4OATA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with isoleucine.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
total genus 138
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oatA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oatA01
4MS4A 3IP6A 1DBWA 4MR9B 5TQ0A 2NZVG 2CHEA 2FMHA 2NUBA 2FQYA 3NNNA 5HKOA 3EGCA 2L18A 3SQNA 4MS3A 3L49A 3NNSA 4LDAA 1J56A 1RXIA 1DC8A 1GCGA 2HQOA 1U2QA 1ABFA 1JF8A 1GUBA 2N9UA 3B2NA 3O2JA 4RK5A 4ZPJA 2HPHA 4E7PA 1I3CA 2PUBA 1CHNA 4NCAA 3A0UA 3HO1A 1TJYA 5KC9A 1QO0D 3K4HA 1ZGGA 4MR8B 2PUGA 1F51E 1URPA 1SXIA 3JPYA 3QLUC 3SY8A 1GCAA 3HV2A 4MS1B 3RVJA 3EQZA 5IBQA 1ZN2A 3SAJA 4YLEA 1U04A 3CKMA 4MRMA 2H3HA 5FWXA 2LBPA 3HEBA 5BQ3A 2F8SA 4G86A 3N8IA 4ML3A 1LBIA 2E4WA 4RU1A 4F11A 4Q7EA 5DGCA 2A9PA 2PUCA 3JPWA 3HS3A 1Y1LA 4NICA 5TPWA 3HJFA 4LX8A 1USIA 4QYMA 3VNAA 1Z15A 3H1GA 2F8TA 4W5NA 1VKRA 1JDNA 5DTEA 2PAFA 3KLNA 1CEYA 3A0RB 4P1ZA 1U0SY 3ROFA 4D6YA 1KRXA 3VNBA 3H1EA 5EWLA 4EVRA 8ABPA 4UHKA 5KQPA 2M1ZA 1NXVA 5I4CA 3HXMA 3MMNA 1RNLA 4G0QA 1D1QA 3ILYA 2PMCA 4YP9A 1LJLA 4RV5A 1IIBA 3GV0A 3QELA 3KHTA 4Z4HA 3ROTA 1U2PA 2RJNA 3GT7A 4MS4B 1EFAA 4MR9A 1U8TA 2MSLA 2OQRA 4DQDA 2AYZA 2FSPA 1XHFA 3Q15C 3GRCA 1PNRA 2FXIA 3F7NA 4YRZA 3UK0A 3FFWA 1E2BA 5ED4A 5T3YA 3H6HA 1B00A 1A2OA 3CTPA 2GWRA 2VYCA 1JFVA 3QX8A 5D2CA 1AB5A 1Z13A 2X7XA 5BRJA 2M98A 4EVSA 2RJOA 2R48A 4WZZA 5JNSA 4Z99A 1JYEA 2R47A 1E6LA 1DG9A 3KYIB 1P6QA 1LJUA 4FE4A 4RZSA 4S05A 3QK7A 3H5IA 2QW1A 4MR8A 1P2FA 4MS1A 1QKKA 2P4UA 1LBHA 3CG4A 5DLEA 2FLWA 3LOPA 2HQRA 4RK6A 4EVQA 5GOTA 2FKAA 3O1IC 4MRMB 3Q41A 3M6MD 2VUHB 4W5RA 3DLBA 2WMYA 4D74A 4JA2A 1QO0A 2LUOA 5F64A 3LUDA 4MLCA 5TPZD 1TLFA 1JYFA 4G97A 5TPWB 3HCWA 4LE1A 4WXMA 3T6KA 2FVYA 4ZMRA 4XXHA 1D1PA 3CRNA 5TQJA 3HDVA 3NHZA 4KQ9A 1HEYA 3E3MA 3F73A 4RKRA 2PUFA 3LUJA 4Q6BA 1PHRA 2E4UA 2CWDA 1ZH4A 4IILA 2JVIA 3M9WA 4ZYLA 1ZHHA 4E7OA 3KTOA 5EWLB 1ZH2A 3LUHA 3CFYA 2CHFA 3MF4A 4EYKA 1GLGA 4CBVA 4EYQA 1NXPA 3N53A 3CZCA 4RK0A 2BGGA 3O74A 3H5VA 2W42A 5IC5A 3LKBA 4N41A 2PUEA 4L85A 3LUGA 3H1FA 3GA5A 2QSJA 4RY8A 3DGEC 3I45A 4F8JA 2JVKA 3UUGA 1P6UA 3IPCA 3H5TA 1BDIA 3FGZA 1RZRA 4XAQA 4IMJB 2IDMA 1BDJA 2FTKE 3LUKA 3OQMA 3MIZA 1Z12A 4HNQA 2E4YA 4FB4A 1APBA 1JDPA 2HQBA 3GWGA 1PNTA 4RXMA 3IP7A 1PUXA 3P9YA 5BRAA 3KG2A 2ZWMA 5IEJA 4Z4IA 2GKGA 3EAFA 4YWHA 1USGA 2FW0A 3HSYA 4RY9A 1C0EA 5CHYA 5E3JA 4KMRA 5HM6A 1D2AA 2QU7A 1M2FA 4Z9BA 3A10A 3SNKA 1DC7A 4F3TA 2L17A 3E61A 3OLWA 3R0JA 4L4UA 4JASB 3EJWA 2PUAA 2FMFA 1SRRA 1Z26A 1RXEA 3CHYA 2FLKA 3I42A 4PE5B 1ZVVA 2MYUA 3O1JC 1W9HA 3IDOA 4Q6WA 1KMIY 3TO5A 4N0PA 2IPNA 1EAYA 2ZAYA 4MQEB 3QLTA 1S8NA 1DBQA 2R25B 3F6CA 4QPJC 2PKXA 1T34A 4M88A 4Z9AA 1QP4A 3DLHA 2JB9A 1A04A 5PNTA 5JNVA 3OLZA 2A9RA 4YR7A 3NBMA 3OMXA 2MSKA 4WXEA 4Z4EA 1CYEA 3JTEA 1K68A 1YK1A 1FFGA 2WWVD 4JAVC 1Z18A 4ZJPA 2IPLA 1UDRA 5TPZA 1USKA 3K9CA 4DADA 1QP7A 4H3HB 4B09A 6ABPA 4JB0A 2RDMA 4RK4A 2PE5A 1JL3A 3CZ5A 3O2QB 3RVNA 3T38A 4KK3A 2RGYA 1Z2EA 5IUKC 4MPTA 1AB6A 4YO7A 2B1JA 2LP4Y 1YK0A 2IPMA 3NHMA 3OO0A 3RVOA 5HQJA 9ABPA 4WT7A 5CNIA 3A3KA 4KVFA 3KLOA 2FN8A 2E4XA 5FBHA 4WWHA 5JNWA 1BVHA 1NXWA 5KQLA 2FMKA 2LPMA 1FQWA 3C97A 1JBEA 3LMKA 4O1HA 5CNMA 4OG2A 3HM9A 3RVLA 1ZITA 3BRQA 4MQFB 3OM1A 4Y9TA 1DBPA 2MYPA 3OLYA 2JRLA 3SM9A 3HVRA 4XFKA 1L5ZA 1YMVA 4RK1A 5ABPA 4XARA 1VLZA 5KQGA 4PYRA 1P8AA 4S04A 3HK2A 5GQSA 1NXXA 3BREA 4JB2A 5EWMB 4EYOA 5JNUA 3OLXA 3H5OA 5DKFA 1H9CA 2LIVA 4Z4GA 2KYRA 2NZUG 4OLBA 4LDZA 5KQMA 4ZMSA 1D4ZA 1DJMA 4MQEA 3MQ4A 1EWVA 3OM0A 4LE0A 6CHYA 3N6VA 1YS6A 5FBKA 2WJAA 4UHJA 3RVSA 4LZLA 4N03A 2L2QA 1L5YA 4GNRA 4KFCA 2DRIA 3W9SA 3IPAA 4G0ZA 2CD7A 4EY3A 1ZESA 3LKVA 1D5WA 2FMIA 4DN6A 2NT3A 3KKEA 3EDCA 4RS3A 3TMYA 2E4VA 3CLKA 3D02A 4TN5A 1DCKA 5EWJB 4WUTA 4MAAA 5HSGA 4YCSA 1ZAYA 1ABEA 3RH0A 3RVRA 4RY0A 4KREA 3N0XA 4P98A 5CNKA 3LUAA 1ZDMA 7ABPA 3QEKA 4D6XA 3CS3A 1M5TA 1SXGA 4YV7A 4KQCA 1K66A 1JWLA 3EULA 3H75A 3JVDA 2TMYA 2HJ9A 2XDYA 2JBAA 4EYGA 3Q7RA 2H0AA 4ETNA 3JS5A 3QLVA 4MQFA 2VK2A 1NXOA 3UKJA 3QEMB 3ILHA 2IKSA 3O1HB 4KNYA 4NCBA 2JVJA 3JY6A 1KGSA 1ZY2A 2GI4A 4O1IA 3TB6A 5C5CA 3FDFA 1M2EA 2FQXA 5KI6A 4Z4CA 1TMYA 4G0OA 3BRSA 1YVUA 2JK1A 5EWMA 4ETIA 1DCMA 3MYYA 3C3WA 4IMIB 2O20A 2OENG 4RDCA 2E4ZA 4HNRA 5C5EA 1E6KA 1A0OA 1MIHA 1Z16A 3T95A 3LTEA 1MAVA 4Z0NA 1KRWA 3CU5A 5IUJC 1BAPA 4PICA 1Z25A 3CG0A 5FWYB 4PEVA 2PJUA 3DBIA 1NXSA 4NQRA 1YIOA 4OBBA 2Q5CA 3H5WA 3EODA 3S99A 1C4WA 5CNJA 1EWTA 3RVMA 5BR1A 1JHZA 3FMVA 3Q9SA 1MB0A 2JCGA 3QLVC 3QX9A 4LRQA 1QNLA 5DCLA 3G85A 1ZGZA 3F6PA 1EHCA 1RPJA 3CNBA 4YGXB 3G1WA 5B3JA 5JNTA 5IULC 3N0RA 2HSGA 4H60A 1YMUA 4O5AA 3SG0A 2A9OA 2QXYA 3LUFA 5EWJA 3KSMA 3OO1A 1NY5A 3T8YA 1QMPA 2GBPA 4OATA 1JX6A 4RXTA 4KRFA 1GUDA 1SXHA 4RSMA 1DCFA 3FFXA 4KV7A 1BDHA 1QPZA 2VUIB 3RVPA 3I5AA 4YS6A 3C3KA 3C3MA 3HDGA 2IOYA 3O75A 3QLUA 1W25A 3OQOA 1NXTA 2L19A 3HUTA 4QICA 5JS2A 1FSPA 2JBAB 2PUDA 3N75A 1JFSA 3MA0A 4NV3A 4MLDA 4QYWA 1PEAA 3IP5A 3RVKA 4G0YA 1YTUA 5TQ2B 2FQWA 1JH9A 2MYTA 3TD9A 4EGSA 3Q7TA 4RKQA 2B4AA 4TLMB 3QEMA 4W5OA 3DZDA 3D8UA 2QVGA 4PZ0A 1Z17A 4KK4A 3O2SB 1TM2A 4N47A 3N0WA 3KYJB 3OQNA 2PL9A 3KS9A 3O21A 4XASA 1NTRA 1YS7A 4MR7B 3BILA 4RWEA 4JOQA 5TE9A 1WETA 2ID9A 3GYBA 3RQIA 5IX8A 4RK7A 5TQ0B 4Z4FA 3L6UA 1ISSA 5FWYA 2QR3A 1F4VA 1FFWA 4OTZA 4MS3B 1VPWA 1OXBB 4HNSA 4H3KB 2NT4A 4G0PA 1VRVA 2FEKA 1E6MA 1JFTA 2ID7A 5KWSA 3TX6A 2FEPA 2PLNA 1DRKA 3LUCA 4JP1A 1BA2A 2MYNA 1MB3A 4LE2A 4MGEA 4F12A 2GX6A 2PL1A 1FFSA 3M9XA 5IUNC 2FEWB 3RVQA 2J48A 2WY2D 1DP4A 3MM4A 4N0QA 3URMA 2WB4A 3H6GA 1QQBA 2QV0A 4RXUA 3C6QA 2WRZA 5B3JC 2I6FA 5FWXB 4IRXA 1JLKA 3BBLA 2FN9A 2IYNA 2MSWA 4TLLB 1XWWA 4G0MA 4HYEA 4FE7A 3EQ2A 3OLVA 4F06A 1DZ3A 5JNRA 3H5LA 4TMYA 4KPYA 3GBVA 1TVMA 3IP9A 5KC8A 2A9QA 2R4QA 1RZRD 1QP0A 2YHBA 2YHAA 4EUKA 5IEBA 4OLAA 3FFTA 1SD5A 5TQ2A 4IGAA 3GL9A 3HZHA 4XLTA 3LFTA 2P9HA 2V0NA 1XHEA 1EWKA 2AYXA 2QZJA 1R8JA 3I09A 4GPAA 4KZKA 4MYRA 4N76A 3DGFC 3KCNA 3Q7SA 4W5TA 1ISRA 1QQAA 4W5QA 1Z2DA 1OXKB 1MVOA 5JS1A 1M5UA 1DRJA 1PEYA 2WJWA 1NATA 5T7BA 4ETMA 3GBPA 3HUUA 1LK0A 4MR7A 2IPAB 3JVIA 2QVCA 3NNDA 3QELB 4IF4A 4G0XA 3OMWA 3KJXA
chains in the Genus database with same CATH superfamily
1WJGA 2JAUA 2Y1WA 3OEYA 2C95A 3RNLA 1OBHA 3I6YA 2RH5A 1II8A 4GZMA 1THZA 1KVUA 1CF2O 3FYUA 4QYSA 4EG8A 1JMVA 2IX9A 2WC1A 3NNSA 3Q8XB 4LDAA 4RQBA 2PVCA 4WGGA 4R3NA 3UG7A 4F8YA 1GRQA 4G07A 3I2FA 1MC1A 2HK9A 2NAFA 2AMVA 1UUFA 1D1SA 2QZPA 3I04A 4B1FA 5L7TA 3H5AA 4NMXB 3HSSA 3QTTA 4M9QA 2A84A 4DLNA 1I9CA 2O8EB 1J97A 2WTMA 2PXHA 4BWGA 1CZUA 1ZGGA 3HB1A 4ZVLA 1EFTA 1N3BA 2CL7X 4PYOA 2XJ4A 1X9GA 4IQGA 4DLRA 5JHHB 3AJDA 4QFBA 2FHPA 3EBLA 3CRRA 4GBJA 5E6UA 4W8OA 4R5MA 2H3HA 4CKYA 1V1JA 1MA3A 3VMMA 1JAIA 1Q5PA 4Z51A 1P3DA 2WZBA 3PPIA 4ML3A 3WGTA 2JAHA 4ZT7A 9LDBA 1SXJE 4RU1A 5IH7A 1B23P 5GGXA 3I9KA 3JPWA 1Q74A 1P4JA 3K3PA 4YPFA 1XTIA 3UHJA 3CNOA 3V7WA 3BFJA 3VNAA 3R5KA 2F8TA 2NUAA 1XRNA 2Z2XA 5AK3A 1H8EA 2ZBEA 4GRIA 1W2WB 1VLLA 3OPNA 5ECWA 2DG2A 1VIMA 2I3BA 4TMXA 4B35A 1OPXA 4D8WA 2PU7A 2P2SA 4H31A 5DNEA 1VGQA 3VRHA 1AK2A 1ZI6A 5DN9A 1E2HA 4AKSA 1FJGB 3DD5A 1JU4A 4UHKA 4LOJA 1LPBB 3R2JA 3V5NA 1WO8A 1QIDA 4J90A 3OQ6A 3TBKA 4Z1MD 1R8SA 2PG3A 2LKDA 3KR0A 1SO8A 2W70A 4CEHA 3BE6A 1G6HA 1J9GA 4DS3A 2YQ5A 1LJLA 4C21A 4LK2A 2MU1A 1CQJB 3GRKA 3ORQA 5YASA 2F1RA 2ZI6A 3B1VA 1YDHA 3K0AA 1WUTA 5L7YA 3VDMA 5CK5A 1PG2A 4ENWA 2VQFB 3JQFA 1QHHA 4LJKA 1B6GA 1BHQ1 3WLTA 4GF5A 4QULA 1D2CA 1QRRA 1S6YA 3TTXA 1ZNQO 2ODTX 1XWIA 5G1PA 1JHDA 1DC6A 3ZE0B 3T5DA 1V2GA 2FP4A 4WASA 4QKQA 4R1UA 2VF7A 4UNNA 3RTAA 2D59A 3IDSA 4OO3A 3V42A 1LTHR 2D3WA 4MV0A 2H5LA 2X58A 3DDNA 4AQ7A 3I05A 1NYTA 4TQ9A 3V8MA 5ADWA 5CDHA 4AJHA 5LQMA 1N5RA 2CMFA 3KHSA 4X3PA 3SD7A 3ZDEA 3CINA 2CNWA 1JQLB 2NNWB 5LPNA 1E1YA 4NLLA 2ZWOA 3ZI0A 3ZD7A 4MS1A 1QKKA 2O3JA 1LBHA 3Q1LA 3DMHA 2HQRA 3E9RA 3B2QA 4NH0A 5AQ1A 1OJ7A 1WKCA 2AV6A 3IRUA 4MRMB 3PHGA 3AEUB 1CUIA 2WUWE 2VUHB 3M6MD 4S24A 5EVJA 3ZDZB 1OAOC 3ENNA 4RVOA 3IJRA 4OHVA 5ALSA 1U90A 1WW8A 4EUSA 1PL0A 1O3YA 2HRCA 3BWVA 4YMWA 2BFBB 2E49A 2MJLA 3KQSA 1H2RS 2VJOA 4UTXA 4MYTA 4X7PA 5F1PA 4DV2B 4XXHA 3CRNA 1P4GA 4NP6A 4DUYB 1DQYA 1S3FA 4BO9A 2GJKA 2RH4A 4ZEVA 1CUSA 3AU9A 2IEYA 2C4VA 4D02A 4BECA 3UB3A 4ZJYA 1H4QA 2O8DB 1AF7A 2QPTA 3ZHSA 5CFOA 3W2HA 5DYYA 1L5RA 3S6JA 4YRTA 4F6LA 3MF4A 4EYKA 2XGSA 1EZZA 2CYAA 4H08A 2BRUC 3K0BA 1SCNE 4H6XA 4JT4A 4IZ6A 4ME6A 4BQPA 1E8MA 2QBYA 3HI6A 2SHKA 2OG2A 3N76A 4PO3X 4RM3A 1WY5A 1GNLA 2GK3A 3PGKA 3KQPA 1XN4A 3SM3A 3DAPA 5ERXA 4ER3A 3DDSA 3UXEA 4CKZA 3H1FA 4KSYA 2O1SA 4TRMA 3MUFA 4RY8A 3OCYA 4ZT4A 4HH3C 3RRNA 3SJ7A 3JALB 1QQTA 1EINA 4Q82A 5REQB 1U2DA 3W7BA 3IPCA 1N7IA 3PR1A 4G1BA 1N5MA 3ROPA 1FDVA 2YQ4A 4BZQA 2H5IA 4RTLA 3G0HA 1M34E 2ZATA 1A4IA 2G0AA 2H7YA 1O6ZA 2HMSA 2OXRA 4IDFA 2JHCA 4OGKA 4PAOA 1QGDA 4GSLA 3RJMA 4CMIA 5LUBA 2F90A 1EUQA 4BWYA 3U39A 3ZV5A 4DCPA 3WIBA 1PJLA 1PUXA 3H86A 5EXDA 1C9MA 2K2QB 3BF7A 3OSZA 1EZ4A 4HH4A 4HK4A 4JQZA 5SZKB 1C0EA 3NCHA 1MX1A 2AJLI 4BO8A 4P08A 1B8PA 4MEBA 3G9TA 1Z7GA 3RTDA 1XPUA 4RENA 3BXFA 2AFVA 1K7EB 4K9LA 3TS1A 2L17A 4P86A 2V0CA 3QJGA 4PYMA 4OQZA 1AUOA 2PS1A 4RLFA 4JUFA 1Z88A 1E0KA 2C7GA 3R6GA 3RJTA 4AJEA 3OTHA 5T8KA 4N0EA 2AX3A 3BFXA 1MNQA 4Y9SA 1NLZA 1W9HA 2DPMA 4KQEA 3M6XA 1UFVA 5L45A 3D2BA 2WTNA 2BBSA 1Q77A 1MVNA 4B7AA 1ONSA 5AVXA 2PKXA 4GFDA 3RVPA 5AW3A 3ZY3A 3LJKA 2WVGA 4JCCA 2XBMA 2NV0A 5PNTA 5JNVA 1C3VA 1UPFA 1WSDA 3FPFA 4AZTA 2EF0A 2GM9A 2ZDGA 2C1XA 4LKOA 3MLAA 1M67A 5JEEA 2XHZA 4Z4EA 3QG5A 4EJFA 4HS4A 1DWPA 2PJDA 3S68A 1H6DA 2PD4A 3OOEA 4UM8B 3UJ3X 5MN5A 1USKA 2IVZA 5A0VA 1RCTE 5HKAA 2OGSA 2J46A 4IO0A 5E2AA 3H3JA 4WZ6A 2WHXA 4YJGB 1TUBA 3GRRA 3A3PA 2OXEA 4HQRA 2DXIA 3D6HA 1VKOA 3AVUA 3DKKA 3QSGA 1GPJA 1NURA 1T15A 4RTQA 2PS9A 4EEXA 4B3SB 1E3QA 4RJ2A 2Q5IA 3WO1A 3NHMA 5FTMA 3AV3A 1E2QA 4DSAA 4Y6LA 1CEXA 5IVPA 4NAVA 2CUKA 1RAAA 3G89A 2CB0A 1E1CB 2O48X 1I6WA 1VE3A 2FRDA 1O97C 4UHFA 2LPMA 2GZMA 2V7QA 4TLBA 4X65B 4K6HA 2ZBDA 3PGLA 2XZDA 5IVDA 4O1HA 2O0HA 4HOYA 1Z6XA 2QRVA 2M6SA 4PLFA 3KT6A 2GB4A 5KJFA 2VL7A 3EQ6A 4PHFA 4Z54A 1N4DA 3OLYA 3MS7A 1JSLA 3A8TA 1BVYF 1RXYA 2VXOA 4YUXA 4L27A 1U8CB 1DC5A 1CQWA 2J5BA 1HL7A 1QV9A 1U5AA 4Q1FA 4XUGB 5FUQA 4BX2A 4RZ2A 2HQSA 3F6EX 2YN2A 4ALMA 1P1BA 2CLOB 2FX5A 1O6CA 4M6WB 4JB2A 1QHSA 1XTQA 2B3DA 3Q8WA 3UA3A 3IBTA 1FNDA 3ZWQA 4LHXA 4Q9HA 5BQOA 2GXUA 3ZEAA 4UTZA 1DXQA 1KSHA 1FLNA 2YJZA 4F9FA 3A27A 1ISPA 1Q1GA 3OHPA 2EJBA 5DYIA 3ISVA 2P5YA 3ND7A 4L9AA 4U6NA 3FHCB 1PG0A 4FZ3A 4UKDA 3GDGA 4UDOA 2QB5A 5SY4A 4B6JA 4C0HA 4IVNA 1RM0A 2O3RA 3R76A 2FRVA 3RFXA 3TNYA 4YV0A 3N6VA 3PC6A 3OUTA 5E1DA 1TM3E 2BEVA 3BJIC 4CJXA 3RUPA 1XMPA 3QU7A 1WDTA 5HKLA 2H07A 1YOVB 4AYTA 1RI4A 1BXRA 2ZIVB 1NR7A 1OHHD 2VATA 4Q02A 1U8XX 3W9SA 5IN4A 1IC6A 3C3BA 4G0ZA 3B3FA 1YL5A 4FCTA 3H7AA 2IDJA 1GG5A 4HKTA 3BB3A 4HWPA 4C2BA 2IHVA 4OHMA 5JLJA 4DN6A 1N33B 4A6PA 3X1XA 3EDCA 2WUDA 1C80A 1IN4A 2IPXA 1VKNA 2DPGA 2ZJYA 1GR1A 5AKLA 2Q5HA 2WILA 3UMRA 4DG8A 2IS1A 4IJWA 5JH7F 1NFRA 1P9NA 3I2YX 2DHDA 3ROKA 1PL6A 4WA8A 3TOXA 3PJRA 2BBOA 4RY0A 2WKRA 3WK7A 3HY4A 4D25A 1HX7A 2CL0X 5GGYA 4AJ4A 3QKIA 3R3WA 2AHOA 4P34A 5K09A 3QEKA 1QF7A 3F78A 5CLLA 2AZXA 5C8VA 4M99A 1YZQA 3IC5A 2N42A 2VPYA 2IXDA 3TW4A 4L2IA 4NL4H 2QTVA 3OQPA 3HA7A 4LZJA 1SBIA 4KQXA 4GHWA 1IWOA 3MCVA 5DTQA 4DLZA 1W5EA 1A9QA 2GVNA 4PC1A 1EM8B 1P1HA 3HKEA 3P9SA 3VFDA 4AL4A 4D3FA 3VR4A 4OVKA 5ICFA 3OE4A 3Q7RA 5IANA 5BOVA 2BONA 1R4MB 4LQDA 1PD0A 4RHYA 4V02A 2VYQA 3H84A 1F8XA 1OIVA 3DT8A 3MJ4A 4RVHA 1MP0A 4Q9LA 1ZY2A 1ZHOA 3MJFA 2DLDA 3BXPA 1R5JA 4I1OA 4WVFA 3AYXB 4ZOCA 4JT2A 3X1MA 4NYJQ 1C30B 2DECA 4LYFA 5EWMA 2QLTA 3U56A 3WLAA 5LQNA 3AMVA 4BO2A 3AB8A 3EOZA 2F9LA 3DE2X 1IBCA 3ZHBA 4F86A 4NARA 4B7CA 1BS2A 4DABA 1LSOA 2HI0A 5J2TA 2W8BB 3BIWA 3I72A 3ZDRA 4PPYA 2JAQA 3CUEF 1N9GB 3V3TA 1SC3A 2Z1NA 3DBIA 1AOXA 4JVOA 4V0KA 4XKJA 1CY8A 4B6QA 2C4MA 4MRRA 5EI5A 1IPFA 4FI3F 1NPDA 1GL3A 1RAEA 3WRXC 2VAXA 4C03A 5BUCA 1AD2A 4DSZA 4GLFA 4B6SA 2VSNA 5GZ6A 5H59A 3VKFA 2SBTA 3H8SA 3D0OA 3VMFA 3FHLA 1N75A 3F6PA 1EHCA 4B6FA 2ZIXA 4GSKA 3ZV6A 4DBZA 3EG5A 2QIOA 5EJEA 5JHGB 3HUEA 2QMOA 3H4IA 3F5DA 3AFHA 5B7NA 4EHLA 3KX2A 3LUFA 3BH6A 3VO1A 1U7UA 4EYEA 1L9KA 1M2KA 4NZZA 5FUMA 3PQ7A 3PLAE 4C7JA 2QVBA 4XYGA 3RWBA 2W37A 4B7UA 1SVIA 3LGAA 1XDWA 2YFHA 1ZD4A 4RXTA 4ZVMA 1AY0A 1SXHA 2C82A 1C7EA 4KWEA 4AJOA 5KWIA 5C1PA 1ZJZA 4IZIA 3OQJA 1KARA 2Y1FA 3DZKA 1S4MA 4QWMA 3ICOA 3HXTA 2FWJA 1FDIA 3RYHA 4B4KA 4BN4A 4IUYA 2QRHA 1FX1A 2OSBA 3ZXIA 2J3JA 3KQOA 5FLKA 3WNBA 4CDNA 4GD3Q 3EA4A 4C88A 2C98A 2DBYA 3QKSB 4NWIA 1NJFA 2FQWA 1ZK2A 2IXFA 2EJTA 4INJA 2OOSA 4JC8A 4HTAA 3QEMA 1PR5A 4L5IA 3D6MA 1XEWX 1G98A 2P0AA 2QVGA 4XOIA 4ZEOA 4L5JA 1MJFA 2DQZA 1GPYA 4CTOA 1KC1A 1UZLA 1TM2A 1KFEB 3KS9A 1R66A 4RTKA 2SCUA 1QTRA 4OPMA 3RK4A 2HR1A 1CR0A 5L4SA 4P4TA 2CLFB 2P9BA 2ZBFA 4N12A 4BQRA 4YAOA 3LHDA 4QJ3A 2QYOA 1Y48E 1P1RA 3GYBA 4H35A 4U1RA 4CR7A 3TBFA 3T5PA 4K1XA 1GQOA 2HFJA 4RMHA 3OC0A 5JVDF 3EY4A 4KLCA 2ZTUA 4QUDA 4U9HS 1U1CA 3SFVA 2R1TB 1NQXA 4O4IA 3LDFA 4W5JA 1RI5A 5FWDA 2I3AA 3BJEA 1QG2A 3CW8X 3HLYA 1OD6A 1S2OA 1KERA 3P32A 2R6AA 2X3FA 3GROA 5DRYA 1A9XB 1ZMXA 3F98A 3K5PA 3BMCB 3FJYA 4WI1A 5J58A 3GU3A 5AKEA 3W5IA 4ARAA 5CDFE 2WJ4A 4ADSG 3DZIA 4RFSA 1FYFA 4MWBA 2WFAA 4G01B 4GPZA 3WQSB 2A1UA 3LVQE 4GVLA 2PGJA 3FKJA 3GGPA 8LDHA 1GQFA 1Y98A 2N3ZA 3PUYA 3EXG2 2J0UB 4YMUA 1Q91A 3FNGA 3IUJA 5AW5A 1N2CE 3HGQA 1P73A 4CEJB 1Z39A 3IAS1 4A0HA 5JNRA 1MA0A 1DJNA 3ETGA 2IC5A 3LY9A 3KHUA 4BBJA 1GFZA 2VJQA 1WNFA 1JI3A 2Z09A 5EIHA 3HRIA 5HNKA 3VHQA 3ZWMA 5AUNB 3PTAA 3CBGA 3DEKA 3DCNA 4XVCA 1ST3A 1F8GA 2E55A 4TZ0A 1Q1QA 2P2YA 4PN3A 4IGAA 4FIZA 1I0IA 3EVCA 4IG4A 4RF2A 5G0TA 3TSAA 4HO1X 4K9OA 3BICA 4CM9A 4YYEA 1SVKA 1UIRA 2DHEA 3CLUD 4E5YA 5FRDA 3DF9A 1UFKA 5IJ9A 1YR1A 4K46A 1JW9B 1CUUA 5IFKA 1IZ8A 2YY7A 4XJTA 3ER9A 4LHEA 4JJ4A 3FKSA 4Y6SA 2JH8A 4KMOA 3HUUA 2ZANA 2ZTVA 3TQOA 2Z8XA 4D92A 2X41A 1FP2A 2Q4RA 1G2PA 2O7QA 1P9OA 2W2OA 4KGZA 4WINA 3ZWKA 4G0XA 1T3SA 1PUJA 3H4TA 4OHUA 4KVGA 1CIPA 4LA4A 3GFQA 4UU0A 3IKTA 1ISFA 2AK3A 3K70D 3PWZA 4AY4A 3T54A 3LUPA 4OI0A 3CUYA 2PSDA 4FI3C 3FBWA 4LXTA 1SCUA 3R7SA 3EJ6A 4GI5A 3FI0A 1C7RA 1EE2A 5FTWA 3B52X 3AF0A 4K9QA 2P69A 4M46A 2HO4A 4ZJUA 5PGMA 3H5RA 3FCEA 2LNDA 1U2QA 1JLLB 4AI6A 4E7PA 2NZ8A 2W6ZA 2Q41A 1JE1A 1N2CB 1B8OA 1U9CA 1YRHA 1P0MA 2H9YA 4NKRA 5SV2A 4BE7B 1Q7GA 1EK5A 1Z5NA 3BULA 3P9QA 5A9SA 1LBSA 3UA4A 1X13A 2PRSA 1YB4A 2P0YA 1L5WA 1LFAA 4LDPA 3W8DA 3QSYA 3L7IA 3V8BA 4I4TA 2M32A 1U0RA 1PYDA 4AP5A 1DAMA 3CVUA 4FGZA 2IQ5A 1XMVA 3PNKA 4J0EA 2CHVA 3H9GA 4O2BA 2I71A 3WA6A 1L7XA 5HRUA 4K3UA 4KXYA 2AC4A 4P32A 3W0LB 3O3NB 3SSAA 1X7ZB 1XL0A 2VP0A 1TMOA 3DBHA 4Y1RB 1I10A 5AM4A 2XE7A 1V11A 2ORIA 3KUUA 5CDTA 4U0KA 1U31A 2WYIA 3B53X 4X7MA 3G0DA 2NYRA 4DXHA 3GJ8A 3ZNNA 1PZGA 3FOBA 4I8IA 4LX8A 4QPZA 4B3CA 3VAAA 4UBJA 1A8SA 3U7QB 4ENUA 1LLDA 2AQIA 5LMUB 3CIOA 3DV2A 4I36A 2RONA 4UQPA 4RUKA 4WLOA 4N3CA 2XGMA 2C29D 1SBQA 1U3GA 1IHPA 1UBLS 1FFCA 1ID8A 1DBSA 3VPGA 1Z22A 1N2GA 1NXVA 2G9QA 2E0IA 2VQDA 1B0UA 3NG1A 1GU1A 3IUEA 5EZSA 1L5HA 3KAQA 1V5IA 2B0CA 3CZPA 2PMCA 4PSCA 4AP6A 3Q2IA 1ORIA 1NVVQ 4OXYA 1KE1A 1A4UA 4NRDA 3FIJA 3LYAA 3NKVA 3C3EA 1N0HA 2HRBA 2O5RA 2POCA 4S35A 5CP8A 4CV1A 4D3XA 3PX2A 4EJSB 2OYSA 1C3OA 4MVJA 1ECBA 1Q95A 2QG4A 4BO7A 4YAIA 1U63A 1H4VB 1PT6A 3IHTA 3I9FA 2EL7A 2AYZA 3EXHC 4UHBA 3ZTWA 4XRGA 1YVDA 3GRCA 4U7HA 1PNRA 5TB5A 4BEJA 1II8B 1O95C 2VDMB 1IHXA 1SFRA 3FYUB 5F2EA 4P35A 2JDIA 2ORVA 2D1YA 1N8TA 3B9PA 3CH6A 3HXQA 5K0CA 4Q3CA 3V4ZA 3X44A 1WWKA 2J0VA 4WZZA 1V8ZA 2G1JA 3D4BA 2BEWB 1NLUA 1O2DA 1DG9A 1XVLA 2Q4EA 4W7HA 4DANA 4Q7QA 5JY1A 4FE4A 2C0QA 2HPAA 2O8EA 1LW7A 1N25A 2RGEA 3SDSA 4C2UA 3FWYA 1IM8A 1N1MA 4TV8F 4UDXX 5ALOA 5FP0A 1VJGA 1RZUA 3GEMA 2EARA 2GJAA 2FLWA 1JDBC 3CSUA 4RK6A 3ZLUA 5BWMA 5CD9A 1FC0A 2IE0A 2FPMA 3PZRA 1VM6A 3U16A 1CWUA 1V16A 5I5GA 1K6MA 1UP6A 4KXLA 4NV1A 3HZOA 3T3OA 3W4KA 3PCRB 4M37A 1JHYA 1XTPA 3RAFC 5F64A 1HNNA 2ASVA 2FOLA 3VKGA 1Z45A 4GZLA 2IV7A 5CCDA 4RSGA 2VT6A 1ORHA 4U6SA 3E03A 4YUVA 3ERCA 3LHIA 2FVYA 4DCOA 1JR3E 2IU0A 4KR6A 3BK7A 3MWFA 1I1QB 1IN8A 3KZCA 3ZKWB 5E0KB 5L4NA 4YJ2A 1C81A 1P2VA 2HJSA 3R8XA 1WP9A 4JKYA 1Z5VA 2RBEA 5IKOA 3Q9NA 4LRUA 1X8JA 3MBIA 3QVJA 5I8PA 3N0VA 5GJBA 4NF2A 1QWSA 2X76A 5CW2A 1QH8B 1QORA 5F5NA 1P7VA 1UT5A 1GPLA 4MQ6A 1RR6A 2YFQA 4NENA 3L02A 3BUSA 4OM7A 1RWXA 1HI9A 4KWTA 1P18A 4YJDA 4CIXA 5EE0A 2O4CA 4TOIA 4CEHB 3WGIA 4EJ6A 3S7TA 2QTWB 5EHQA 4LISA 2ENWA 4RESA 1J0AA 2KB0A 1IQUA 1CQJA 3L8CA 4JZKA 4N5NA 2CLHB 1ZXBA 3C3JA 3K0AB 4BKPA 2CJWA 1E2NA 4XWGA 5K3EA 1W9MA 1AKMA 1P6UA 1T1RA 4KI0A 5BW5A 1EUYA 5CITA 5B1EA 4DE5A 4LJ9A 1UXKA 3KKOA 1AKYA 4B3IA 4MUJA 1ZEJA 2GEJA 1G21A 1EM6A 10MHA 1CFJA 1UCFA 3I0MA 1QONA 3W8EA 4PXSA 1YZHA 3ZIAA 5JW6A 2RBGA 3AUKA 3CE6A 3H19A 2FP4B 4M1EA 4PGMA 4RF5A 4WZAE 5JIBA 2XAAA 2JAPA 2QL9A 5IEJA 4QL3A 4F5EA 5IDVA 4Z4IA 3EIWA 3IYLW 2BR5A 1DKLA 2O3UA 1U2ZA 3MCUA 5J1SB 1RHQA 1TAGA 1OR8A 2OAP1 4EIWA 4KYUA 1EH5A 4GOND 4EW3A 3PQ2A 4ZVUA 5ES4B 3DYBA 1OUMA 1K86A 3UENA 4PNHA 1I7PA 2ATIA 3E61A 4F5WA 1LPSA 2X22A 2ZRFA 3F7MA 2DAPA 2FI1A 2X9LA 2YWGA 3AKCA 3JWGA 3PRHA 4KKXB 3OTIA 3V4PB 4AUKA 3MHTA 1Y1RA 4MWEA 5EINA 2O8CA 1O9GA 3L3BA 3H2GA 1W5SA 4ZDWA 1OTYA 2GVZC 3ROMA 4E2WA 1J5PA 3KEMA 4XLZA 3BCUA 1XJ0A 5LZ8A 4DQUA 5ALIA 1BHJA 2ZTSA 2DLCX 5EQTA 5JSHA 3VXKA 1NU6A 3M6VA 4GLJA 1RBQA 3CONA 3EXFB 2W6IA 1QKIA 2IYYA 2V3VA 1OH5A 3P26A 3C85A 1PZXA 4LNUB 3WV5A 2YXNA 4A36A 5DLDA 4V2UA 2WG0A 3WL5A 1BS9A 3JZDA 5H02A 1KWKA 2G80A 3SS9X 2IHYA 3WXMA 2QBYB 3G8AA 1AHPA 1P7CA 3IMCA 3VC7A 1DAEA 1GKIA 3O2QB 2HH9A 3OCUA 4Q9NA 3BXHA 4RELA 4BLPA 5BUQA 1GZSA 4O8ZA 4QOEA 1M8JA 2RG1A 2RHTA 3G0IA 4WKOA 5E9WA 3TTUA 3ZPXA 4FFPA 4BMXA 2B1JA 3IAS6 3LGXA 3QF4A 4KCGA 2XNDA 3GJ6A 3UICA 3AX6A 4P3NA 1QZ3A 1K0FA 4OMUA 1M8PA 1I4OA 2YFYA 1PQYA 4D9MA 5JRDS 3RVDA 5K45A 4V3BA 2J3QA 2ZS8A 3PK0A 3OZCA 8MHTA 4B48A 4RKFA 3OIWA 4CIVA 1DDOA 2YOGA 5GM1A 4JI1B 3KC2A 4EVIA 1GUZA 3DJYA 3VR5A 3ADBA 2JDID 3BKWA 2QI9C 1GZ3A 4OG2A 1BA3A 2GF9A 1QDEA 4B43A 4Q24A 4FKZA 3HFRA 3NVDA 3ABOB 2MYPA 2WUFA 4XFKA 1YMVA 1P62B 1ZL2A 2FZVA 1ORRA 1E8DA 2YNMD 3MYRA 4BEBA 3QRWA 3THWB 2V6IA 3BRCA 2COEA 4V0MA 5FPKA 1HE3A 1NW8A 3F90A 1XI2A 4OCZA 4TMVA 1DHRA 1TOAA 2WINI 2RHBA 3OLXA 3H5OA 1ODIA 4PGGA 1LD3A 1RZVA 4HL6A 3RSFA 3EBOA 4ZC1A 4ZKEA 3VHXB 1V3VA 5HILA 4BGEA 4BP1A 2G6TA 4Q37A 2Q3EA 3TFWA 2C5EA 4FK8A 4MUBA 1XCMA 2A86A 3KPVA 5DF1A 2H5JA 2HU2A 3BDIA 2FA9A 4Q3BA 3WBKA 2H9AA 2VNKA 3ZK7A 5DIFA 5FBKA 2IU3A 2AMYA 3AIIA 4N03A 1PVVA 2C0CA 3G9QA 4GLBA 1HT1E 4GNRA 1B8VA 1FMLA 4XIJA 3PUKA 1XV5A 2GO7A 3CZRA 1ZINA 3HCPA 2GEKA 3P97A 3UJ8A 4AIRA 1B4DA 2I2FA 1C8LA 5ITSA 4ZVRA 1TM4E 3D7RA 1YQQA 3TLCA 4AECA 3EPRA 3B36A 1SMKA 5CG2A 3IMFA 1U3WA 2OBNA 4YJGA 2FV8A 4D8VA 1TUBB 3DT6A 4IF6A 4UUNA 2QTZA 5C37A 1ZAYA 4PSVA 1GILA 1HKHA 1TJ3A 2GBLC 2P4QA 3G9ZA 4UUAA 4X6XA 5I7AA 4DIOA 1BD3A 2VK8A 4N82A 3J81k 1ZCZA 1R7RA 4YRDA 3RV3A 2W93A 3PPWA 4U02A 3RJZA 3WG9A 3PRJA 5AO9A 1ZZGA 2OXCA 1N2ZA 4X8LA 1L2TA 3I92A 1QBGA 3CUWA 1KF0A 3UW1A 3FN4A 3HXKA 4DR5B 2FUNB 5BWLA 1OAKA 3H75A 2WABA 3UQYS 3WWOA 4D9IA 4MV4A 5EJ7A 4G89A 2V7XA 3A4MA 4OK3A 2XQFA 7YASA 3GA7A 1V41E 5HCNA 3TG8A 4LECA 4GXQA 2D4AA 4KXQA 3JZIA 3CJTA 1TO2E 3IUMA 1XTRA 2WJPA 3JY6A 2R97A 5ALTA 3FDFA 3M1LA 3QGMA 1ZGBA 4PFJA 3CZ9A 3LM8A 5D5PA 1SU6A 1WKBA 1MFPA 3OZGA 1EHIA 4QDXA 5D84A 3P9ZA 4ZGWA 4QM7A 4L9RA 3AKEA 4PLYA 1C4OA 4ON9A 3EGEA 3UH0A 5LZ5A 1BQ3A 3RRJA 2AQHA 1AA9A 1SKQA 1VJ1A 2VPQA 2W43A 1Z16A 2B6HA 3ADOA 1CNEA 2BFEB 3P45A 4M0UA 4MRNA 5EMKA 1KRWA 4OLJA 1SGWA 4BC0A 2QVZX 2JCSA 3DMDA 2XAUA 5DGTA 5TGTA 3A11A 5H3CA 6YASA 3T12A 3WRYA 2I1VB 5CA0B 2JI4A 5LWHA 4BV2A 2ZYAA 4GUDA 5IZCC 2VJKA 5IAAA 1YOVA 2YZNA 2FOIA 4K87A 3KU1A 2YWJA 1DIAA 4DIEA 3Q3IA 2WQZA 4LWOA 1SPBS 3WI7A 2D2XA 4IS2A 3CISA 4CR8A 3CNBA 4FBMA 1KOJA 4G85A 5ECDA 2F4VB 3D3KA 2IZOA 3FNIA 4HN4B 5HUQA 1VLHA 1ZNXA 3NMUF 3K1JA 3ESBA 1KK3A 4ZO6A 2AD1A 5F5XA 2VUUA 3T3EA 4FFLA 2NO6A 2D5AA 4ZP1A 4YGYA 3ONNA 3ZD9A 4XQEA 3FMPB 3SKVA 4RSMA 2M6RA 4YBZA 3Q8KA 4DCSA 4V03A 5JAQA 1U8ZA 1I5EA 3WS7A 2UVDA 3CZQA 1ZNZA 1QHIA 4L2IB 5JQGB 2OV6A 3H2BA 3ABQB 4BMNA 1AIPA 4G0VA 3HKEB 4YASA 4MKHA 4EECA 2J30A 5LP6C 1JFSA 5JZSA 2ZVDA 1KJYA 5F51A 3HB7A 1N2HA 2G5TA 2ZSAA 3W3ZB 1KXZA 3PWTA 1EFLA 1QQ6A 1JKMA 1R4MA 3BAFA 1W46A 5TEWA 6ADHA 4G5GA 4RKQA 2B4AA 2HLDD 3H04A 4EK9A 5ADUS 3TH5A 3LK6A 4PFQA 2ZS7A 1ADCA 1NBMD 2KW5A 3PJGA 1YFJA 2XKJE 1RWVA 4FB4A 2OLJA 1BN7A 1IY1A 1JT2A 5DYTA 4QRHA 3OQNA 1J5EB 2Q5LA 2BH2A 4C0SA 1Q1BA 3W79A 1U98A 3F3YA 4XDHA 1I7DA 3BFPA 3LT0A 2ZSIA 1Q2UA 2V5UA 2QTTA 2XE4A 1EAMA 2RCYA 4HDRA 2YW9A 5ESRA 3U6BA 1WBBA 5HIJA 2X9GA 3RYIB 1PAUA 5ALGA 3MD9A 1E1RA 4RL4A 3VV2A 1ULAA 3ORSA 4BNLA 1OFUA 3F4BA 2VRNA 1INLA 1UBMS 3F6YA 4HNSA 2FPWA 4PX9A 1MHTA 3DDOA 1U5CA 2OAQ1 3EIUA 2MMGA 1HMYA 1Q15A 1IBLB 1GZUA 4JXZA 3PUJA 3KOUA 3RSQA 2YS6A 5ENVA 1C3EA 1KYYA 3ST7A 3UWSA 3RWOA 1SR8A 1KI3A 1TTPB 4PBSA 2C5GA 4ARUA 2EYQA 3Q3GE 4G67A 4DW8A 5IUNC 5DK4A 3P5BA 4Z3OA 1SU7A 5DN6D 2A5DA 4N5HX 1NW7A 3H9QA 3DR5A 5EJ2A 4O0LA 1KNQA 4UVHA 3II6X 3MN1A 4XCXA 2A1TS 2Q9AA 3NV9A 4E5NA 1MXFA 2PGOA 1ZCFA 4FDUA 4Z7OB 5ESWA 1U65A 1NVMB 2FP3A 2ADMA 3H1BA 4QIHA 5DBFA 1PTKA 1XNRB 3I5YA 3BAZA 3RYHB 1PP4A 4OP2A 2JH3A 3OOHA 3RG8A 3D8SA 2QJWA 3THYA 2HCFA 4K6GA 5HKBA 2C83A 2HJRA 1QCDA 3CEHA 3ZIAD 4HNAA 3QKSA 4BNVA 4KMMA 2V7QD 2Z9CA 3D6JA 1I6LA 2IRWA 2D0PB 1ZJ4A 3OVMA 5CT6A 2V7UA 4WJZA 2ZJ1A 5AVKA 1Y9EA 4WXHA 4C4XA 2LRHA 3PGXA 2WWHA 1N32B 4LXQA 5DWDA 1EFCA 4UREA 2PGDA 3CNQS 3CRMA 3UYLA 1X1QA 1N6RA 2SCUB 3WK9A 3LE8A 1TZCA 3U7EB 3DMGA 1JIXA 1ESZA 2HHCA 2P27A 4WTOA 1XVUA 3ML1A 2FPRA 4JL5A 2B20A 2VTEA 4F5ZA 2ZJ2A 5CFRA 2P0EA 4MHSA 1LPPA 4PZLA 3WGVA 1S2LA 4RL6A 5HKOA 5K01A 1THTA 2IOQA 2R1TA 3K31A 1RCFA 2ZB4A 1NAIA 5FI5A 2DH5A 2HIAA 2F6RA 2X5KO 3EUFA 3IPXA 4O4IB 1CR1A 1FL9A 1XVAA 4B6GA 5CVTA 4DNFA 2N9UA 5HE8A 4GPD1 3O2JA 1ZM7A 4IRMA 4L4SA 1KQNA 2JLXA 1PU2A 1LS6A 3NASA 4DIMA 3DKIA 3FAKA 3FNFA 1T5BA 2COKA 1QO0D 2BMJA 3BMCA 2W0MA 4KV9A 4K6MA 3K4HA 4WD3A 1QLJA 2OORC 5FI1B 3NDRA 4CMKA 1G5QA 4L3OA 3AVXA 4N4AA 1R3DA 1RQ2A 1XJQA 5D00A 5CCXA 1I80A 4JWTA 4RD0A 3VKVA 3PQ6A 4I7EA 4YUAA 5KJ1A 1Q57A 1U0HC 1LZLA 1EVQA 1MKYA 4K9MA 1BXKA 1PJ3A 2FR1A 3TLXA 5CM2Z 1XALA 3U80A 3WMEA 2J0UA 4CL0A 3MBKA 4DHWA 1XZNA 1Z6AA 3PXAA 3QOYA 2V8BA 5IK2A 3SVLA 1PT8A 5HOQA 2K6GA 5K3SA 1RT9A 3AFIA 3DE4X 3W5VA 5AVVA 2A9PA 4K7JA 5SY6A 5BUZA 5EJ5A 4IBOA 3ZJYA 3L41A 2CDRA 1FXWA 5ITZB 1JZQA 3G79A 5AM0A 4WH0A 2JEOA 1WZUA 2QS9A 5KNBA 4UTNA 1C1YA 4HDSA 2G63A 4IIYA 4MAMA 1VCNA 1SIUA 1VGVA 4CM1A 4FB5A 1NSFA 3OIUA 3VI3B 2Z8YM 1W35A 3FWHA 4P1ZA 4OAQA 4WOKA 5KCZA 3LCRA 3PFBA 1KRXA 4LJLA 1W36B 3NIDB 3EZ2A 2QD2A 1BJRE 3ZHQA 5IJ9B 2I54A 3L1HA 2CXUA 1HYHA 2CXOA 5KU1A 4AUMA 5LQCA 4DCJA 4WV3A 2IQIA 4PGHA 4UM9D 1KYQA 3GUVA 3GN1A 1GFIA 4LXHA 3ROTA 2EHJA 4QBHA 1L5SA 2J6BA 1JIQA 4E5PA 1SCUB 3H2KA 2JFUA 3U31A 3R4VA 1OASA 1U0JA 1WLSA 2HU8A 4XCVA 2O7VA 3WGYA 5KNCH 5A3VA 3AKZA 5AI9A 2GWRA 4Q18A 2H4YA 3TEMA 4YQFA 2ZROA 1JLLA 3OLCX 1CEQA 3K35A 5DWQA 4HGPA 4UFOA 3R9IA 3D64A 1ESCA 4R7GA 4D42A 2J45A 1NPYA 1E96A 1IY0A 1JYEA 1DIHA 2GD0A 2G25A 3DYVA 3RLIA 4G8CA 3G2OA 1G4AE 3FR8A 1F2VA 1VJRA 3DE7X 4GI2A 3N7UA 4LYJA 4RZSA 4ZAYA 5A9SB 5C3MA 3K1YA 1QE5A 3PI6A 4UMEA 1N6PA 1Y3HA 1P2FA 2H5EA 2IEIA 4I4TB 3VJLA 4EG1A 4ZAVA 3JQPA 3T3DA 1M2NA 3F0TA 1YR2A 2OV2A 4MZDA 3G5AA 4NK4A 2VVTA 4PCAA 3PVSA 3GMIA 3P9RA 3JRNA 5LDDC 4W5RA 1BE6A 1OBCA 3L92A 3O9VA 1NQOA 3W9BA 4WBNF 1X8LA 1QO0A 2E1PA 4JA2A 1QB7A 2O19A 1V11B 1SXJD 2VHUA 3ME5A 3O82A 1QAMA 3VPDA 2BI7A 3WWPA 1GPBA 1NIJA 2HQ1A 2W6ID 2AN4A 4LE1A 3T6KA 3SYRA 1VRWA 4BV8A 5KNBH 4FYHA 1AKQA 5DYGA 1MO4A 3U7QA 5TQJA 4DLPA 3GELA 1DNPA 1E9VA 3QOXA 2XVMA 2BM9A 1TTTA 1ADJA 2ZS9A 1UDAA 1W8IA 1BEZA 4DV4B 4Z5XA 1HFWA 1Y6ZA 4FCWA 1YL6A 4LZAA 2VYVA 1L5HB 4CM7A 2XF2A 3PDIB 3PNSA 3U48A 3KE8A 2FRDC 1RYNA 1KBOA 4QAQA 1RQPA 1BCRB 1JIVA 2QGZA 3P19A 4YCDA 4DCMA 4NHEA 2GBGA 4WKBA 1DGQA 3O3OB 1ZKMA 4EJSA 4JJZA 1J39A 2XB8A 3LA6A 4Z7JA 4F8JA 2QMZA 5EC8A 1MOSA 2YMLA 5JI3E 1WMEA 1UFRA 1NVEA 1P5HA 4QYIA 1KQPA 4Y6OA 2J9RA 4R69A 4YRIA 2JG3A 3VH1A 4JI8B 2O54A 3HKBB 3LUKA 5DBHX 3MTEA 3SYNA 2X40A 4NI5A 4ECEA 1X80A 2E4YA 5AM5A 3RU3A 3V4OA 3ICEA 1JR2A 3N05A 4D3SA 3AL0C 2GKGA 1QF6A 1RKBA 1DAPA 2BFAA 3PRYA 1BCSA 1LLQA 1DBVO 1PFQA 1QG6A 2BEWA 2VP9A 2X1MA 3DA8A 5CXUA 2J59A 1KIFA 1D2AA 1Q83A 1RKUA 4QBIA 3AGPA 3D1VA 2PX6A 2W6NA 1Q0HA 1IJFA 3SNKA 1BGWA 3LKDA 5EHXA 1FSFA 4ZTUB 5CW1A 2J3LA 3N2IA 1MAAA 3ED5A 3I9V1 2IUYA 4XSHA 1N2EA 1WVGA 4WFQA 4ZQGA 5K20A 3UMBA 1GGFA 2ECQA 4LJYA 4PFSA 3V00A 1V16B 3BF8A 1PTJC 4I6GA 2BBWA 4H0FA 3FUCA 3H0EA 5EGSA 2MYUA 4YDRA 2Z9BA 2B4TO 1Y63A 3BEOA 4EFKA 2EWVA 1V5GA 1SH7A 1NIPA 3R8CA 4BE9A 4EGCB 4LYYA 2CUNA 1E2JA 4R5HA 3SHTA 3FHOA 1ZVKA 5AK6A 1A04A 1C7JA 2HA4A 2PA0A 1JDVA 1LWNA 1CUHA 4HQLA 2ZI3A 3ZKWA 3ITNA 1EXMA 1KAGA 2A3NA 2Y4NA 3OMXA 3N5KA 4YJ2B 3WHPA 4AF8A 4DAEA 4LRTB 1PV2A 2PWZA 1T91A 3D7SA 1Z18A 2HEIA 5GZ1A 1SXJB 1QH8A 1UDRA 1FQOA 3OPYB 4XOUA 2HMUA 5EZYF 3KPYA 5LJLA 4NENB 6ABPA 2QZZA 1R10A 1BD4A 3STTA 5LQKA 3OZDA 4DWVA 1OI4A 1XZEA 2REXB 1SVSA 1U7DA 4UE3S 5DV9A 4GXRA 3STXA 1KEEA 2C9BA 1O8BA 1P4AA 1Y1TA 5E9QA 1KDOA 1V2HE 2RGYA 3N6XA 2VBFA 3G6KA 4POOA 1B16A 4I1IA 4OHXA 3SU8A 1XROA 2CJWB 4Q3KA 3CT4A 2XCIA 3LY7A 3U4QB 1IM2A 1V6CA 2P30A 1H2FA 4IL5A 2IHTA 2AG8A 3TSZA 3F4KA 5JADA 2HLDA 1Y34E 1NJ2A 1WZNA 3BG5A 1ZIYA 1CYDA 2IXAA 3OY2A 1QGZA 1WDKA 4LGCA 1G21B 4WKPA 1BEEA 3RIHA 4EMBA 5BN3A 5CFZA 5JD4A 1O95A 3ECSA 4OQLA 5FFMA 3PCXA 1CTQA 1FQWA 1EVJA 2CHGA 2E18A 5J4KA 4BMCA 2D7DA 1I3KA 3BH0A 2WYOA 5F12A 3ZXXA 5FB3A 2OZVA 3WMFA 3OM1A 3OCVA 5JG7A 3I6MA 5TVGA 2ILVA 4R1PA 3V48A 1WMSA 1QIGA 5G3YA 4D26A 4RK1A 3HEMA 5ABPA 3SBEA 4NR0A 3RUFA 2QSUA 2C4HA 1IUNA 1SKUA 1NXXA 3KKZA 3PG5A 3BREA 3MAAC 1ZBDA 2ZBQA 2AOXA 2XRYA 2O8CB 2BGNA 2CNNA 2QTAA 3MWKA 2QI9F 1X7HA 1ZVMA 4LRWA 1CS0B 2VPTA 4HWOA 2GCNA 4YI5A 4NNPA 1DJMA 3LP5A 13PKA 2D5CA 4XSGA 3PXGA 1JHUA 1OILA 3GRPA 4TL9A 1YS6A 1WV0A 2J85A 2WJAA 1JMYA 1UEXC 2C5BA 2ZETA 3CV3A 3EXFA 5DN6A 421PA 1P0FA 1PF7E 2V98A 3M1IA 1M0EA 2WP0A 3LWDA 1H85A 4LNUA 4F91B 3VA7A 2TMKA 3IPAA 3M6AA 5B1DA 5K0LA 1TIKA 4OFBA 5ILQA 1UIMA 1VE6A 4LI0A 4EY3A 5JZBA 2HTEA 3G8BA 5ESXA 3IQGX 1KDYA 2HLNA 1CUZA 2IUFA 1GVHA 2BJVA 2E4VA 3WL3A 1QQ5A 4YP6A 3IHWA 5IT4A 1DRWA 3LYUA 4RLQA 3E2PA 1NNI1 4OMCA 2WWWA 2FLVA 3LS2A 3GAMA 1EK1A 3IAEA 1GQ2A 3LOQA 1NE7A 1YBFA 4ZV7A 2E4AA 3LUAA 3QF4B 1EWRA 4GQBA 4I4LA 4HUQA 4D46A 2ZREA 5CAEA 4OFZA 3GAZA 3EA0A 1RHUA 1N5KA 2PMBA 4S2UA 4ANFA 3EG9A 4LC0A 2SNIE 2VZ0A 4LY3A 3DL2A 4XGNA 1E4YA 3QNMA 4TZKA 5HJEA 1H23A 4RVDA 4YAKA 4Z2AA 4K3VA 3TJZA 3OOJA 3UJHA 1ODCA 3A4YA 9MHTA 1PDWA 1Y4DE 2QN9A 2Y1EA 3JYPA 1OGIA 2N75A 4ND5A 3JRXA 4HAVA 1C7ZA 3LL7A 1PKEA 4ZI3A 2AG5A 2DY1A 4GO1A 4MIKA 2TSYB 2ZYDA 4GIBA 1JXOA 4I0WB 3C74A 3ZZMA 4OKIA 4I6JA 2PIDA 3QU4A 1V5EA 1Z4MA 3THWA 1QFXA 3TRFA 4FOOA 3V8NA 4ZQBA 2EWWA 2X8WA 4JWKA 3NAQA 1TE2A 3U6KA 1Y9ZA 2OENG 4KGDA 3AR3A 4ARIA 3VHXA 1T2UA 4J1TC 1LBEA 4WK6A 3ESXA 4LQLA 2VAWA 3PKZA 5A71A 4R40A 4IQFA 3TX2A 3ZC3A 2IOFK 3V4FA 1RZ3A 3QUSA 2Y9MB 3GJZA 2XMSA 2QTHA 4LFCB 2O6LA 1GN9A 1UADA 3R09A 4CKCB 4HGQA 4A27A 1C4WA 3Q9SA 4WNCA 2ZUEA 4R01A 1B1AA 1K98A 1KGDA 3D6TB 4TXHA 3ZCXA 3OP4A 1QNLA 5IMBA 1ZJ5A 3IA7A 1Z5UA 2AIRA 3RS0A 2B94A 4X24A 4LY9A 3DE1X 1TCCA 4PXYA 2Z6VA 2GAJA 1DQSA 4Q12A 2AR0A 4X44A 1H0RA 5DCUA 5FBWB 1XTJA 1UDWA 4N5IX 4YMSA 4RHXA 4B75A 4URXR 2AI3A 1R0KA 4D9EA 1Z4JA 4OJQA 2XPCA 1D2GA 4PBTA 3E82A 3GMSA 4CIYA 4PLTA 3VZCA 4X62B 3TR5A 1RKQA 4RA6A 1OXUA 4P22A 2BKEA 2PU5A 2V4UA 2W58A 3EA5A 5SZIA 4ZRNA 1E2MA 4RHTA 1D7AA 1GZ6A 5DEIA 4G4IA 2B5WA 2FEXA 2J6IA 4Y2HA 3RFCA 5DBIA 3CRVA 1TM7E 4YS6A 1GRNA 2CZQA 2IHJA 4WESA 2EWMA 2Q5EA 2W2VA 2B78A 3UHAA 2BHNA 4BX0A 2A0YA 1UWCA 1I3NA 1FDTA 3IAHA 3LI2A 4OXKA 4G4GA 5LB4A 3RU2A 1N0IA 2C00A 2ECOA 3FSGA 1QCYA 4ROSA 4YLEA 2NVUB 3VHLB 4QM6A 3GT0A 1ZR4A 4R81A 4B32A 1TT5A 2B36A 3WZLA 3DBVO 2WIJA 3R3YA 1T5TA 4DEYA 5EESA 1NTOA 3FXAA 3IQHX 1E2GA 4LQCA 5MFZA 4PZ0A 4EA6A 1T4DA 4YQEA 1RE1A 5P21A 3M70A 3P52A 4B3FX 2OCAA 1NDQA 2CXRA 2HJVA 3CSSA 3LPMA 3O21A 2I6SA 3IBCA 4FIDA 3GJRA 3KZVA 2VTBA 1GDDA 3H2JA 3G2LA 1UMDB 2UU9B 4KG7A 5DNAA 1BU8A 2HBZA 1M76A 1SNYA 2Y27A 1P17A 1XFDA 1YBVA 1ZU4A 3AUTA 3CN7A 3N86A 2BFEA 5K4AA 1N4AA 3ZZNA 4QUEA 2Z6UA 3VR2D 4Q4DA 1Y81A 3QWFA 4QHYA 1HOTA 2D0OB 1AQ6A 1F4VA 1RAIA 4OY3A 4R3UC 5CA0A 1QO9A 4RJLA 2H18A 3NBQA 3PUHA 5FEMA 3O4RA 1VPWA 3I2IA 1OXBB 3KBOA 3V1TC 4ZI7F 1UM8A 3NAGA 1WS6A 2BAGA 3K9GA 4A73A 2VWGA 2MYNA 2QK4A 3RODA 2P9ZA 3D6NB 3MSCA 4JP3A 3ZJVA 1WE2A 4PYIA 1CF9A 3GWZA 1ZSYA 1FS4A 4KNVA 1QE3A 2LW7A 2NUPB 3B6EA 1W52X 2C96A 2PKQO 5M7EA 2FCAA 4M76B 3QBVA 4FMDB 2WA1A 2PGNA 2QUJA 4PZPA 3N8GA 4B0PA 4DQLA 2BZSA 3PEUA 4DUZB 4ZI2A 1TQ6A 2QUKA 2WK1A 3AOGA 4TS9A 1LNQA 1A1VA 2BIFA 2PX0A 2XA1A 1DZ3A 2WD7A 3FTPA 3DFUA 5ALLA 1NSYA 5DXJA 2GZAA 3H5LA 3PWKA 3I39X 5EEGA 4BNJA 4M9ZA 1TVMA 2WBLC 1E98A 2NZJA 5AI0A 4MWGA 4NBRA 3IQIX 4HEHA 2JD1A 4M38A 3AEZA 2ZJFA 3LBYA 4LW8A 4M86A 4NCXA 1E8NA 1SD5A 1L8AA 1MX9A 1GADO 1NVWQ 4OLHA 5JZVA 4YXWD 5IKPA 2P9HA 1Q14A 3QVLA 5BMVF 2NYVA 4PYJA 1KDRA 1LDMA 2A94A 3ECCA 4W5TA 8OHMA 2Q3MA 3HU2A 4Y2PA 2XI4A 4OL9A 1HZZA 4MB0A 3B9RA 4BFCA 2JI7A 4BP9A 1WUJS 4N0MA 3QMMA 5T7BA 5F7ZA 2I4TA 2R6FA 4LY0A 1V8DA 3HI4A 4GMFA 4HDRB 2BR4A 4NX2A 5KJCA 3OMWA 1L3BA 4GS5A 3UB4A 4F5DA 2I4RA 3RYIA 1YB2A 3IVMA 4G41A 5DDIP 3KRTA 4NE7A 2D8MA 4DLAA 3QITA 4M60A 4GQIA 4RTOA 1RXIA 1RXSA 3DFKA 1GQRA 1JF8A 3KXPA 1U6IA 1UOPA 1E20A 2I8AA 1YULA 4IVRA 3ZS9A 2GNOA 4WXPA 2IYLD 1KEKA 2OK8A 1XSEA 3CEMA 3A0UA 4U3JA 3ZE7A 5KTSA 2BE9A 4DIBA 1SBCA 3G2KA 1A2BA 4QUIA 4A8JB 1FRNA 3FKQA 3AXSA 3KTAB 4TKMA 3I58A 3RS5A 1F60A 4JI0B 1I2MA 4BASA 2FWMX 4IINA 2J9FB 1QIIA 1FBTA 4MINA 2WYVA 4EWLA 5KHOC 1ZRSA 3ZKAA 4MKIA 5EUMA 4DYDA 1QX4A 4CNQA 3OE5A 4LF6B 4XD2A 3DLTA 1BQ4A 3H2ZA 1UZUA 4JLOA 2XUJA 3OWHA 3PU6A 1A27A 3BD7A 5L51A 4AUNA 5A4JA 1JJIA 2PYZA 3VR6A 2XDAA 3RSOA 5DGCA 1TDJA 3PXXA 5AK4A 2OGUA 3VOSA 5A04A 3THYB 5F1YA 1USIA 1O5TA 3GXOA 1DTSA 4L08A 2YXDA 2VPZA 4HNAB 3AK4A 4QEZA 1CUVA 1EK6A 3X1DA 1RIFA 2XVYA 2ZJAA 1AN0A 1OFVA 4CKXA 4HVTA 3VNBA 3H1EA 4BX3A 1CY0A 3C5CA 2DP4E 1K9SA 3RUAA 3CLSD 4O29A 3VBCA 1V35A 5B2EA 2X2OA 4LDRA 1D4FA 1QRDA 3HLTA 2JLCA 3I9NA 1BMQA 4HLQB 4ONEA 4WHMA 5CPBA 1TQHA 5FTNA 4YP9A 4IEIA 2JJ2A 5AJWA 1B0AA 3ND8A 3NTLA 2F1HA 5I7OA 2BCEA 1NX6A 3WMGA 2VJNA 3OETA 1O03A 1T3HA 3NPMA 3OWXA 4C5CA 2GCGA 2YIJA 1CY6A 2GEUA 4EL5A 4ND3A 4G3XA 5EXTA 3D59A 5BV7A 2VYCA 4Q0MA 1UC4B 2C9CA 1JYSA 2ETXA 3MLBA 4Q3NA 3UUFA 2X7XA 1U1GA 2QL5A 5TGZA 1PJSA 2RJOA 3IE1A 5DHPA 5I9MA 3AUFA 2JC3A 2RC6A 2FZLA 1SD1A 4DC9A 1P6QA 1VDZA 3GX1A 4M7PA 4NVRA 3T3IA 1AKVA 1XP5A 1RMQA 3MJCA 2HADA 5E1OA 3IAUA 521PA 4C7KA 4F4FA 1ZD5A 4FHZA 3UAYA 3HEAA 2W83A 4U5XA 3VVLA 4BS9A 1I14A 4B79A 4NXNB 3OFSA 4TT3A 1C4XA 1HBJA 5E4FA 2OXTA 3D43A 3OQBA 3A9RA 4ZT5A 4AY6A 1PK7A 1YUNA 1OXSC 1K27A 2V55B 3AONB 3OQHA 3PJFA 2HDNB 2PV7A 5A4FS 2DBZA 2ZWVA 1NMYA 3R9KA 4FGWA 2A8YA 3GJXC 3BYZA 3NTQA 4J1SA 1G41A 1IOLA 3V7YA 1XRRA 2FG6C 5ITZA 1JTFA 3SLRA 2ZQYA 3LQ2A 2Y71A 3HDVA 1W2GA 4HDSB 4BNGA 4G1MB 9ATCA 2B69A 4AW9A 2XDQA 3R5TA 4IILA 1ZMTA 4MUGA 2X5OA 1IUPA 1MRSA 2HXSA 4PPNA 4UDNA 5KKCA 2FMTA 1Q20A 4IIHA 3KTOA 4HY3A 2YWRA 3ZW7A 3UHFA 1NQAO 3SOZA 2IYPA 4P6VF 4BOYA 3D0QA 1L5GB 1PJBA 3B3GA 5GJVC 1WLYA 4KAJA 2RSLA 3LQYA 4G65A 1VP3A 1SCQA 2NXWA 3OEWA 1OI7A 8ATCA 5HTKA 4L95C 3KKQA 4QFCA 1BZYA 1ZD9A 1EVIA 3C14C 1SXJC 4CL8A 3E5RA 1IIRA 2F2TA 7GPBA 3QYAA 4ESVA 4M53A 2JVKA 3I34X 3ZEIA 1TQ8A 1PYGA 4B81A 5HTOA 1XCLA 1MPXA 2Q4BA 1F0KA 2PLRA 5CB4F 3L4KA 1SJ9A 1VHWA 1YJ5A 1K6JA 4CT0A 2GLXA 3T7KA 3R3HA 2PMKA 1YZKA 2DE0X 2GARA 2VNAA 2OP0A 3OE7A 4A5SA 4DXDA 4HNQA 1B93A 3FCOA 4BMZA 1JDPA 4EHKA 1NVGA 2EX4A 4GE3A 3T0GA 3K6JA 4HMQA 5EQDA 3MTJA 4FONA 3O73A 3IKMB 5LNK6 4UCWA 2DUJA 3H9JA 4O02B 5HM6A 2ZM6B 3WFZA 1F06A 3NYWA 4G9EA 4E4YA 3KOOA 4DBLE 1MW8X 3C8HA 2WAXA 2ERCA 4GMHA 2AH5A 2OOKA 1DC7A 2GDZA 3MERA 5IK2D 3V1LA 4L4UA 4QPCA 1UOQA 3EJWA 1UMKA 1ZK4A 1CRPA 4H77A 1A4XA 1G3IA 4DLUA 4I9HA 1C9KA 4QELA 4Y30A 3WISA 4KR2A 2G0NA 3LPLA 1UJMA 3RIEA 1XLWA 3I2GA 2WU3A 4U2BA 2IYRA 2ODAA 3IDOA 2D13A 1Z2NX 3NBFA 4QPPA 3FCUB 1UXHA 4FSXA 3JVVA 4HMOA 3WLRA 3INRA 3ISTA 1G5TA 2FHSA 5C4MA 2PT5A 3OLZA 5JSYA 1ENZA 1HRDA 2JGDB 1YU9A 3DF7A 3IEUA 4YUWA 2R3SA 4HWGA 4YONB 4JXXA 1B6RA 1VCOA 4ITUA 5ADHA 1RKVA 3VX4A 3VU8A 4JYBA 1TC1A 1CUEA 1RABA 2IPLA 5IWCA 3KO8A 2XBUA 1PK9A 4M8IA 5KWVA 3KT0A 4FSHA 2CDCA 3NM6B 1KO5A 2FJ0A 3PDIA 2EGGA 2YX1A 1JLRA 3NWBA 3WGHA 4TVSA 2JL1A 4GP9A 4EMUA 1BCRA 1HYBA 1YNOA 1Y4AE 1QIMA 4GMXA 4I08A 3X1YA 5AW8A 2GM5A 1RPTA 3JQRA 5DCYA 5JBIA 1QTIA 2W9XA 3LP6A 3RVOA 3QQPA 3UK7A 1SEVA 3FTNA 4OF4A 4FYYA 3QBEA 3T9EA 3K0CC 2OQIA 4PYNA 4QYIB 3ZG6A 1ZPDA 2WJIA 1Z33A 1L4NA 2B5OA 3GAAA 3WAKA 2OESA 4UTPA 2DF8A 3K1AB 3HKBA 1Y9JA 5G41A 4FMBB 3VR3A 3CPSA 1VJCA 1I13A 1X80B 4QEKA 1B0ZA 1RJFA 3UJPA 3DCJA 5FI0B 2O6HA 1G66A 2PZGA 2QAJA 2PMWB 4LVUA 2BLNA 1ZM2A 3BRQA 3DTVB 3RO7A 1BCSB 3NIFB 4ETWA 1HUQA 4DC1A 3PICA 4N54A 3GCXA 4JFRA 2ZAMA 2WIKA 4UXJA 5CUQA 2QLJA 4IUBS 1SAYA 4N65A 2C5AA 1BWSA 3ZV3A 1TJPB 1M8KA 2DUNA 2OCIA 1S89A 2H1VA 2V74B 1Q0ZA 3QW2A 2PR2A 4J7CA 3C1UA 4PYRA 4CCAA 5JAIA 5JU6A 4BNTA 3A9CA 5HX7A 2P5TB 4KU4A 1EX6A 2AFHE 4ICIA 2I22A 3HDHA 4WK0B 5G4LA 1OLXA 3TQFA 1ODSA 5EHZA 5JSFA 2GESA 1VL5A 2KM1A 1GSAA 2I99A 1TQ4A 5J2TF 4WZBE 1D4ZA 4IDBA 4YDSA 4E2XA 1EWVA 4MKRA 1PGNA 5WRFA 4MCJA 4LE0A 4L0QA 3D6FA 4FMCF 4UHJA 3LIIA 3RVSA 3AFGA 3GDFA 1IBRA 2A4MA 3JSXA 4KWIA 1BX1A 5E95A 4DLVA 2IBMA 4DMUB 2Y1LA 4WY2A 4G8BA 1SXJA 1VCMA 3O8RA 4D0LB 1G0NA 4GR5A 3OPYA 1YC5A 2RGUA 4LQ4A 5HZGA 2VR1A 3FBGA 4DCNA 3IDFA 4JHXA 1JDUA 2PZLA 1A1SA 1KEEB 4E51A 3FPLA 4BVBA 2VDVE 4YLGA 2YWCA 2N1BA 3LQKA 4MP6A 2K7FA 1FJHA 2EYUA 4NBWA 3ZU2A 1ZDMA 1MAHA 4RQTA 3TEFA 2ZRBA 4FNAA 3WMRA 3VPAA 3T34A 4LTDA 3U4QA 1GZ5A 3L84A 1OGJA 3I5XA 2W4QA 3RAJA 4ZT2A 3SKYA 5CDSA 3BHJA 3O9ZA 5CGZA 3OFVA 1AVTA 1PWYE 2XEDA 2FAXA 3V6MA 5BN3B 2HA2A 3ZGYA 4B3XA 2EU8A 1GPUA 2GZ1A 2VZ8A 4BQIA 3JVDA 3HCOA 3I76A 1IVNA 1ENYA 1W19A 4YRLA 5CT9A 2ETVA 4EYGA 2I34A 4PXAA 2JFBA 1ZJWA 2QD1A 1PJQA 3SXUB 2CZCA 1N8NA 4XJXA 5DW3A 3OX3A 1U9IA 2VK2A 3LXRA 4FU0A 2IHNA 3DM9B 3P9PA 3A6GA 2ZJ4A 1O94C 2NO9A 3TGWA 4YRJA 2ATCA 3JASA 4P31A 4QQKA 1QVWA 3RYCA 1Y3CE 3OEHD 2P2CA 2JK1A 4AO7A 1F38A 4I55B 3L4BC 3UJCA 1AUVA 4HQOA 1A7AA 1VI6A 3KSRA 1HG0A 1ATZA 1PTJA 1VMDA 1W1IA 1CS0A 1TA0A 3BTSA 1ZR2A 4DR6B 3CU5A 3EPKA 1W93A 4PICA 1NQWA 5E4TA 1CJUC 4D0RA 3FA2A 2D1QA 5FO0A 4L3VA 2ZRHA 4KZPA 3ZY6A 3LXXA 4B4VA 4LWQA 2RGCA 3MNFA 1AO0A 3EPJA 1TC2A 4KTVE 4KFTA 4MUFA 2V3CC 3QX9A 3TXYA 2G7MC 2C3OA 5AT1A 1UPCA 5ALWA 1O57A 3TLKA 4EM6A 4HMPA 4WLEA 1I3MA 2ORED 2Q1TA 1D0VA 3C43A 3I0NA 4FYPA 4DJDC 3BMQB 3MTGA 2EZ4A 2A9VA 2JHGA 3GUHA 1SEPA 3L8HA 3PQEA 4P33A 4AU1A 3T1QA 3JR7A 4EY4A 3ND5A 2IYZA 3MT9A 5AKYA 2VJYA 1X0VA 4RD2A 2YJTD 2B4RO 2GBPA 3IURA 4YAJA 5CAEB 4QU8A 4HUQB 4Z8YA 1QANA 1X42A 2BBTA 1XU9A 5DNCA 5LZ2A 1HDCA 2XCRB 3BHMA 1S8FA 4HB2A 3T3PB 3EG9B 5CXXA 3TOCA 3P94A 1U80A 4AQDA 2QA5A 3SWWA 1U6KA 3T9FA 3A6DA 3KOYA 2G76A 2VLBA 5AI4A 5AXCA 2CFSA 3GH1A 2BGJA 3N28A 2PT9A 3EEYA 2GKOA 2HN9A 3PUXA 2VQ3A 5CK4A 4KI7A 3SHQA 1YRWA 1OPRA 1PJAA 2I6QA 4PONA 5G1NA 3V6LA 3FOEC 3QPWA 1VJTA 1IXSB 2VFAA 1WUYA 3Q7TA 2IFTA 4M0LA 5F3RA 4C3ZA 2DETA 1MGOA 4I9UA 1SOAA 2H4FA 2VJLA 5E2IA 1RLIA 1VMIA 3H16A 3IVGA 2A7QA 2JASA 3IXQA 1XNJA 4A23A 4EDHA 4ARCA 1ACJA 2PL9A 1E5DA 1C1DB 4ZANA 2PXCA 3T3MB 4YPVA 4YWJA 1LX6A 2A0WA 4MR7B 3KUCA 1PFKA 5TE9A 4LDNA 3TLGA 5TLSA 3TEJA 4IM7A 1GDHA 2PBFA 3GT3A 4QXPA 3UMCA 3MJDA 5ICCA 2BMAA 2XYHA 2F67A 1CT9A 3OHMA 4GNKA 4CMGA 4J4TA 3WIEA 4X90A 3CURA 3IR7A 5EMJA 1T5SA 4A4DA 3HE3A 1SVLA 4JGBA 5DULA 4AJ9A 4CKCA 1W85A 2CCKA 1A2KC 1OZHA 1A50B 3WYDA 5F33A 4B7ZA 4F96A 5KTYA 3BL6A 4L0CA 4L76A 1QTNA 1TKRA 4RD6A 5FAKA 2H4WA 4UE6A 1MB3A 4FZRA 4HG2A 4WLNA 3TW0A 1QH0A 1YQTA 2DUUA 1R4NA 1YE3A 3NHJA 3CPJB 3OOYA 4ND4A 3SZRA 3MJVA 5LQDA 5JDCC 4D56A 1LI4A 1EX7A 2IXTA 2YV3A 1C0LA 3PD0A 4MVJP 3AEXA 4JJ8A 4I4TF 4FS3A 2QYHA 3PYXA 2QV0A 1B74A 4M8NE 1UAAA 5K8JB 4G37A 4X91A 3FGNA 3HNPA 2Y0BA 4RA6B 6AT1A 1JXMA 2CUZA 3KUKA 1SWVA 1E6WA 4E88A 4URVR 4KPGA 4CM9D 2H59A 5I47A 4ZO8A 3WGLA 2AI1A 4A0GA 4WESB 3LP8A 2DFTA 1T1JA 2JEYA 5BP7A 4LS3A 5IF9A 1RLJA 1S02A 2YHAA 4KLNA 3GI1A 3K32A 3B9QA 4TMKA 4A6DA 1VPLA 2NVUA 4OLAA 1QIEA 3M2TA 1DOAA 1MUUA 3FVQA 1ILWA 1LK7A 1TT5B 4JODA 4JGGA 1NMEA 1M2VB 1R8JA 1XJWA 3Q4GA 2R8YA 1K4KA 5FF9A 1LSJA 4XX1A 3N3AC 3VYUB 2Z56A 1QQAA 1YS1X 1ZD2P 3RUDA 2IYTA 1J1IA 2RHWA 1PLKA 3C5HA 3OPVA 2QOEA 4EG6A 3R6LA 3SIRA 1QAOA 1TEXA 1X7GA 4Y2SA 4ETMA 3FPJA 2HWYA 2VTBB 4FKBA 2FZ4A 1UMDA 2IPAB 1BXZA 3EHEA 3EIQA 2GZDA 3I9LA 2HRDA 3CEAA 4TRJA 3ZZUA 4W4TA 2Y1CA 4PAMA 1MOPA 1W4LA 2ZI4A 3D3NA 4MS4A 4CLOB 1KOFA 3IP6A 4PWYA 1M6VA 4NPHA 4B45A 4G8DA 4Q9JA 1EGAA 1EFKA 1IHDA 2NTVA 3EVDA 1M7HA 4YROA 5P8WA 1NMZA 2H2WA 3EAGA 3PPVA 2Q7DA 2ZVPX 2J5RA 2WFZA 1X3SA 1ABFA 5FR1A 1SG0A 5DH9A 3KEFA 4ZAXA 2BFCA 4CIAA 5AW9A 3MGCA 4DDWA 5A4KA 3TK1A 2Z04A 2QRKA 2OCDA 4MPRA 2ZPTX 1VSTA 2VRWA 4J3FA 3H13A 1NRJB 2BY4A 4DR1B 2QQGA 4LBZA 3AHEA 1Y7IA 2ZRDA 4HC4A 1DRVA 1P1IA 3A1FA 1ZS9A 3L6DA 2A9KA 2AFRA 1UJ5A 2QSYA 3PFHA 4D9FA 1RQRA 2NUPA 4ZVPA 1VC2A 3I4CA 2X0IA 3CVJA 2WIBA 1XAGA 5JE8A 1YS4A 5A2QA 3EQZA 5KNLA 1W0KD 2YIMA 4GI1A 4YMHA 5JC8A 4QO8A 2M6LA 2JAXA 4MTCA 2BZ1A 1LPMA 2XGOA 3D31A 2AOUB 2QRZA 1VA5A 5F9MA 3TAXA 3HRKA 3W3AD 4CMCA 5T4HA 4MARA 1X7XB 4Z9FA 1CPYA 4Z0TA 2RGWA 4NDNE 5DNDA 2J9GA 5A4IS 2WD7B 4O4LF 3IOYA 5FBVB 1OFTA 5L8VA 4TYQA 1K5GA 3GP5A 3HS3A 1Y1LA 1V8FA 1N5OX 4NDAA 3D0RA 1EE9A 4PCLA 1XJ5A 4M54A 1T8SA 5EP4A 3G2JA 4ZARA 1ORVA 3ZZTA 3QBTA 5AKZA 1KTIA 3IO3A 3Q5GA 2X5XA 2FUKA 1QAQA 3AIKA 1J7KA 2FNAA 4G5YA 5C34B 4KDCA 5FUXA 2L42A 1TIBA 1GYRA 1CUBA 2XUOA 1SC6A 3QFSA 1E3MA 2C3MA 2X0NA 4IVQA 4JDUA 4CLDA 1T9ZA 1U0OC 4HFNA 5I7VA 3GDOA 5KYUB 3QHQA 4YNBA 2Q1YA 3JQEA 1UP7A 1GQYA 4II3A 4RD4A 5TT0A 2XCLA 3P0EA 4YIKA 1RMTA 1L1EA 2YV5A 5AJHA 1Y6GA 3UW3A 5C1OA 4LUCA 4UM9B 1P19A 3FLAA 2RJNA 4W1RA 5C18A 3PD7A 1OIXA 4KNWA 3W4IA 4DDMA 2NYUA 1IN6A 4BU1A 4HNUA 5A1TA 1Z83A 2ZYHA 4ZOBA 3GW8A 3UK0A 3KFVA 2XB2A 1B00A 2WKPA 4WOPA 3R7BA 3NT5A 4QHTA 4XE5A 1AGYA 5FR2A 621PA 4UBKA 4V1CI 2CFRA 1KE2A 3A6ZA 4FD3A 1D2EA 4WQMA 3VKWA 1SULA 2OK7A 5JNSA 1CU1A 5KREA 3AKDA 3M4ZA 4RMNA 4JX8A 4RBNA 2XV1A 4IFTA 4RD3A 4U3JB 3DHNA 3LSYA 4F92B 1CIJA 4A8JA 3MAJA 3U4HA 4E6PA 3BK2A 1MFZA 1S2NA 3A06A 3KTAA 3SZUA 5M5BA 2HV9A 1IONA 1Z74A 1J22A 2J9FA 2P4UA 4WEQA 1WNTA 3DT9A 2XYPA 2HEGA 2JANA 2YMMA 1N1EA 1V0JA 3FE2A 4IIXA 5BOSB 3EN0A 1SBTA 1QPGA 3IILA 3ZN2A 2P9FA 3L6EA 3LUDA 2QZSA 4U7PB 3U26A 4KXVA 5FOQA 4H7DA 3EBPA 1GNRA 4UAGA 4MA0A 3U3OA 4N8DA 4C7MA 4IAOA 4YCBA 1TMKA 2HXYA 2CW5A 1TKBA 4E3ZA 1FUEA 3LWZA 3O2NA 4AKTA 5LA6F 1ORWA 2PX3A 3RWMB 3ETEA 4BNYA 3L7NA 3W1EA 1KVQA 4F2PA 2EZ8A 4BAZA 2PSSA 2D0IA 3PC7A 2BKLA 3ZDYB 4CF4A 2ODWA 3AILA 1K8ZB 5D86A 2O8FB 3WZ2A 4L8YA 1IG0A 3T99A 3KVNA 4F1WA 1RLUA 3GJ4A 4DLYA 2GN9A 2R2GA 4AX8A 5BNTA 5J5VA 3PUZA 3OT4A 3WSTA 2BE7A 1BS1A 2MINB 3E2IA 1KIAA 4M9XA 1QLWA 3PJDA 3R3VA 1F9AA 2FMXA 2BGMA 1VBKA 1U94A 3EXG1 3H5TA 3HBAA 1TA9A 3U9TA 2AW5A 1E5VA 3SSOA 4OU5A 2XZOA 5TMEA 3W6NA 3CXUA 4E3WA 1YV9A 2P9QA 1P29A 2FN3A 1MT0A 3WB1A 5JWOA 2OB1A 4I99A 4JC0A 1PNTA 4OB7A 1Y6RA 3DQPA 2FU5C 4UOEA 3IO5A 4WDQA 5IW8A 4CMIB 3E3OA 3SQXA 5T57A 2R2AA 2G9UA 1UBFA 1NW9B 2I62A 3B1KA 3MK31 2I78A 2P62A 1G20B 1FDOA 3DHVA 2OYRA 4MPDA 3D7KA 1C2YA 4H7HA 2NYAA 2XW6A 1OU4A 3F9CA 2AB0A 2FQQA 3U9LA 2CLEB 5C4IA 4DQXA 4WCFA 5B37A 3FCSB 4AT1A 2VEDA 3CX3A 3GUUA 4IUCS 3S0JA 4A3SA 1B14A 2CMHA 3I42A 2PPLA 2E37A 1A5TA 2BDTA 2V7VA 2XQGA 3O84A 2OO7A 1Y3DE 2OQ2A 3HBNA 3HB4X 4IFEA 4CETA 3K2IA 3WAGA 3D8RA 4HBGA 5FOVA 1DINA 3WJ2A 1T34A 1KO4A 4X1YA 2O2XA 2YJ4A 1S2GA 3C3XA 1WHSB 1NZFA 3I6QA 3ZWPA 4EGQA 4KHZA 5IDXA 3GLFE 3GH3A 4P4UA 1LK5A 4AP9A 4JK3A 1FFGA 1R15A 3E9CA 2XDQB 3G17A 1MXHA 3DAYA 1PWEA 3IPRA 3NGLA 2HHJA 3NVMB 4FLFA 3B20A 4R83A 1PJRA 3PEWA 3QV1A 3QBJA 4AZSA 2WV7A 3HP1A 3TQHA 1JUDA 4O1MA 1LKZA 4ID9A 3SEAA 1JL3A 1JI0A 3ASVA 4J1QA 4MZXA 3FM9A 3C1TA 5ALNA 3LHSA 2GEVA 5IUKC 2X3UA 1VSQA 4XGRA 3CW2A 2IH5A 2GFQA 4ZAWA 3DG9A 3KR2A 2RHMA 4OYYA 5LNK1 2J9ZB 1NWHA 4JYCA 5LIRA 2FYTA 1MR3F 3EFBA 2ADFA 3M9LA 3BPSA 3AZQA 1J24A 2BD0A 1IZ7A 1Y8CA 3B5JA 2PKRA 5HF6A 1Q17A 4XVQA 1NXWA 2PQ6A 2ANCA 4KODA 2ZE5A 2FMKA 1E3DA 3FSGD 3EVAA 4AO6A 2H0QA 2RH9B 3WICA 3BWEA 3GEHA 3SYMA 1SHKA 3PE4A 5EUBA 3IVAA 5H82A 2X2PA 4MWCA 4LI3X 5CDGA 1I6MA 4TQAA 2I8LA 2O2EA 5F9HA 2NV6A 3E05A 2ACWA 3I1FA 3MILA 3MT7A 3C4VA 1Z0AA 3N6RA 4Z9YA 4EHIA 3SCZA 1NUHA 1FW6A 4PRYA 1ODKA 3SQOA 2QT0A