4OAHA

Crystal structure of the cytosolic domain of mouse mid51 h201a mutant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
330
structure length
330
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADAIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 114
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oahA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oahA02
4NXWA 4WOYA 4NXUA 4AT9B 4K98A 4NXVA 4K9AA 4OAHA 4O67A 4KM5A 4AT8A 4MKPA 4K99A 4ATBA 4O6AA 4K96A 4JLZA 4NXTA 4AT7B 4AT9A 4LEVA 4KB6A 4K97A 4NXXA 4OAFA 4AT7A 4LEYA 4LEZA 4O69A 4JLXA 4OAIZ 4K9BA 4K8VA 4AT8B 4O68A 4OAGA 4ATBB 4LEWA
chains in the Genus database with same CATH superfamily
8ICZA 2DR5A 5DECA 3WFOA 4S3NA 4F5NA 2I9GA 4AT7B 4X0AA 4WC3A 1VFGA 2ID1A 4X4OA 2ZHAA 5J0XA 5J2EA 4PHAA 8ICPA 5HREA 1ZQZA 3B0XA 4PHEA 8ICRA 1ZQHA 2BCVA 3K75D 8ICQA 4MFCA 5J0SA 2BPCA 3AQLA 4XJEA 2FMQA 4KLJA 4Z6DA 5HC9A 4OAHA 4K99A 4I2CA 5J0WA 4NXZA 5HHIA 4NXTA 5HR9A 9ICFA 4I27A 1BPDA 4PGQA 3TFRA 4KLHA 2PFQA 2ZH4A 4QZ9A 3C2MA 4QZFA 4OAFA 2ZHBA 4NY8A 4AT7A 4TUSA 2PFNA 2DVIA 5HRDA 2M2TA 4WC5A 3HJ1A 5IIKA 2ZH6A 4NM2A 3JPPA 4ATBB 4WH5A 2FMSA 9ICUA 4AT9B 4M9GA 1ZQCA 5EOZA 9ICAA 4O67A 5J0YA 5D4BA 5CFSA 4IQUA 3NWIA 3NVOA 4X4NA 4WBYA 4LEVA 4F5PA 4GXIA 3V7KA 5DKWA 2ZH3A 4WC6A 4R64A 4PPXA 1KDHA 1JQRA 5D62A 4M47A 2EWRA 4WC4A 4M0AA 5HRFA 2ISPA 7ICSA 1ZQMA 2ZH8A 3GDXA 4KLOA 4FHYA 9ICCA 4RPXA 1UEVA 4WBZA 5TZVA 8ICLA 3RJGA 2B4VA 4RWNA 4RQ2A 4UAZA 3MGHA 4K4IA 3V7JA 4RWPA 5D46A 4WC2A 4KLQA 4ATBA 1ZQBA 8ICHA 4YMMA 4XRHA 4R65A 3RH5A 3WFPA 2DR7A 2DR9A 4RQ1A 4I2EA 9ICSA 4EP7A 5IINA 3TFSA 8ICNA 3MGIA 7ICMA 5F2VO 3MDCA 7ICJA 4I28A 8ICWA 4M2YA 2Q66A 5DDMA 5J29A 4EBJA 5DBBA 4XA5A 9ICXA 4YCXA 1R8CA 8ICEA 2IUBA 4MKPA 4UB3A 4O6AA 4I2JA 5CB1A 8ICIA 9ICNA 4PGXA 1R89A 4PH5A 1BPBA 4I29A 1V4AA 4FHXA 4TURA 4UB5A 1ZQVA 4QZBA 4K9BA 3UPQA 4YD1A 4UD5A 4I2GA 3MBYA 3UXOA 4K8VA 2FMPA 3AQNA 4NLKA 4FHWA 4NXWA 9ICHA 5JTGA 4EEDA 1JMSA 3JZ0A 4PHPA 1ZQTA 3UQ2A 9ICJA 4I2DA 4RQ7A 3JYYA 4RPYA 2IHOA 4QZEA 2P66A 1R8BA 5J2HA 1XSPA 3UPSA 3C5GA 3LK9A 1ZQUA 4OAIZ 5CWRA 9ICVA 5CA7A 3V7LA 4FO1A 4P4MA 2BCSA 4QZHA 4NXVA 3ISBA 4P2HA 2PBEA 4WQKA 4UD4A 1ZQFA 1GPJA 5CFUA 4TUQA 4RQ0A 4O5EA 4RQ5A 4WCWA 4KB6A 9ICOA 2HN2A 4M9HA 4X4UA 3AUOA 7ICOA 4QZCA 4X4SA 5J2CA 2ISOA 3UXNA 3RH4A 8ICJA 7ICFA 3NKUA 4FHPA 4AT8B 4M9JA 3JPOA 5DB8A 2M2UA 3JPSA 3NYBA 9ICRA 5BOMA 3CK6A 7ICIA 4K9AA 2BPFA 4X4VA 4KLSA 9ICEA 4JLZA 5HRLA 2IHMA 4NKTA 5CHEA 2PFPA 7ICLA 4UBBA 4DOBA 3AU2A 5J0UA 3C2KA 5HRHA 2PXIA 1ZQLA 1ZJMA 1ZQRA 2BE3A 2RFFA 3C18A 4K4GA 7ICQA 3AQKA 1MIVA 1XSNA 2O5AA 3LQCB 1Q79A 5CP2A 3JPRA 4XQ7A 1NO5A 5J2KA 9ICBA 4AT8A 8ICAA 5IIMA 4X5VA 4I2FA 4LVSA 5BOLA 4AT9A 4X4PA 5J2IA 2ZH1A 4K97A 1ZQNA 4KLIA 3OUYB 4IQTA 8ICSA 7ICVA 4XQ8A 3HW8A 3WFSC 4O68A 4YN4A 3RJKA 4UBCA 8ICXA 9ICKA 4RWOA 4RWQA 3B0YA 3MCRA 5J2BA 1KEJA 4KM5A 3WFQE 1ZQAA 9ICPA 3UQ0A 8ICMA 4I0UA 3WFRE 4NLZA 8ICOA 3H3AA 4F5QA 4RT2A 1RPLA 3C66A 4RQ4A 5HHHA 5J2AA 4O9MA 1YLQA 1ZQPA 3OVAA 4LEZA 3ISCA 4GXKA 3H37A 4RT3A 3JPTA 4KLLA 1ZQGA 3OUYA 4HX0A 5IIOA 5DB6A 3OGUA 3MDAA 3AQMA 2ZH5A 2HN1A 1UEUA 3H39A 5J2DA 4QZGA 5HRBA 4R66A 4I2AA 4NXUA 4KLGA 3RJIA 5D49A 8ICYA 1XSLA 4KLUA 4UB2A 5BPCA 5DBAA 3ER8C 4YMOA 3PMLA 8ICTA 1JAJA 5IIIA 4RPZA 4F5RA 4KLTA 4MF8A 3OWGA 4X4QA 3C2LA 5D61A 4FHVA 1ZQXA 4QZIA 8ICFA 9ICQA 1ZQSA 4O69A 1ZJNA 5B3PA 4TUPA 5J0RA 1VJ7A 3C5FA 4DOCA 4KLFA 4Z6CA 3ERCC 4RQ3A 4NLNA 1HUOA 3HX0A 9ICWA 5DBCA 4QZAA 1TFYA 5DEDA 3OVBA 7ICTA 2GWSA 4Z6FA 5J0PA 1BPZA 4KLDA 2ZH9A 5DDYA 1ZQOA 7ICHA 7ICEA 5IIJA 1WOTA 5CHGA 3RJEA 2M2VA 1F5AA 2BCUA 4JWMA 4MFAA 4UB4A 3JPQA 4IG8A 1R8AA 4JWNA 4KLEA 4DOAA 5J0QA 3JCFA 3K7DA 1TV9A 9ICMA 3L9DA 4R63A 7ICUA 5J2FA 4WOYA 4X4TA 1MQ3A 8ICCA 5J0TA 4YD2A 3EF2A 4Z6EA 8ICVA 8ICGA 4K96A 5CFTA 1NOMA 4YMNA 4I2HA 4EEBA 4UB1A 1MIWA 4PGYA 4FH5A 2M2WA 4O5CA 9ICIA 1Q78A 5HRIA 2W9MA 1HUZA 1ZQWA 9ICLA 4E80A 4FH3A 1TVAA 4UAYA 2FCLA 1BPYA 2GA9D 3PNCA 4FO6A 4QZ8A 4KLMA 4WQLA 4MFFA 8ICKA 7ICGA 8ICBA 2B51A 5DB9A 4RQ8A 1ZQJA 7ICPA 4X0BA 1TFWA 4WC1A 2ZH7A 4LZGA 3PHZA 4K4HA 5HRKA 4QZDA 3AU6A 1MIYA 5J2GA 2O1PA 4NXXA 4DO9A 4M9LA 4EBKA 3ER9B 9ICTA 4P4PA 3ISDA 2DR8A 1ZQDA 1ZQQA 3UXPA 4P4OA 4M5DA 1ZQEA 5CR0A 4E7XA 4GXJA 1MQ2A 2BCQA 2VANA 4I2IA 7ICNA 1ZQKA 3RJHA 4NKUA 3OVSA 5CJ7A 4NM1A 1JN3A 9ICGA 3PMNA 4UAWA 1UETA 4LT6A 4WC7A 4M04A 7ICKA 5J2JA 1ZQIA 7ICRA 4LEYA 2BBHA 3HIYA 4I2BA 2DRBA 5IILA 5J0OA 4JLXA 2BBJA 2NRKA 8ICUA 4EGWA 3HWTA 3OV7A 5DB7A 2PFOA 4K98A 3RH6A 1BPEA 5HRGA 4O5KA 1FA0A 2BPGA 1PX5A 4RQ6A 4MF2A 1RZTA 4M9NA 4LZDA 1BPXA 2GAFD 1OU5A 4N7RA 3JPNA 4PHDA 5B3QA 4WC0A 1ZQYA 4IQWA 4X4RA 4F5OA 4EV6A 3RJJA 2B56A 2BCRA 2ZH2A 3HJ4A 4E8FA 2DRAA 1KNYA 4IQVA 2HHPA 3RJFA 3H38A 4XUSA 5D63A 4OAGA 3V72A 4LEWA
chains in the Genus database with same CATH topology
1Q79A 2DR5A 2Q66A 4WOYA 4X4TA 1R8CA 3EF2A 4AT8A 4MKPA 4O6AA 4K96A 5CFTA 4AT7B 4X4OA 4AT9A 4X4PA 2ZHAA 2ZH1A 4K97A 4FH5A 1R89A 3OUYB 1Q78A 4FHXA 4E80A 4K9BA 4FH3A 4UD5A 2FCLA 4O68A 4K8VA 2GA9D 4FHWA 4NXWA 4XJEA 4WQLA 3MCRA 2B51A 4KM5A 4OAHA 4K99A 1TFWA 4NXTA 2ZH7A 3PHZA 2IHOA 2ZH4A 3C66A 2O1PA 4NXXA 4OAFA 2ZHBA 4AT7A 3OVAA 1R8BA 4LEZA 2DVIA 3ER9B 3HJ1A 2ZH6A 2DR8A 4OAIZ 3OUYA 4HX0A 4M5DA 4ATBB 2ZH5A 4WH5A 1UEUA 4FO1A 4NXUA 4AT9B 4E7XA 4NXVA 4O67A 5CFSA 4NKUA 3OVSA 4UD4A 4WQKA 1GPJA 5CFUA 3ER8C 4X4NA 4LEVA 1UETA 4KB6A 4LT6A 2ZH3A 4X4UA 5D62A 3OWGA 2EWRA 4X4QA 5D61A 4LEYA 4FHVA 3HIYA 4X4SA 2DRBA 2ZH8A 4FHYA 4O69A 4JLXA 3NKUA 5B3PA 4FHPA 4AT8B 1UEVA 3OV7A 3ERCC 2B4VA 4K98A 3NYBA 4K9AA 1TFYA 4X4VA 4ATBA 3OVBA 1FA0A 4JLZA 4NKTA 5CHEA 2ZH9A 2GAFD 2DR7A 4N7RA 2DR9A 5B3QA 1F5AA 4X4RA 4EP7A 2B56A 1R8AA 2ZH2A 3HJ4A 4E8FA 2DRAA 2HHPA 3K7DA 5D63A 4OAGA 4LEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXW A;  4WOY A;  4NXU A;  4AT9 B;  4K98 A;  4NXV A;  4K9A A;  4OAH A;  4O67 A;  4KM5 A;  4AT8 A;  4MKP A;  4K99 A;  4ATB A;  4O6A A;  4K96 A;  4JLZ A;  4NXT A;  4AT7 B;  4AT9 A;  4LEV A;  4KB6 A;  4K97 A;  4NXX A;  4OAF A;  4AT7 A;  4LEY A;  4LEZ A;  4O69 A;  4JLX A;  4OAI Z;  4K9B A;  4K8V A;  4AT8 B;  4O68 A;  4OAG A;  4ATB B;  4LEW A; 
#chains in the Genus database with same CATH topology
 8ICZ A;  2DR5 A;  5DEC A;  3WFO A;  4S3N A;  4F5N A;  2I9G A;  4AT7 B;  4X0A A;  4WC3 A;  1VFG A;  2ID1 A;  4X4O A;  2ZHA A;  5J0X A;  5J2E A;  4PHA A;  8ICP A;  5HRE A;  1ZQZ A;  3B0X A;  4PHE A;  8ICR A;  1ZQH A;  2BCV A;  3K75 D;  8ICQ A;  4MFC A;  5J0S A;  2BPC A;  3AQL A;  4XJE A;  2FMQ A;  4KLJ A;  4Z6D A;  5HC9 A;  4OAH A;  4K99 A;  4I2C A;  5J0W A;  4NXZ A;  5HHI A;  4NXT A;  5HR9 A;  9ICF A;  4I27 A;  1BPD A;  4PGQ A;  3TFR A;  4KLH A;  2PFQ A;  2ZH4 A;  4QZ9 A;  3C2M A;  4QZF A;  4OAF A;  2ZHB A;  4NY8 A;  4AT7 A;  4TUS A;  2PFN A;  2DVI A;  5HRD A;  2M2T A;  4WC5 A;  3HJ1 A;  5IIK A;  2ZH6 A;  4NM2 A;  3JPP A;  4ATB B;  4WH5 A;  2FMS A;  9ICU A;  4AT9 B;  4M9G A;  1ZQC A;  5EOZ A;  9ICA A;  4O67 A;  5J0Y A;  5D4B A;  5CFS A;  4IQU A;  3NWI A;  3NVO A;  4X4N A;  4WBY A;  4LEV A;  4F5P A;  4GXI A;  3V7K A;  5DKW A;  2ZH3 A;  4WC6 A;  4R64 A;  4PPX A;  1KDH A;  1JQR A;  5D62 A;  4M47 A;  2EWR A;  4WC4 A;  4M0A A;  5HRF A;  2ISP A;  7ICS A;  1ZQM A;  2ZH8 A;  3GDX A;  4KLO A;  4FHY A;  9ICC A;  4RPX A;  1UEV A;  4WBZ A;  5TZV A;  8ICL A;  3RJG A;  2B4V A;  4RWN A;  4RQ2 A;  4UAZ A;  3MGH A;  4K4I A;  3V7J A;  4RWP A;  5D46 A;  4WC2 A;  4KLQ A;  4ATB A;  1ZQB A;  8ICH A;  4YMM A;  4XRH A;  4R65 A;  3RH5 A;  3WFP A;  2DR7 A;  2DR9 A;  4RQ1 A;  4I2E A;  9ICS A;  4EP7 A;  5IIN A;  3TFS A;  8ICN A;  3MGI A;  7ICM A;  5F2V O;  3MDC A;  7ICJ A;  4I28 A;  8ICW A;  4M2Y A;  2Q66 A;  5DDM A;  5J29 A;  4EBJ A;  5DBB A;  4XA5 A;  9ICX A;  4YCX A;  1R8C A;  8ICE A;  2IUB A;  4MKP A;  4UB3 A;  4O6A A;  4I2J A;  5CB1 A;  8ICI A;  9ICN A;  4PGX A;  1R89 A;  4PH5 A;  1BPB A;  4I29 A;  1V4A A;  4FHX A;  4TUR A;  4UB5 A;  1ZQV A;  4QZB A;  4K9B A;  3UPQ A;  4YD1 A;  4UD5 A;  4I2G A;  3MBY A;  3UXO A;  4K8V A;  2FMP A;  3AQN A;  4NLK A;  4FHW A;  4NXW A;  9ICH A;  5JTG A;  4EED A;  1JMS A;  3JZ0 A;  4PHP A;  1ZQT A;  3UQ2 A;  9ICJ A;  4I2D A;  4RQ7 A;  3JYY A;  4RPY A;  2IHO A;  4QZE A;  2P66 A;  1R8B A;  5J2H A;  1XSP A;  3UPS A;  3C5G A;  3LK9 A;  1ZQU A;  4OAI Z;  5CWR A;  9ICV A;  5CA7 A;  3V7L A;  4FO1 A;  4P4M A;  2BCS A;  4QZH A;  4NXV A;  3ISB A;  4P2H A;  2PBE A;  4WQK A;  4UD4 A;  1ZQF A;  1GPJ A;  5CFU A;  4TUQ A;  4RQ0 A;  4O5E A;  4RQ5 A;  4WCW A;  4KB6 A;  9ICO A;  2HN2 A;  4M9H A;  4X4U A;  3AUO A;  7ICO A;  4QZC A;  4X4S A;  5J2C A;  2ISO A;  3UXN A;  3RH4 A;  8ICJ A;  7ICF A;  3NKU A;  4FHP A;  4AT8 B;  4M9J A;  3JPO A;  5DB8 A;  2M2U A;  3JPS A;  3NYB A;  9ICR A;  5BOM A;  3CK6 A;  7ICI A;  4K9A A;  2BPF A;  4X4V A;  4KLS A;  9ICE A;  4JLZ A;  5HRL A;  2IHM A;  4NKT A;  5CHE A;  2PFP A;  7ICL A;  4UBB A;  4DOB A;  3AU2 A;  5J0U A;  3C2K A;  5HRH A;  2PXI A;  1ZQL A;  1ZJM A;  1ZQR A;  2BE3 A;  2RFF A;  3C18 A;  4K4G A;  7ICQ A;  3AQK A;  1MIV A;  1XSN A;  2O5A A;  3LQC B;  1Q79 A;  5CP2 A;  3JPR A;  4XQ7 A;  1NO5 A;  5J2K A;  9ICB A;  4AT8 A;  8ICA A;  5IIM A;  4X5V A;  4I2F A;  4LVS A;  5BOL A;  4AT9 A;  4X4P A;  5J2I A;  2ZH1 A;  4K97 A;  1ZQN A;  4KLI A;  3OUY B;  4IQT A;  8ICS A;  7ICV A;  4XQ8 A;  3HW8 A;  3WFS C;  4O68 A;  4YN4 A;  3RJK A;  4UBC A;  8ICX A;  9ICK A;  4RWO A;  4RWQ A;  3B0Y A;  3MCR A;  5J2B A;  1KEJ A;  4KM5 A;  3WFQ E;  1ZQA A;  9ICP A;  3UQ0 A;  8ICM A;  4I0U A;  3WFR E;  4NLZ A;  8ICO A;  3H3A A;  4F5Q A;  4RT2 A;  1RPL A;  3C66 A;  4RQ4 A;  5HHH A;  5J2A A;  4O9M A;  1YLQ A;  1ZQP A;  3OVA A;  4LEZ A;  3ISC A;  4GXK A;  3H37 A;  4RT3 A;  3JPT A;  4KLL A;  1ZQG A;  3OUY A;  4HX0 A;  5IIO A;  5DB6 A;  3OGU A;  3MDA A;  3AQM A;  2ZH5 A;  2HN1 A;  1UEU A;  3H39 A;  5J2D A;  4QZG A;  5HRB A;  4R66 A;  4I2A A;  4NXU A;  4KLG A;  3RJI A;  5D49 A;  8ICY A;  1XSL A;  4KLU A;  4UB2 A;  5BPC A;  5DBA A;  3ER8 C;  4YMO A;  3PML A;  8ICT A;  1JAJ A;  5III A;  4RPZ A;  4F5R A;  4KLT A;  4MF8 A;  3OWG A;  4X4Q A;  3C2L A;  5D61 A;  4FHV A;  1ZQX A;  4QZI A;  8ICF A;  9ICQ A;  1ZQS A;  4O69 A;  1ZJN A;  5B3P A;  4TUP A;  5J0R A;  1VJ7 A;  3C5F A;  4DOC A;  4KLF A;  4Z6C A;  3ERC C;  4RQ3 A;  4NLN A;  1HUO A;  3HX0 A;  9ICW A;  5DBC A;  4QZA A;  1TFY A;  5DED A;  3OVB A;  7ICT A;  2GWS A;  4Z6F A;  5J0P A;  1BPZ A;  4KLD A;  2ZH9 A;  5DDY A;  1ZQO A;  7ICH A;  7ICE A;  5IIJ A;  1WOT A;  5CHG A;  3RJE A;  2M2V A;  1F5A A;  2BCU A;  4JWM A;  4MFA A;  4UB4 A;  3JPQ A;  4IG8 A;  1R8A A;  4JWN A;  4KLE A;  4DOA A;  5J0Q A;  3JCF A;  3K7D A;  1TV9 A;  9ICM A;  3L9D A;  4R63 A;  7ICU A;  5J2F A;  4WOY A;  4X4T A;  1MQ3 A;  8ICC A;  5J0T A;  4YD2 A;  3EF2 A;  4Z6E A;  8ICV A;  8ICG A;  4K96 A;  5CFT A;  1NOM A;  4YMN A;  4I2H A;  4EEB A;  4UB1 A;  1MIW A;  4PGY A;  4FH5 A;  2M2W A;  4O5C A;  9ICI A;  1Q78 A;  5HRI A;  2W9M A;  1HUZ A;  1ZQW A;  9ICL A;  4E80 A;  4FH3 A;  1TVA A;  4UAY A;  2FCL A;  1BPY A;  2GA9 D;  3PNC A;  4FO6 A;  4QZ8 A;  4KLM A;  4WQL A;  4MFF A;  8ICK A;  7ICG A;  8ICB A;  2B51 A;  5DB9 A;  4RQ8 A;  1ZQJ A;  7ICP A;  4X0B A;  1TFW A;  4WC1 A;  2ZH7 A;  4LZG A;  3PHZ A;  4K4H A;  5HRK A;  4QZD A;  3AU6 A;  1MIY A;  5J2G A;  2O1P A;  4NXX A;  4DO9 A;  4M9L A;  4EBK A;  3ER9 B;  9ICT A;  4P4P A;  3ISD A;  2DR8 A;  1ZQD A;  1ZQQ A;  3UXP A;  4P4O A;  4M5D A;  1ZQE A;  5CR0 A;  4E7X A;  4GXJ A;  1MQ2 A;  2BCQ A;  2VAN A;  4I2I A;  7ICN A;  1ZQK A;  3RJH A;  4NKU A;  3OVS A;  5CJ7 A;  4NM1 A;  1JN3 A;  9ICG A;  3PMN A;  4UAW A;  1UET A;  4LT6 A;  4WC7 A;  4M04 A;  7ICK A;  5J2J A;  1ZQI A;  7ICR A;  4LEY A;  2BBH A;  3HIY A;  4I2B A;  2DRB A;  5IIL A;  5J0O A;  4JLX A;  2BBJ A;  2NRK A;  8ICU A;  4EGW A;  3HWT A;  3OV7 A;  5DB7 A;  2PFO A;  4K98 A;  3RH6 A;  1BPE A;  5HRG A;  4O5K A;  1FA0 A;  2BPG A;  1PX5 A;  4RQ6 A;  4MF2 A;  1RZT A;  4M9N A;  4LZD A;  1BPX A;  2GAF D;  1OU5 A;  4N7R A;  3JPN A;  4PHD A;  5B3Q A;  4WC0 A;  1ZQY A;  4IQW A;  4X4R A;  4F5O A;  4EV6 A;  3RJJ A;  2B56 A;  2BCR A;  2ZH2 A;  3HJ4 A;  4E8F A;  2DRA A;  1KNY A;  4IQV A;  2HHP A;  3RJF A;  3H38 A;  4XUS A;  5D63 A;  4OAG A;  3V72 A;  4LEW A; 
#chains in the Genus database with same CATH homology
 1Q79 A;  2DR5 A;  2Q66 A;  4WOY A;  4X4T A;  1R8C A;  3EF2 A;  4AT8 A;  4MKP A;  4O6A A;  4K96 A;  5CFT A;  4AT7 B;  4X4O A;  4AT9 A;  4X4P A;  2ZHA A;  2ZH1 A;  4K97 A;  4FH5 A;  1R89 A;  3OUY B;  1Q78 A;  4FHX A;  4E80 A;  4K9B A;  4FH3 A;  4UD5 A;  2FCL A;  4O68 A;  4K8V A;  2GA9 D;  4FHW A;  4NXW A;  4XJE A;  4WQL A;  3MCR A;  2B51 A;  4KM5 A;  4OAH A;  4K99 A;  1TFW A;  4NXT A;  2ZH7 A;  3PHZ A;  2IHO A;  2ZH4 A;  3C66 A;  2O1P A;  4NXX A;  4OAF A;  2ZHB A;  4AT7 A;  3OVA A;  1R8B A;  4LEZ A;  2DVI A;  3ER9 B;  3HJ1 A;  2ZH6 A;  2DR8 A;  4OAI Z;  3OUY A;  4HX0 A;  4M5D A;  4ATB B;  2ZH5 A;  4WH5 A;  1UEU A;  4FO1 A;  4NXU A;  4AT9 B;  4E7X A;  4NXV A;  4O67 A;  5CFS A;  4NKU A;  3OVS A;  4UD4 A;  4WQK A;  1GPJ A;  5CFU A;  3ER8 C;  4X4N A;  4LEV A;  1UET A;  4KB6 A;  4LT6 A;  2ZH3 A;  4X4U A;  5D62 A;  3OWG A;  2EWR A;  4X4Q A;  5D61 A;  4LEY A;  4FHV A;  3HIY A;  4X4S A;  2DRB A;  2ZH8 A;  4FHY A;  4O69 A;  4JLX A;  3NKU A;  5B3P A;  4FHP A;  4AT8 B;  1UEV A;  3OV7 A;  3ERC C;  2B4V A;  4K98 A;  3NYB A;  4K9A A;  1TFY A;  4X4V A;  4ATB A;  3OVB A;  1FA0 A;  4JLZ A;  4NKT A;  5CHE A;  2ZH9 A;  2GAF D;  2DR7 A;  4N7R A;  2DR9 A;  5B3Q A;  1F5A A;  4X4R A;  4EP7 A;  2B56 A;  1R8A A;  2ZH2 A;  3HJ4 A;  4E8F A;  2DRA A;  2HHP A;  3K7D A;  5D63 A;  4OAG A;  4LEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...