4OAFA

Crystal structure of the cytosolic domain of mouse mid51
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
326
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 113
structure length 326
sequence length 329
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oafA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oafA02
4OAHA 4NXUA 4OAIZ 4O6AA 4O68A 4LEYA 4KM5A 4K9AA 4NXTA 4NXXA 4O69A 4JLXA 4JLZA 4O67A 4KB6A 4K97A 4K98A 4K9BA 4ATBB 4ATBA 4OAFA 4K8VA 4MKPA 4K96A 4AT9B 4AT9A 4AT8B 4AT8A 4NXWA 4AT7A 4NXVA 4AT7B 4LEZA 4LEWA 4OAGA 4LEVA 4K99A 4WOYA
chains in the Genus database with same CATH superfamily
2DR7A 4QZDA 1FA0A 5D46A 4KLHA 9ICSA 4M47A 3AQNA 4PHEA 4UB5A 2PXIA 3RJIA 4PPXA 4K9AA 4KLGA 4RWQA 4O69A 4TUSA 4K98A 4RPYA 4I2DA 1ZQEA 2HHPA 5D63A 5CFUA 1ZQIA 8ICWA 1MIVA 4MFFA 4AT9B 1ZQHA 4AT7B 1HUZA 2ZH9A 7ICIA 2PFNA 8ICLA 4XRHA 4QZEA 4R63A 4X0AA 4XQ8A 2BE3A 1TFYA 4HX0A 5CA7A 3OV7A 5B3PA 4I28A 5CR0A 8ICZA 4KLTA 4K4IA 4IQVA 2BBHA 1ZQJA 4M2YA 5DKWA 4QZIA 4WC7A 3CK6A 5BPCA 3JPSA 7ICRA 9ICLA 5CHEA 3TFSA 5DBAA 3TFRA 5HRLA 4UAZA 8ICMA 5J2IA 4PH5A 3MDCA 9ICXA 4EBKA 4FH5A 2P66A 2GWSA 5HRHA 4RWNA 9ICMA 5J0UA 1TVAA 4K4GA 5J2GA 3AQKA 4Z6CA 7ICVA 5J2KA 3WFQE 3JPOA 3RJGA 4QZCA 1MQ2A 4RT3A 3HIYA 5D61A 3ISCA 3JPTA 4M9LA 4NLZA 9ICIA 9ICNA 4DOBA 2ZH8A 4AT8A 3OVSA 4KLFA 2BCSA 3MGHA 9ICHA 4YN4A 5BOMA 4LZDA 9ICTA 1ZQXA 3GDXA 4KLDA 3NWIA 7ICEA 4RQ4A 2ZH6A 4IQTA 1ZJNA 2BCUA 4MFCA 4R65A 5DB6A 5J29A 5HHIA 3JPNA 4ATBA 4UBBA 8ICGA 3C5GA 3L9DA 1BPEA 2BPCA 5DDYA 8ICAA 2IHOA 3RJEA 4PHAA 3JYYA 7ICUA 8ICYA 9ICRA 4OAHA 1XSPA 4E7XA 5J0YA 4GXJA 1ZQCA 1ZQRA 5HC9A 4WC3A 2HN2A 4UBCA 3AU6A 4NLNA 4YMOA 4O5CA 7ICSA 2FMQA 3B0XA 4WBZA 3NVOA 3RJFA 3RJJA 4Z6DA 4F5OA 4K8VA 4NM2A 9ICVA 4TUPA 4AT9A 4F5QA 7ICLA 4WC2A 5DBBA 4NXWA 4UD5A 2DR5A 7ICHA 4E80A 4K99A 1JMSA 4XUSA 2DVIA 4WC1A 5J2FA 1MIYA 5HRBA 5J0RA 4DOCA 1NOMA 1ZQYA 5IIOA 5DDMA 3RJHA 3OUYB 3HJ4A 5CB1A 2ISOA 1ZQUA 2RFFA 4MF8A 7ICNA 1JQRA 5CFTA 5HRGA 4FHYA 4I2FA 4EGWA 4EV6A 4GXIA 3K7DA 5J0TA 2ZH7A 4XJEA 9ICAA 4FHWA 1Q78A 5HRDA 4P4OA 4P4PA 5EOZA 4O6AA 4QZHA 3UPSA 4KLLA 5J0XA 1XSNA 3NYBA 4WCWA 9ICCA 5J2AA 4KLIA 3UXPA 1UETA 4JLZA 4KB6A 4TURA 3ERCC 2B51A 4X4NA 4UB3A 4WC4A 3LK9A 2ID1A 4NXZA 2PBEA 1HUOA 4I2GA 4F5PA 4XQ7A 5HR9A 3UPQA 8ICJA 4P4MA 3C2LA 2DRAA 2NRKA 4RQ5A 2IUBA 7ICPA 4NXUA 2O5AA 3AUOA 2Q66A 5D62A 4UD4A 3MCRA 1WOTA 1TV9A 4P2HA 4LEYA 3B0YA 5JTGA 4RQ1A 4M04A 7ICJA 5J0WA 4K97A 3WFSC 9ICGA 4JWMA 4KLMA 4RQ7A 3UXNA 2ZH3A 2B4VA 3V7LA 5HHHA 3WFRE 4KLEA 4UB4A 7ICKA 2W9MA 1RZTA 3JPRA 4JWNA 4LEVA 5IIJA 4PGQA 3MDAA 5HRIA 2GAFD 4KLOA 4N7RA 3RH6A 1UEVA 2PFQA 5J2EA 3OWGA 4NXTA 3AQMA 4JLXA 4Z6FA 5IIKA 3C66A 4M0AA 4RT2A 3MGIA 4YMMA 4FHXA 3ISDA 4FHPA 5DB8A 1ZQZA 4I2IA 3EF2A 4R66A 4X0BA 4F5RA 2DR9A 4OAGA 3OVBA 3PMLA 4I2AA 7ICQA 1R8CA 4OAIZ 4QZBA 5HREA 2IHMA 5J0SA 4M9HA 5DB7A 1ZQVA 3RH5A 5IILA 3OGUA 4YMNA 2ZH1A 3OUYA 2ZH2A 4FO1A 1KEJA 4S3NA 1JN3A 4YD1A 1VFGA 5CJ7A 3V7JA 9ICEA 5TZVA 4WBYA 2DR8A 4MKPA 4K4HA 4K96A 2EWRA 5DB9A 2M2UA 2PFOA 3RJKA 4UAWA 5D4BA 5DEDA 4NXVA 9ICUA 2ISPA 1ZQMA 4R64A 1ZQDA 5IIMA 5CFSA 2BPFA 4WQLA 3RH4A 1ZQLA 4X5VA 2M2WA 1ZQNA 4YCXA 4PGXA 3JZ0A 3PMNA 1UEUA 5B3QA 4I2JA 4M9JA 2BCQA 4QZ9A 4QZAA 5J2DA 3JPQA 1ZQQA 3JPPA 4TUQA 4RQ8A 8ICQA 8ICPA 3LQCB 1Q79A 5HRKA 5J2BA 9ICWA 4PHDA 4MF2A 4QZ8A 1ZQOA 1ZQPA 3V7KA 3AU2A 4GXKA 1ZQAA 3C18A 1KDHA 3H39A 3HJ1A 1R89A 5DECA 2BCVA 2FMSA 8ICNA 2B56A 4FH3A 5HRFA 8ICEA 2ZHAA 2DRBA 9ICQA 9ICBA 4I2HA 4KLJA 5CP2A 4OAFA 4EBJA 9ICFA 2O1PA 4PHPA 4X4RA 4X4QA 7ICOA 8ICCA 4QZFA 9ICOA 4RQ2A 3H37A 5BOLA 4I27A 4RPXA 4I2CA 4RWOA 1V4AA 2FCLA 4RQ6A 4X4SA 1OU5A 4M9NA 3AQLA 8ICFA 1MIWA 1ZQWA 1KNYA 1NO5A 4YD2A 4EP7A 4WQKA 5F2VO 2M2VA 2FMPA 4M5DA 3UXOA 4I2BA 2ZH4A 4X4TA 5CHGA 4RPZA 4O5EA 3MBYA 5IIIA 3C2MA 9ICKA 2M2TA 5CWRA 1BPXA 4NLKA 9ICJA 1BPBA 4XA5A 8ICUA 4WC0A 4M9GA 4NY8A 7ICMA 2HN1A 4X4PA 2I9GA 4RWPA 1VJ7A 5J0PA 1R8AA 2BCRA 4KLQA 4UAYA 3H3AA 8ICXA 3C5FA 1ZQGA 8ICIA 4I0UA 4FHVA 3UQ2A 4F5NA 7ICGA 4X4UA 2GA9D 5J2HA 2VANA 3ER9B 8ICHA 4I29A 4MFAA 1ZQBA 4Z6EA 4KLSA 3C2KA 3PNCA 4O5KA 1GPJA 4RQ3A 3PHZA 4E8FA 4QZGA 8ICVA 3K75D 4NKUA 4UB1A 1ZJMA 4NM1A 1BPZA 4LEZA 8ICOA 4LEWA 1BPDA 3WFOA 1MQ3A 4UB2A 5D49A 1JAJA 4NKTA 2BBJA 4O9MA 5J0OA 3V72A 4X4OA 1XSLA 3ISBA 4NXXA 4O67A 2BPGA 4LVSA 1ZQFA 2ZH5A 3WFPA 7ICFA 3NKUA 1ZQTA 4PGYA 8ICSA 4WC6A 7ICTA 4DOAA 1BPYA 4AT8B 5J2CA 3UQ0A 4EEBA 1F5AA 3HWTA 3HX0A 8ICBA 4WOYA 4KLUA 4LZGA 1PX5A 1TFWA 4IQWA 3OVAA 2PFPA 1RPLA 3H38A 4O68A 4IG8A 4KM5A 4WC5A 8ICTA 1ZQKA 5J0QA 8ICRA 4FO6A 8ICKA 1ZQSA 3JCFA 4EEDA 4RQ0A 4K9BA 4IQUA 4ATBB 5J2JA 1YLQA 3ER8C 4LT6A 9ICPA 4X4VA 2ZHBA 5DBCA 4I2EA 5IINA 4AT7A 1R8BA 3HW8A 4DO9A 4WH5A
chains in the Genus database with same CATH topology
4OAHA 2DR7A 2FCLA 4X4SA 1FA0A 4E7XA 2GAFD 4EP7A 4WQKA 4N7RA 4M5DA 4K9AA 1UEVA 4X4TA 2ZH4A 3OWGA 4NXTA 4JLXA 4O69A 4K98A 3C66A 2HHPA 5D63A 5CFUA 4K8VA 4AT9B 4FHXA 4AT9A 4FHPA 4NXWA 4UD5A 2DR5A 3EF2A 4AT7B 4E80A 2DR9A 4OAGA 3OVBA 2ZH9A 4K99A 4X4PA 2DVIA 1R8CA 4OAIZ 1R8AA 1TFYA 4HX0A 3OV7A 5B3PA 3OUYB 2ZH1A 3HJ4A 3OUYA 2ZH2A 4FO1A 4FHVA 4X4UA 2GA9D 3ER9B 5CFTA 4FHYA 1GPJA 2DR8A 4MKPA 3PHZA 4K96A 5CHEA 2EWRA 4E8FA 4NKUA 3K7DA 4NXVA 2ZH7A 4LEZA 4LEWA 4XJEA 5CFSA 4FHWA 4WQLA 1Q78A 4FH5A 4O6AA 4NKTA 3NYBA 4X4OA 1UEUA 4NXXA 5B3QA 1UETA 4JLZA 4O67A 4KB6A 3ERCC 2B51A 4X4NA 3HIYA 2ZH5A 5D61A 3NKUA 2ZH8A 2DRAA 4AT8B 1Q79A 4AT8A 3OVSA 1F5AA 4WOYA 4NXUA 2Q66A 5D62A 1TFWA 4UD4A 3MCRA 3OVAA 3HJ1A 4O68A 1R89A 4KM5A 4LEYA 2ZH6A 2B56A 4FH3A 2ZHAA 2DRBA 4K97A 4K9BA 4ATBB 4ATBA 4OAFA 3ER8C 2O1PA 4LT6A 4X4VA 4X4RA 2ZHBA 2ZH3A 4X4QA 2B4VA 4AT7A 1R8BA 2IHOA 4LEVA 4WH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAH A;  4NXU A;  4OAI Z;  4O6A A;  4O68 A;  4LEY A;  4KM5 A;  4K9A A;  4NXT A;  4NXX A;  4O69 A;  4JLX A;  4JLZ A;  4O67 A;  4KB6 A;  4K97 A;  4K98 A;  4K9B A;  4ATB B;  4ATB A;  4OAF A;  4K8V A;  4MKP A;  4K96 A;  4AT9 B;  4AT9 A;  4AT8 B;  4AT8 A;  4NXW A;  4AT7 A;  4NXV A;  4AT7 B;  4LEZ A;  4LEW A;  4OAG A;  4LEV A;  4K99 A;  4WOY A; 
#chains in the Genus database with same CATH topology
 2DR7 A;  4QZD A;  1FA0 A;  5D46 A;  4KLH A;  9ICS A;  4M47 A;  3AQN A;  4PHE A;  4UB5 A;  2PXI A;  3RJI A;  4PPX A;  4K9A A;  4KLG A;  4RWQ A;  4O69 A;  4TUS A;  4K98 A;  4RPY A;  4I2D A;  1ZQE A;  2HHP A;  5D63 A;  5CFU A;  1ZQI A;  8ICW A;  1MIV A;  4MFF A;  4AT9 B;  1ZQH A;  4AT7 B;  1HUZ A;  2ZH9 A;  7ICI A;  2PFN A;  8ICL A;  4XRH A;  4QZE A;  4R63 A;  4X0A A;  4XQ8 A;  2BE3 A;  1TFY A;  4HX0 A;  5CA7 A;  3OV7 A;  5B3P A;  4I28 A;  5CR0 A;  8ICZ A;  4KLT A;  4K4I A;  4IQV A;  2BBH A;  1ZQJ A;  4M2Y A;  5DKW A;  4QZI A;  4WC7 A;  3CK6 A;  5BPC A;  3JPS A;  7ICR A;  9ICL A;  5CHE A;  3TFS A;  5DBA A;  3TFR A;  5HRL A;  4UAZ A;  8ICM A;  5J2I A;  4PH5 A;  3MDC A;  9ICX A;  4EBK A;  4FH5 A;  2P66 A;  2GWS A;  5HRH A;  4RWN A;  9ICM A;  5J0U A;  1TVA A;  4K4G A;  5J2G A;  3AQK A;  4Z6C A;  7ICV A;  5J2K A;  3WFQ E;  3JPO A;  3RJG A;  4QZC A;  1MQ2 A;  4RT3 A;  3HIY A;  5D61 A;  3ISC A;  3JPT A;  4M9L A;  4NLZ A;  9ICI A;  9ICN A;  4DOB A;  2ZH8 A;  4AT8 A;  3OVS A;  4KLF A;  2BCS A;  3MGH A;  9ICH A;  4YN4 A;  5BOM A;  4LZD A;  9ICT A;  1ZQX A;  3GDX A;  4KLD A;  3NWI A;  7ICE A;  4RQ4 A;  2ZH6 A;  4IQT A;  1ZJN A;  2BCU A;  4MFC A;  4R65 A;  5DB6 A;  5J29 A;  5HHI A;  3JPN A;  4ATB A;  4UBB A;  8ICG A;  3C5G A;  3L9D A;  1BPE A;  2BPC A;  5DDY A;  8ICA A;  2IHO A;  3RJE A;  4PHA A;  3JYY A;  7ICU A;  8ICY A;  9ICR A;  4OAH A;  1XSP A;  4E7X A;  5J0Y A;  4GXJ A;  1ZQC A;  1ZQR A;  5HC9 A;  4WC3 A;  2HN2 A;  4UBC A;  3AU6 A;  4NLN A;  4YMO A;  4O5C A;  7ICS A;  2FMQ A;  3B0X A;  4WBZ A;  3NVO A;  3RJF A;  3RJJ A;  4Z6D A;  4F5O A;  4K8V A;  4NM2 A;  9ICV A;  4TUP A;  4AT9 A;  4F5Q A;  7ICL A;  4WC2 A;  5DBB A;  4NXW A;  4UD5 A;  2DR5 A;  7ICH A;  4E80 A;  4K99 A;  1JMS A;  4XUS A;  2DVI A;  4WC1 A;  5J2F A;  1MIY A;  5HRB A;  5J0R A;  4DOC A;  1NOM A;  1ZQY A;  5IIO A;  5DDM A;  3RJH A;  3OUY B;  3HJ4 A;  5CB1 A;  2ISO A;  1ZQU A;  2RFF A;  4MF8 A;  7ICN A;  1JQR A;  5CFT A;  5HRG A;  4FHY A;  4I2F A;  4EGW A;  4EV6 A;  4GXI A;  3K7D A;  5J0T A;  2ZH7 A;  4XJE A;  9ICA A;  4FHW A;  1Q78 A;  5HRD A;  4P4O A;  4P4P A;  5EOZ A;  4O6A A;  4QZH A;  3UPS A;  4KLL A;  5J0X A;  1XSN A;  3NYB A;  4WCW A;  9ICC A;  5J2A A;  4KLI A;  3UXP A;  1UET A;  4JLZ A;  4KB6 A;  4TUR A;  3ERC C;  2B51 A;  4X4N A;  4UB3 A;  4WC4 A;  3LK9 A;  2ID1 A;  4NXZ A;  2PBE A;  1HUO A;  4I2G A;  4F5P A;  4XQ7 A;  5HR9 A;  3UPQ A;  8ICJ A;  4P4M A;  3C2L A;  2DRA A;  2NRK A;  4RQ5 A;  2IUB A;  7ICP A;  4NXU A;  2O5A A;  3AUO A;  2Q66 A;  5D62 A;  4UD4 A;  3MCR A;  1WOT A;  1TV9 A;  4P2H A;  4LEY A;  3B0Y A;  5JTG A;  4RQ1 A;  4M04 A;  7ICJ A;  5J0W A;  4K97 A;  3WFS C;  9ICG A;  4JWM A;  4KLM A;  4RQ7 A;  3UXN A;  2ZH3 A;  2B4V A;  3V7L A;  5HHH A;  3WFR E;  4KLE A;  4UB4 A;  7ICK A;  2W9M A;  1RZT A;  3JPR A;  4JWN A;  4LEV A;  5IIJ A;  4PGQ A;  3MDA A;  5HRI A;  2GAF D;  4KLO A;  4N7R A;  3RH6 A;  1UEV A;  2PFQ A;  5J2E A;  3OWG A;  4NXT A;  3AQM A;  4JLX A;  4Z6F A;  5IIK A;  3C66 A;  4M0A A;  4RT2 A;  3MGI A;  4YMM A;  4FHX A;  3ISD A;  4FHP A;  5DB8 A;  1ZQZ A;  4I2I A;  3EF2 A;  4R66 A;  4X0B A;  4F5R A;  2DR9 A;  4OAG A;  3OVB A;  3PML A;  4I2A A;  7ICQ A;  1R8C A;  4OAI Z;  4QZB A;  5HRE A;  2IHM A;  5J0S A;  4M9H A;  5DB7 A;  1ZQV A;  3RH5 A;  5IIL A;  3OGU A;  4YMN A;  2ZH1 A;  3OUY A;  2ZH2 A;  4FO1 A;  1KEJ A;  4S3N A;  1JN3 A;  4YD1 A;  1VFG A;  5CJ7 A;  3V7J A;  9ICE A;  5TZV A;  4WBY A;  2DR8 A;  4MKP A;  4K4H A;  4K96 A;  2EWR A;  5DB9 A;  2M2U A;  2PFO A;  3RJK A;  4UAW A;  5D4B A;  5DED A;  4NXV A;  9ICU A;  2ISP A;  1ZQM A;  4R64 A;  1ZQD A;  5IIM A;  5CFS A;  2BPF A;  4WQL A;  3RH4 A;  1ZQL A;  4X5V A;  2M2W A;  1ZQN A;  4YCX A;  4PGX A;  3JZ0 A;  3PMN A;  1UEU A;  5B3Q A;  4I2J A;  4M9J A;  2BCQ A;  4QZ9 A;  4QZA A;  5J2D A;  3JPQ A;  1ZQQ A;  3JPP A;  4TUQ A;  4RQ8 A;  8ICQ A;  8ICP A;  3LQC B;  1Q79 A;  5HRK A;  5J2B A;  9ICW A;  4PHD A;  4MF2 A;  4QZ8 A;  1ZQO A;  1ZQP A;  3V7K A;  3AU2 A;  4GXK A;  1ZQA A;  3C18 A;  1KDH A;  3H39 A;  3HJ1 A;  1R89 A;  5DEC A;  2BCV A;  2FMS A;  8ICN A;  2B56 A;  4FH3 A;  5HRF A;  8ICE A;  2ZHA A;  2DRB A;  9ICQ A;  9ICB A;  4I2H A;  4KLJ A;  5CP2 A;  4OAF A;  4EBJ A;  9ICF A;  2O1P A;  4PHP A;  4X4R A;  4X4Q A;  7ICO A;  8ICC A;  4QZF A;  9ICO A;  4RQ2 A;  3H37 A;  5BOL A;  4I27 A;  4RPX A;  4I2C A;  4RWO A;  1V4A A;  2FCL A;  4RQ6 A;  4X4S A;  1OU5 A;  4M9N A;  3AQL A;  8ICF A;  1MIW A;  1ZQW A;  1KNY A;  1NO5 A;  4YD2 A;  4EP7 A;  4WQK A;  5F2V O;  2M2V A;  2FMP A;  4M5D A;  3UXO A;  4I2B A;  2ZH4 A;  4X4T A;  5CHG A;  4RPZ A;  4O5E A;  3MBY A;  5III A;  3C2M A;  9ICK A;  2M2T A;  5CWR A;  1BPX A;  4NLK A;  9ICJ A;  1BPB A;  4XA5 A;  8ICU A;  4WC0 A;  4M9G A;  4NY8 A;  7ICM A;  2HN1 A;  4X4P A;  2I9G A;  4RWP A;  1VJ7 A;  5J0P A;  1R8A A;  2BCR A;  4KLQ A;  4UAY A;  3H3A A;  8ICX A;  3C5F A;  1ZQG A;  8ICI A;  4I0U A;  4FHV A;  3UQ2 A;  4F5N A;  7ICG A;  4X4U A;  2GA9 D;  5J2H A;  2VAN A;  3ER9 B;  8ICH A;  4I29 A;  4MFA A;  1ZQB A;  4Z6E A;  4KLS A;  3C2K A;  3PNC A;  4O5K A;  1GPJ A;  4RQ3 A;  3PHZ A;  4E8F A;  4QZG A;  8ICV A;  3K75 D;  4NKU A;  4UB1 A;  1ZJM A;  4NM1 A;  1BPZ A;  4LEZ A;  8ICO A;  4LEW A;  1BPD A;  3WFO A;  1MQ3 A;  4UB2 A;  5D49 A;  1JAJ A;  4NKT A;  2BBJ A;  4O9M A;  5J0O A;  3V72 A;  4X4O A;  1XSL A;  3ISB A;  4NXX A;  4O67 A;  2BPG A;  4LVS A;  1ZQF A;  2ZH5 A;  3WFP A;  7ICF A;  3NKU A;  1ZQT A;  4PGY A;  8ICS A;  4WC6 A;  7ICT A;  4DOA A;  1BPY A;  4AT8 B;  5J2C A;  3UQ0 A;  4EEB A;  1F5A A;  3HWT A;  3HX0 A;  8ICB A;  4WOY A;  4KLU A;  4LZG A;  1PX5 A;  1TFW A;  4IQW A;  3OVA A;  2PFP A;  1RPL A;  3H38 A;  4O68 A;  4IG8 A;  4KM5 A;  4WC5 A;  8ICT A;  1ZQK A;  5J0Q A;  8ICR A;  4FO6 A;  8ICK A;  1ZQS A;  3JCF A;  4EED A;  4RQ0 A;  4K9B A;  4IQU A;  4ATB B;  5J2J A;  1YLQ A;  3ER8 C;  4LT6 A;  9ICP A;  4X4V A;  2ZHB A;  5DBC A;  4I2E A;  5IIN A;  4AT7 A;  1R8B A;  3HW8 A;  4DO9 A;  4WH5 A; 
#chains in the Genus database with same CATH homology
 4OAH A;  2DR7 A;  2FCL A;  4X4S A;  1FA0 A;  4E7X A;  2GAF D;  4EP7 A;  4WQK A;  4N7R A;  4M5D A;  4K9A A;  1UEV A;  4X4T A;  2ZH4 A;  3OWG A;  4NXT A;  4JLX A;  4O69 A;  4K98 A;  3C66 A;  2HHP A;  5D63 A;  5CFU A;  4K8V A;  4AT9 B;  4FHX A;  4AT9 A;  4FHP A;  4NXW A;  4UD5 A;  2DR5 A;  3EF2 A;  4AT7 B;  4E80 A;  2DR9 A;  4OAG A;  3OVB A;  2ZH9 A;  4K99 A;  4X4P A;  2DVI A;  1R8C A;  4OAI Z;  1R8A A;  1TFY A;  4HX0 A;  3OV7 A;  5B3P A;  3OUY B;  2ZH1 A;  3HJ4 A;  3OUY A;  2ZH2 A;  4FO1 A;  4FHV A;  4X4U A;  2GA9 D;  3ER9 B;  5CFT A;  4FHY A;  1GPJ A;  2DR8 A;  4MKP A;  3PHZ A;  4K96 A;  5CHE A;  2EWR A;  4E8F A;  4NKU A;  3K7D A;  4NXV A;  2ZH7 A;  4LEZ A;  4LEW A;  4XJE A;  5CFS A;  4FHW A;  4WQL A;  1Q78 A;  4FH5 A;  4O6A A;  4NKT A;  3NYB A;  4X4O A;  1UEU A;  4NXX A;  5B3Q A;  1UET A;  4JLZ A;  4O67 A;  4KB6 A;  3ERC C;  2B51 A;  4X4N A;  3HIY A;  2ZH5 A;  5D61 A;  3NKU A;  2ZH8 A;  2DRA A;  4AT8 B;  1Q79 A;  4AT8 A;  3OVS A;  1F5A A;  4WOY A;  4NXU A;  2Q66 A;  5D62 A;  1TFW A;  4UD4 A;  3MCR A;  3OVA A;  3HJ1 A;  4O68 A;  1R89 A;  4KM5 A;  4LEY A;  2ZH6 A;  2B56 A;  4FH3 A;  2ZHA A;  2DRB A;  4K97 A;  4K9B A;  4ATB B;  4ATB A;  4OAF A;  3ER8 C;  2O1P A;  4LT6 A;  4X4V A;  4X4R A;  2ZHB A;  2ZH3 A;  4X4Q A;  2B4V A;  4AT7 A;  1R8B A;  2IHO A;  4LEV A;  4WH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...