4OAHA

Crystal structure of the cytosolic domain of mouse mid51 h201a mutant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
330
structure length
330
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADAIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
total genus 114
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oahA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oahA02
4K9BA 4LEZA 4AT8B 4MKPA 4ATBB 4KM5A 4NXUA 4K9AA 4AT9B 4O67A 4LEVA 4O68A 4WOYA 4ATBA 4NXTA 4AT7B 4O6AA 4OAIZ 4K99A 4K98A 4OAHA 4KB6A 4K97A 4OAGA 4AT7A 4NXVA 4K96A 4LEYA 4JLZA 4OAFA 4NXWA 4O69A 4NXXA 4JLXA 4K8VA 4AT8A 4AT9A 4LEWA
chains in the Genus database with same CATH superfamily
2ZH9A 9ICRA 3AQLA 1KEJA 4QZCA 4QZAA 5J0YA 5D62A 4X5VA 3K7DA 3ISDA 4WBZA 1YLQA 1VFGA 1MIVA 4AT7B 3C2LA 4NLZA 1MIYA 4X0BA 3WFPA 4WQLA 8ICOA 4NXVA 8ICNA 4JLZA 9ICFA 2HN2A 3JPNA 2ID1A 4RQ1A 4PGXA 3RJJA 4R66A 4F5RA 3WFOA 2M2TA 7ICRA 8ICLA 1PX5A 4WC2A 3ER8C 4XRHA 4PHEA 5J2HA 4KM5A 7ICEA 7ICHA 5F2VO 1JN3A 5HRFA 4O68A 4Z6DA 1ZQMA 2ZHBA 3MCRA 4OAIZ 1ZQBA 4O5CA 1BPDA 5DB9A 5CHEA 3V7LA 5J0SA 5HHHA 4RQ0A 4MF2A 4X4TA 1ZQTA 9ICMA 8ICPA 1ZQNA 4I2CA 3RJIA 4S3NA 1HUOA 2DRBA 5HRHA 1ZQJA 4UD4A 4I29A 2ZH3A 3RJHA 7ICUA 4I2BA 3NVOA 4Z6CA 3UPSA 1ZQIA 2ZH1A 4PH5A 3RJKA 9ICPA 4I28A 1BPXA 3OVBA 4M04A 4YMNA 4OAHA 5HREA 4IQTA 4OAGA 4I27A 3JYYA 3MDCA 4OAFA 2HN1A 4NXWA 4FO6A 4LVSA 4QZHA 5IIOA 8ICKA 9ICQA 3RJGA 4AT9A 9ICSA 5DBAA 2BCQA 4X4SA 2PFPA 5DBCA 1ZQXA 8ICAA 5J2FA 1ZQEA 3H37A 4FHXA 4I2JA 3JPOA 2BPGA 4RQ2A 4UB1A 5IIMA 1ZQPA 3OUYA 2GA9D 1ZQKA 4M9GA 1ZQUA 3C5FA 8ICTA 4PGYA 4K97A 1MIWA 4FHYA 1KNYA 4AT7A 4WQKA 4RQ6A 1TVAA 4XQ7A 1Q79A 3NWIA 7ICSA 2ISOA 4QZBA 5JTGA 3OUYB 5J0XA 7ICLA 5J2KA 2M2VA 4K9BA 2EWRA 4NLKA 5BOLA 3HIYA 3ISCA 3UQ0A 2GWSA 4TURA 2DR7A 4JWNA 2DR8A 1ZJNA 2PBEA 4RPYA 4O6AA 1XSNA 5CHGA 4MFAA 1OU5A 2BE3A 4R63A 4FHWA 8ICVA 3B0XA 5D46A 3K75D 4JLXA 4EV6A 5IILA 3JPSA 2B56A 9ICHA 2PFNA 4I2GA 1R8AA 4WH5A 1RZTA 2BBHA 4RT2A 4UB2A 8ICIA 2GAFD 4UB5A 4FO1A 4PHDA 3UXPA 9ICVA 5CR0A 4WOYA 1UEVA 4K99A 3JCFA 2P66A 1Q78A 4WC1A 3NYBA 2I9GA 4M9LA 4KLUA 3PHZA 5J2CA 2HHPA 1UETA 1ZQWA 1BPYA 8ICMA 7ICMA 4P4PA 5B3PA 3JPQA 2ISPA 5J29A 4KLHA 4UAZA 2W9MA 4O9MA 3C66A 4WC7A 3RH6A 1V4AA 3LK9A 1ZQOA 5D63A 3ER9B 4KLQA 4F5PA 4RQ3A 5CWRA 4YMMA 3H38A 4M9HA 8ICYA 8ICHA 4KLEA 3MDAA 7ICTA 2FCLA 1ZQAA 5J2EA 5HRDA 3JPRA 1ZQYA 8ICXA 3UXOA 2FMPA 2IUBA 4RQ8A 5J0PA 3LQCB 9ICKA 5CFUA 4PGQA 3TFRA 1ZQCA 2FMSA 5HRIA 3HWTA 4MFCA 4EEDA 1XSLA 4YD1A 5HRBA 3HJ1A 1ZQRA 4WC5A 4IQVA 8ICGA 4RWQA 4I2EA 4QZGA 4K98A 5D4BA 7ICNA 4RT3A 5D49A 5J2JA 2ZH4A 9ICWA 4K4HA 1JMSA 3CK6A 7ICJA 1NOMA 9ICCA 3UXNA 3L9DA 4E80A 5J2IA 4KLLA 3RJFA 3WFRE 3TFSA 2IHOA 4I2FA 4UD5A 3AU6A 9ICEA 4EP7A 1R8BA 4P4MA 4QZIA 5J2BA 5J2GA 4MF8A 3OWGA 4ATBB 5B3QA 3JPPA 7ICQA 3PMNA 4PHAA 4UB4A 4DOBA 1ZQZA 1ZQHA 4KB6A 4RPZA 9ICIA 5CP2A 4RQ4A 4M0AA 4XJEA 3HJ4A 2M2WA 4UAWA 1FA0A 1TFWA 4IG8A 4M9JA 4EGWA 1WOTA 4YCXA 4KLSA 3MBYA 8ICQA 4M47A 4X4OA 4LEWA 5HR9A 1TV9A 4AT8B 4MKPA 4X4RA 4O5EA 3OVAA 2NRKA 3V7KA 4UBCA 4NXTA 2ZHAA 1BPBA 3C18A 4NM1A 4X4UA 8ICZA 4GXJA 2DRAA 3UPQA 4PPXA 3PMLA 5IIKA 3WFQE 4DOCA 4XA5A 2BPCA 4IQUA 5J0RA 5D61A 4KLJA 4TUSA 7ICIA 4KLOA 7ICPA 1R89A 4LZGA 3HW8A 4Z6FA 4NXUA 4PHPA 3H39A 3C2KA 4NLNA 3PNCA 4K9AA 5DBBA 4P2HA 8ICUA 3ERCC 1R8CA 4KLDA 1ZQQA 3B0YA 1MQ3A 4JWMA 5HRKA 9ICXA 2M2UA 9ICLA 4RQ5A 2PFQA 4I2DA 5BOMA 4EEBA 2Q66A 4K96A 4E7XA 4O69A 3RJEA 9ICAA 3H3AA 5J0QA 5IIIA 1ZQDA 4NXXA 1XSPA 4K8VA 4NY8A 4AT8A 9ICNA 4WBYA 4LZDA 5CJ7A 4FH5A 3ISBA 4X4PA 3C5GA 8ICWA 5DB6A 4XQ8A 4O67A 4LEVA 4ATBA 4QZ8A 1ZQSA 8ICJA 4HX0A 4EBJA 4UAYA 4RQ7A 1ZJMA 8ICCA 4RWNA 4WC3A 2BPFA 4M9NA 4TUQA 4P4OA 9ICJA 3V72A 4KLMA 9ICBA 5J2DA 1JQRA 3GDXA 4KLTA 7ICOA 1RPLA 1BPEA 1GPJA 2VANA 1KDHA 4I2AA 4O5KA 4GXKA 2DR5A 2ZH7A 3AU2A 4N7RA 4AT9B 3JPTA 4WC6A 7ICFA 4M2YA 1MQ2A 4X4QA 4KLFA 2DVIA 3RH5A 4YN4A 2RFFA 5HRLA 5J2AA 2BCUA 5HRGA 4I0UA 4X0AA 4NKUA 3OVSA 1F5AA 9ICOA 4F5QA 3OGUA 4KLGA 3NKUA 4YMOA 8ICEA 4GXIA 5J0OA 2ZH5A 4LEZA 3AQKA 4E8FA 4NM2A 2B51A 4FHPA 4X4VA 9ICUA 4QZDA 4WCWA 7ICVA 5CFSA 2PXIA 3C2MA 4FH3A 4F5OA 9ICGA 5DB8A 4QZ9A 3OV7A 4NXZA 3V7JA 4LT6A 4FHVA 5HHIA 4K4GA 3EF2A 5DDYA 3MGIA 3AUOA 5IINA 3AQNA 8ICFA 2BCRA 4MFFA 5DB7A 5IIJA 1NO5A 2PFOA 1TFYA 5DKWA 4UB3A 4K4IA 2FMQA 4RWPA 4NKTA 4QZFA 4Z6EA 3UQ2A 5J0TA 4DOAA 2BBJA 4I2HA 5DEDA 9ICTA 8ICRA 5CFTA 2ZH2A 4TUPA 8ICBA 2O1PA 2O5AA 7ICKA 4QZEA 5J0WA 4WC0A 4YD2A 4R64A 2BCVA 4LEYA 4F5NA 4WC4A 3WFSC 4RPXA 2ZH8A 4EBKA 5DECA 5BPCA 5EOZA 5DDMA 1VJ7A 1BPZA 4R65A 5HC9A 1UEUA 4KLIA 1ZQLA 3RH4A 1ZQVA 2DR9A 1ZQFA 4I2IA 8ICSA 1HUZA 5TZVA 4RWOA 2B4VA 7ICGA 4DO9A 1ZQGA 5CB1A 2IHMA 2ZH6A 3JZ0A 4UBBA 1JAJA 3MGHA 5J0UA 2BCSA 4X4NA 4M5DA 4XUSA 5CA7A 4IQWA 3HX0A 3AQMA
chains in the Genus database with same CATH topology
4K9BA 2ZH9A 2DR5A 2EWRA 3HIYA 3OWGA 4ATBB 5B3QA 2ZH7A 5D62A 3K7DA 4AT9B 4N7RA 2DR7A 2DR8A 4AT7B 4O6AA 4X4QA 4KB6A 2DVIA 4XJEA 3HJ4A 4WQLA 4NXVA 4FHWA 1FA0A 1TFWA 4JLZA 4NKUA 3OVSA 1F5AA 4JLXA 2B56A 3NKUA 4X4OA 1R8AA 4WH5A 4LEWA 2GAFD 3ER8C 2ZH5A 4LEZA 4AT8B 4MKPA 4X4RA 3OVAA 4E8FA 4KM5A 4FO1A 2B51A 4FHPA 4X4VA 4O68A 4WOYA 4NXTA 2ZHAA 2ZHBA 3MCRA 4X4UA 1UEVA 5CFSA 4OAIZ 4K99A 4FH3A 2DRAA 3OV7A 1Q78A 4LT6A 3NYBA 4FHVA 3EF2A 5CHEA 3PHZA 4X4TA 2HHPA 1UETA 5B3PA 5D61A 2DRBA 1TFYA 1R89A 4UD4A 3C66A 2ZH3A 4NKTA 5D63A 3ER9B 4NXUA 4K9AA 2ZH1A 5CFTA 3ERCC 1R8CA 2ZH2A 2O1PA 3OVBA 4OAHA 2FCLA 4OAGA 2Q66A 4K96A 4LEYA 4OAFA 4E7XA 4NXWA 4O69A 2ZH8A 4NXXA 4K8VA 4AT8A 5CFUA 4AT9A 4X4SA 4FH5A 4X4PA 1UEUA 4FHXA 3HJ1A 2DR9A 4O67A 4LEVA 4ATBA 2B4VA 3OUYA 2GA9D 4HX0A 4K98A 4K97A 4FHYA 4AT7A 2ZH4A 4WQKA 1Q79A 2ZH6A 4E80A 3OUYB 4X4NA 2IHOA 4UD5A 4M5DA 1GPJA 4EP7A 1R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K9B A;  4LEZ A;  4AT8 B;  4MKP A;  4ATB B;  4KM5 A;  4NXU A;  4K9A A;  4AT9 B;  4O67 A;  4LEV A;  4O68 A;  4WOY A;  4ATB A;  4NXT A;  4AT7 B;  4O6A A;  4OAI Z;  4K99 A;  4K98 A;  4OAH A;  4KB6 A;  4K97 A;  4OAG A;  4AT7 A;  4NXV A;  4K96 A;  4LEY A;  4JLZ A;  4OAF A;  4NXW A;  4O69 A;  4NXX A;  4JLX A;  4K8V A;  4AT8 A;  4AT9 A;  4LEW A; 
#chains in the Genus database with same CATH topology
 2ZH9 A;  9ICR A;  3AQL A;  1KEJ A;  4QZC A;  4QZA A;  5J0Y A;  5D62 A;  4X5V A;  3K7D A;  3ISD A;  4WBZ A;  1YLQ A;  1VFG A;  1MIV A;  4AT7 B;  3C2L A;  4NLZ A;  1MIY A;  4X0B A;  3WFP A;  4WQL A;  8ICO A;  4NXV A;  8ICN A;  4JLZ A;  9ICF A;  2HN2 A;  3JPN A;  2ID1 A;  4RQ1 A;  4PGX A;  3RJJ A;  4R66 A;  4F5R A;  3WFO A;  2M2T A;  7ICR A;  8ICL A;  1PX5 A;  4WC2 A;  3ER8 C;  4XRH A;  4PHE A;  5J2H A;  4KM5 A;  7ICE A;  7ICH A;  5F2V O;  1JN3 A;  5HRF A;  4O68 A;  4Z6D A;  1ZQM A;  2ZHB A;  3MCR A;  4OAI Z;  1ZQB A;  4O5C A;  1BPD A;  5DB9 A;  5CHE A;  3V7L A;  5J0S A;  5HHH A;  4RQ0 A;  4MF2 A;  4X4T A;  1ZQT A;  9ICM A;  8ICP A;  1ZQN A;  4I2C A;  3RJI A;  4S3N A;  1HUO A;  2DRB A;  5HRH A;  1ZQJ A;  4UD4 A;  4I29 A;  2ZH3 A;  3RJH A;  7ICU A;  4I2B A;  3NVO A;  4Z6C A;  3UPS A;  1ZQI A;  2ZH1 A;  4PH5 A;  3RJK A;  9ICP A;  4I28 A;  1BPX A;  3OVB A;  4M04 A;  4YMN A;  4OAH A;  5HRE A;  4IQT A;  4OAG A;  4I27 A;  3JYY A;  3MDC A;  4OAF A;  2HN1 A;  4NXW A;  4FO6 A;  4LVS A;  4QZH A;  5IIO A;  8ICK A;  9ICQ A;  3RJG A;  4AT9 A;  9ICS A;  5DBA A;  2BCQ A;  4X4S A;  2PFP A;  5DBC A;  1ZQX A;  8ICA A;  5J2F A;  1ZQE A;  3H37 A;  4FHX A;  4I2J A;  3JPO A;  2BPG A;  4RQ2 A;  4UB1 A;  5IIM A;  1ZQP A;  3OUY A;  2GA9 D;  1ZQK A;  4M9G A;  1ZQU A;  3C5F A;  8ICT A;  4PGY A;  4K97 A;  1MIW A;  4FHY A;  1KNY A;  4AT7 A;  4WQK A;  4RQ6 A;  1TVA A;  4XQ7 A;  1Q79 A;  3NWI A;  7ICS A;  2ISO A;  4QZB A;  5JTG A;  3OUY B;  5J0X A;  7ICL A;  5J2K A;  2M2V A;  4K9B A;  2EWR A;  4NLK A;  5BOL A;  3HIY A;  3ISC A;  3UQ0 A;  2GWS A;  4TUR A;  2DR7 A;  4JWN A;  2DR8 A;  1ZJN A;  2PBE A;  4RPY A;  4O6A A;  1XSN A;  5CHG A;  4MFA A;  1OU5 A;  2BE3 A;  4R63 A;  4FHW A;  8ICV A;  3B0X A;  5D46 A;  3K75 D;  4JLX A;  4EV6 A;  5IIL A;  3JPS A;  2B56 A;  9ICH A;  2PFN A;  4I2G A;  1R8A A;  4WH5 A;  1RZT A;  2BBH A;  4RT2 A;  4UB2 A;  8ICI A;  2GAF D;  4UB5 A;  4FO1 A;  4PHD A;  3UXP A;  9ICV A;  5CR0 A;  4WOY A;  1UEV A;  4K99 A;  3JCF A;  2P66 A;  1Q78 A;  4WC1 A;  3NYB A;  2I9G A;  4M9L A;  4KLU A;  3PHZ A;  5J2C A;  2HHP A;  1UET A;  1ZQW A;  1BPY A;  8ICM A;  7ICM A;  4P4P A;  5B3P A;  3JPQ A;  2ISP A;  5J29 A;  4KLH A;  4UAZ A;  2W9M A;  4O9M A;  3C66 A;  4WC7 A;  3RH6 A;  1V4A A;  3LK9 A;  1ZQO A;  5D63 A;  3ER9 B;  4KLQ A;  4F5P A;  4RQ3 A;  5CWR A;  4YMM A;  3H38 A;  4M9H A;  8ICY A;  8ICH A;  4KLE A;  3MDA A;  7ICT A;  2FCL A;  1ZQA A;  5J2E A;  5HRD A;  3JPR A;  1ZQY A;  8ICX A;  3UXO A;  2FMP A;  2IUB A;  4RQ8 A;  5J0P A;  3LQC B;  9ICK A;  5CFU A;  4PGQ A;  3TFR A;  1ZQC A;  2FMS A;  5HRI A;  3HWT A;  4MFC A;  4EED A;  1XSL A;  4YD1 A;  5HRB A;  3HJ1 A;  1ZQR A;  4WC5 A;  4IQV A;  8ICG A;  4RWQ A;  4I2E A;  4QZG A;  4K98 A;  5D4B A;  7ICN A;  4RT3 A;  5D49 A;  5J2J A;  2ZH4 A;  9ICW A;  4K4H A;  1JMS A;  3CK6 A;  7ICJ A;  1NOM A;  9ICC A;  3UXN A;  3L9D A;  4E80 A;  5J2I A;  4KLL A;  3RJF A;  3WFR E;  3TFS A;  2IHO A;  4I2F A;  4UD5 A;  3AU6 A;  9ICE A;  4EP7 A;  1R8B A;  4P4M A;  4QZI A;  5J2B A;  5J2G A;  4MF8 A;  3OWG A;  4ATB B;  5B3Q A;  3JPP A;  7ICQ A;  3PMN A;  4PHA A;  4UB4 A;  4DOB A;  1ZQZ A;  1ZQH A;  4KB6 A;  4RPZ A;  9ICI A;  5CP2 A;  4RQ4 A;  4M0A A;  4XJE A;  3HJ4 A;  2M2W A;  4UAW A;  1FA0 A;  1TFW A;  4IG8 A;  4M9J A;  4EGW A;  1WOT A;  4YCX A;  4KLS A;  3MBY A;  8ICQ A;  4M47 A;  4X4O A;  4LEW A;  5HR9 A;  1TV9 A;  4AT8 B;  4MKP A;  4X4R A;  4O5E A;  3OVA A;  2NRK A;  3V7K A;  4UBC A;  4NXT A;  2ZHA A;  1BPB A;  3C18 A;  4NM1 A;  4X4U A;  8ICZ A;  4GXJ A;  2DRA A;  3UPQ A;  4PPX A;  3PML A;  5IIK A;  3WFQ E;  4DOC A;  4XA5 A;  2BPC A;  4IQU A;  5J0R A;  5D61 A;  4KLJ A;  4TUS A;  7ICI A;  4KLO A;  7ICP A;  1R89 A;  4LZG A;  3HW8 A;  4Z6F A;  4NXU A;  4PHP A;  3H39 A;  3C2K A;  4NLN A;  3PNC A;  4K9A A;  5DBB A;  4P2H A;  8ICU A;  3ERC C;  1R8C A;  4KLD A;  1ZQQ A;  3B0Y A;  1MQ3 A;  4JWM A;  5HRK A;  9ICX A;  2M2U A;  9ICL A;  4RQ5 A;  2PFQ A;  4I2D A;  5BOM A;  4EEB A;  2Q66 A;  4K96 A;  4E7X A;  4O69 A;  3RJE A;  9ICA A;  3H3A A;  5J0Q A;  5III A;  1ZQD A;  4NXX A;  1XSP A;  4K8V A;  4NY8 A;  4AT8 A;  9ICN A;  4WBY A;  4LZD A;  5CJ7 A;  4FH5 A;  3ISB A;  4X4P A;  3C5G A;  8ICW A;  5DB6 A;  4XQ8 A;  4O67 A;  4LEV A;  4ATB A;  4QZ8 A;  1ZQS A;  8ICJ A;  4HX0 A;  4EBJ A;  4UAY A;  4RQ7 A;  1ZJM A;  8ICC A;  4RWN A;  4WC3 A;  2BPF A;  4M9N A;  4TUQ A;  4P4O A;  9ICJ A;  3V72 A;  4KLM A;  9ICB A;  5J2D A;  1JQR A;  3GDX A;  4KLT A;  7ICO A;  1RPL A;  1BPE A;  1GPJ A;  2VAN A;  1KDH A;  4I2A A;  4O5K A;  4GXK A;  2DR5 A;  2ZH7 A;  3AU2 A;  4N7R A;  4AT9 B;  3JPT A;  4WC6 A;  7ICF A;  4M2Y A;  1MQ2 A;  4X4Q A;  4KLF A;  2DVI A;  3RH5 A;  4YN4 A;  2RFF A;  5HRL A;  5J2A A;  2BCU A;  5HRG A;  4I0U A;  4X0A A;  4NKU A;  3OVS A;  1F5A A;  9ICO A;  4F5Q A;  3OGU A;  4KLG A;  3NKU A;  4YMO A;  8ICE A;  4GXI A;  5J0O A;  2ZH5 A;  4LEZ A;  3AQK A;  4E8F A;  4NM2 A;  2B51 A;  4FHP A;  4X4V A;  9ICU A;  4QZD A;  4WCW A;  7ICV A;  5CFS A;  2PXI A;  3C2M A;  4FH3 A;  4F5O A;  9ICG A;  5DB8 A;  4QZ9 A;  3OV7 A;  4NXZ A;  3V7J A;  4LT6 A;  4FHV A;  5HHI A;  4K4G A;  3EF2 A;  5DDY A;  3MGI A;  3AUO A;  5IIN A;  3AQN A;  8ICF A;  2BCR A;  4MFF A;  5DB7 A;  5IIJ A;  1NO5 A;  2PFO A;  1TFY A;  5DKW A;  4UB3 A;  4K4I A;  2FMQ A;  4RWP A;  4NKT A;  4QZF A;  4Z6E A;  3UQ2 A;  5J0T A;  4DOA A;  2BBJ A;  4I2H A;  5DED A;  9ICT A;  8ICR A;  5CFT A;  2ZH2 A;  4TUP A;  8ICB A;  2O1P A;  2O5A A;  7ICK A;  4QZE A;  5J0W A;  4WC0 A;  4YD2 A;  4R64 A;  2BCV A;  4LEY A;  4F5N A;  4WC4 A;  3WFS C;  4RPX A;  2ZH8 A;  4EBK A;  5DEC A;  5BPC A;  5EOZ A;  5DDM A;  1VJ7 A;  1BPZ A;  4R65 A;  5HC9 A;  1UEU A;  4KLI A;  1ZQL A;  3RH4 A;  1ZQV A;  2DR9 A;  1ZQF A;  4I2I A;  8ICS A;  1HUZ A;  5TZV A;  4RWO A;  2B4V A;  7ICG A;  4DO9 A;  1ZQG A;  5CB1 A;  2IHM A;  2ZH6 A;  3JZ0 A;  4UBB A;  1JAJ A;  3MGH A;  5J0U A;  2BCS A;  4X4N A;  4M5D A;  4XUS A;  5CA7 A;  4IQW A;  3HX0 A;  3AQM A; 
#chains in the Genus database with same CATH homology
 4K9B A;  2ZH9 A;  2DR5 A;  2EWR A;  3HIY A;  3OWG A;  4ATB B;  5B3Q A;  2ZH7 A;  5D62 A;  3K7D A;  4AT9 B;  4N7R A;  2DR7 A;  2DR8 A;  4AT7 B;  4O6A A;  4X4Q A;  4KB6 A;  2DVI A;  4XJE A;  3HJ4 A;  4WQL A;  4NXV A;  4FHW A;  1FA0 A;  1TFW A;  4JLZ A;  4NKU A;  3OVS A;  1F5A A;  4JLX A;  2B56 A;  3NKU A;  4X4O A;  1R8A A;  4WH5 A;  4LEW A;  2GAF D;  3ER8 C;  2ZH5 A;  4LEZ A;  4AT8 B;  4MKP A;  4X4R A;  3OVA A;  4E8F A;  4KM5 A;  4FO1 A;  2B51 A;  4FHP A;  4X4V A;  4O68 A;  4WOY A;  4NXT A;  2ZHA A;  2ZHB A;  3MCR A;  4X4U A;  1UEV A;  5CFS A;  4OAI Z;  4K99 A;  4FH3 A;  2DRA A;  3OV7 A;  1Q78 A;  4LT6 A;  3NYB A;  4FHV A;  3EF2 A;  5CHE A;  3PHZ A;  4X4T A;  2HHP A;  1UET A;  5B3P A;  5D61 A;  2DRB A;  1TFY A;  1R89 A;  4UD4 A;  3C66 A;  2ZH3 A;  4NKT A;  5D63 A;  3ER9 B;  4NXU A;  4K9A A;  2ZH1 A;  5CFT A;  3ERC C;  1R8C A;  2ZH2 A;  2O1P A;  3OVB A;  4OAH A;  2FCL A;  4OAG A;  2Q66 A;  4K96 A;  4LEY A;  4OAF A;  4E7X A;  4NXW A;  4O69 A;  2ZH8 A;  4NXX A;  4K8V A;  4AT8 A;  5CFU A;  4AT9 A;  4X4S A;  4FH5 A;  4X4P A;  1UEU A;  4FHX A;  3HJ1 A;  2DR9 A;  4O67 A;  4LEV A;  4ATB A;  2B4V A;  3OUY A;  2GA9 D;  4HX0 A;  4K98 A;  4K97 A;  4FHY A;  4AT7 A;  2ZH4 A;  4WQK A;  1Q79 A;  2ZH6 A;  4E80 A;  3OUY B;  4X4N A;  2IHO A;  4UD5 A;  4M5D A;  1GPJ A;  4EP7 A;  1R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...