4OAHA

Crystal structure of the cytosolic domain of mouse mid51 h201a mutant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
330
structure length
330
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADAIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 114
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oahA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oahA02
4ATBA 4OAFA 4K99A 4O6AA 4NXUA 4K98A 4LEZA 4AT8A 4ATBB 4LEWA 4LEYA 4AT8B 4K9AA 4KB6A 4K9BA 4NXVA 4MKPA 4K8VA 4NXXA 4OAGA 4O67A 4OAHA 4WOYA 4AT7A 4KM5A 4OAIZ 4K97A 4NXWA 4AT9A 4O69A 4NXTA 4AT7B 4JLZA 4AT9B 4LEVA 4K96A 4JLXA 4O68A
chains in the Genus database with same CATH superfamily
2BCSA 9ICEA 7ICJA 4XA5A 4KLMA 4IQUA 3RJFA 8ICUA 3AQKA 4I2BA 7ICOA 4IQWA 4K9AA 8ICHA 9ICQA 3JPOA 3WFRE 3H3AA 1MIVA 9ICKA 8ICFA 8ICSA 8ICIA 4XUSA 4QZ8A 5HHHA 5IIMA 5DB7A 1ZQQA 4M5DA 4WH5A 9ICIA 1UETA 2B4VA 3C2KA 9ICHA 4WC1A 5HRHA 1KNYA 4O6AA 4M9JA 1TVAA 2ZH5A 3PMLA 1ZQPA 3AQMA 4EBJA 2IHMA 4AT8B 4E8FA 4P4OA 5CB1A 8ICLA 3HX0A 4K9BA 4QZIA 2B51A 1MQ3A 4M9LA 4X4PA 1BPYA 4OAHA 4M04A 5DDYA 2ZH1A 4KLEA 9ICJA 5DKWA 4R63A 4FO6A 4X4RA 3MDCA 4X4SA 8ICWA 2DR8A 5D63A 5DB9A 3OV7A 3JPSA 1ZQEA 2ZH9A 4NXXA 5B3QA 2BPCA 4MFFA 5IIJA 1JN3A 4UAZA 3UXNA 2ZH6A 1KDHA 5HRBA 3RH5A 5DEDA 8ICMA 9ICOA 4KLOA 1RZTA 9ICVA 3HWTA 4KLTA 4I2FA 2BCQA 4F5PA 9ICUA 4K98A 4LEZA 4P2HA 8ICJA 4ATBB 4YCXA 4WC0A 3WFSC 7ICUA 7ICKA 3CK6A 4YMOA 2DVIA 4E7XA 2VANA 4OAGA 3AU6A 9ICXA 4MF2A 3UXOA 2P66A 3JCFA 3MGIA 1PX5A 3UXPA 5J2BA 1ZQTA 1NOMA 3NKUA 2FMPA 8ICBA 4UBCA 2ISOA 2DR9A 5DBAA 4YD1A 4EP7A 2IHOA 4RWOA 4I2IA 4XQ8A 2PFNA 1ZJNA 1ZQFA 4FH3A 4QZAA 5CHGA 3PMNA 4PHPA 1XSLA 4KLJA 5DB8A 2BCUA 1BPDA 1ZQWA 5J29A 5D62A 4KLGA 3OUYB 2W9MA 4PH5A 4UAWA 3UPSA 4Z6FA 8ICPA 5J0UA 4X4UA 1ZQRA 2EWRA 3JPNA 1UEUA 4PHEA 3MDAA 7ICPA 5HRIA 4S3NA 4DOBA 4DOCA 1JAJA 3OGUA 5J2HA 4NXVA 4K8VA 4RQ7A 2BCVA 3K7DA 3RH6A 1ZQNA 4FH5A 4OAIZ 4X5VA 4QZHA 1ZJMA 2DR5A 3AQNA 7ICHA 3JYYA 8ICZA 2DR7A 8ICRA 4RQ2A 9ICPA 4NLNA 1KEJA 3OVBA 3HJ1A 1UEVA 3HIYA 5CA7A 8ICGA 3ISCA 5IINA 5D49A 1HUZA 4JWMA 4LT6A 4RWNA 4EGWA 1F5AA 4FHWA 2GA9D 4UD4A 5HRDA 4PHDA 1BPBA 7ICVA 3PNCA 2PFQA 1OU5A 1ZQLA 5D46A 9ICMA 3ISDA 4I0UA 4NXTA 4O5CA 1MIWA 7ICIA 2BPGA 8ICVA 4AT9B 5J0PA 3OVAA 4K4HA 4N7RA 3V7LA 4AT8A 4QZBA 4MFCA 1R89A 4FHXA 4WC6A 3EF2A 4E80A 4FHYA 5CFTA 3C2LA 5J2JA 4X4QA 4YN4A 3H37A 4WQKA 4R66A 2PFPA 8ICKA 4QZEA 4WBZA 4M9HA 1ZQGA 4MKPA 4RPXA 3RH4A 1ZQUA 4NXZA 5J2DA 4P4MA 4WOYA 4M2YA 4NLKA 4EV6A 1NO5A 3C18A 8ICYA 1R8CA 4K97A 3RJKA 4NXWA 5CHEA 4UBBA 4FO1A 5J2CA 1ZQSA 4LVSA 2HHPA 3RJGA 4NM2A 8ICCA 4IG8A 4I2AA 4RQ8A 4NXUA 4PGYA 5J0SA 5DB6A 4X4NA 1RPLA 4K4IA 4I2DA 1JMSA 5J0QA 3WFOA 3ISBA 4F5RA 4X4VA 1YLQA 2BPFA 4Z6EA 5D4BA 1ZQIA 2ZH8A 3JPPA 4RQ3A 4GXJA 9ICSA 4O67A 5J0YA 4UB4A 7ICRA 3RJIA 7ICLA 2Q66A 5CWRA 4TUSA 8ICEA 4JLZA 7ICTA 2DRBA 1ZQVA 4K99A 5JTGA 3TFRA 1HUOA 4PPXA 8ICXA 5HHIA 4WQLA 4KLIA 5J0XA 4M47A 3UQ2A 3V7JA 1V4AA 2RFFA 5J2GA 4R64A 3OWGA 9ICAA 3JZ0A 4RWQA 4WC2A 4RQ1A 2ZHBA 9ICNA 4EBKA 2M2VA 3MBYA 5IIIA 7ICEA 4PHAA 2FCLA 2BE3A 5DDMA 3NWIA 4KLSA 4PGXA 4AT7B 4R65A 3JPRA 4UD5A 4LEVA 1ZQXA 1TV9A 8ICNA 4WC7A 4RQ0A 4Z6DA 3JPQA 2B56A 2O5AA 5DBCA 4NKUA 2I9GA 4NM1A 5CP2A 1ZQHA 4RQ4A 4M9NA 2HN1A 1Q78A 3HW8A 1VFGA 4GXIA 2DRAA 4X0BA 4TUPA 4RQ5A 3B0YA 4K4GA 3RJEA 9ICWA 5J0WA 9ICBA 2PFOA 5TZVA 5IIKA 3TFSA 2ZH7A 1GPJA 5CJ7A 4RPZA 2ID1A 5BPCA 3C5GA 4EEBA 4I2EA 4QZDA 3H38A 3V7KA 4F5OA 4RPYA 5CR0A 9ICGA 3V72A 4K96A 4OAFA 4I2CA 3RJJA 7ICGA 2GAFD 5J0TA 4M0AA 4P4PA 4YMNA 4TUQA 4X0AA 4F5NA 5B3PA 9ICFA 4XRHA 4I28A 4UAYA 3H39A 9ICLA 4QZ9A 3NVOA 2ZH2A 2BBJA 3WFPA 1FA0A 4JWNA 4NY8A 4KLQA 3AQLA 5J2KA 1ZQAA 2ZH3A 5BOLA 7ICQA 2HN2A 5HR9A 1XSPA 5J2AA 1BPXA 9ICTA 1ZQZA 3AU2A 9ICRA 1BPEA 4O68A 2ISPA 4I2HA 5IILA 4UB1A 4I2JA 3PHZA 3NYBA 2PBEA 2M2WA 4Z6CA 2ZHAA 4IQTA 5HRLA 2M2TA 4KLDA 4YMMA 4DOAA 3OVSA 4O5KA 4KLFA 1JQRA 1TFYA 9ICCA 4KM5A 4QZFA 8ICAA 4AT9A 2O1PA 4X4TA 4M9GA 1ZQOA 3L9DA 5HRGA 3MGHA 3WFQE 7ICMA 1MIYA 5J0RA 4RT3A 4TURA 3C66A 3JPTA 5J2FA 3UQ0A 3RJHA 2BCRA 1TFWA 4KLHA 3ER8C 1R8BA 8ICOA 5J2IA 4YD2A 2FMQA 2NRKA 1ZQDA 4LZDA 4WBYA 5J0OA 5HRFA 4LZGA 4O5EA 4MFAA 4RWPA 3C5FA 1WOTA 4X4OA 4QZGA 8ICTA 4NKTA 4XQ7A 5CFSA 1ZQKA 3K75D 4ATBA 4RT2A 3LQCB 4O9MA 5DBBA 4PGQA 1ZQBA 3MCRA 5BOMA 7ICSA 4EEDA 4HX0A 4LEYA 1Q79A 5DECA 3AUOA 5F2VO 5J2EA 7ICNA 4FHPA 1ZQMA 4I27A 5D61A 1VJ7A 1XSNA 2PXIA 4KLLA 3ERCC 2GWSA 5EOZA 4UB5A 3HJ4A 3C2MA 4FHVA 5IIOA 4WC3A 1R8AA 4GXKA 4KLUA 5HREA 1ZQYA 4WC5A 1MQ2A 4I2GA 4RQ6A 2ZH4A 3B0XA 5HC9A 4WC4A 4F5QA 2FMSA 4LEWA 4KB6A 2IUBA 4WCWA 4IQVA 4MF8A 3ER9B 4DO9A 5CFUA 2M2UA 4NLZA 7ICFA 4UB3A 1ZQCA 5HRKA 3UPQA 8ICQA 3LK9A 4AT7A 4QZCA 4I29A 3OUYA 1BPZA 4XJEA 4UB2A 4O69A 2BBHA 1ZQJA 3GDXA 4JLXA
chains in the Genus database with same CATH topology
4NXUA 3PHZA 3NYBA 4X4NA 2DR9A 2ZHAA 4EP7A 2IHOA 4K9AA 4X4VA 4FH3A 3OVSA 2ZH8A 1TFYA 4O67A 4KM5A 4M5DA 4WH5A 4AT9A 2O1PA 4X4TA 2Q66A 5D62A 1UETA 2B4VA 3OUYB 4JLZA 3NKUA 3C66A 2DRBA 4K99A 4O6AA 4X4UA 2ZH5A 4WQLA 2EWRA 1UEUA 3OWGA 1TFWA 3ER8C 1R8BA 4AT8B 4E8FA 2ZHBA 4K9BA 4NXVA 2B51A 4K8VA 3K7DA 4X4PA 4OAHA 2FCLA 4FH5A 4OAIZ 2DR5A 4X4OA 2ZH1A 4AT7B 4NKTA 4UD5A 5CFSA 4LEVA 2DR7A 4ATBA 3OVBA 3HJ1A 2B56A 4NKUA 1UEVA 3HIYA 4X4RA 3MCRA 4X4SA 1Q78A 4HX0A 4LEYA 2DRAA 1Q79A 2DR8A 4LT6A 5D63A 1F5AA 4FHWA 2GA9D 3OV7A 2ZH9A 4NXXA 4FHPA 5B3QA 2ZH7A 1GPJA 4UD4A 5D61A 3ERCC 3HJ4A 4FHVA 2ZH6A 1R8AA 4NXTA 4AT9B 4K96A 3OVAA 4OAFA 4K98A 4LEZA 4N7RA 4AT8A 2ZH4A 4ATBB 1R89A 4FHXA 2GAFD 3EF2A 4E80A 4FHYA 5CFTA 4LEWA 4X4QA 4WQKA 5B3PA 4KB6A 2DVIA 4E7XA 4MKPA 3ER9B 2ZH2A 5CFUA 4OAGA 1FA0A 4WOYA 4AT7A 1R8CA 2ZH3A 4K97A 3OUYA 4NXWA 4XJEA 4O69A 5CHEA 4FO1A 2HHPA 4JLXA 4O68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATB A;  4OAF A;  4K99 A;  4O6A A;  4NXU A;  4K98 A;  4LEZ A;  4AT8 A;  4ATB B;  4LEW A;  4LEY A;  4AT8 B;  4K9A A;  4KB6 A;  4K9B A;  4NXV A;  4MKP A;  4K8V A;  4NXX A;  4OAG A;  4O67 A;  4OAH A;  4WOY A;  4AT7 A;  4KM5 A;  4OAI Z;  4K97 A;  4NXW A;  4AT9 A;  4O69 A;  4NXT A;  4AT7 B;  4JLZ A;  4AT9 B;  4LEV A;  4K96 A;  4JLX A;  4O68 A; 
#chains in the Genus database with same CATH topology
 2BCS A;  9ICE A;  7ICJ A;  4XA5 A;  4KLM A;  4IQU A;  3RJF A;  8ICU A;  3AQK A;  4I2B A;  7ICO A;  4IQW A;  4K9A A;  8ICH A;  9ICQ A;  3JPO A;  3WFR E;  3H3A A;  1MIV A;  9ICK A;  8ICF A;  8ICS A;  8ICI A;  4XUS A;  4QZ8 A;  5HHH A;  5IIM A;  5DB7 A;  1ZQQ A;  4M5D A;  4WH5 A;  9ICI A;  1UET A;  2B4V A;  3C2K A;  9ICH A;  4WC1 A;  5HRH A;  1KNY A;  4O6A A;  4M9J A;  1TVA A;  2ZH5 A;  3PML A;  1ZQP A;  3AQM A;  4EBJ A;  2IHM A;  4AT8 B;  4E8F A;  4P4O A;  5CB1 A;  8ICL A;  3HX0 A;  4K9B A;  4QZI A;  2B51 A;  1MQ3 A;  4M9L A;  4X4P A;  1BPY A;  4OAH A;  4M04 A;  5DDY A;  2ZH1 A;  4KLE A;  9ICJ A;  5DKW A;  4R63 A;  4FO6 A;  4X4R A;  3MDC A;  4X4S A;  8ICW A;  2DR8 A;  5D63 A;  5DB9 A;  3OV7 A;  3JPS A;  1ZQE A;  2ZH9 A;  4NXX A;  5B3Q A;  2BPC A;  4MFF A;  5IIJ A;  1JN3 A;  4UAZ A;  3UXN A;  2ZH6 A;  1KDH A;  5HRB A;  3RH5 A;  5DED A;  8ICM A;  9ICO A;  4KLO A;  1RZT A;  9ICV A;  3HWT A;  4KLT A;  4I2F A;  2BCQ A;  4F5P A;  9ICU A;  4K98 A;  4LEZ A;  4P2H A;  8ICJ A;  4ATB B;  4YCX A;  4WC0 A;  3WFS C;  7ICU A;  7ICK A;  3CK6 A;  4YMO A;  2DVI A;  4E7X A;  2VAN A;  4OAG A;  3AU6 A;  9ICX A;  4MF2 A;  3UXO A;  2P66 A;  3JCF A;  3MGI A;  1PX5 A;  3UXP A;  5J2B A;  1ZQT A;  1NOM A;  3NKU A;  2FMP A;  8ICB A;  4UBC A;  2ISO A;  2DR9 A;  5DBA A;  4YD1 A;  4EP7 A;  2IHO A;  4RWO A;  4I2I A;  4XQ8 A;  2PFN A;  1ZJN A;  1ZQF A;  4FH3 A;  4QZA A;  5CHG A;  3PMN A;  4PHP A;  1XSL A;  4KLJ A;  5DB8 A;  2BCU A;  1BPD A;  1ZQW A;  5J29 A;  5D62 A;  4KLG A;  3OUY B;  2W9M A;  4PH5 A;  4UAW A;  3UPS A;  4Z6F A;  8ICP A;  5J0U A;  4X4U A;  1ZQR A;  2EWR A;  3JPN A;  1UEU A;  4PHE A;  3MDA A;  7ICP A;  5HRI A;  4S3N A;  4DOB A;  4DOC A;  1JAJ A;  3OGU A;  5J2H A;  4NXV A;  4K8V A;  4RQ7 A;  2BCV A;  3K7D A;  3RH6 A;  1ZQN A;  4FH5 A;  4OAI Z;  4X5V A;  4QZH A;  1ZJM A;  2DR5 A;  3AQN A;  7ICH A;  3JYY A;  8ICZ A;  2DR7 A;  8ICR A;  4RQ2 A;  9ICP A;  4NLN A;  1KEJ A;  3OVB A;  3HJ1 A;  1UEV A;  3HIY A;  5CA7 A;  8ICG A;  3ISC A;  5IIN A;  5D49 A;  1HUZ A;  4JWM A;  4LT6 A;  4RWN A;  4EGW A;  1F5A A;  4FHW A;  2GA9 D;  4UD4 A;  5HRD A;  4PHD A;  1BPB A;  7ICV A;  3PNC A;  2PFQ A;  1OU5 A;  1ZQL A;  5D46 A;  9ICM A;  3ISD A;  4I0U A;  4NXT A;  4O5C A;  1MIW A;  7ICI A;  2BPG A;  8ICV A;  4AT9 B;  5J0P A;  3OVA A;  4K4H A;  4N7R A;  3V7L A;  4AT8 A;  4QZB A;  4MFC A;  1R89 A;  4FHX A;  4WC6 A;  3EF2 A;  4E80 A;  4FHY A;  5CFT A;  3C2L A;  5J2J A;  4X4Q A;  4YN4 A;  3H37 A;  4WQK A;  4R66 A;  2PFP A;  8ICK A;  4QZE A;  4WBZ A;  4M9H A;  1ZQG A;  4MKP A;  4RPX A;  3RH4 A;  1ZQU A;  4NXZ A;  5J2D A;  4P4M A;  4WOY A;  4M2Y A;  4NLK A;  4EV6 A;  1NO5 A;  3C18 A;  8ICY A;  1R8C A;  4K97 A;  3RJK A;  4NXW A;  5CHE A;  4UBB A;  4FO1 A;  5J2C A;  1ZQS A;  4LVS A;  2HHP A;  3RJG A;  4NM2 A;  8ICC A;  4IG8 A;  4I2A A;  4RQ8 A;  4NXU A;  4PGY A;  5J0S A;  5DB6 A;  4X4N A;  1RPL A;  4K4I A;  4I2D A;  1JMS A;  5J0Q A;  3WFO A;  3ISB A;  4F5R A;  4X4V A;  1YLQ A;  2BPF A;  4Z6E A;  5D4B A;  1ZQI A;  2ZH8 A;  3JPP A;  4RQ3 A;  4GXJ A;  9ICS A;  4O67 A;  5J0Y A;  4UB4 A;  7ICR A;  3RJI A;  7ICL A;  2Q66 A;  5CWR A;  4TUS A;  8ICE A;  4JLZ A;  7ICT A;  2DRB A;  1ZQV A;  4K99 A;  5JTG A;  3TFR A;  1HUO A;  4PPX A;  8ICX A;  5HHI A;  4WQL A;  4KLI A;  5J0X A;  4M47 A;  3UQ2 A;  3V7J A;  1V4A A;  2RFF A;  5J2G A;  4R64 A;  3OWG A;  9ICA A;  3JZ0 A;  4RWQ A;  4WC2 A;  4RQ1 A;  2ZHB A;  9ICN A;  4EBK A;  2M2V A;  3MBY A;  5III A;  7ICE A;  4PHA A;  2FCL A;  2BE3 A;  5DDM A;  3NWI A;  4KLS A;  4PGX A;  4AT7 B;  4R65 A;  3JPR A;  4UD5 A;  4LEV A;  1ZQX A;  1TV9 A;  8ICN A;  4WC7 A;  4RQ0 A;  4Z6D A;  3JPQ A;  2B56 A;  2O5A A;  5DBC A;  4NKU A;  2I9G A;  4NM1 A;  5CP2 A;  1ZQH A;  4RQ4 A;  4M9N A;  2HN1 A;  1Q78 A;  3HW8 A;  1VFG A;  4GXI A;  2DRA A;  4X0B A;  4TUP A;  4RQ5 A;  3B0Y A;  4K4G A;  3RJE A;  9ICW A;  5J0W A;  9ICB A;  2PFO A;  5TZV A;  5IIK A;  3TFS A;  2ZH7 A;  1GPJ A;  5CJ7 A;  4RPZ A;  2ID1 A;  5BPC A;  3C5G A;  4EEB A;  4I2E A;  4QZD A;  3H38 A;  3V7K A;  4F5O A;  4RPY A;  5CR0 A;  9ICG A;  3V72 A;  4K96 A;  4OAF A;  4I2C A;  3RJJ A;  7ICG A;  2GAF D;  5J0T A;  4M0A A;  4P4P A;  4YMN A;  4TUQ A;  4X0A A;  4F5N A;  5B3P A;  9ICF A;  4XRH A;  4I28 A;  4UAY A;  3H39 A;  9ICL A;  4QZ9 A;  3NVO A;  2ZH2 A;  2BBJ A;  3WFP A;  1FA0 A;  4JWN A;  4NY8 A;  4KLQ A;  3AQL A;  5J2K A;  1ZQA A;  2ZH3 A;  5BOL A;  7ICQ A;  2HN2 A;  5HR9 A;  1XSP A;  5J2A A;  1BPX A;  9ICT A;  1ZQZ A;  3AU2 A;  9ICR A;  1BPE A;  4O68 A;  2ISP A;  4I2H A;  5IIL A;  4UB1 A;  4I2J A;  3PHZ A;  3NYB A;  2PBE A;  2M2W A;  4Z6C A;  2ZHA A;  4IQT A;  5HRL A;  2M2T A;  4KLD A;  4YMM A;  4DOA A;  3OVS A;  4O5K A;  4KLF A;  1JQR A;  1TFY A;  9ICC A;  4KM5 A;  4QZF A;  8ICA A;  4AT9 A;  2O1P A;  4X4T A;  4M9G A;  1ZQO A;  3L9D A;  5HRG A;  3MGH A;  3WFQ E;  7ICM A;  1MIY A;  5J0R A;  4RT3 A;  4TUR A;  3C66 A;  3JPT A;  5J2F A;  3UQ0 A;  3RJH A;  2BCR A;  1TFW A;  4KLH A;  3ER8 C;  1R8B A;  8ICO A;  5J2I A;  4YD2 A;  2FMQ A;  2NRK A;  1ZQD A;  4LZD A;  4WBY A;  5J0O A;  5HRF A;  4LZG A;  4O5E A;  4MFA A;  4RWP A;  3C5F A;  1WOT A;  4X4O A;  4QZG A;  8ICT A;  4NKT A;  4XQ7 A;  5CFS A;  1ZQK A;  3K75 D;  4ATB A;  4RT2 A;  3LQC B;  4O9M A;  5DBB A;  4PGQ A;  1ZQB A;  3MCR A;  5BOM A;  7ICS A;  4EED A;  4HX0 A;  4LEY A;  1Q79 A;  5DEC A;  3AUO A;  5F2V O;  5J2E A;  7ICN A;  4FHP A;  1ZQM A;  4I27 A;  5D61 A;  1VJ7 A;  1XSN A;  2PXI A;  4KLL A;  3ERC C;  2GWS A;  5EOZ A;  4UB5 A;  3HJ4 A;  3C2M A;  4FHV A;  5IIO A;  4WC3 A;  1R8A A;  4GXK A;  4KLU A;  5HRE A;  1ZQY A;  4WC5 A;  1MQ2 A;  4I2G A;  4RQ6 A;  2ZH4 A;  3B0X A;  5HC9 A;  4WC4 A;  4F5Q A;  2FMS A;  4LEW A;  4KB6 A;  2IUB A;  4WCW A;  4IQV A;  4MF8 A;  3ER9 B;  4DO9 A;  5CFU A;  2M2U A;  4NLZ A;  7ICF A;  4UB3 A;  1ZQC A;  5HRK A;  3UPQ A;  8ICQ A;  3LK9 A;  4AT7 A;  4QZC A;  4I29 A;  3OUY A;  1BPZ A;  4XJE A;  4UB2 A;  4O69 A;  2BBH A;  1ZQJ A;  3GDX A;  4JLX A; 
#chains in the Genus database with same CATH homology
 4NXU A;  3PHZ A;  3NYB A;  4X4N A;  2DR9 A;  2ZHA A;  4EP7 A;  2IHO A;  4K9A A;  4X4V A;  4FH3 A;  3OVS A;  2ZH8 A;  1TFY A;  4O67 A;  4KM5 A;  4M5D A;  4WH5 A;  4AT9 A;  2O1P A;  4X4T A;  2Q66 A;  5D62 A;  1UET A;  2B4V A;  3OUY B;  4JLZ A;  3NKU A;  3C66 A;  2DRB A;  4K99 A;  4O6A A;  4X4U A;  2ZH5 A;  4WQL A;  2EWR A;  1UEU A;  3OWG A;  1TFW A;  3ER8 C;  1R8B A;  4AT8 B;  4E8F A;  2ZHB A;  4K9B A;  4NXV A;  2B51 A;  4K8V A;  3K7D A;  4X4P A;  4OAH A;  2FCL A;  4FH5 A;  4OAI Z;  2DR5 A;  4X4O A;  2ZH1 A;  4AT7 B;  4NKT A;  4UD5 A;  5CFS A;  4LEV A;  2DR7 A;  4ATB A;  3OVB A;  3HJ1 A;  2B56 A;  4NKU A;  1UEV A;  3HIY A;  4X4R A;  3MCR A;  4X4S A;  1Q78 A;  4HX0 A;  4LEY A;  2DRA A;  1Q79 A;  2DR8 A;  4LT6 A;  5D63 A;  1F5A A;  4FHW A;  2GA9 D;  3OV7 A;  2ZH9 A;  4NXX A;  4FHP A;  5B3Q A;  2ZH7 A;  1GPJ A;  4UD4 A;  5D61 A;  3ERC C;  3HJ4 A;  4FHV A;  2ZH6 A;  1R8A A;  4NXT A;  4AT9 B;  4K96 A;  3OVA A;  4OAF A;  4K98 A;  4LEZ A;  4N7R A;  4AT8 A;  2ZH4 A;  4ATB B;  1R89 A;  4FHX A;  2GAF D;  3EF2 A;  4E80 A;  4FHY A;  5CFT A;  4LEW A;  4X4Q A;  4WQK A;  5B3P A;  4KB6 A;  2DVI A;  4E7X A;  4MKP A;  3ER9 B;  2ZH2 A;  5CFU A;  4OAG A;  1FA0 A;  4WOY A;  4AT7 A;  1R8C A;  2ZH3 A;  4K97 A;  3OUY A;  4NXW A;  4XJE A;  4O69 A;  5CHE A;  4FO1 A;  2HHP A;  4JLX A;  4O68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...