3RVVC 2NY6D 3CFDB 5AYQA 2CD0A 4JO3H 3O4LD 1G6RL 2O93L 1KEGH 2D2OA 1F00I 4YR6B 3QQ4B 3AY4A 4Y4FA 3VXSB 2BP3A 5EU3B 4HH9A 4PRBA 3GSVA 4KGJA 3T0EC 5DJ0A 5DQDH 3ZHLA 4I0PA 3H8NA 1OTUC 1TCRB 2EIDA 4JFDE 5KJRH 2ADIB 2WQRA 3BX7C 3VXMA 5H2BA 4MJIA 4Q58C 2G9HB 3H3KA 1TMCB 1T7ZA 3ES6B 3OB0K 5DR5H 5TQ2H 3GJFK 3W81A 3ZKXB 1MQ8A 3OXRB 1MIMH 2DWEA 4JRYB 4CN1A 4GW1A 4O51B 2AJXH 1EX0A 2DL9A 3D2UB 3MGAA 3ARBD 3HAEB 4NKIL 4K23H 2BHYA 4EJ1C 3HMXA 4PRDA 4WU7B 3U46B 3MO1B 2PTTB 4MXVE 2FL5A 2HRLA 2RFXB 5GGTA 4NO3B 5C0ND 5FF6A 2C4FT 3VH8B 4FA8A 4XAKE 4KKLC 2ZCLL 2VH5L 3VG9C 1JF5A 4I2XA 3ULVH 2H45A 1ONQB 4G8GD 2GJ6A 1F2QA 3QHZL 4XHQA 1N5YH 3MA9H 5HYJB 5FYLD 1KCVH 2ZCKH 4UOJA 1U93B 4Z95L 1S5IL 1S7RB 4ACPA 4X7SL 4X4MA 1T2QH 2XWTB 4U1GC 4HIEA 4EUPH 4D8PA 4EZMA 4YHKH 5HVHC 1OAXL 5CZXD 1W72A 3GSNH 3EOAB 2VTFA 4NFCA 1DQTA 5CP7B 3GJFA 2Y36H 3TA3C 4L3ED 3HZKA 3QAZB 1RY7B 5ISZE 1F2XK 1BVKB 1U8NB 4AIXA 1OTSC 4JY6B 2Z31D 1DBJL 3S3PA 3UO1L 2AJXL 2AKRB 2LE9A 2D9CA 2VO5A 4WU5A 1WBYB 1KEMH 5FM5O 4DWHA 3KLSA 3MZTA 1BD2D 4HUMB 3SHSA 2R69H 2GYSA 3MA7B 4JPVL 3PWNA 2X4RA 4HMEA 3X3GL 4WHYH 3W5MA 1MCSA 4KJWC 1RJYB 2XG5A 4IDJH 5D7SL 2Q7YB 4NZTL 5SWZA 4J12A 2HT3D 5HHME 3MFFA 5E2JA 4D9QE 1F4WH 3GM8A 3BH9B 5FKAB 4U3HA 4HGWA 2D0FA 4MQTB 2DLEA 3VFUB 1I1RA 2YD2A 2V2TA 4PRAB 5IB5B 3L6FA 5T3ZD 3QZWB 3WUWG 3PXHA 2B1HL 4J3VA 2XTJE 4TVPL 3KLHC 1S3KL 3UROR 3V79C 3BPLC 4PJ7B 1NCAH 4JLRA 1JN6B 1UG9A 4CMHC 2F74B 3GMOB 1S7UB 4XNZB 1EEUA 3LN5B 3V4PH 1ERNA 3DWTA 3THMH 1ETZA 1F11B 4NP4H 1QSVA 1IVLA 3CFEA 1FIGH 3GBNL 1RZJC 1BX2A 2DDQH 3EZJB 3UTTA 2DQFB 3ZKMD 2IFFH 3UJJH 3PP4H 1P4BH 5JA8B 2YD9A 1D9KD 1MJ8L 1QP1A 2Q8BL 5EIIA 5SWSE 1I8IB 1T66C 5HYSA 3OR7A 2LU7A 3WUZA 1T7VA 5IB3A 4MJ5A 4BZ2H 1QKZL 3IDYC 1FPTH 1ZAGA 4NO5A 4WUUB 4JN2A 2XIDA 1UVQB 1I3RB 2VABB 1D6EB 2HKHL 1OAXH 5ISZD 1BZ7B 1NLDL 2JE8A 1FL6B 1F6AB 5I8KL 3ALPA 4ODXB 5HGAB 3AVEA 3ARGC 5ESVA 5J11C 3MFGB 4YE4H 3UDWA 4XPGL 5ITBH 3ARDC 1LO2L 3ZE1F 2GTZB 1QR1B 1KPVA 1KNOB 2R39A 1QO3A 3C2AL 2YMXH 3GBMH 5IGXL 2IPTL 5A43C 2JIXA 4Y88A 1BQHB 2VLKD 2GT9A 3VXMB 3Q3GB 2D7OA 1QHOA 1FNHA 5LWYH 5IMMB 4XB8A 1UH4A 2BVPA 1U8PB 2FO1A 4XBEL 2NX5A 5EORL 3HZVA 3TPUB 1T6VN 4Z7NF 1A7OH 3NZHL 4MNGB 4Z7VB 3SBWC 4AMKH 1RK0B 1WISA 2CO7B 2NLJA 1OSPH 5I19L 3TWCL 4OJFH 5GHWL 1PEWA 5GRXG 3H0TA 3LSOB 4U1SB 3MMEA 4PRIE 3WCYA 2FECL 2OXHA 1KTLA 2GJZA 3G08A 4K23L 3R0NA 1CDIA 4X4ZA 1YPZA 2W65A 3CK0L 2ZG1A 4L8DB 3MRDB 1CDUA 1S5HB 4X9IA 3V95A 3D1MC 5DUML 3FONB 3JWOH 3ZDXE 4KKNA 4P2QA 1FL6A 4ONGH 3ULVD 5B21A 1MF2L 3V6OA 3OHXB 1GGBH 3NOIA 1GGIL 5JDJA 2NXZD 2YC1A 3D5OF 1A3LL 4MMXC 1HZHL 1N6UA 3TM6A 3IDXH 4JGMA 2XN9E 4NQEB 4RIRB 3P4LA 4J7RA 2ORBL 4RX4A 3GMNA 4I9WE 1AGCB 5I1DB 4BJLA 1QBLL 1IL1A 4L8BB 4WHCA 4Z78B 1A2YA 1BWWA 2DLFL 3O4LE 4PJAF 4QTHB 1T1WA 3C5SA 4W6WB 1OAKL 3K2UL 5C0CD 1FG9C 1S9VA 3PNWB 1EPFA 5IROA 2V2WA 4JJ5A 2D3VA 4PIRF 3IRPX 5GGQH 5C9JA 3K3QA 4KUCD 4WFHD 2BY3A 1RJLA 1NCTA 1CFTA 3L3KA 4L8CA 3L5XH 5GGRA 4X7EC 2ZWLT 4PG2C 1VADB 1Q94A 3L3OA 4ENEC 4MB4A 5LJYH 2NW2B 3ARWA 2VAJA 1J7VR 2OJZL 4FZEH 1KIPA 3H9SA 3VFVB 3IKCA 3NIGE 4N0UA 4UMGA 4XCNA 3RVTC 5I8KH 5C0JA 3DYMA 3CZFB 3IF1A 4EOWH 3GKZA 2DQCL 4LCYA 1C5BL 5GS0L 3C8KA 3LRGA 4WHDA 4Z7QF 2OP4H 2VDQH 2L7JA 5E8DL 4K3DL 4PJ8B 1IC1A 1XGPA 4Z7WA 1EEZB 2W9DL 2I07B 5E4IA 4LCWE 3D39E 3LMJH 5E0QA 3IDGA 5SX5H 1RMFH 4QRRB 2VZOA 5B3NA 4R4BA 4WTWA 3WXVH 5FO7B 1M71B 3ULSB 1DEEB 4ISVA 5HTSA 5JHDA 5HXMA 1XR9B 3QXTA 4K8RL 1XT5A 2CRYA 4ZUSB 4P23A 5IMKB 1DBKL 2F58H 3SKMB 1J10A 4MA3A 4P2CG 4PS4H 5ETUA 3MRBB 4OGYH 1HCFX 4PREA 5F6HI 1T03L 4CJ1A 3G9AB 2PYEA 4UUJA 4IRJB 1U3HD 4M1GL 5DMGD 2OQJA 3MCLL 5C0BE 2XPGA 1BFOA 2DDQL 1LP9A 5A16B 5J6GB 3L3HA 4HGKC 4JZJC 4P2OC 3ARDD 3HAEG 1I8IA 2W0KA 5KVDH 2OCFD 2EC9T 3EBAA 3KPQA 4OGYL 4JFQA 2MWCA 1CE1H 2ATPA 1S8DB 1OW0A 3K8LA 2VDLL 3VFPA 3S34H 4YHIB 5CJXA 5MP6H 4DGVH 1RZJL 5I17A 4EBQL 4QRUB 1F90L 3U0WH 3S5LA 2BSSA 4HK0A 3DI3B 4PJFB 1UA6L 4JDZA 4OD2A 1CK0L 4DEPB 2RB8A 3DROB 2P8LB 4LARL 2RQ8A 1P4LB 3CSGA 4QNPF 5EU6A 3CXHJ 1NGYA 4P5MA 1WIOA 2Z35A 5CLTA 2MPAL 1X5LA 1U8MA 2OZ4L 2VDNH 3TA3A 1PLGL 3QNXB 1FYTE 5FGBC 4JFEB 4L29B 4Z76A 3MLPA 5B38G 4UILL 4AENA 3BJ91 5C0AD 4XCYA 1NFDA 3RVWC 2ZUTA 1NCWL 1REIA 2YPVL 5GJSL 4WCYL 3QO1A 5E00A 1U3JA 3BP7A 4JKWA 4M00A 3ILPB 1J0HA 5IMOA 2EIBA 1SYSA 4I4WA 4WW2B 1YA5A 1N6QL 5IP4A 5CP3H 4C83B 4PJDE 4PY8J 3AROA 2A73A 5EOQH 3RNQA 3L1OL 2BVTA 1QPXA 4UBDC 5C09A 3S4SA 4PRID 2AEIT 1FNSL 4H88L 2LFGA 4MVBC 4XBPB 1E6JH 3NAAL 5LXGH 3RDTD 2KH2B 2XWTA 4X80H 5ADPH 4XNZC 4QXUL 4G3YL 1IBGL 1U93A 2BVUA 2ZCHL 4ZNCD 4POZC 1C12A 1A7RL 4KV5E 5E99H 3RWHA 5I1IH 4AT6B 3ULVE 2BNQE 1TJHH 2WZPD 5E6IC 4LRNH 4ONGL 4HWBL 1FZOB 1BVKA 3REWB 3QNYB 3QUML 1JWSB 4KUZH 2PW2B 4WGWB 4ALAL 5C0BD 1QRNE 2P8MA 4S1RH 3S96B 3DETD 3B9KD 2CKBA 2PXYB 1XGQB 3ZLQC 4X6CB 1UWXH 5C6TH 3PWPE 1Z9OA 2XACC 4GRWB 4YDJB 5B4MC 1G6RH 3NPZB 4ODVL 5B39G 1KCLA 2ZOKA 1OSPL 5I19H 4OLYL 3MV7A 1WK0A 1JMXA 1NFIA 1KLGB 3SGKC 4QRTB 5JIIA 3BW9A 2NY0D 1B9ZA 3L5WB 3O8XB 3BMVA 4HIXL 2XFXA 4HIHA 3ZYIA 4BH8A 5HD8C 3RWEA 5AG9A 5KS9E 3U6RB 2NXYC 3LQZA 1K6QH 1FZKB 1CDHA 1FSKB 2DQUL 3M45A 1FL5A 1A14H 1SJHB 3BUYA 4V2CB 5EPMB 1NFDE 1HI6A 5CIPH 3VGDA 4N90E 4TOYH 4KJPC 2FIKA 4L3CB 5GGSB 5IFAL 3C6LA 4RDQF 4HQQL 2HRPH 5FGSA 1JJUA 2VISB 5GS0H 1T4KA 5F8QC 3V5DB 4MA8L 3P4OB 3MJ9H 3UX9B 4F9LC 1NGZA 5E2WL 4NQDE 3TCXA 1B0RA 3CFJB 1O7VA 4HEPG 1LK3H 2DICA 1A1NA 5GGQL 1UGNA 4QHKJ 3UDWC 1BZQK 2ESVB 2YPKB 5EIVA 5BJTB 2L4OA 3ZMRA 2F5BL 3RL2A 4ODTL 2W9DH 1H15B 3ROOB 1MCDA 5FYKH 1W0WB 4XCFL 3ARDB 1A1OB 1ZGLB 4LLAA 3DPBA 3L1OH 4M7KL 5DK2B 4KU1A 3HR5A 1FV1A 3NA9L 4P9ML 4DKFL 1GC1C 1HEZA 4NQUA 5TE6L 3KJ4B 5GGTL 1UH3A 5EBGA 1A4JB 4QY8A 4LVOB 4O00A 1N59B 2P47B 4NNPH 3BP6B 3RZCB 5L2JA 2AQ3A 2HFTA 4HKBB 3OHXA 1S7SB 4Z7OF 2EXYC 4HDIB 4OLEA 5I71B 3D39B 3FO1A 1FGVH 3IFLL 3NCFB 4KZEH 1BQHG 3ABZA 1KENL 1E0OB 4W81A 2J8UA 4J4PC 1XF1A 4XC3H 4JM4L 3L5HA 1CVSC 6FABL 4H0HB 1HILA 5E6YA 2HJFA 1N0LA 2IH3A 5EUKA 1MIML 1GC1H 3GSXA 1ES0B 4BM7A 4BZ1L 4C56D 5L9DH 4LIQL 3LRSB 1PEZA 4JG0H 3RKDC 1RZJH 1MSPA 4KRPC 4OCMC 1NL0L 4RMVA 3RGVD 5E8OB 5FUCC 4EXPX 2NX5B 4GQ9L 2NY5L 2VXQH 1P1ZA 3QJHB 4UT6L 4NFDA 4NDMA 4HKBA 3KHOA 2PN5A 3EOBA 4QGYA 4IDJL 4XC3L 4WHTA 5D7IF 1K8IB 1CLYL 4N68A 1IKFH 1FFOB 3IDJA 2J88H 5D1ZB 4HV8B 4FQXA 4XPFL 4NM8L 2F8VA 2EYRA 4OFPA 3HNTL 3QIWB 2KKQA 1S7XA 3BH8A 2PXYA 4HJJL 4NKOA 1N6QH 3MOBL 1U8HB 4YFDB 1J0YA 1OCWH 3IAPA 4ZG1A 3DSFH 1H3TA 5FEBA 3ARDA 1JWSA 3O3BA 4GBXB 4Z7UA 4N1EA 2P24B 5SV4A 4AEIL 4LSRH 1KELL 1X7QA 3MJ8A 3O0RL 5SX4H 2EE9A 1YNLL 2OJEB 3TT3H 5ANME 1I7RA 2XNAB 4G6ML 5IKCB 1L0YA 4GKNB 4XP9L 2M1KA 5AYUL 3KPTA 2ZSWB 4GLRH 1D5XB 5EZJB 5F7DA 2O61A 1BMGA 5DYOA 5HI3C 1YEKH 4Y8AA 2FJGB 3CX2A 3OJDA 5L2KD 1L0QA 3VW3L 4U2ZA 4ZMAT 3RWDA 2YSSB 3GK8L 4KTEH 4HZLA 4L4TA 4PRPE 3W11C 1WF5A 2AEPL 1AQDA 4H0GA 4G80A 4DW2L 1KACB 1G7PA 4ZFFA 4O2EB 3QXDA 1B0WA 3GSWA 4ZPTB 5DJ6A 2Z93B 2BRRH 4MB5A 3QO1B 1QR1A 5C1MB 5D7JB 3WKMH 3VXUA 3NCCB 4YDLC 4J1UB 3SO3B 1AGEB 3L95A 4WY7H 3U7WL 3QIUD 1OSZB 4O5LL 1W72H 4KXZI 3PQYD 4I18A 3OAUH 3U2SB 4XPAH 2PXYC 3EOTH 5KS9F 5T3ZE 3X14A 4HFWA 2PW1A 1FQ9C 3OJ2C 4QHNB 2AQ2A 3MJ6A 3B9DA 5ACZB 2F9BT 3O3EB 4P5TB 1ZLUK 1BHGA 5EULV 4JVWA 1XR9A 1P6AB 4BKLA 3MRRB 4PJ9A 2RHEA 1YECL 5D2LB 4ONOA 2CLRB 1R3HA 4PJDF 3ROLA 3QDHA 2NTSP 4HGWB 4OLYH 1R5IB 1NMBL 1BFSA 4ODVH 4D2NA 1EV2E 4OZHF 4QXGH 4PJIF 5C0BB 3D85A 4Y2OA 1UB5B 4U6HB 3CFEB 4FQIL 3MX0A 5DJCA 4X83A 4YIQB 3T0EB 4UB0L 4PLJC 1HYSD 1JGLH 3FN3A 5C92A 1YEFL 1I1YB 3G5XB 5HDBF 1D5IH 4WW2C 4KDWA 1A9EB 1SYVB 1CL7L 2K3TA 2Z93A 4M6OL 1VACB 1DUZA 1U95A 2YZ1A 4Y4FD 5CKAA 4XP6H 1Y6MR 3KPSE 1HHJA 1JF1A 2A9MH 4G8IA 1I9IH 5HHPB 5L8JB 3FFDB 2Y36L 3QWOB 3AMKA 3NA9H 2IFGA 3GNML 2B4CH 4KPHL 1Q9OB 2V2TB 5D1XB 3S36X 1RURH 4DEPC 3RAJL 1G7PB 3LN4B 2P5EE 5FM8A 3VDBA 2Z4QA 3LPFA 3QDJA 1FC2D 1RUMH 1TETL 2ED7A 1CFVL 4Y4HA 2APVA 1M4KA 5ITFB 4PP1C 2AEWA 5E2UL 4ZUTA 5F96H 5FV2A 3V8CA 3QRGH 3FQTB 3LKOA 4JFEE 4OCRH 3DX9B 3GI8L 5I1EH 2DN7A 4OFVA 1JHLL 1SBSH 4Y4FB 5DR5L 5TQ2L 3LPWA 2O5ZH 2H32A 4JANB 4FG6D 2PR4H 3JWOC 4LAQL 3QCTH 4MJIE 2CIKA 5FGCE 1IGYB 3ZO0A 4POYA 3D18A 5IVXE 4WVRA 1WTGT 4G8GE 2MKWA 4LCUB 3QIWD 2Y5TB 4ZO9A 5MERA 4WDIB 3VXOA 3V0WL 3U82B 2E6PA 3L3DB 4MWFB 5FO9B 3STLB 2X1OA 3VXQB 3O3UN 3WFBL 3IDNA 1ORSA 1WAAE 4M1DL 4KTYA 1LE9A 3H3PL 1GGIH 2VLJD 3S37L 1EO8H 5D5ME 3W39B 1BQHA 2X9YA 3IFPA 3CVHH 1P7QA 2ZZUT 1NMAL 4XI5C 5DS8A 3BP4A 2HN7A 2QV2A 4WI8A 4UQ3B 3MJ8B 3GIVB 2HWZH 3QXVA 3N85H 3TBVB 2YKLL 1QRNA 4M93B 3WFBH 2DTSA 3HG1E 3P77A 1FBIH 4AJ0A 3HA0A 1EO8L 3MREB 1FYTB 1ES0A 1S7XB 3AXLA 3GSNA 4FFVD 3S7GA 4G9DB 12E8L 4TVSa 4EVNA 1H0DA 1KUMA 5I75B 1UKQA 2MCG1 5L0QB 1YNKL 5I1AA 3MRKB 1I3GL 3GJEA 3QNZB 1PYWA 4G6JL 1RULH 1JTOA 5IHZB 2BJMH 4FNLH 4KK9C 4YE4L 5ECJE 4EUPA 3BHBB 2X4PB 5I1JH 1MI5A 3FN9A 3VXQA 4DW2H 1BAFL 4KPHH 2YBRA 2D4DA 2AEPH 5DXWA 4NQCB 4BH7A 1Z0MA 1RMFL 4PYHA 5JZ7C 1PG7L 3GFUA 3CSBA 4HT1H 3IJSA 1G7MB 2KDGA 1OT1A 2V2WB 1KCSL 4JJ5B 1AD9B 3SE8L 4HIHB 4PB9L 3LH2H 3V6BR 1A6ZA 1DN0A 2QQQA 2XWJB 3L5WA 3SDCB 3O6FC 4JFYA 5T3ZH 3TBWB 1MQKH 3B2VL 3D39D 2F54B 4CVUA 4L9LB 5LAXA 5T1MB 3CGTA 4J3TA 3RL2B 1OB1A 4G6FD 5C08D 1T66D 1MCHA 2J2ZA 4HAFA 1NEUA 5KSBB 3TFKD 1VFBB 2ZKHH 4X6CA 1RUPH 1KN4H 3MREA 3NTCL 4OGAD 5IBUB 1ADQL 4KVNL 1H9VA 1KCSH 5D1XA 2F5BH 2IAMA 3NN8B 4LSSL 4LHQB 3X3FL 4GRLC 4DGIH 2PYFB 4TNWK 4R7NB 1MJ8H 4M8QA 2MCPH 1I4FA 3FB8B 4KXZH 2EEDA 3REWA 2DJ4A 4N8PA 1Y6NR 2EE2A 3N9GH 1NGQH 4PV9A 1QVOB 3GIZL 1IM3B 2EDWA 2NY1D 5IV2A 1YQVL 4OI7A 1SYVA 1NMAH 1BOYA 2BOCA 3TPUA 4QRPB 4WTXA 1T0NB 4TUKH 3AREB 4NPYB 3VXUD 4XI5D 3I6KB 1WCBA 3ZTNH 1N64L 3A6CL 2FGWL 5TPWL 2OYPA 4LQ1A 2C3HA 1A7NH 3I9GH 1KYOK 1Q9KB 1GZPB 3LN9A 2EECA 4F8TA 4XB7A 1T4KB 4G7YH 4IOFD 5F1NB 4BK5A 1OP5K 3TH2T 3UTSE 2DQJL 5E08L 3MACH 1JNLL 1GHFH 5DJYB 5D96C 2NX5D 1VEPA 4P5KA 4TSBH 1KC5H 1F13A 1A3QA 4U6TA 1UCTA 3MRNB 5ESAB 5IROC 4JPKL 5GGVL 4J3OC 1SBSL 1XCTB 3HN3A 4HIJB 1BLNA 1KB9K 4Y1AE 3MRIA 2VQ1A 1T1YA 5FYJU 4U6YB 3ARYA 3UZEA 4HK0B 3OKNA 1JHLH 4RBPH 5HYJD 4NO5B 1WWCA 4EN3B 3MRLB 1CE6B 1K5NA 5F7EL 2JJTC 5J6HA 3QG7L 1MJJA 4UT7L 4R97B 4AENB 2GJ6E 4JM2A 4KVCH 4MDJA 2Q86A 3G5ZB 4HJJH 4G9FE 2HKFH 2QADB 1Q72L 1QD0A 4HHAB 3GSNL 3ARBB 1KXTB 4JRXE 1H3XA 1D5BA 4TTDD 1ZMYA 5I1KH 2UYLB 3FQUA 4U0RB 5C07B 1DUYB 4WI7A 2FBJL 43C9B 5D71L 2BNRE 3HI1A 3KLAA 4C55A 1S7TA 2LABA 4YNYA 5IV2B 1S7WB 5JW5B 2Z35B 4G8GB 1IGJA 2DIAA 4XBPA 5ALCL 4K71B 4YEEA 3NH7L 4Q0XH 1MAML 3SE4C 4E41A 2B0SL 5ID0A 3UBXA 5T1LD 1CG9A 3O3BB 3DV4B 4GAYB 3VFTA 1I8MB 4Y5VC 1FO0L 2B2XH 4NRZA 3H2WA 4ZD3L 3HUJA 3ROLB 1FVDA 5DD5L 4JPWH 3BPCA 2OR7A 5FDYA 2E5EA 3AFLA 2CXGA 5L9DL 3D9AH 3DURB 4XTRD 5DJXA 3V52H 1G7QB 1DQQB 3OV6A 5C07D 2EYRB 5F3BA 2EDOA 3U0WL 1PAMA 4DVBA 3ZE0E 1ZHLA 4LDEB 1IEBA 4JFYB 3TBWA 1KB5B 1ZT1B 2OR9L 2XRAH 3L3HB 4RAUB 3PWNB 3QCUH 3RI5F 5CBEB 5AAMA 4R26L 3JV0A 5I66B 1TVHB 3FFCB 1CF8L 3FT2A 5HHMB 1JZ7A 4HZAA 1XF3A 4ZUSA 1NC4D 3ARFB 5E94A 2VL4A 1LILA 1BM3H 4XMPL 1AHWC 5J1AB 3C9NA 1VPOH 2ED9A 4PJ8A 3EDKA 5CUSH 3BZ4A 3LAFA 2P7TA 4DAGH 3VWKA 4M9OA 1MCCA 4LCCA 3WUWB 4UTBL 3HMWH 3U0TB 2J5LB 4M4PA 1IC5L 4H20L 2I9TA 1R3HB 4P9MH 4MXWL 3HC0B 4Z7VF 5DJ2A 3RZWA 2BC4A 3T0DA 1U58A 4PV8A 2VZUA 1NCUA 4B50A 5DSCB 2NTFA 2CH8A 1CICC 2GFBB 4KROD 5C0AB 1NLDH 1YMMA 4TVPD 1CU4H 4YZFF 5ELIA 1QOKA 1AH1A 1X5IA 3H9HA 5D93B 1FIEA 1NUFA 3CVIL 5DA4A 5IQ7L 1AGBA 2CR3A 3VWJA 1RIVH 5GSRA 3MLRL 2GQHA 4ZTPH 2I26N 4TTDC 4WV1B 4L8CB 1PY9A 2AK4D 5D96B 2PO6C 5D1ZA 1T89A 3QI9B 4AL8L 1AIFB 5E2VH 3RVXC 4TNWF 1XF5B 1I9JH 2G2RB 4HS6A 2BNUA 4H8WL 4Z7UE 3CFJA 2DYPB 1E6OH 5I8EA 4NO0A 4R4FL 4UDTB 5IMLB 4AYFA 4JQXA 5JMOC 4OLWL 5MI0C 3AUVA 4I3RH 3OKMB 3EDJA 3FB6B 3WXWL 4NO2B 1XGUB 5C2UB 2R29L 4XPFH 5AD0B 4WW2F 2W38A 4ZXBA 5ENWA 3MMEB 1YYMH 3ILQD 3TVMA 4LLWB 2QQKH 1S7VB 5FKPB 1CICA 3RY4A 2SEBA 1XCQB 1YN7B 5I8CB 3QQ3A 1G9MH 3DVNB 4QXGL 1DCLA 2K1MA 4PJHF 1R3IL 4LPCA 4RRPG 4NO0B 3ZTNL 5ADOH 2EXWD 5E5MA 2DIJA 2XI9A 4DUXA 1IQDB 3EO1A 3UEZA 5IBTH 1X5XA 2UUDK 5DQJA 1XZ0A 3KPNA 2E9JA 1MCQA 5TE6H 3ZHKA 4PRHA 4LRNL 4QHMB 3EOBB 1TZGH 2P46B 3MLSH 2FWOB 4MD4B 1MVUA 4P9HL 1G6RA 3QZWG 4NJ9H 5GGRY 1Q72H 5H37G 3V0VB 5J1AA 1NJ9B 3VE0A 1KG0B 4YHYB 2WSKA 5IJVA 1HSAA 4OD1L 1H5BA 4MQXC 4G6KL 1UXSA 1BEYL 4RMSA 5FK9B 1V7MH 4KH2A 4UIKL 5CZVH 1Y0LA 5F1SA 3FO2A 1OP3K 1DE4B 1X4YA 3NCYS 1INDH 5B22A 2JB5L 3V5KA 2P8PA 5MEOB 2LAGB 4P2QE 3P4OA 4BQBA 4R0LC 3WS6A 1JGEB 3T1FA 4TULL 1GOGA 3IDNB 2DLHA 4XGZA 4NQVB 1HI6B 3B4NA 4F33B 3F8UB 5DJAB 5I1LB 5EZLB 3BT2H 1OWWA 1MRFL 5E1AB 2EYTA 4Y8DC 4NBXB 2CDEB 3MRQB 4JKPH 3ILPA 4F7MB 5E2UH 4NN7C 5FKAA 3HI5H 2A0LC 4XVUD 2R0ZL 1QBLH 5I2IB 3UBXB 4AEEA 3ZSSA 3HB3D 1ZVSB 3QUYD 4U1MB 2ZUYA 4QOKE 4RAUA 3BZFB 1ZLWK 4P4RB 4QO1A 1X5ZA 3K80A 5MENE 2R0WL 1M05B 3UPCA 3IU3A 4X7DC 1YEIH 3CCHA 5DQ9A 1N7ML 3ARUA 1BM3L 3HI1B 2CXKA 4NM8H 4TNVK 4LCIL 1X44A 3RIAF 4NKDA 1EDQA 3V52L 4HUUA 4H1LH 3QIUA 4WI6A 2CDEA 4I77L 1MFEL 1ZK9A 2CR6A 3Q5YA 4CGTA 1PQZB 1T22B 4G80B 2VDPL 3LRHA 4LSVH 5CMAB 4LCCB 5JDSA 4L4TB 3EFFA 1UM4H 2C4FU 5F7UA 3PGCA 3EJJX 4G5ZH 1DL7L 3NMEA 1CFQA 4LL9A 5FGBA 3DI2B 1P9MC 7FABH 1BX2B 2RCSL 4ORGA 1NBQA 4XP1L 2EXWC 4NCDA 2FZ3A 3EAKA 4XBEH 2WIIB 5EORH 4KK9D 4PJ9D 1OGAA 2WANA 3HI5L 3AAZA 3SKJL 2Y07H 3DGGB 1YEGH 4GRMB 2OS7A 5FK9A 1TVHA 2RGSA 2IEPA 4FQPA 1IEBB 3RGVA 4P23C 4OSUH 4ZTPL 2VUYA 2EDXA 2GKIA 4ZS6C 3PF2A 4LEXL 1E6JL 5LXGL 2HG5A 2LVEA 1JP5A 3ARED 3VXUB 4GW1B 5E2VL 1J11A 1CD9B 5HHMD 1EO7A 4K7PL 4PJDB 3V5HA 3G6JA 2C1PA 1W72L 1XZ0B 5E99L 3EW3B 4H5SA 5I15L 1SY6A 2OR8A 1KB9J 3VD7A 5H35A 3SJVB 4OLZL 1CGTA 5FA3B 5I1JL 4TUOA 1TCRA 1J0KA 1CDCA 4WO4B 5EU7C 4OGAC 2W0FB 2CRIA 4LHUA 4YHZL 5I30L 4NO0D 5DYOB 1DVFC 3O45B 5IW3A 5MEOA 1MJ7H 2KZWA 4HWZA 2BOBB 1U8QB 5IB4B 4JKKA 3B2UC 3WLWC 1OW0C 2MJWA 4CADA 3TT1L 1JHKH 2IQ9L 2YUZA 3WO3B 3GSWB 4S1QH 4XNUL 4HH8A 3GI9L 5TQ0H 4LLVA 4BFIA 4M61B 4HXAL 4YDVB 1PX4A 3BKCL 1PQZA 1G7LB 5HHXL 2CMRL 2YWYA 2HT2D 5IMOB 3ULVL 4KWUA 1X9QA 5BS0B 1MNUH 2WLZA 5ADOL 3H7LA 1UM5H 4OLWH 1TENA 5DD0L 5LBSL 4JFEA 4KQ4H 4Z76B 1OAZH 4JFFB 4XVTL 5GXBB 1HNFA 2ZG2A 3UC0L 1JHTA 4Y2DA 4M1CD 3CH1B 1U8MB 1Z2KA 1MCPL 5A2JH 1R5WB 1EO5A 3FMGL 1MFCH 4NCC1 1H3PL 4R4ND 3HNVH 4JFFE 3I85A 5E8NA 4B53A 2ESVE 4HK3J 4FFYL 2IAND 5BW7A 5I2IA 5C0CA 3HZYB 3VXPA 4OIBA 4IS6A 3VWKC 3OKOA 5DZNA 4XVSH 3G5VA 1TZHB 4QRRD 4JHAH 3QUYC 5ENWB 2EDBA 3MV11 5K59E 3LQAH 4F7PB 3B9KB 15C8H 2OSLB 4IM8A 1JV5B 5JXAH 2CQVA 2APBA 4K3HA 1IT9L 1V3KA 1BF8A 1EAPB 1OLLA 3SDCA 3NCEB 3QRGL 3EIFA 4JFZH 5ITBL 4AY0A 4PJ5D 1IC4L 4XNYH 1BJ1H 1U3HB 2DRUA 4MLSA 5C0EA 2UVEA 1FGNH 4OCYL 2YUXA 1SJEB 3DIFA 1FZKA 3RPKA 2G60H 1A6VL 1LEIB 2N7AA 4HWUA 3RWEB 1M7DB 2AXGB 1IM9D 4XMPH 3KG5A 3VWJB 3FFCA 3T77B 1HQRB 5KW9H 1BQUA 4Y19B 1I4FB 5IG7A 1ZT1A 4MCZA 4OCWH 4DKFH 2DI9A 4U4BA 2NPLX 3FB5A 3ZKSD 1OQOA 3CMGA 4GMTH 3E2HB 1N0XL 3MRKA 3IDGB 3OWEA 3I3DA 4D9RE 5KBNC 2VWEE 2MMXA 4L1DA 3KXFA 3GZKA 1U3HA 3WNLA 4WWKB 3OPZL 3MROA 2D7TH 4YHOL 1DVFB 4MCYB 4ZS6D 1JTPA 1YJDL 1IKNA 1NANI 4X4YB 1UEYA 4XPBH 3VFRA 3WS3A 4PP1D 4N0UB 3AREC 4JRWA 2A77L 4JFZL 2AJZA 2R4SL 4WDIA 5HD8D 1P53A 3B9EA 2DQJH 5E2WH 5E8NB 4XBGB 4DFHA 5KSAA 3D48R 4KI5D 1ZT7B 3S35L 1BBDL 3H0TB 32C2B 4CU6A 2Z91A 5IQ9A 1A5FH 5FIEA 4TSBL 5INDA 3U4EB 5ALCH 2I5YH 5LGKA 1Y6KR 3KS0H 3A0OA 3QSKB 5K33A 2P5EA 4UT6H 3BHBA 1NCBH 2IPUK 2DB8A 2NY5H 2VXQL 5D7KE 5HPMA 1HOCA 1KIQA 5GZND 2BSED 5DTFB 2A73B 3QCTL 4GLRI 5CFHA 1W0VA 4NQED 1XGYL 3NACH 2DKMA 4OD3H 3WL9A 3VXOB 1SYSB 2FIKB 3VMPA 2COQA 4NHUA 1QO3B 3GBML 1FORL 3IDIA 2C3WA 2CUIA 2R0LL 2R29H 2V5RA 3HI6H 2YD3A 4LLYB 2FR4A 1NGPL 3C5JB 2IBBA 4WTZA 4ZS7L 3PDDA 2YEZB 1KN4L 4L4VA 4U1LA 4OZFG 1V7NL 3SDXA 4LLVB 1HSBB 1KYOJ 1U92A 1D5MA 2R1WA 1EGJL 3HUJE 5DMIL 4KRMB 1HQ4B 5KN5A 4QRRE 3C09B 1R5WA 3S98A 3AU1B 5E8DH 3BKYL 3ESUF 2YWZA 1KFAH 4R0LA 1CLZH 2VOTA 3MRHA 2APXA 1N8ZB 2A6JB 2XKNA 5HHOA 1FH5H 3IT8D 1NAKH 1CU4L 1DUYA 1LNUA 5JXEC 1BZ9B 3TT1H 1MIEH 2VXVL 4FQQA 4M6ML 2IPTH 4ZFZA 2ATPB 1F58H 4OZHB 4CVZB 2OTWA 3ARFC 2H1PL 3C6LD 1QYGL 4FQLL 2AERT 4WI5A 2VNCA 3KJ6L 4CVWA 4HJGA 3TBTB 4TTGA 2BXZA 3RDTC 2GITB 4GG8A 3OKKB 3EOAA 2EO9A 4WCYH 5CSBA 3RX7A 1ACZA 1OM3H 1FLRH 2FX9L 2AI0L 3MRMA 3ZKMC 3OKLB 5C70A 1EXUB 1L7IL 1X6LA 2QSCH 2X4UB 2YRPA 4PG9A 1UCBL 1D5ZB 1U8QA 1NMBH 3MV7D 2NZ9C 4YXLL 5E9DB 1KIRB 5EU6B 2NZIA 1ONQA 4YPGB 2CKBH 5F7HA 1H8SA 4L8SA 4XXDB 3CK0H 5F72S 4K9EH 3QA3A 1GJIA 4N5EC 5CMAA 1P2CA 5AUMA 3QDGD 2IC2A 1BJ1J 4EBQH 5TH2A 5GPRA 3QISA 3F65A 4NNXB 4O2EA 5D2LA 4C56B 3D2UA 3KYKH 4JDTL 2GK0A 2OL3L 3MJ7B 4P99A 1MOEA 3BWAB 2BXYA 5DRWA 1HIML 3DV4A 1DQLL 4GSDH 3PGCB 2BVQB 4L9DA 3VFWB 43CAA 1R6VA 3CCHB 1U36A 3O6KH 1T83A 5T3XH 4YK4B 4WI4A 3VGHA 3Q6GH 3WSQH 5E9DD 3I2CH 3VFVA 3IFOB 1XF2B 3IXTB 3KLAB 4YHPB 1AKJD 3PGDB 5C3TA 1MWAH 4KK6D 3EOYG 5ICZA 1N4XH 1RUAL 1L7IH 2QSCL 1RD6A 3NTCH 2BY1A 1O5DT 1JYNA 4F7MA 4E5XA 1Z9LA 4EXKA 5JW4R 5KANI 2HFFB 1GIGH 4LKXA 1P4IL 2A1WH 4GBXA 1AJ7L 4Z7UB 2C3VA 5JQ6H 1KJ2A 2CKNA 3S37X 4XWOD 3BZFA 3U7YH 4HWBH 1OY3B 5GRZA 4P23B 3L6FB 5D2LF 1AR2A 3NN8A 1NC4A 1N0XH 3F6IA 4GJTB 3BD3A 1I85C 2CK2A 1RUML 2XXCB 5IM7B 1DVFA 5HGGS 5HJ3B 1FN4A 3ZTJH 1QNZH 5HGBB 5F71A 5LVEA 5DT1H 1HE7A 1UJ3A 3B3IB 1P5UA 1IAKB 4E41D 2PXYD 5EBLB 3WXVL 4P46C 4YUEL 1T2QL 3OAYK 2MKLC 4JGUA 3NIGF 4F57L 4R90H 4NUJA 1XCQA 1YN7A 1BP3B 5BZDB 3H9SB 4ODHL 2YEZA 1ZHNB 4NYLA 3DSFL 4RMRA 4Y1AB 3QUXD 3HRZA 3L95B 3CSYB 4JR9H 2H41A 4X4ME 4LEXH 5AAWA 4GOSA 2Z31B 3C60D 1KCVL 3U4BL 1MCJA 4HCRH 2ZJSH 4NBYB 4A6YB 4RFNB 3OR6B 2ZSVA 5F3HB 2EYTB 4G6MH 5CUSL 4YXKL 1CQKA 2JLLA 5EFIB 1AQDB 4MNGA 1YY9D 4OZGA 2L0DA 1Q9KA 4LHJB 1R5VA 1J1XL 2DMBA 1ZHBB 2A9ML 5ID1A 1P7HL 3VWJD 5T1KD 1KGCE 5KZCB 4HS6B 1SVCP 4QNPE 1FO0A 2HH0H 1YMME 4WW1A 5EH1A 3S37H 1QFWH 3IKCB 4XCNB 5EOTA 3QEQD 4KMTL 2OR9H 2XRAL 3P9LA 3MRHB 1FVCB 5F1IB 3PWLB 1KPVB 4O2CA 3RGVC 3QDMB 5JTWA 3GM0A 1MREL 1MY7A 2X5PA 3DMMB 3LOWA 3QUZB 3VU2A 5KS9A 4JN1L 5HYJE 4Y16A 4XH2B 4AH2B 3DX6A 1NGXA 2B1HH 4S0TD 2VZ3A 1IJ9A 3G5YB 3WIIH 1C08B 1RV6X 5HGHA 4RCAA 1KT2A 1RHHA 2GFBA 4WGVB 4K3JL 4OLUH 4XC1L 1J86A 3SDCC 4LLMA 1RIVL 2E7CA 4HEME 1JHTB 5BV7H 4PRPD 4QTIH 5EOTB 4KRLB 2V2XA 5DQJB 3V0WH 3W39A 4AK1A 5I8OL 5E5MB 3KJ6H 5HPMB 3KWWB 4ODUB 3T2NL 4N9GA 1Q0XH 5F7MC 3GSVB 2V5TA 3KPRE 5GISH 4UOW1 5IW1A 3PE9A 5KVEH 5CS7A 4I3GA 4F9PA 1HHGA 2GSIA 2WBJB 3KDMB 2EDTA 3RL1A 3DIFB 1WFUA 1ED3B 2VXSL 3PWVA 2XZCH 4PJHB 4RX4D 3UAJC 3TVMB 1KBGL 2FX9H 3VD3A 1TNNA 2XQBH 3L3GA 1FPTL 5HVWA 3FB7A 5BV7C 5HI3D 2A83B 5ICXB 4HXBH 4RISL 4JKMA 4P59L 2BC4B 3VXTA 5HDLA 5E56A 3VA2C 4NQTA 3WNKA 4PJ7A 3U4AA 1I7UA 1PKQB 3RIFF 2X89D 3VXNB 4AEIH 4RAVB 1J05A 4TRPH 5T3ZL 5DVOA 2YZ8A 4KGLA 1YNLH 4GUPA 1IRAY 2IPKB 4MA1C 3TT3L 4YJZL 2CGRH 5D1ZC 5FYJE 5EDXA 2WV3A 1IARB 1UWEL 2H3NB 2AJSH 3QDGA 1A14L 2ITCA 1FFNB 1KB5H 4IMLB 3SDAA 3WO4C 4YH6A 5C8JA 4OZIF 2HKHH 1VEMA 2X7LB 3WJJC 5EIIB 3RFZC 1XIWB 1YMMD 4V1DB 5EO1B 3T77A 2F15A 4KRPB 5CBEA 5T3XL 2AEQL 1QLRB 4MJ4A 2ZUWA 5DUPH 1C12B 1P69B 3SDDB 2HFEB 3VGFA 3B8SA 5A2KH 5IESH 3L7FA 4KHXH 2NY1B 3WFHB 1RUAH 3MLZH 3M07A 1HWGB 5D7JA 3WNOA 3WIFA 3S9DB 1AJ7H 4RGNC 1IGIL 4HLJA 4ELKA 1MCPH 3C5ZA 5LGJA 1FNFA 4JO2L 1W0YT 1KJ2H 1GGYA 1H3PH 3G9VA 2OSLA 2HFGL 1E4JA 4OQ1A 4A2MA 5LCVH 4QCIB 2QQNH 2GSGB 2OL3B 2Z8SA 3WD5H 3EFFB 3EGSA 4S1DD 4OUOA 3ALXA 3HE7A 3RI5K 3QDAA 1QQDA 4XVTH 4M03A 1QLEL 2P49B 3K46A 3QUMA 4NNXA 4CN6A 3G5VB 3VRJB 1J8HE 1Q0YH 3HFML 4OM0H 3U6RA 3W0WA 3Q1SH 5JR1H 1KPRA 1I3VA 2G5RA 5HDBE 2X4TB 2R4RL 3BFOA 4IRZL 5D1XC 2R56L 5C9KA 4QKXB 3SO5A 1KPUB 3VRIA 4KZEL 1MCKA 1XF4A 3F7YB 3STZB 1CFNA 4PJFA 4QHLB 4PB0H 5JUEH 2V7NB 3WN5B 4M02A 4M7KH 2A38A 1ZS8B 5IVZA 4LSPH 1MLCB 1YYLL 2PCPB 1WV7T 4CW1A 3SDYH 3EGSB 4UT9H 5GRJH 5C0RH 3T4YB 2R2EB 5HDQH 3BAEH 3QNXA 3SGEI 3NPSB 4XP4H 2QSVA 5I6XB 3UP1A 3SE4A 1G7JA 1BGXL 2HTLC 1NAMA 4F7EA 1OP9A 3F12B 4GRLB 4M5ZH 3K2UH 2AP2A 4NDMB 2B4CL 3MLVH 4M5YH 4NGHH 4XPTL 4WIQA 3I6KA 3BDYH 2W59A 3MLUL 5SWZB 4FABH 2HMIC 5T1KA 1CLYH 3CU1A 1S9KC 4PJCF 3DGGA 3T3MF 1CXKA 3S5LB 1DE4A 2PYED 3X11A 2BOBA 3G6DH 3ZYZA 1IC4H 2FH6A 4UOW0 3PL6B 3GSXB 4JZNB 2AS5M 5IK3A 2IMNA 1WBZB 4MA7L 3TBYB 3ARZA 2AJVH 3F12A 5JIHA 3CVHA 3MRNA 4YBHA 4Z0BH 5GRVK 1AGDA 3D39A 1I9IL 3G6JE 1T1XA 3C6SB 3QH3B 3SE3C 2X4QA 3TH3T 2FATH 5SV3A 4M7JH 1BZ9A 3WFEL 4GH7B 1GRWA 1J0JA 4JRXB 1U6AL 2OQJB 3MRLA 1AO7A 4JZOA 2AK1H 4UQ2B 2R1YA 4F7CB 1A6UL 4LLQB 4X6BA 3RA7H 3BEVA 1LGVA 4GS7C 4ZTOH 2A0LD 5KSVB 4X6EB 1NFDF 2N7BA 3W9EA 3CFKB 4JGJA 3X13A 4NQCE 2HFGH 1C5DB 3P4MB 4XAWH 2VIRB 5F6IB 3MR9B 2QHRH 4JPIA 5DRXA 1HHHA 3HAEH 1A6ZB 1DN0B 1D5MB 3FB7B 3DOSA 1XIWA 1T0NA 1BVZA 5I75C 2NYYC 1JHKL 1DEEA 3OF6D 1CGWA 4ZPTA 5DJ6B 1F97A 3S36H 3RJQB 2Z8WC 2A2QT 2EKSA 4EN3C 4LQFL 5EZIH 5MEQB 1UYWH 2IQ9H 1CBVL 3AS2A 5HI4C 3HLAA 1HNGA 4F37K 3EOTL 4LSUH 4MJIB 5FGCB 4XNUH 5JXED 4AM0A 2XN9A 2JJVA 4ZOBA 3O2VL 3N9GL 1D9KC 3I3BA 4TRPL 4QOKA 4U1GB 5HGDA 3PJSA 4MJ2A 1F8TH 1W8NA 3OGOE 4ZFOB 3TH4T 4DGYL 3RTQB 2Z9TA 5KVEL 1UM6H 3AXLB 1TVBB 3GSNB 3SGKA 3HR6A 2XQBL 1YPZE 2Y6SD 5IVNA 2XA8L 1YJDH 2DWDA 5CIPA 4XNMB 3ECBB 3WKML 4K8RD 3HZYA 1F58L 2AGJL 2CDFB 4I18C 1NDGA 3ZYJA 1YUHB 4QRQA 3F7RA 4Q6IA 3ARGD 1CXEA 4GRWH 3U7YL 3X13B 4PUBH 2AJYH 3RVUD 1PSKL 2NY0C 5E8EA 3VFRB 3WS3B 1G84A 1GAFH 1II4E 4MSWA 4RQQA 1CWVA 4JQVA 4YXHH 3MYJA 3SE8H 1EZVX 1U2CA 4LEOB 3RHWK 5D7LB 3UPRA 1HZHH 1KSRA 4I5BB 4M6OH 5D5MA 3CFCH 4MX7A 2N1KA 2EDJA 3O6LL 1ORSB 2QQNL 4HUNB 2CLZA 3AB0B 4Z7WF 3DVNA 4JFOB 3ZDYE 4LDLB 2YD7A 5DEFA 3FMGH 1DFBL 2X6MA 4RGOH 3D87B 2F53A 5DJDB 1YEDA 1IGTB 3C87A 4JY4A 5HVGB 2Z31A 5L2KE 1FLTX 4GT7A 4HS3A 4JDTH 5AG8A 4CJ0A 5F9JB 5C6TL 4D9RD 3UYOD 2QQKL 4HPYL 5FM5M 4CNIB 1R3IH 1J9CT 5J9PA 1GYAA 1YYML 1IAIM 4GKOA 5KSBF 3EDEA 3VXSE 2FB4L 1LE9B 3IJYA 4HWEL 5SWZD 4DKEL 3FO9A 2DYPA 4UINH 3ZT6A 1BQLH 4JVUA 3NBNA 2R1XB 1NEZA 2FYYB 4DVBB 1GGUA 3VG0L 3HPLA 1SY6H 4PJGE 1NUGA 4PLKC 4PFEA 1SEBB 4K94C 3PHSA 3AS1A 1VHPA 1IGYA 4IRSA 5KVFH 1TZHA 3DXAA 3WDIA 4DZ8B 2R4SH 2X1QA 5IB1B 4R9HA 3T09A 4O4YL 2EDNA 4XH2A 2E27L 4D3CL 5KSBE 3N1GC 5ID0B 1QSFB 4FTVD 5HYQA 1N5AA 3I75B 1OGTB 5IK3B 3EYQC 2VR4A 4LPUA 2WBJC 3QEGL 1A1NB 3MLTA 4NO2A 5CZVL 1P7QB 5IM7A 2EYSB 3MXWL 4XRCB 4JEGB 4OQTL 3PGFH 3MCG1 3QIBA 2NY6B 1B0GB 4GG6B 3ARRA 2QLVB 4HW6A 5BS0A 4K8RC 1CVRA 5AZEH 5ITFA 4C54A 2HP4A 3AMLA 1BGXH 1DQJB 4OTXH 3HC4L 5B38B 3U79A 5IB2B 2AJUL 2WWKT 1CN4A 2PKDA 3IJHB 3ARXA 4YAQA 4UV7L 3FTGA 1T04A 1ETZB 1P2CB 3BP5B 1JWMB 1JFQL 4P2OA 1WICA 3QEHB 5IBLD 2VN7A 2CIKB 3MV9D 1P84J 1INQA 1R3KA 4FTVB 1N64H 2UVFA 3MR9A 4HULB 5ISZA 3RJDA 5B4MD 4OM1L 4QRSA 5TGBB 5DD3L 2DQGH 1NCAL 5I1CH 4MAUH 2R15A 3IXAA 4APQB 1A22B 3DROA 3VFWA 3QJFB 1EXUA 2EEAA 3BPOC 1JPGA 2XWBA 5CCKH 4YDJA 3I50L 1XIWD 1YNTA 2DQDL 4Q9BA 2FHBA 3IETA 2Y9RT 3HC0A 5DJ2B 4LNRA 2ZNWA 3QXDB 4HKJA 2P44B 3IS1X 1ZANL 1VKXB 4HJGB 3W5NA 4JY5H 3VDAA 2NXYD 1HHIB 2R2BA 3GJFB 5DMYA 3RWDB 1S3KH 3EHBC 4KJYA 3QEUB 5ABDE 4AT6A 5L8LB 4ZUWB 1OM3L 1KCKA 1BIIB 3TGXA 3MQIA 2JCCF 3QIWC 1D5ZA 3R8BB 5EBMA 2X4RB 1QLFB 5KANG 2X4UA 1QTYT 4YHOH 4LVNB 5GRWA 4GRMA 4YHPA 3CXDL 4Z7OE 3QUXB 4IOFC 2JKXA 1RIHL 4YAQB 3L9RA 1J8KA 4TSAH 2XKSA 5IJVB 2HFEA 1VFAA 3FL7A 1VFUA 4HT1L 1LDPH 2ILLA 4KUZL 2P5ED 5FOJA 3P4NB 4MA3B 2XY2A 4PUBL 5I1KL 5ICYB 3KPMB 4KKAD 4NN5B 5DVMA 1IZKA 1WBXB 1WZLA 3QFDA 5DFVC 2CLRA 3UJTH 3F58H 2H26B 1NMCB 2R1XA 3DTXB 3MC0A 4HXBL 4RISH 4XGZB 1I1FA 2PO6B 5E95B 1JUFA 4ORZC 3KYMB 3MRIB 5L2KB 1AHWA 1A4KA 2YPLD 3MRJB 1GOHA 4QRSB 2A74A 3DUSA 3OKDA 2H2SD 1VDGA 3MXVH 1F4XH 1RUKH 3CMOH 5F88A 3FOMA 4Z95H 2WWMC 1U8JA 4KKBC 1WFTA 4J4PD 4OCNC 3VXSD 3T3ME 3K1KC 1G9NC 3OKKA 4GG8B 1ZSDB 2Y72A 4PY7A 2FHCA 5ALBH 2Q20A 3AS0A 1OT2A 5EN2B 5FDWB 1MHCB 1QBML 3O2DA 5I1LA 1AP2B 5T33H 3H9SD 1E28B 1BJ8A 1NH6A 3NZ8A 4NUGL 5C3LD 2FWOA 4ODUA 4LSRL 5K9OB 1RZGB 4I5BA 3ARGA 1EA9C 5E08H 4OCLC 1MCFA 4FQ1L 3C60A 3NFPB 5C0CE 5DRZB 2JIXB 4PG2A 1TZIB 3L7FB 3NCMA 4HWBA 4YDLB 5DMJB 3UTZB 1I9EA 4S1DC 3CPLA 1WEJH 5DHVB 1Y0LB 5JMRA 5FYKD 5T5FL 3J8F7 4NKMA 1OGTA 1FYTA 1WIPA 4EDWL 1XCTA 1DEDA 3LS5L 4PJ8C 2D0HA 1DQDL 2NY4B 4M43H 4MNQD 2W60A 3NZHH 4MD5B 1ZEAL 1MVUB 5T1DH 3NCYP 2AEQH 4PTTB 1KTLB 3K8KA 5KG9A 2VLRE 5EUKB 5AD0A 2NCMA 3U4BH 4PLOB 5T33L 4QOKB 2EDHA 2VQUA 4JFXA 4KK8D 4WW1B 3R4DA 2XN9B 4Y16D 5IMLA 3GBLA 3LKSB 2ARJB 4JAMA 4JJHA 2XQYK 4Y19A 4O02L 5GS0C 1E27B 5DFTA 5DJ0B 3KNBB 4L3CA 5GGSA 4AEHL 2E7BA 1ZLVH 2CDGB 5J3HD 4NQXB 3WLBB 1OD7A 1OARL 3NABH 4YR6A 1OLZA 3L3KB 4PRPB 3GRWH 4HCRL 1UWEH 4LKXB 4YDKL 3BRDA 3TIEA 4KAQH 4RZCB 4NBZB 4RA3A 1IKNC 1RZFL 3WIHA 1FGNL 3FOMB 5IW1B 3MNZB 4R2GB 4WHYG 3FHAA 4LPWA 1UWGH 3MODL 1BFVL 5TF1L 3INUH 3EO0B 1WVZA 1TPXB 3O2DH 3OX8B 3PJSB 1NBZA 5F44A 3T04D 5E6IB 3VRLF 3WKNA 2X41A 5CD5D 1LWRA 2J6EH 1GCFA 3MBXH 5JO5B 4UB0H 5JOEA 3TCLA 2BVQA 3QDJE 4BA8A 2WINA 2H2SC 1MJUL 1JZ2A 1AIFA 3IU4H 3WJLC 4XCFH 3RVWD 3B6SA 2ARWA 5SWSD 3BPCB 2IQAB 3DVIA 4KY1H 1P7QD 3P11H 4AM0B 4IMKA 1HWHB 5EZOL 4DQOH 2HJKA 3C2SA 3U0PB 4P9HH 1I8LC 5F89B 4R2GD 4MXQD 2VE6B 3LS4H 4L8SB 5EC2A 1OARH 2GEEA 4KROB 4Q9RL 5I71C 2CUMA 1IC5H 2VDLH 2WQ8A 4H20H 1A9BA 1ZT4A 3RWGA 1MAKA 4QRTA 2FATL 2LTQC 3VFOA 1KCUH 1Z5LB 2D0GA 3BWUC 5E8PB 3MV7B 4AIOA 1I9RH 4ETYA 1VENA 3FQRA 1CF8H 4NQXA 5AWNL 1BBDH 2NX5E 3BGMB 1OWRM 1WBYA 4KRPD 3D69A 4X7CC 5F7WC 2NY0B 5IHZA 2P8MB 3P0YL 2G75A 1ACYL 4L4VE 4LVNC 5F7NC 3JTTB 4HXAH 1ZEAH 3UTQA 4E0RB 1ND0B 4PJ9C 1HKLH 1KTDB 3MNVB 2YA0A 3VXUE 4QYOB 2NNAA 4PYGA 5GHWH 4ELME 4YDIH 1MLCA 3PABA 1UM5L 5HHOB 2YRZA 1N2RA 2R0KH 1JGVL 4L3EE 1ZHNA 1LMKA 4X7TB 5EOQL 1X5YA 3TO2B 5J06A 4HBCL 3QG6A 1GPOL 5T5NF 3LS4L 3DX9A 1CD8A 1RVFL 2FLBT 1Z6JT 2QL1A 5F9OH 3EYFA 4X0KB 3QDGE 1QFWL 1RK1A 3UO1H 1F4XL 1RUKL 1CLZL 3U2SA 5FHAH 4P3DB 2H26A 1YDPA 3LN4A 3MA7A 4CKVX 3NFPA 2FZ3B 4YDKH 2UZIL 3UJTL 3DHMA 5KSUA 1KTDA 4DN3H 4U7SA 3SJVE 3T3PE 2W9EL 1EEYB 4F37F 4NWUL 1I1AC 4KJPD 3CXHK 3LDBC 3O9WB 4RFOH 5MHSD 1R3JA 1FCCA 5LKNA 2F19H 4PB9H 5JPMA 4NSKB 4WEBL 1L6ZA 4X9BA 5I0ZA 3LY6A 4BQ6A 5IHUL 3BP7B 1U8JB 3HC3L 3MLYH 3O2VH 5D7JD 1RZKL 1UZ6E 4V1DE 4GAFB 4UU9A 3QQ4A 1KN2H 2EYSA 2ENYA 4Y2DD 4ZS7H 1T3FB 1JVKA 1NLBH 4PV9B 4OF8A 4NN6C 3DNKA 5I0DA 3T3PF 5KSAB 2JELH 4U6VH 1ZGLM 4XP6L 3PP4L 4LSTL 5FA3A 3GMPB 1MCRA 4I0KA 2O5YH 3T2QA 3ZE2E 4BQ8A 2MNUA 2HJKB 1PDKA 2VKXA 5BV7B 4QWWD 1BPVA 5IF0A 2QSTA 1QFPA 1IQWL 4WW2A 4NP4L 3ZDXF 5TH2B 3PV6A 5CZKA 5DI8B 3GBNH 3LHPH 4N5UA 2BSTA 4I3SH 1HYRC 4N8VA 2VITA 1DBKH 2OL3H 5DEZA 4XX1E 1TLKA 1MCWW 5LAXB 4WHTB 2DLIA 2MQ3A 3SN6N 4IRSC 4MS8C 3DRQB 3VFMB 5DD3H 3FO9B 4PG9B 2BVOB 3D69B 4P3CH 4Z7VE 5HHNA 1URLA 1KV3A 3DMMD 3QUZD 4PJBF 2NMSA 4TUJA 1C16B 5I16A 3U1SH 3MV9B 1LDSA 3NPSC 4XP5H 1M7DA 1DFBH 3BP5A 4GW5A 3S35H 5DJCB 5HVHB 4WO4C 4MA7H 4MHHG 1YEEL 1SM3L 4EIZC 2NNAB 2JB5H 2VLJE 1EFXB 1X5AA 2RJMA 1IM9A 1ZHKB 1FYTD 3TJHD 2X4PA 2F53E 1JGEA 1RZ7L 1T0MB 1Z9MA 4PRHB 4OB5L 4PGZA 4IMLA 1H3UA 4UNVA 2B5IB 1G0XA 2DS4A 5BVJA 3MRPB 4WUUD 4X9FA 2ICWJ 3LD8C 3SCMA 3SQOL 4JQXC 1QEWB 4Z7WB 2JTDA 4Z9KB 4X9GA 5J1SC 5K9QI 1DBAH 1RUQL 1HQ4A 4OQTH 2BMKB 2NY2C 4PR5B 3E3QE 3SGDI 1IAOB 1QNZL 1RJLB 2FL5B 3TFKC 3O41B 5HHVL 2DQTL 3U30C 2QADD 1IEHA 1MI5D 3VGEA 4A2LA 4IHOB 2I60L 1Q94B 3MNZA 2HLFC 3MBXL 2L7UA 3HC4H 1LO5A 2Q1EA 1CFSB 4WI9A 5KSAD 12E8H 2H3NA 2JB6B 4ZNEA 4CAGA 1VB9A 2ICES 5C9JB 1YMHB 5DTFA 5EO9A 2NY1C 5I76A 4M8VA 1B0RB 1RULL 1FNGA 1ZHBA 1CGSL 4G6AD 2MOVA 4OSUL 3BGAA 5BVPH 3UTTE 4P4KB 3S8WA 4CNIA 5HY9A 3V4VL 3STLA 4RMWA 1S7VA 3VXRE 4NQEA 2BNQA 4KMTH 1DL7H 4LDOB 4LPTA 3P0GB 2FH8A 2GJZB 3G08B 4JHAL 2HH0L 1MHHB 2Y07L 4JB9H 4LIQH 1MPAL 1HINL 4KI1A 5D1QA 3OGCA 1EVTC 2IAMD 3TP4A 4CN4A 4N0CD 3RHWF 3O9WD 5C7XH 1B88A 2A74B 4XNQA 2XN9D 4Y16B 3T08A 2R0WH 2GY5A 1FRGH 5I9QB 2BMKA 4IRSB 3W9DA 4U3XA 3O8XA 1Q9WB 3CFKA 1L7TH 3CFIC 5DSCA 4FQXB 1HK6A 4WFED 5IR1A 4XPGH 5DURD 3HB3C 4UQ2A 3OB8A 5ERWA 1WBXA 1FO0B 3KXFE 3MUY1 4GRWF 4Y0GA 1OTTD 5SWQB 4U49A 4LNVA 4WI3A 1YUHA 4QRQB 3BZ4B 3NZ8B 1G0YR 5I8CA 3RGHA 5FO9A 3BPOB 2H2PD 3JV6B 4PJ7E 1TITA 4UILH 2IF7A 4HUXB 4APQC 2AJYL 2AJUH 4NN6B 4LLWA 5LWYL 2J4WH 1ZA6B 4YHZH 1KNOA 3SDXF 4NKMB 4JE4B 2NYYD 2BRRL 3KYOA 3CUPB 3PL6A 1HYSC 2P5WA 3FQXB 1OD9A 1Q8MA 4JHWL 4IRSD 4MS8D 1AGFA 2H32B 5EOCJ 5JOFB 4WUKH 1KB5A 3OAZH 3CIQA 3F6LA 1CLOL 4GAJL 1NC4B 3ARFD 1CR9L 4ZPVA 3PG2A 4UDTA 4UIMA 1SJVA 3VW3H 5IMMA 3ULVF 3FN0L 3SKNB 4IMKC 2PR4L 4LAQH 4LLDA 3VXRB 5GS1A 2D03H 4XMKH 2EZ0D 1HH9A 3VFGH 1ZLSH 5DRWB 5JW4M 1MWAL 2OZ4H 2VDNL 5F9AC 4KZDL 4XP9H 3VFUA 1NKRA 4KC3B 5L88H 3LQZB 3NABL 1G9EA 5E7BA 3OR7B 5IB3B 4PRNA 4KI5F 1CK0H 3IDMA 2V5MA 4Y1AA 3DBXA 4NKQB 4PJBE 1HHJB 2YUVA 1H5BC 3X14B 2IBGA 3T0EE 1EBPA 5ISZB 3WEXA 1UXWB 5C0FB 4ZUUA 1GGBL 1YEFH 3WN5C 1MCEA 3GMOA 3RTQD 1G7QA 1H8OA 4HFUL 4JDZB 4X4XA 43C9A 1KTKE 2F54E 1QEWA 2WLYA 2YD5A 4V2BA 3CNKA 4W68A 5IB5A 1A6PA 4M7ZC 4KHXL 5D7KD 1Q9LA 5HI5D 1CFBA 4ORGB 1MCIA 2EH8L 1FBIL 1T0MA 4F33A 1EHLL 1MWAB 2VN4A 3BO8A 2X4NB 3VI4F 3NFNA 5T1LA 3QI9C 5A2IH 5FYLH 5LQBH 5F9WC 2X4NA 3BEWA 3MGTA 2Z8RA 4HUVA 1T22A 1OAQH 4MNGE 4K3DH 1U95B 1KLUA 5CBAA 4NQCD 4D0CB 4ZO6A 5C6PB 2P42B 4OV5B 5A16A 4LFHG 1UKTA 1E4KA 1DQLH 2DBLL 4RSVA 3KPRD 2XFXB 4LVEA 2UWEB 2VXVH 4M6MH 2OJZH 3EYSL 4FZEL 1YPZF 4RFEA 3QXWA 4D0BB 4KROC 4Q0XL 5DFWH 1KLGA 2DQDH 5E24E 1ZHLB 3I6GB 2Q86B 5HHVH 1CGUA 5C0IA 1CQYA 4OFKA 1CD0A 4GMTL 4M1CC 1FFPA 5DRNA 1G7HA 4OCWL 4O2FB 4ODTH 3AB0C 5CJ5A 3SDDC 3RNKB 3X17A 1G7HB 2VDOL 3HG1B 5FO7A 2WBKA 4IIQC 3BQUB 4LSPL 4PLNC 3RZCC 2ZNXA 2VLKA 4LLUA 1AXSB 2DKUA 2W0PA 5GRJL 3I02A 5L6YL 3TBYA 3WO4B 4AEHH 3QJFA 4DJMA 1T7YA 5IVXA 3RIFK 4BUGA 1U8OB 1NC2A 3T4AA 3AREA 1A6WH 5F9OL 4HIEB 1DANU 5GQBA 5JORA 1OTTC 2A6JA 2AABH 2EDQA 1MFBH 3MLVL 4M5YL 4R2GC 5IQ9B 2DQUH 3OKLA 5D7IA 2VDOH 4MA1B 3BVNB 3LEVL 1VADA 2J6EA 2HVJA 2I9LA 1ZA6A 5DJYA 3IJHA 5I8OH 4X6FA 2FEEL 3B9AA 4LU5L 3ES6A 1LQSR 2ADJB 4BQ9A 2R56H 2J3SA 4NJ9L 3O9WA 3RUGA 2YA1A 2FLRT 1N5YL 3QIBD 5M94B 4JDVB 1D9KB 4RMUA 3IYLW 3HE6C 3BRFA 3ZKNC 5JLZB 5KSBA 5I18H 3HS0B 4J4PA 3VXSA 4OF5A 4OJFL 3WL9B 4IRJA 2B8OT 3KPPB 4G7VH 3TNMA 5C0FA 3BSZL 2ARJQ 2Z91B 3WJLA 1YQ2A 4ZTOL 1FORH 5D1XD 1PD6A 1FE8H 3NFSL 2FRGP 2AXJA 4XAWL 5FYLL 1OVZA 2Y06H 3IFLH 4PJCB 2FJHB 4PGDB 4ZD3H 3T0BA 4HKZB 4HLZG 4YHMH 1YEIL 3W0WB 3BKJH 3TIDA 3O8XC 4LMQI 5F6IC 3QUYB 4UTAL 2OTUA 3IGAB 1TIUA 1FCGA 4JFFD 3WFDL 3Q5TA 4PY8I 4YHIA 1EZVY 3ARBC 3UZVB 2HJFB 2WINB 4GS7B 4X80L 4XBGA 4Q9QL 4NT6B 3QB7C 4GXVL 4HV8A 3ME0A 1LE5B 1IGCH 1NBVL 1I7ZB 1GZPA 3P73A 4Q6YA 4YQXH 5CHNB 2JK5A 3B9VA 5HVFB 4H8WH 5J6GA 3TNNB 1H3VA 3U48A 3VD4A 4G42B 2P7TB 4G3YH 5BQ7A 4HD9A 2CSPA 3T2OA 5FV1L 5I15H 4PRHD 3JV6A 5CZXC 3PL6C 2GY7B 1NGWA 3PWPD 3W0WD 3SOBH 3ZKXC 4EI6B 4QT5A 1YEEH 3UXFA 4TUJB 2CDFA 2H8PA 4FFWD 4QTHA 4XHJD 3VFMA 1CR9H 1OOAA 1SHMA 2Z31C 5KSVA 1QKZH 2N4IA 5I1AB 1GH7A 4Z6AT 4P5TD 2ERJC 2ENSA 1H0DB 4KHTL 1IQDA 1XAUA 3EO1B 5BOZG 1YEJH 3TCLB 3F5WA 4LSQL 3VCLA 3O4OB 1WEJL 5T3XE 4ZOCA 3O6KL 5DWUH 4NOBA 3VXPB 1MCOH 3C60C 3UYPA 2H8PB 4RDQG 1FFRA 4FFZL 3GMPA 1A3LH 4FHBD 4JFHD 3KXFD