4OAHA

Crystal structure of the cytosolic domain of mouse mid51 h201a mutant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
330
structure length
330
Chain Sequence
b'SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADAIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 114
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oahA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oahA02
4AT7A 4NXXA 4NXVA 4OAIZ 4O68A 4K99A 4NXTA 4WOYA 4O6AA 4LEVA 4JLXA 4OAFA 4OAGA 4NXWA 4O69A 4K97A 4K98A 4NXUA 4OAHA 4AT8B 4MKPA 4ATBB 4AT8A 4KB6A 4O67A 4ATBA 4KM5A 4K8VA 4LEZA 4K96A 4K9AA 4K9BA 4LEWA 4AT9B 4LEYA 4AT7B 4AT9A 4JLZA
chains in the Genus database with same CATH superfamily
4M47A 1ZQKA 9ICNA 1RZTA 4DO9A 5TZVA 3OVBA 4NM2A 3OUYA 4TUQA 5B3PA 4E8FA 5J29A 4QZ8A 5D4BA 5DB6A 5DB7A 4AT8B 5HRBA 2ISPA 4M9LA 5CFTA 5J2JA 2B56A 1HUOA 5J2CA 1ZQHA 1TFYA 3ERCC 7ICNA 4YD1A 5BOMA 1R8BA 1MQ3A 2BCRA 4PHPA 3RJEA 5DDYA 4RQ8A 1ZQOA 3TFRA 4NLKA 5IINA 3AQMA 9ICOA 9ICEA 5DBBA 2W9MA 1ZQSA 8ICUA 4FHWA 4NM1A 9ICAA 4RQ2A 4Z6EA 4K97A 4QZBA 4R65A 1ZQNA 9ICTA 5HRKA 4WC0A 2M2UA 3OVAA 5IIOA 1NOMA 3PMNA 3JPSA 4I2BA 7ICLA 8ICFA 8ICLA 3H3AA 5HRIA 5DKWA 2HN1A 5CHGA 4KLEA 1R89A 3B0XA 2B51A 5DB9A 4EP7A 1ZQUA 3JZ0A 5J0QA 3MDAA 4JLXA 5J2AA 2PBEA 2ZH1A 3JPPA 4F5QA 4M5DA 5J2KA 9ICVA 5CWRA 4F5RA 3MDCA 1ZJNA 4YN4A 4NXUA 2FMSA 1VFGA 9ICFA 3TFSA 4JWNA 2DR7A 8ICKA 4K4GA 3OV7A 2FMQA 1BPZA 9ICGA 3AQKA 4AT9A 4YMMA 2BPGA 4RQ5A 4AT7A 5HRDA 1MIVA 4NXVA 8ICHA 5IIJA 4EV6A 4E80A 4K99A 4RQ0A 4UAWA 2ZHAA 4QZ9A 4XQ7A 4QZCA 4KLTA 3K75D 5DEDA 2FCLA 9ICBA 3OWGA 1Q79A 3ISCA 4MFAA 4KB6A 8ICBA 5DBCA 3H37A 3JPRA 3MCRA 4X4QA 2Q66A 3RJFA 4IQTA 4LEYA 1UETA 7ICOA 4N7RA 3AQLA 4WBZA 4MFFA 4WC4A 4IQUA 4X4UA 4YMOA 2GAFD 4WOYA 1ZQPA 4RT2A 5CFUA 5HREA 9ICLA 5CJ7A 5D63A 1BPYA 1ZQLA 4O69A 9ICWA 9ICCA 5HRFA 4MFCA 3RH6A 5CA7A 1UEUA 5IILA 2I9GA 4M9JA 4NY8A 4KLHA 4I2GA 2BCVA 4ATBA 4XQ8A 1JN3A 4PGQA 3JYYA 5HR9A 5CB1A 4X4TA 4FO1A 4QZHA 2DR8A 4RPXA 5HC9A 4X0AA 8ICIA 4FHXA 5BPCA 3C2LA 1MIYA 2O5AA 4LZGA 3ISDA 4WQKA 4KLMA 5D61A 1ZJMA 4RT3A 3WFQE 4QZIA 4UB5A 1MIWA 4R63A 5DB8A 9ICUA 5CR0A 7ICHA 2PFPA 2BE3A 4DOBA 4DOAA 5J2GA 4RQ7A 4M9NA 3UPQA 4FH3A 1GPJA 7ICMA 2IUBA 5D46A 2M2WA 2NRKA 4TURA 4OAIZ 9ICIA 2ZH2A 1ZQYA 5J0PA 8ICJA 8ICPA 4LZDA 3LQCB 3ER9B 1ZQCA 4O5EA 2DRAA 4OAGA 7ICTA 1R8AA 3NVOA 4K4IA 5CHEA 5DDMA 4YMNA 2ZH4A 7ICSA 4I2JA 9ICSA 3NYBA 3GDXA 3RJGA 5CFSA 8ICWA 4O67A 1ZQZA 2BCQA 4M9HA 1BPDA 4I2EA 4M04A 4O5KA 1HUZA 4K9BA 1ZQQA 4R66A 4WQLA 3WFOA 3H38A 3WFPA 4TUSA 4I29A 5J0OA 4KLGA 4NXXA 3C5GA 5HRLA 3WFSC 4X0BA 4P4MA 2ISOA 3MGHA 2M2VA 2BPFA 5HHIA 3HIYA 4I27A 8ICOA 4IQVA 4WCWA 4QZGA 8ICQA 1PX5A 9ICXA 5HRHA 1JAJA 5J0YA 5J0RA 5J0WA 1KNYA 4I2AA 3K7DA 4RQ1A 2O1PA 4X4PA 9ICQA 8ICTA 3LK9A 3L9DA 1ZQJA 4WC3A 4UB3A 3RJKA 4XA5A 3OUYB 4NXTA 1MQ2A 3PHZA 4UB4A 5J0TA 4WC1A 7ICGA 4WC5A 4NXWA 7ICJA 3ER8C 5J2FA 4AT8A 3JPTA 5HRGA 4F5PA 4GXKA 3V7KA 4WC2A 2HHPA 7ICUA 4FH5A 4I2IA 4PHAA 4TUPA 3JPOA 1ZQRA 4RWPA 3UQ0A 4O6AA 4UAYA 2PFQA 8ICZA 4XJEA 4FHVA 5J2DA 1JMSA 4I2DA 4F5OA 4O9MA 4Z6CA 1ZQDA 2BBJA 4R64A 4X4NA 2ZH9A 1FA0A 2ID1A 3RJIA 3EF2A 7ICEA 4UBCA 5IIIA 4FO6A 4FHPA 3PNCA 7ICKA 8ICNA 8ICSA 8ICCA 8ICRA 2RFFA 4X4RA 3RH5A 8ICAA 5J2EA 3JPNA 4EEDA 4X5VA 4O5CA 1YLQA 3HW8A 4O68A 3V7JA 7ICIA 4P4PA 2DR9A 4I2FA 3UXOA 3UQ2A 1TFWA 4XRHA 4FHYA 2HN2A 1NO5A 2GA9D 8ICYA 4HX0A 4X4VA 4K9AA 8ICGA 4AT9B 2EWRA 3HJ4A 4QZAA 1ZQWA 4AT7B 3C2MA 1ZQTA 4LT6A 5B3QA 1VJ7A 5J0UA 3UXNA 3MBYA 5D62A 4WC7A 4F5NA 3C18A 4NXZA 1ZQEA 1ZQIA 4LEVA 5BOLA 7ICQA 7ICFA 4OAFA 2ZH3A 2BCUA 4Z6FA 4NLZA 1ZQVA 8ICXA 5EOZA 2PFOA 4EGWA 4I0UA 4QZFA 4GXIA 4UB1A 9ICJA 4KLOA 4E7XA 1KEJA 5J2HA 4DOCA 4IQWA 4LEZA 4IG8A 4RWNA 4RQ3A 9ICPA 4JLZA 1Q78A 1OU5A 2BPCA 3AU2A 1V4AA 3OGUA 4GXJA 4WC6A 3NKUA 2VANA 4PPXA 3HJ1A 4UD5A 3V7LA 4QZDA 4PGXA 8ICMA 3UXPA 2BBHA 3JPQA 8ICVA 4EBJA 2GWSA 1JQRA 4K98A 2FMPA 2ZH7A 4ATBB 4RQ6A 4PHDA 1ZQFA 4I2CA 3ISBA 4M0AA 4LEWA 4UBBA 2ZHBA 5HHHA 4Z6DA 4JWMA 1XSNA 2PFNA 5DBAA 1BPXA 4EBKA 5JTGA 4KLSA 4I2HA 3HX0A 3MGIA 2P66A 4NKUA 4PH5A 5DECA 7ICVA 4KLUA 1XSLA 3C2KA 4X4OA 9ICHA 1KDHA 4RWQA 3RH4A 4OAHA 4KLDA 4MKPA 3NWIA 5J2IA 3RJJA 4NLNA 8ICEA 9ICRA 1WOTA 4WH5A 4KLLA 4M2YA 4RWOA 4K96A 3C66A 4RPYA 4KLIA 1ZQGA 3UPSA 7ICRA 5D49A 3HWTA 2BCSA 1ZQAA 4UB2A 4S3NA 1ZQMA 2DRBA 1XSPA 3JCFA 5IIKA 4UD4A 2IHOA 1UEVA 5J0SA 4I28A 3WFRE 2ZH8A 2ZH5A 2DR5A 2B4VA 1R8CA 5J2BA 1RPLA 1ZQBA 3AUOA 9ICKA 4P2HA 4X4SA 4P4OA 1TV9A 3AQNA 1ZQXA 2M2TA 4NKTA 5F2VO 5J0XA 4KM5A 4K8VA 4K4HA 4MF2A 1F5AA 3H39A 3RJHA 4YD2A 3B0YA 2ZH6A 2PXIA 4PHEA 1BPBA 2IHMA 4RPZA 3CK6A 4XUSA 5IIMA 4KLJA 1BPEA 7ICPA 3C5FA 4LVSA 4EEBA 9ICMA 5CP2A 4KLFA 4QZEA 1TVAA 3PMLA 3AU6A 4RQ4A 4WBYA 2DVIA 4UAZA 4MF8A 3OVSA 4PGYA 3V72A 4KLQA 4YCXA 4M9GA
chains in the Genus database with same CATH topology
1Q78A 4X4UA 2GAFD 3OUYB 3NKUA 3OVBA 4NXTA 4WOYA 3PHZA 3HJ1A 5CFUA 3OUYA 4UD5A 5D63A 5B3PA 4E8FA 4NXWA 4O69A 4K98A 4AT8B 2ZH7A 1UEUA 4ATBB 3ER8C 4AT8A 5CFTA 4ATBA 2B56A 3ERCC 4LEWA 1TFYA 4X4TA 2HHPA 1R8BA 2ZHBA 4FH5A 4FO1A 2DR8A 4FHXA 4NKUA 4O6AA 4WQKA 4XJEA 4FHWA 4FHVA 5D61A 4X4OA 4K97A 4OAHA 4X4NA 4MKPA 2ZH9A 1FA0A 3EF2A 4WH5A 4K96A 3OVAA 3C66A 4FHPA 4X4RA 4FH3A 1GPJA 4OAIZ 1R89A 2ZH2A 2DRBA 2B51A 4O68A 4EP7A 2DR9A 3ER9B 4UD4A 4JLXA 1UEVA 2IHOA 2ZH1A 2DRAA 4OAGA 4M5DA 1R8AA 2ZH8A 2ZH5A 2DR5A 2B4VA 1R8CA 1TFWA 5CHEA 4NXUA 2ZH4A 4FHYA 3NYBA 4X4SA 5CFSA 2GA9D 4NKTA 4O67A 4KM5A 2DR7A 4HX0A 4K8VA 4X4VA 4K9AA 4K9BA 4AT9B 3OV7A 1F5AA 3HJ4A 2EWRA 4WQLA 4AT7B 4AT9A 4LT6A 2ZH6A 4AT7A 5B3QA 4NXXA 4NXVA 5D62A 4E80A 4K99A 2ZHAA 4LEVA 4OAFA 2ZH3A 3HIYA 2FCLA 4N7RA 3OWGA 1Q79A 4E7XA 4KB6A 3MCRA 4X4QA 2Q66A 1UETA 4LEZA 2DVIA 3OVSA 4LEYA 3K7DA 2O1PA 4X4PA 4JLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT7 A;  4NXX A;  4NXV A;  4OAI Z;  4O68 A;  4K99 A;  4NXT A;  4WOY A;  4O6A A;  4LEV A;  4JLX A;  4OAF A;  4OAG A;  4NXW A;  4O69 A;  4K97 A;  4K98 A;  4NXU A;  4OAH A;  4AT8 B;  4MKP A;  4ATB B;  4AT8 A;  4KB6 A;  4O67 A;  4ATB A;  4KM5 A;  4K8V A;  4LEZ A;  4K96 A;  4K9A A;  4K9B A;  4LEW A;  4AT9 B;  4LEY A;  4AT7 B;  4AT9 A;  4JLZ A; 
#chains in the Genus database with same CATH topology
 4M47 A;  1ZQK A;  9ICN A;  1RZT A;  4DO9 A;  5TZV A;  3OVB A;  4NM2 A;  3OUY A;  4TUQ A;  5B3P A;  4E8F A;  5J29 A;  4QZ8 A;  5D4B A;  5DB6 A;  5DB7 A;  4AT8 B;  5HRB A;  2ISP A;  4M9L A;  5CFT A;  5J2J A;  2B56 A;  1HUO A;  5J2C A;  1ZQH A;  1TFY A;  3ERC C;  7ICN A;  4YD1 A;  5BOM A;  1R8B A;  1MQ3 A;  2BCR A;  4PHP A;  3RJE A;  5DDY A;  4RQ8 A;  1ZQO A;  3TFR A;  4NLK A;  5IIN A;  3AQM A;  9ICO A;  9ICE A;  5DBB A;  2W9M A;  1ZQS A;  8ICU A;  4FHW A;  4NM1 A;  9ICA A;  4RQ2 A;  4Z6E A;  4K97 A;  4QZB A;  4R65 A;  1ZQN A;  9ICT A;  5HRK A;  4WC0 A;  2M2U A;  3OVA A;  5IIO A;  1NOM A;  3PMN A;  3JPS A;  4I2B A;  7ICL A;  8ICF A;  8ICL A;  3H3A A;  5HRI A;  5DKW A;  2HN1 A;  5CHG A;  4KLE A;  1R89 A;  3B0X A;  2B51 A;  5DB9 A;  4EP7 A;  1ZQU A;  3JZ0 A;  5J0Q A;  3MDA A;  4JLX A;  5J2A A;  2PBE A;  2ZH1 A;  3JPP A;  4F5Q A;  4M5D A;  5J2K A;  9ICV A;  5CWR A;  4F5R A;  3MDC A;  1ZJN A;  4YN4 A;  4NXU A;  2FMS A;  1VFG A;  9ICF A;  3TFS A;  4JWN A;  2DR7 A;  8ICK A;  4K4G A;  3OV7 A;  2FMQ A;  1BPZ A;  9ICG A;  3AQK A;  4AT9 A;  4YMM A;  2BPG A;  4RQ5 A;  4AT7 A;  5HRD A;  1MIV A;  4NXV A;  8ICH A;  5IIJ A;  4EV6 A;  4E80 A;  4K99 A;  4RQ0 A;  4UAW A;  2ZHA A;  4QZ9 A;  4XQ7 A;  4QZC A;  4KLT A;  3K75 D;  5DED A;  2FCL A;  9ICB A;  3OWG A;  1Q79 A;  3ISC A;  4MFA A;  4KB6 A;  8ICB A;  5DBC A;  3H37 A;  3JPR A;  3MCR A;  4X4Q A;  2Q66 A;  3RJF A;  4IQT A;  4LEY A;  1UET A;  7ICO A;  4N7R A;  3AQL A;  4WBZ A;  4MFF A;  4WC4 A;  4IQU A;  4X4U A;  4YMO A;  2GAF D;  4WOY A;  1ZQP A;  4RT2 A;  5CFU A;  5HRE A;  9ICL A;  5CJ7 A;  5D63 A;  1BPY A;  1ZQL A;  4O69 A;  9ICW A;  9ICC A;  5HRF A;  4MFC A;  3RH6 A;  5CA7 A;  1UEU A;  5IIL A;  2I9G A;  4M9J A;  4NY8 A;  4KLH A;  4I2G A;  2BCV A;  4ATB A;  4XQ8 A;  1JN3 A;  4PGQ A;  3JYY A;  5HR9 A;  5CB1 A;  4X4T A;  4FO1 A;  4QZH A;  2DR8 A;  4RPX A;  5HC9 A;  4X0A A;  8ICI A;  4FHX A;  5BPC A;  3C2L A;  1MIY A;  2O5A A;  4LZG A;  3ISD A;  4WQK A;  4KLM A;  5D61 A;  1ZJM A;  4RT3 A;  3WFQ E;  4QZI A;  4UB5 A;  1MIW A;  4R63 A;  5DB8 A;  9ICU A;  5CR0 A;  7ICH A;  2PFP A;  2BE3 A;  4DOB A;  4DOA A;  5J2G A;  4RQ7 A;  4M9N A;  3UPQ A;  4FH3 A;  1GPJ A;  7ICM A;  2IUB A;  5D46 A;  2M2W A;  2NRK A;  4TUR A;  4OAI Z;  9ICI A;  2ZH2 A;  1ZQY A;  5J0P A;  8ICJ A;  8ICP A;  4LZD A;  3LQC B;  3ER9 B;  1ZQC A;  4O5E A;  2DRA A;  4OAG A;  7ICT A;  1R8A A;  3NVO A;  4K4I A;  5CHE A;  5DDM A;  4YMN A;  2ZH4 A;  7ICS A;  4I2J A;  9ICS A;  3NYB A;  3GDX A;  3RJG A;  5CFS A;  8ICW A;  4O67 A;  1ZQZ A;  2BCQ A;  4M9H A;  1BPD A;  4I2E A;  4M04 A;  4O5K A;  1HUZ A;  4K9B A;  1ZQQ A;  4R66 A;  4WQL A;  3WFO A;  3H38 A;  3WFP A;  4TUS A;  4I29 A;  5J0O A;  4KLG A;  4NXX A;  3C5G A;  5HRL A;  3WFS C;  4X0B A;  4P4M A;  2ISO A;  3MGH A;  2M2V A;  2BPF A;  5HHI A;  3HIY A;  4I27 A;  8ICO A;  4IQV A;  4WCW A;  4QZG A;  8ICQ A;  1PX5 A;  9ICX A;  5HRH A;  1JAJ A;  5J0Y A;  5J0R A;  5J0W A;  1KNY A;  4I2A A;  3K7D A;  4RQ1 A;  2O1P A;  4X4P A;  9ICQ A;  8ICT A;  3LK9 A;  3L9D A;  1ZQJ A;  4WC3 A;  4UB3 A;  3RJK A;  4XA5 A;  3OUY B;  4NXT A;  1MQ2 A;  3PHZ A;  4UB4 A;  5J0T A;  4WC1 A;  7ICG A;  4WC5 A;  4NXW A;  7ICJ A;  3ER8 C;  5J2F A;  4AT8 A;  3JPT A;  5HRG A;  4F5P A;  4GXK A;  3V7K A;  4WC2 A;  2HHP A;  7ICU A;  4FH5 A;  4I2I A;  4PHA A;  4TUP A;  3JPO A;  1ZQR A;  4RWP A;  3UQ0 A;  4O6A A;  4UAY A;  2PFQ A;  8ICZ A;  4XJE A;  4FHV A;  5J2D A;  1JMS A;  4I2D A;  4F5O A;  4O9M A;  4Z6C A;  1ZQD A;  2BBJ A;  4R64 A;  4X4N A;  2ZH9 A;  1FA0 A;  2ID1 A;  3RJI A;  3EF2 A;  7ICE A;  4UBC A;  5III A;  4FO6 A;  4FHP A;  3PNC A;  7ICK A;  8ICN A;  8ICS A;  8ICC A;  8ICR A;  2RFF A;  4X4R A;  3RH5 A;  8ICA A;  5J2E A;  3JPN A;  4EED A;  4X5V A;  4O5C A;  1YLQ A;  3HW8 A;  4O68 A;  3V7J A;  7ICI A;  4P4P A;  2DR9 A;  4I2F A;  3UXO A;  3UQ2 A;  1TFW A;  4XRH A;  4FHY A;  2HN2 A;  1NO5 A;  2GA9 D;  8ICY A;  4HX0 A;  4X4V A;  4K9A A;  8ICG A;  4AT9 B;  2EWR A;  3HJ4 A;  4QZA A;  1ZQW A;  4AT7 B;  3C2M A;  1ZQT A;  4LT6 A;  5B3Q A;  1VJ7 A;  5J0U A;  3UXN A;  3MBY A;  5D62 A;  4WC7 A;  4F5N A;  3C18 A;  4NXZ A;  1ZQE A;  1ZQI A;  4LEV A;  5BOL A;  7ICQ A;  7ICF A;  4OAF A;  2ZH3 A;  2BCU A;  4Z6F A;  4NLZ A;  1ZQV A;  8ICX A;  5EOZ A;  2PFO A;  4EGW A;  4I0U A;  4QZF A;  4GXI A;  4UB1 A;  9ICJ A;  4KLO A;  4E7X A;  1KEJ A;  5J2H A;  4DOC A;  4IQW A;  4LEZ A;  4IG8 A;  4RWN A;  4RQ3 A;  9ICP A;  4JLZ A;  1Q78 A;  1OU5 A;  2BPC A;  3AU2 A;  1V4A A;  3OGU A;  4GXJ A;  4WC6 A;  3NKU A;  2VAN A;  4PPX A;  3HJ1 A;  4UD5 A;  3V7L A;  4QZD A;  4PGX A;  8ICM A;  3UXP A;  2BBH A;  3JPQ A;  8ICV A;  4EBJ A;  2GWS A;  1JQR A;  4K98 A;  2FMP A;  2ZH7 A;  4ATB B;  4RQ6 A;  4PHD A;  1ZQF A;  4I2C A;  3ISB A;  4M0A A;  4LEW A;  4UBB A;  2ZHB A;  5HHH A;  4Z6D A;  4JWM A;  1XSN A;  2PFN A;  5DBA A;  1BPX A;  4EBK A;  5JTG A;  4KLS A;  4I2H A;  3HX0 A;  3MGI A;  2P66 A;  4NKU A;  4PH5 A;  5DEC A;  7ICV A;  4KLU A;  1XSL A;  3C2K A;  4X4O A;  9ICH A;  1KDH A;  4RWQ A;  3RH4 A;  4OAH A;  4KLD A;  4MKP A;  3NWI A;  5J2I A;  3RJJ A;  4NLN A;  8ICE A;  9ICR A;  1WOT A;  4WH5 A;  4KLL A;  4M2Y A;  4RWO A;  4K96 A;  3C66 A;  4RPY A;  4KLI A;  1ZQG A;  3UPS A;  7ICR A;  5D49 A;  3HWT A;  2BCS A;  1ZQA A;  4UB2 A;  4S3N A;  1ZQM A;  2DRB A;  1XSP A;  3JCF A;  5IIK A;  4UD4 A;  2IHO A;  1UEV A;  5J0S A;  4I28 A;  3WFR E;  2ZH8 A;  2ZH5 A;  2DR5 A;  2B4V A;  1R8C A;  5J2B A;  1RPL A;  1ZQB A;  3AUO A;  9ICK A;  4P2H A;  4X4S A;  4P4O A;  1TV9 A;  3AQN A;  1ZQX A;  2M2T A;  4NKT A;  5F2V O;  5J0X A;  4KM5 A;  4K8V A;  4K4H A;  4MF2 A;  1F5A A;  3H39 A;  3RJH A;  4YD2 A;  3B0Y A;  2ZH6 A;  2PXI A;  4PHE A;  1BPB A;  2IHM A;  4RPZ A;  3CK6 A;  4XUS A;  5IIM A;  4KLJ A;  1BPE A;  7ICP A;  3C5F A;  4LVS A;  4EEB A;  9ICM A;  5CP2 A;  4KLF A;  4QZE A;  1TVA A;  3PML A;  3AU6 A;  4RQ4 A;  4WBY A;  2DVI A;  4UAZ A;  4MF8 A;  3OVS A;  4PGY A;  3V72 A;  4KLQ A;  4YCX A;  4M9G A; 
#chains in the Genus database with same CATH homology
 1Q78 A;  4X4U A;  2GAF D;  3OUY B;  3NKU A;  3OVB A;  4NXT A;  4WOY A;  3PHZ A;  3HJ1 A;  5CFU A;  3OUY A;  4UD5 A;  5D63 A;  5B3P A;  4E8F A;  4NXW A;  4O69 A;  4K98 A;  4AT8 B;  2ZH7 A;  1UEU A;  4ATB B;  3ER8 C;  4AT8 A;  5CFT A;  4ATB A;  2B56 A;  3ERC C;  4LEW A;  1TFY A;  4X4T A;  2HHP A;  1R8B A;  2ZHB A;  4FH5 A;  4FO1 A;  2DR8 A;  4FHX A;  4NKU A;  4O6A A;  4WQK A;  4XJE A;  4FHW A;  4FHV A;  5D61 A;  4X4O A;  4K97 A;  4OAH A;  4X4N A;  4MKP A;  2ZH9 A;  1FA0 A;  3EF2 A;  4WH5 A;  4K96 A;  3OVA A;  3C66 A;  4FHP A;  4X4R A;  4FH3 A;  1GPJ A;  4OAI Z;  1R89 A;  2ZH2 A;  2DRB A;  2B51 A;  4O68 A;  4EP7 A;  2DR9 A;  3ER9 B;  4UD4 A;  4JLX A;  1UEV A;  2IHO A;  2ZH1 A;  2DRA A;  4OAG A;  4M5D A;  1R8A A;  2ZH8 A;  2ZH5 A;  2DR5 A;  2B4V A;  1R8C A;  1TFW A;  5CHE A;  4NXU A;  2ZH4 A;  4FHY A;  3NYB A;  4X4S A;  5CFS A;  2GA9 D;  4NKT A;  4O67 A;  4KM5 A;  2DR7 A;  4HX0 A;  4K8V A;  4X4V A;  4K9A A;  4K9B A;  4AT9 B;  3OV7 A;  1F5A A;  3HJ4 A;  2EWR A;  4WQL A;  4AT7 B;  4AT9 A;  4LT6 A;  2ZH6 A;  4AT7 A;  5B3Q A;  4NXX A;  4NXV A;  5D62 A;  4E80 A;  4K99 A;  2ZHA A;  4LEV A;  4OAF A;  2ZH3 A;  3HIY A;  2FCL A;  4N7R A;  3OWG A;  1Q79 A;  4E7X A;  4KB6 A;  3MCR A;  4X4Q A;  2Q66 A;  1UET A;  4LEZ A;  2DVI A;  3OVS A;  4LEY A;  3K7D A;  2O1P A;  4X4P A;  4JLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...