4O9WA

Crystal structure of polo-like kinase(plk1)pbd in complex with phospho peptide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
211
Chain Sequence
HLSDMLQQLHSVNASKPSELVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title The condensin component NCAPG2 regulates microtubule-kinetochore attachment through recruitment of Polo-like kinase 1 to kinetochores
doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 73
structure length 211
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4o9wA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4o9wA01
3RQ7A 4X9WA 4E9CA 4WHLA 3P35A 4WHHA 3P2WA 4J7BB 1UMWA 5J19A 4LKMA 4H71A 4RS6A 4X9VA 4X9RA 5LHZA 4E67A 2OJXA 5DMSA 5DNJA 3P37A 1Q4OA 1Q4KA 3HIKA 5DMVC 3FVHA 4HABA 4E9DA 3P2ZA 3P34A 4H5XA 4HY2A 2OGQA 4LKLA 4O9WA 4RCPA 3Q1IA 3C5LA 4O56A 4YYPA 4HCOA 4DFWA 4XB0A 4WHKA 2N19A 3P36A 3HIHA 3BZIA 4O6WA
chains in the Genus database with same CATH superfamily
3RQ7A 4E9CA 3P35A 1N2KA 5J19A 4H71A 4CXSA 5DMSA 5DNJA 1Q4KA 3HIKA 1E2SP 3FVHA 1E2TA 3P2ZA 3P34A 4CYRA 2OGQA 1E1ZP 1HDHA 3LXQA 3HMJG 4FDJA 2N19A 4WHKA 3HIHA 1A87A 3BZIA 4O6WA 4NK7A 4G7NA 4N7ZA 3HFDA 2I9XA 3GYWA 4WHLA 4WHHA 1E33P 4J7BB 1P49A 1UMWA 4LKMA 4RS6A 5LHZA 2I9ZA 2IA9A 2OJXA 3P37A 4CXUA 1AUKA 2QZUA 3C5LA 2VKZG 4YYPA 3LM3A 4N7VA 4X9WA 1N2LA 2UV8G 3P2WA 5AJ9A 4CXKA 4E67A 1Q4OA 3KDRA 5DMVC 4HABA 4N9JA 4O9WA 4LKLA 4RCPA 4DFWA 3P36A 3GYVA 3ED4A 4NKBA 4X9RA 1F34B 4X9VA 4CYSA 1FSUA 4H5XA 4HY2A 2E50A 3Q1IA 3FS3A 4O56A 1E3CP 1F32A 4FDIA 4HCOA 5DAYA 4XB0A 4E9DA
chains in the Genus database with same CATH topology
3RQ7A 4X9WA 4E9CA 4WHLA 3P35A 4WHHA 3P2WA 4J7BB 1UMWA 5J19A 4LKMA 4H71A 4RS6A 4X9VA 4X9RA 5LHZA 4E67A 2OJXA 5DMSA 5DNJA 3P37A 1Q4OA 1Q4KA 3HIKA 5DMVC 3FVHA 4HABA 4E9DA 3P2ZA 3P34A 4H5XA 4HY2A 2OGQA 4LKLA 4O9WA 4RCPA 3Q1IA 3C5LA 4O56A 4YYPA 4HCOA 4DFWA 4XB0A 4WHKA 2N19A 3P36A 3HIHA 3BZIA 4O6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQ7 A;  4X9W A;  4E9C A;  4WHL A;  3P35 A;  4WHH A;  3P2W A;  4J7B B;  1UMW A;  5J19 A;  4LKM A;  4H71 A;  4RS6 A;  4X9V A;  4X9R A;  5LHZ A;  4E67 A;  2OJX A;  5DMS A;  5DNJ A;  3P37 A;  1Q4O A;  1Q4K A;  3HIK A;  5DMV C;  3FVH A;  4HAB A;  4E9D A;  3P2Z A;  3P34 A;  4H5X A;  4HY2 A;  2OGQ A;  4LKL A;  4O9W A;  4RCP A;  3Q1I A;  3C5L A;  4O56 A;  4YYP A;  4HCO A;  4DFW A;  4XB0 A;  4WHK A;  2N19 A;  3P36 A;  3HIH A;  3BZI A;  4O6W A; 
#chains in the Genus database with same CATH topology
 3RQ7 A;  4E9C A;  3P35 A;  1N2K A;  5J19 A;  4H71 A;  4CXS A;  5DMS A;  5DNJ A;  1Q4K A;  3HIK A;  1E2S P;  3FVH A;  1E2T A;  3P2Z A;  3P34 A;  4CYR A;  2OGQ A;  1E1Z P;  1HDH A;  3LXQ A;  3HMJ G;  4FDJ A;  2N19 A;  4WHK A;  3HIH A;  1A87 A;  3BZI A;  4O6W A;  4NK7 A;  4G7N A;  4N7Z A;  3HFD A;  2I9X A;  3GYW A;  4WHL A;  4WHH A;  1E33 P;  4J7B B;  1P49 A;  1UMW A;  4LKM A;  4RS6 A;  5LHZ A;  2I9Z A;  2IA9 A;  2OJX A;  3P37 A;  4CXU A;  1AUK A;  2QZU A;  3C5L A;  2VKZ G;  4YYP A;  3LM3 A;  4N7V A;  4X9W A;  1N2L A;  2UV8 G;  3P2W A;  5AJ9 A;  4CXK A;  4E67 A;  1Q4O A;  3KDR A;  5DMV C;  4HAB A;  4N9J A;  4O9W A;  4LKL A;  4RCP A;  4DFW A;  3P36 A;  3GYV A;  3ED4 A;  4NKB A;  4X9R A;  1F34 B;  4X9V A;  4CYS A;  1FSU A;  4H5X A;  4HY2 A;  2E50 A;  3Q1I A;  3FS3 A;  4O56 A;  1E3C P;  1F32 A;  4FDI A;  4HCO A;  5DAY A;  4XB0 A;  4E9D A; 
#chains in the Genus database with same CATH homology
 3RQ7 A;  4X9W A;  4E9C A;  4WHL A;  3P35 A;  4WHH A;  3P2W A;  4J7B B;  1UMW A;  5J19 A;  4LKM A;  4H71 A;  4RS6 A;  4X9V A;  4X9R A;  5LHZ A;  4E67 A;  2OJX A;  5DMS A;  5DNJ A;  3P37 A;  1Q4O A;  1Q4K A;  3HIK A;  5DMV C;  3FVH A;  4HAB A;  4E9D A;  3P2Z A;  3P34 A;  4H5X A;  4HY2 A;  2OGQ A;  4LKL A;  4O9W A;  4RCP A;  3Q1I A;  3C5L A;  4O56 A;  4YYP A;  4HCO A;  4DFW A;  4XB0 A;  4WHK A;  2N19 A;  3P36 A;  3HIH A;  3BZI A;  4O6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...