4OATA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with isoleucine.
rcsb
source organism Anabaena variabilis
total genus 138
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oatA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oatA01
2WY2D 2FKAA 2VYCA 3Q7RA 4OLAA 3N53A 2FLKA 3SM9A 4P1ZA 4Z4CA 4RK4A 2IDMA 3NNDA 1JFTA 1W9HA 2IPMA 4WUTA 5PNTA 1DRKA 2FN8A 4RWEA 2HSGA 3H5TA 3OMXA 3LUCA 1QP0A 4ZMRA 2NZVG 2L18A 2JVJA 4RS3A 4UHJA 5DLEA 4KRFA 5IUJC 3OM0A 4WT7A 3QEMA 1M2EA 4LE0A 4MLCA 5C5EA 3LUFA 4G0ZA 5EWLA 3QK7A 5B3JC 1W25A 1C0EA 3EODA 4JAVC 5ED4A 2IKSA 4JOQA 2CD7A 2FEPA 3EQ2A 5IULC 2PAFA 4JB2A 2WJAA 4MRMB 3MQ4A 1JF8A 4O5AA 4Z99A 1PEAA 2FSPA 4DADA 4W5QA 5B3JA 3TO5A 3JVDA 2ID9A 3OM1A 4PYRA 3BRSA 1QP7A 3OLZA 2L19A 5FWXA 1U8TA 4P98A 4XLTA 3LMKA 1QMPA 2E4YA 1MB0A 4YO7A 4KREA 4RK0A 1USKA 2QSJA 3Q7SA 1JH9A 2CWDA 5IEBA 1SXIA 4F3TA 1M5TA 2YHBA 4Z4IA 2LP4Y 3HZHA 1XWWA 4KQCA 4MS4A 3C3KA 3LKBA 2XDYA 4W5NA 1LK0A 4OLBA 1NXOA 1TMYA 1KRXA 1B00A 1Z18A 3GT7A 1QO0D 2LUOA 4O1HA 4YRZA 3HDGA 3HK2A 3LUAA 5KWSA 3F7NA 3FGZA 4E7OA 4RK7A 3T8YA 2YHAA 2FQYA 8ABPA 2IPAB 4E7PA 3D8UA 3GYBA 4F11A 3OQOA 3RH0A 4YLEA 1SXGA 4F12A 5BR1A 1T34A 2E4XA 4Q7EA 3RVOA 3RVPA 3N0RA 2PJUA 3KS9A 3UK0A 5EWMB 1Z12A 2JVIA 1QKKA 4G0YA 4LRQA 3HO1A 2FTKE 5CNKA 1XHFA 1M2FA 2NT3A 2A9RA 2ID7A 4XARA 2JB9A 2NUBA 3SNKA 4L85A 1C4WA 5D2CA 2PMCA 5F64A 3VNBA 3H5OA 2VUHB 3KYIB 5CNMA 1VKRA 4MQFB 1NXTA 1ZAYA 3C97A 1E6LA 4JASB 4LE1A 4MR9A 3W9SA 1FSPA 1U04A 2PUBA 4DN6A 1D4ZA 4Z4GA 5KQGA 2GX6A 2AYZA 3LUJA 3HS3A 5TPWA 2H0AA 2F8TA 4Q6WA 5IX8A 5FBHA 3CTPA 1FQWA 1Y1LA 5DGCA 5TPZD 3GWGA 4JA2A 5EWJA 1ZVVA 4ZYLA 4DQDA 4NICA 1ABFA 1EFAA 2FMFA 3CFYA 1YTUA 1MAVA 4G0MA 5KC9A 5T7BA 4QICA 3QELB 4YWHA 3EGCA 4G0PA 2FLWA 1MIHA 3Q41A 4ETIA 4WXMA 5JNSA 1Z26A 3E3MA 4OBBA 4MR7A 2WWVD 4Z9BA 4OTZA 2QVGA 5E3JA 5GQSA 3EULA 1K66A 3HV2A 1MB3A 2JBAA 4H3HB 3HXMA 2NZUG 3M9WA 1YIOA 3T6KA 1RZRD 1ISRA 3I5AA 4QPJC 3BRQA 1JYEA 1LBIA 5JNWA 2IPNA 4QYMA 5T3YA 1JX6A 3GV0A 3MF4A 3QX9A 2MSKA 3KG2A 1RPJA 3HDVA 1Z15A 4IMJB 3T95A 4IRXA 4YP9A 1VRVA 4ML3A 1QQAA 1YS6A 4MS1A 1U2PA 3EDCA 4KPYA 1EWKA 3MIZA 3HEBA 2KYRA 3TB6A 4MRMA 1XHEA 3H1EA 1DCMA 4MPTA 3HSYA 4MQEA 4IMIB 2FEWB 5I4CA 3KHTA 9ABPA 1ZY2A 1Z25A 1ABEA 4Y9TA 2GWRA 1JHZA 2IYNA 3C3WA 1D1QA 3H5WA 3MA0A 4RKRA 1U2QA 3O1IC 5FWYA 3CS3A 1Z16A 2OENG 4XFKA 1YK1A 1PUXA 3QLUC 1TJYA 4LE2A 4XASA 4W5RA 3C6QA 2HQRA 2FMKA 2HQBA 4Z0NA 4XAQA 1CEYA 1EWTA 3IP6A 1URPA 3O2JA 5TQ0B 2RDMA 3KTOA 4EGSA 4YR7A 4PE5B 4JB0A 2X7XA 2PL9A 1A2OA 3HUUA 1YMUA 1GLGA 3CLKA 3QLUA 4G0QA 4G0XA 4N0QA 1I3CA 5TQ2B 3T38A 2FQXA 2MSWA 5CNIA 4OG2A 1DCKA 4JP1A 3CG0A 3LFTA 4MYRA 4D74A 1QP4A 2R4QA 4UHKA 5KI6A 1FFWA 3I45A 1BA2A 3Q9SA 2M1ZA 3OLVA 2R25B 3Q7TA 3L49A 2BGGA 4L4UA 3H6GA 1ISSA 1GCGA 2ZAYA 3M9XA 5KQMA 2QZJA 3OQMA 6CHYA 2CHFA 5EWLB 3DLHA 1NXWA 2WMYA 1D5WA 2QVCA 3IP9A 1QO0A 1JBEA 1DBWA 4KV7A 5HM6A 4MS3B 4ETMA 3FDFA 4QYWA 3JPYA 2E4ZA 4RK1A 3DLBA 3CZ5A 3SY8A 1TLFA 1A04A 1EWVA 1RXIA 3G85A 4RU1A 4RXUA 3LUKA 3DZDA 2FMIA 1DG9A 1DZ3A 1DC8A 1OXBB 2B1JA 1ZGGA 3RVNA 2FXIA 4EY3A 3KLNA 1MVOA 5IEJA 2FQWA 1P6UA 4GNRA 1JWLA 5FWXB 3OLYA 2PL1A 4S04A 2H3HA 2Q5CA 3GL9A 2E4WA 5TE9A 4W5OA 2PE5A 4Z4FA 2CHEA 3KJXA 4MGEA 5JNUA 1VPWA 3O21A 1KRWA 4MS4B 2L17A 1L5ZA 1BDIA 3CU5A 4RK6A 4MR8A 2QW1A 3E61A 3ILYA 3KSMA 3LUGA 4RZSA 5ABPA 1VLZA 4IILA 1RXEA 3LKVA 4HNRA 3O75A 2RJNA 4Q6BA 1JYFA 3EJWA 1L5YA 3ROFA 4CBVA 3GRCA 2QU7A 4FE4A 3TD9A 4GPAA 1DBPA 3O2SB 1GUDA 3NBMA 5IBQA 2MYPA 3A0UA 1JL3A 1PEYA 3JTEA 4G86A 1GUBA 2RGYA 1CHNA 4PICA 3O74A 5TPZA 3TX6A 3QLVC 1SXHA 4EYGA 4KMRA 4PZ0A 5CHYA 2J48A 2GBPA 3LUDA 3RVJA 4YCSA 4RXMA 2LBPA 1YK0A 3NNSA 4H60A 3HVRA 1Z13A 4G0OA 2L2QA 4O1IA 2VUIB 3C3MA 2HJ9A 1IIBA 2FN9A 3I42A 1F51E 4HNQA 3QLVA 1QQBA 3FFWA 5DKFA 1DRJA 1SRRA 3KKEA 2V0NA 5BRJA 3IPCA 5C5CA 3RVMA 4NCBA 4MR9B 4PEVA 4N47A 3O2QB 1D1PA 1BVHA 1JDPA 5HQJA 2PUAA 4NV3A 1BDJA 5IC5A 5IUNC 1ZDMA 3BREA 3DGEC 1DP4A 4IGAA 5TPWB 3BBLA 2OQRA 2IPLA 1Z17A 1DC7A 2DRIA 3L6UA 4N03A 4ZJPA 3HCWA 3EQZA 1TVMA 5EWJB 1FFGA 4TN5A 1ZGZA 3H1GA 1P6QA 3K9CA 3QEKA 4EYKA 1E6KA 2JK1A 3EAFA 3NHMA 1JFSA 1EAYA 2WRZA 2FEKA 3A0RB 3HJFA 2E4VA 4WWHA 1PNRA 4LX8A 3KCNA 1LJLA 3RVRA 3LTEA 3OO1A 1RNLA 4M88A 2N9UA 3O1HB 3JPWA 4MR7B 2PUGA 4YS6A 5CNJA 2PUEA 5JNTA 2JBAB 3P9YA 1OXKB 2JRLA 3O1JC 2M98A 4Z4EA 3H6HA 1DCFA 5IUKC 2PKXA 4KZKA 1USIA 4N41A 3OMWA 2A9OA 1EHCA 1NXVA 3SQNA 4D6XA 1USGA 1ZESA 3CG4A 3CRNA 3TMYA 1Z2DA 5DTEA 3RVLA 4NCAA 1DJMA 3B2NA 4HYEA 4RSMA 2W42A 4MS1B 4TMYA 1YMVA 4RY9A 4MS3A 3VNAA 4EYQA 2PUCA 3R0JA 3G1WA 3KYJB 3OLWA 1LJUA 2P9HA 3GBPA 1P2FA 1FFSA 1ZH2A 4FB4A 4N76A 4F8JA 3A3KA 4MQEB 5BQ3A 3CKMA 1JDNA 4G97A 3UUGA 4Z9AA 5EWMA 2FVYA 1M5UA 1GCAA 2MYUA 2TMYA 3QEMB 3NHZA 2F8SA 2NT4A 1Z2EA 1NATA 3ILHA 4TLMB 4S05A 4MLDA 5FWYB 1QPZA 1QNLA 1K68A 3FFTA 2A9PA 4LZLA 3RQIA 2JCGA 3KLOA 4MQFA 2RJOA 3RVKA 1UDRA 3SAJA 2PUDA 3FFXA 1NTRA 3K4HA 3N6VA 2B4AA 4KVFA 1APBA 3OO0A 4EVQA 4OATA 4WZZA 4XXHA 1HEYA 1S8NA 2O20A 3HM9A 3CZCA 4N0PA 1J56A 5GOTA 1JFVA 3DBIA 4LDAA 3UKJA 5KQPA 1WETA 4KQ9A 4EYOA 1DBQA 2HQOA 3RVQA 3IP7A 4KNYA 1P8AA 4IF4A 1KGSA 1BAPA 3QELA 1D2AA 2E4UA 2PLNA 3CNBA 4MAAA 3LOPA 3IP5A 4NQRA 5KC8A 4ZPJA 5HSGA 1AB5A 3GBVA 3JS5A 4D6YA 3GA5A 1AB6A 2P4UA 3A10A 2AYXA 1NXXA 4KFCA 3H1FA 4LDZA 4RY0A 1PHRA 2ZWMA 1LBHA 3F6CA 4EVRA 3F73A 3MYYA 1ZN2A 1BDHA 4EVSA 3NNNA 2JVKA 3JVIA 3OQNA 3URMA 5HKOA 3H5VA 3H5LA 3LUHA 4FE7A 3BILA 5BRAA 4KK3A 6ABPA 1R8JA 4TLLB 2IOYA 3F6PA 3N8IA 3FMVA 2WJWA 3CHYA 1ZHHA 4Z4HA 2QXYA 1NXSA 3M6MD 3D02A 5TQJA 5DCLA 2A9QA 4RKQA 1U0SY 4ETNA 1ZITA 2I6FA 1PNTA 4RY8A 1KMIY 4EUKA 5KQLA 3N75A 3Q15C 2MYTA 3MM4A 3JY6A 3OLXA 1F4VA 4YGXB 2MYNA 1E6MA 2HPHA 3N0WA 2FW0A 2LIVA 3N0XA 4KK4A 4F06A 3H5IA 1YS7A 3MMNA 3ROTA 3S99A 1RZRA 4MR8B 2PUFA 4HNSA 1JLKA 2QR3A 2LPMA 5JS2A 2VK2A 7ABPA 1CYEA 5JNVA 3SG0A 3RVSA 5JNRA 3I09A 4RK5A 4B09A 4RXTA 4WXEA 3DGFC 1H9CA 4RV5A 2R48A 5FBKA 3QLTA 2GKGA 3QX8A 1NXPA 2R47A 2FMHA 4H3KB 1YVUA 4RDCA 4YV7A 2GI4A 3IDOA 1E2BA 2WB4A 1A0OA 5TQ0A 3IPAA 5JS1A 3H75A 3HUTA 1TM2A 5TQ2A 1SD5A 1NY5A 1ZH4A 4ZMSA 2MSLA 2QV0A 4W5TA
chains in the Genus database with same CATH superfamily
4YV1A 3NKLA 4G37A 4TQGA 5C32A 2FRDA 2WWFA 3SM9A 2Q5IA 3QX3A 4D0SA 3KE8A 3SZ3A 4G24A 4P3OA 4L0DA 3TSOA 1PTJC 1E4VA 2KJQA 4H3SA 3F9CA 2FN8A 4JN6B 4F92B 5I8PA 3BXGA 4TS9A 1Q91A 2HIGA 2I7TA 4Y9DA 4B2LA 4C43A 1T29A 5LWQA 4QQ8A 1JXOA 3GHYA 4CM6A 3DL7A 2CJWA 2VUSA 3MMPA 1GQ2A 4FGUA 2NX2A 2ZUVA 5KVVA 1X1QA 3U61B 1USVA 4OUDA 3ITKA 1JVNA 3A2KA 1F3LA 1W25A 3PX7A 1ORVA 4IX9A 3QLEA 2G8LA 3QKRB 4E5SA 3SX2A 3WICA 4L16A 4JUFA 4PWZA 1HE4A 1Z35A 1PL8A 2QY6A 4RS4A 4RPHA 4JB2A 5ALEA 5E1DA 4HRVA 2ZYGA 4H27A 2PBRA 5G53C 1VLJA 2COUA 3IP8A 4I4IA 2O4CA 2IYSA 5LZ7A 4A0SA 5B4TA 4J1TA 2Z5GA 2OV6A 2Q0QA 5T57A 2VDWA 3T7EA 2AH5A 1Q44A 4HQKA 2I2FA 2CEKA 2CY0A 3EIUA 4L5JA 4G1FA 4RJJA 2EJBA 3PWKA 3BL5A 3EA0A 4HO1X 5A9SA 5F7OA 1KPHA 2JD2A 3RAGA 3OZWA 1F7UA 4GGMX 3W6NA 4RK0A 4HAOA 3QVXA 4NENB 1JH9A 5EHNA 2RK3A 1JVSA 1BN6A 1I14A 2MTBA 5FO1A 2WVJA 4B43A 4KLNA 5EYPB 1C4OA 4URHA 5DNUA 1O4WA 2BGMA 1KKMA 3RUIA 4B47A 2ZS9A 4DBZA 4F3KA 4Q1DA 1NBOA 2IY8A 1P17A 3G17A 3MSXA 5HHTA 1B00A 3K9GA 3C70A 2RKBA 1ODFA 4BX0A 3NC4A 1IU9A 1JEAA 1LSOA 1NSYA 3K09C 4AS3A 1LDEA 3ZTYA 4FHCA 4R9NA 2G4VA 2V5AA 1KDYA 4DRXA 3I01A 1IM8A 3LG2A 2PWPA 4IR7A 2DHEA 3JQ8B 4UEWA 3DZBA 4J7UA 4E7PA 1IK6A 2IZ5A 3N87A 3K5PA 1FC0A 5F21A 2H85A 4PRYA 1Z0ZA 1NUTA 2I33A 2O8EB 4XEUA 2DG2A 3TEFA 4NCIA 3V33A 4C01A 4QULA 2H51A 5BYJA 2PGNA 5HX7A 1ZD9A 1RYFA 2CVZA 1M8PA 2I6QA 2JVIA 4HUQB 1G8MA 4W5JA 2XIJA 5B7PA 2WB2A 1OV6A 1R3DA 3N74A 1DU4A 3BWMA 5CDHA 3X1ZA 4P2GA 1E3LA 1M2FA 4O2LA 2CNLA 2VCEA 3E9QA 1L5HA 1MO2A 4LZOA 3SOZA 4NQZA 1FTGA 2V45A 2IZ0A 2GAJA 2VPWA 3E2MA 2XT9A 3UOGA 1ZD4A 1ZOOA 1WE2A 1D2GA 3SI7A 4O25A 4QOIA 2VDJA 1Z56C 2EHDA 1OGJA 3U3DA 1DV2A 1U04A 1CJTC 3L0BA 3LHIA 2OZLB 5EJ9A 1VSVA 2XT6A 4KIJA 3C5VA 3U19A 3MHTA 4Q4JB 2IF2A 2W6QA 4LZJA 4B48A 1LV8A 3PI6A 4EHAA 1M76A 2XF2A 2IBSA 3E7WA 1BGWA 2VJPA 3FFBA 4J8PA 2NZ2A 1JE0A 4LZAA 4NICA 3BAZA 4BTEA 3CLUC 1P4RA 4AN1A 2V4ZA 4CL2A 2X6RA 2OV1A 3PGA1 3H11B 2D8MA 2QVXX 1Y8QB 1T0HB 2VDPB 1JPJA 4OB7A 3IAM1 4ZOLB 4LBZA 5KSOA 1AUOA 2CDBA 2G36A 3FLMA 4QDKA 1B74A 1E8MA 4O2AB 2WT8A 1UBNA 3CY6A 2NZUG 1C5KA 1DIOB 3B5IA 3R5KA 4FHZA 4Q16A 3KWMA 3U1VA 4GI1A 4QPJC 3UJBA 3TFOA 4Q7KA 5E3IA 3O38A 4QOSA 3H4MA 1JX6A 4F9EA 1RJWA 1JIJA 3DBOB 3R4CA 2UVDA 3IXMA 3PITA 4RCZA 1V37A 3PNLA 4BNDB 3I0ZA 4FGWA 5J4KA 3L1KA 2VDNB 2AF4C 2KYRA 1K0UA 3PIDA 2E37A 2XDQB 1ZBDA 3LS2A 5IZCC 4KCGA 1J22A 5KYWB 4C06A 4RO0A 1ODTC 4IMIB 4YRFA 1U94A 1GSHA 4N82A 1KAHA 1JNYA 3B9RA 3LO5A 3LPMA 5TB5A 1ZY2A 3L8HA 4CLRA 3I52A 1C80A 1R6TA 4B8YA 1M2NA 2GWRA 2QLLA 3SJBA 3WJAA 4CVNA 4RPJA 4X7MA 3WLSA 1JALA 4FSXA 4LXXA 2BN4A 4IH4A 4YGYA 4AJEA 4NEGA 3AI7A 1NONA 2WSSD 1GDHA 2YIMA 3DDCA 4AZSA 1TGVA 4FT2A 2WKWA 2XT0A 4JNCA 3ZCQA 2Y0EA 1KJIA 2QMQA 3I73A 3FMOB 3G9UA 1P1BA 3V80A 4BCCA 4DSUA 3C6QA 4HT3B 8ATCA 2R00C 2QLNA 3K73O 4B0OA 1Y7LA 4JOCA 2CV2A 4DV7B 2NVOA 2LWIA 3O4VA 4QRDA 4TX1A 2OO7A 1HDZA 4LMPA 2Q6VA 4EGSA 1W87A 2J3DA 4GBED 4LJ8A 1KEPA 1P31A 2DERA 4PBSA 2HDOA 5EC8A 3T38A 1RP1A 3CGWA 2VWQA 1U9YA 4GM0A 2G83A 2DWOA 2EJUA 4HB4A 4PSKA 5KYUB 1CHDA 4Q02A 3LQ4A 3PA8A 5FUMA 1HDGO 1T9GS 3OUTA 1MXFA 3SVLA 3A6DA 3IMGA 4D1YA 4C7OB 2ZSEA 5JJLA 1Z88A 4U7PB 2M1ZA 1B2RA 1EUDB 1GUAA 1NQTA 1SPBS 3PFFA 1INLA 2Z2YA 1QHNA 3MUFA 1YB6A 2AHOA 3H6GA 2PL5A 5AUOB 1PJAA 5DT2A 5F5LA 5LCXA 3UXEA 2OXRA 1CR6A 1E0SA 1ENPA 1OFTA 2FZ5A 2QVCA 2XCUA 3JQ7A 3VOTA 5AM0A 2PQ2A 1EWRA 2RGCA 3O82A 1WUKS 5AKEA 2W00A 4ETMA 1P7YA 5KX5B 4JLBA 4M0CA 4X24A 2PZKA 3BJZA 3HL0A 3EZ6A 4MQBA 2O4UX 4X60A 2G6BA 1R18A 2B99A 3WY9A 4I1IA 2Q50A 4IDCA 5HPYB 1RXIA 2QD5A 1H2WA 1CR4A 4X95A 3MB5A 2PNJA 3UTCA 3G9XA 1QHSA 3LY9A 4N6GA 1CUYA 2AX4A 2GOYA 1SXJA 1PZHA 1ZXLA 3M1LA 2NZYA 4ND3A 1RKUA 2A3NA 1U1DA 4UXIA 3H05A 4ZMRA 1JW9B 2PRSA 1MA3A 4DJAA 1Q7CA 3EVDA 3PUYA 2QE7D 2HLDD 3GFGA 4I9UA 1OC2A 3FYUA 1Q1ZA 2BKEA 2XE6A 1NVFA 3C5WP 3EXIB 1XNRB 3WO1A 5BW5A 1NVVR 1XCLA 3EZLA 5AW5A 3WZMA 3OF2A 1DBVO 2ALJA 3ZKWA 4QJIA 4A3SA 1YQXA 3QFSA 3RASA 2LIPA 3URKA 2GN4A 1U3VA 4MR8A 5FTLA 2NGRA 5DLQC 5ALKA 3ZLJA 2FRXA 1QPGA 1FUYB 2REXB 4YFYA 5HIKA 4QM7A 3H4IA 1X8XA 5ENDA 2YWBA 2RJNA 1XFAA 3CPSA 1H2EA 4WJLA 4P7GA 2ZQZA 5C4IA 5TLSA 5JDIC 3CX6A 1VMEA 2W0SA 3TZBA 3SEQA 1ACLA 1XCOA 4GPAA 5DE3A 3R7AA 4EW3A 3ABOB 3M9LA 4KQJA 3ESQA 3PNQA 1SC1A 2HADA 2WPDA 3O74A 1P61B 1CU1A 2MWMA 3ACBA 1HSOA 3N6XA 3QLVC 4X1YA 2R2GA 4PZ0A 4YP0A 5EZ5A 4YAJA 3RYFB 3EGDB 5KTSA 2GCOA 1UT6A 3EVTA 1J2TA 4HEHA 1P4SA 1YK0A 5TDHA 3BRWA 1GAQA 2R6CA 2YFKA 3PHCA 2VWGA 5CCXA 2PQMA 1NURA 4DLSA 4K9LA 1P45A 1XCBA 1JQKA 3AR3A 4H16A 4ME6A 1YCHA 1IJBA 1PDWA 3JYOA 3HDTA 3FFWA 2C9CA 4EA6A 1N2EA 4NZOA 4OLHA 2NIPA 3FX2A 1HQDA 3GGSA 3P5BA 4FI3F 4X41A 1S8FA 5B37A 4EEZA 2FOIA 4RIIA 4JKYA 4EGJA 1U1GA 1KNXA 4PEVA 3ECAA 4UD2A 4Y1FA 3ZDZB 1AM4D 1Z0DA 1XKLA 2H16A 4HAYA 2OWEA 4XTRA 3U4GA 3FTDA 3LXMA 2W4IA 2WR8A 4I9GA 4UVEA 3TVDA 3UK7A 1WXIA 2BM0A 2OQRA 3GELA 1KJ9A 1RMQA 2I7VA 2VNAA 1MRZA 3BZWA 3L8GA 4H7KA 4PRLA 4TTSA 3SYRA 1C7ZA 1Y3IA 4PZ9A 4ALIA 5C53B 4LXGA 2PSFA 2FY8A 1ZR2A 4JMLA 3ASVA 2D1RA 5J3JA 3D31A 5K0LA 3RIGA 2WFZA 3VO1A 1JSLA 2EEZA 4W9MC 1JFSA 1LV7A 3GR6A 3W7BA 4X92A 3U9TA 3DMHA 4JGIA 2C4VA 3EFOB 1LPOA 4JA0A 4Q34A 2RAPA 4PLHA 3NC0C 4F7WA 2ENUA 2HPVA 4QLBA 2GJ8A 4RFSA 3NDRA 2JBAB 4O1MA 4C30A 1CK4A 2JS7A 5HJ2A 3TF5A 1OIXA 4PZUA 4Z3OA 1IM2A 2G9RA 5ADWA 1F7VA 3GLFE 1DCFA 3DCYA 4M53A 3CH7A 1GQOA 3AEUA 3TFQA 1RP7A 5AHOA 1USIA 4CKEA 3SZOA 3GA0A 4OA8A 2A9OA 2F59A 5F2KA 4DNQA 4YJKA 4B4DA 1ZMRA 1XKTA 3AIIA 2D00A 3P19A 3R6TA 4LDRA 5EVCA 3JQRA 4L3OA 5DLDA 3RFFA 4EEXA 4J0IA 5IS2A 4QNMA 1AKNA 4AO6A 3F7OA 3QUBA 5LLDA 3DQZA 2VHEA 4YMWA 3RS8A 1E63A 4YRCA 2GM5A 4MKXA 2QZ9A 3NHPA 4EHJA 5ULLA 5IVKA 3KD3A 3RSOA 3M83A 1EFHA 1H2RS 1Z6XA 2ZRKA 4N0DA 5CBPB 1JKFA 4Z9AA 4YDQA 2NZWA 3V6MA 3K05A 5BV7A 1IZ8A 4NZPA 1UP7A 4HDSB 3KVNA 2G1PA 1QYDA 3HC7A 1NLZA 2PRJA 3D1LA 2YW2A 2B8EA 1TT7A 3H7IA 3N3BC 5FUBA 2JCBA 3QLJA 4ZDWA 3DMDA 5IYZA 1GN8A 3H2HA 1ZL0A 2FZVA 2J7KA 3NX4A 5AM5A 1DOZA 5H80A 2ADMA 4FOPA 3SDBA 1Y63A 2ZETA 1HYBA 2Z43A 2VF2A 4ZA2A 4N18A 4OHPA 4DDHA 3WIBA 2EKQA 5KYXA 5IYZF 4KRXA 1PW7A 1VCNA 4IKPA 2HD4A 3HA5A 3Q6IA 1JHAA 4P38A 3U4HA 3OZ7A 1ULSA 1MORA 2H9AA 4FWBA 3FSRA 5L4SA 5BUSA 3I9V6 3Q0IA 4IGKA 3HKDB 4DJ5X 3QPWA 2Z4RA 4M9RA 4TQ9A 3A3OA 1CRPA 1M9NA 4M7WA 1NW9B 1KK3A 2VA9A 1F6BA 3VMMA 2KLBA 3M49A 3ZGXA 4MPPA 5TIIA 2GLTA 3RGGA 1PEDA 2O3UA 4CQNA 5KWJA 3AH8A 1ZG3A 1OGIA 1Q1NA 4G5RA 4OGKA 1C3OB 1SVUA 3NZEA 3IP5A 5A2GA 1L7EA 2DT5A 1D8AA 2J5QA 3MAJA 4RLSA 4KP7A 1X7ZA 3ZYZA 5IC4A 3JS5A 5EY5B 3GA5A 1DELA 1S2MA 5ICGA 2RGGA 5DSZA 5JXJA 3DXYA 1NXXA 3OCZA 1XTZA 1L1QA 4X20A 4EPTA 4Q9HA 5CJPA 3CPEA 3U4MA 2JIMA 1U2GC 3TXAA 3LH5A 5THQA 2G4LA 3PRHA 1IN4A 1MF7A 2JFWA 2CBZA 1YL7A 3U7QA 3ENZA 3RHZA 1H1TA 2QIOA 3GB9A 3LUHA 3O84A 3GJ0A 2VH5R 3SQLA 2X2EA 4KE9A 4PGHA 1W0KA 5KNCD 1V6SA 1BFUA 4DJJA 2OGWA 4GLBA 4K9OA 1JSRA 1CF9A 1VYTA 3OMLA 1KIAA 1XEFA 3OOHA 1UJBA 4I3FA 2WJGA 5EQTA 1H85A 3ADKA 1L5KA 3KUCA 3ZWVA 4EPXA 5CXQA 3AF4A 2FWNA 3QVOA 3T1YB 2Q5QA 2Y67A 1NNI1 3V8PA 5E8RA 2NO6A 4L8YA 4BVKA 5BN5B 2G9UA 3Q15C 1I80A 3KZCA 4IAOA 1F4VA 3L06A 2JFBA 2HPHA 1XDBA 2COEA 2IP1A 4IDFA 4FFOA 3CURA 4J0KA 4LV8B 1DAGA 1GYQA 4FEAA 2YV3A 3LPNA 1E66A 1L7BA 1TMKA 1HLGA 3PPVA 4GYYA 4JCOA 2AVNA 4YPFA 4NOLA 4UU0A 3AL3A 1T2UA 3OSUA 3V7UA 5IXSA 3EPLA 5JNVA 3I5XA 1F3OA 4FFBB 1I1NA 4YROA 4J4HA 1BRMA 3IOBA 4KXFB 4Q1AA 5JJIA 3QU5A 5KDOA 2V98A 4P82A 5CW1A 5K5EA 1DC4A 3E5HA 3QG1A 1NXPA 1LQ2A 1UDBA 1YVUA 1NDUA 4LTMA 2RGNA 3S2IA 1RHJA 2GI4A 3HNOA 3M6XA 3N8KA 4OFZA 1JR6A 4WSOA 1DKPA 4TL8A 4C07A 4N54A 1FY2A 2CJPA 2YWDA 4M1QA 1QQTA 3T7AA 5FNVB 3PPXA 3T9AA 2EZ9A 4TV8F 3AR9A 4KHZA 5G4KB 3V1LA 5JAPA 3PC4A 5LWHA 1BE6A 5DHQA 1RCFA 4OLAA 5HIIA 4RA6A 2W2QA 4KAFA 4P1ZA 4HAUA 2TSYB 4RYLA 4Z4CA 3SBXA 3JSAA 4EB3A 4WZBE 1QZXA 1JWBB 3OCJA 4ARZB 1DAMA 2BDUA 2PT5A 3WLLA 4HH4A 4YJ2B 2D7DA 2NZVG 3F8TA 1A71A 2CFOA 1IBCA 1V7QA 2EIXA 3HQ4O 3JQAD 3L4SO 4RS3A 4ZCSA 4ER5A 3ZUPA 1EFRD 1EVKA 2AFIA 4D44A 4YAUA 2OYSA 3CWQA 3UYLA 1VIMA 1D7AA 3OIDA 4UBKA 2QAGC 1BH2A 3LUFA 3Q2IA 1NP6A 4OAOA 1T6XA 3AZPA 4EJ2A 4DSNA 5LJIA 3QVVA 2OO5A 1AXEA 1CEQA 1KEUA 2Z9DA 4JAVC 4I55A 1A82A 3BFVA 4Z1MD 3ZE0B 1QDUA 2WIFA 1CUFA 1NN5A 4HDKA 2ZJFA 1JZQA 4LC0A 6PFKA 2P5TB 2X22A 4MRMB 1IAVA 5AIBA 3MQ4A 1WUJS 4FWIB 4I55F 3KHKA 1FUUA 4HCJA 5JALA 1LC0A 4GX5A 3HBAA 5JVDB 1BCSA 4EA8A 2TECE 3HSKA 5REQB 3BULA 1QP7A 4DGSA 1HYHA 1O94D 1QRDA 2L42A 4BO7A 4RM3A 3RHFA 4EFMA 2C4KA 3EWAA 2X0DA 4XUEA 1Y9AA 3D54D 3QVTA 4FFNA 4HDMB 3SSOA 1YB4A 1YH3A 1WHSA 1N5DA 4M37A 1XEXA 1W5BA 4JXJA 4JJEA 1EGVB 1KQNA 2GJ9A 3PT5A 1U0RA 3QP9A 4ENWA 4ZVUA 5JCZA 4AL4A 2VQSA 3TGLA 2QKYA 1E6WA 1EIWA 2HDNB 1EPUA 4CW7A 4JVLA 1E2LA 3FGOA 1WY7A 5CFLA 3MOGA 4ZP1A 3L6CA 5I8ZA 3SYTA 1SUCA 4B8ZA 2RB4A 3BL6A 4MP6A 2GASA 5FPPA 4R71A 3ZVLA 2QX8A 1E3TA 1ZMXA 1Z7WA 3VDMA 3HDGA 4I1OA 3T7TA 3SC3A 2XA2A 4HLUA 4AUEA 5BWCA 1BX3A 1AZWA 3ROZA 1BQEA 2GFHA 2G9VA 3THYB 1HYQA 3NXKA 1WMEA 3BF7A 4W8HA 3T8YA 1V11A 1IN5A 4Z0TA 3ZEIA 4ZI2A 1UPCA 2QQFA 3IELA 6YASA 1TA4A 2QVYX 5DOVA 5FPHA 1WW3A 1O03A 2FUCA 3WHPA 3C6MA 5A4KA 5J40A 3UK0A 3DKRA 1DZIA 2EG9A 3AJDA 3KD2A 3HKEA 5EWMB 1ZSVA 3WYNA 4C7MA 4CYMA 4CTNA 1KVTA 2HNBA 5CNKA 1ENYA 1KYWA 4FDAA 4IHJF 1BDMA 3DC7A 1K89A 1U2ZA 2AWOA 1VCIA 3OX4A 3SF0A 2JD0A 2NT3A 3EVEA 4XARA 4DA6A 2XGJA 2AB0A 1XNGA 5K6RA 3KPVA 1YC2A 4O4HB 4CIBA 1GGEA 3OZVA 2G5TA 1TL7C 1O5IA 2Z3WA 3HEMA 1N6PA 4HB3A 3EXG1 2IUSA 1VMDA 4B73A 1NYQA 4JYZA 3IKJA 3COWA 4D9GA 1LUAA 1NE2A 1V8OA 3OIGA 4NE7A 3SXJA 5C18A 4RH1A 2VJNA 2AYZA 4EG6A 1Q20A 2QJWA 3E8SA 1XVLA 3LYAA 4P4TA 3Q98A 1QIKA 1IHXA 4HQFA 1PZFA 1PYDA 1U3UA 2B0JA 1FQWA 1O96A 2MINB 3EXFB 2HHCA 3GJSA 4U3JB 5DF1A 4A0RA 3MEQA 4ZYLA 3ZWCA 2HMAA 4TTRA 4WZAE 3JW8A 5KS2A 1P73A 3ILXA 4JH0A 4K9PA 1TU3A 2V0GA 4YWHA 4C89A 4NSNA 4FYXA 1WXHA 1VMAA 5HRAA 3D2AA 3OF3A 2P90A 5HKAA 2BM9A 3Q41A 1E96A 2F1OA 2VTBB 4ZTZB 4FGJA 2QL6A 4D26A 3E3MA 4ZODA 3UWKA 4EEKA 3C4JA 2NTJA 1X1BA 4D3SA 2OXFA 1GZ3A 4C4TA 2XXAA 4FLEA 3MJDA 2C5AA 2X86A 5F4BA 3ZLUA 1YRHA 4RKEA 4GI5A 4WNAA 3TQFA 4BX8A 5KSYA 1NW5A 1VG0B 1Z38A 5C1IA 1QYXA 3P32A 3TNDA 2SCUA 3FSGA 5JZ9A 1QC5B 1CERA 1U80A 4TXNA 5CDFA 2IPNA 1Z8NA 2O5CA 4MSUA 4EB6B 2GQ0A 3JZDA 2EKPA 3QX9A 4NNPA 3UK2A 2G5PA 1ODIA 2W6IA 2C2ZA 4OSOA 1QQAA 1H2YA 1UDXA 5AI0A 1H3NA 2QD2A 4DVGA 3LX4A 5LQCA 2H00A 1LS6A 3WK9A 1XZBA 2CCGA 2VK8A 1IBSA 2ZBDA 2HRBA 4KYUA 1EGQA 5EMHA 2A1IA 1T5TA 3RTCA 4PY2A 4CMIA 4F72A 1BNCA 5KQRA 3TE7A 2VHCA 3W6PA 3OOJA 1RM0A 3WX0A 4AMGA 3KKKA 1NHWA 3ORQA 4NU6A 1SCQA 5I45A 2LGJA 1Z5OA 2QL9A 1RAFA 1ID1A 3HYNA 3E1KA 2I6UA 3DDWA 5FWYA 1EUYA 1RRPA 4XFKA 1T5LA 2F3TA 2WICA 3F49S 2GETA 3WLKX 4I5GA 3IOMA 1E0DA 2AHRA 4FYMA 1JLRA 4WBSA 3OE5A 4S24A 4HWRA 2YJGA 3HXKA 1VE5A 3QVLA 3WV5A 3SQXA 5F78A 4ZI3A 4IV5A 2PX0A 4K46A 1KPGA 3KTOA 1R0CA 3KR2A 4FS3A 1U02A 4K2HA 4YR7A 4B7UA 1UDWA 3GLGA 2P91A 2XXJA 1W4CA 3AK4A 3I0MA 2XHZA 1ZH0A 1S1MA 4N0QA 3ANLA 4UNSA 1PL7A 4M21A 1N2HA 2MSWA 3HCNA 1G20B 3KJQA 1L3BA 2ETVA 2NAPA 4ZV7A 5TGTA 3SD7A 1W88B 3SS8A 2ZYUX 3GCXA 4B33A 1FFWA 5AVYA 4AJJA 4QOGA 4WGFA 2XI4A 4RTSA 3NRBA 1H3EA 2B4QA 3QWAA 2R68A 1OXSC 1PGPA 1QQ5A 2JLBA 2VHJA 3N2IA 3SNHA 1QRUA 3K92A 3VKWA 1TAQA 3DHWC 2FP4B 1NSFA 2WM3A 4P92A 3EA5A 1QLJA 3TDMA 4OK3A 2HV8A 2H63A 2ZI3A 3SGLA 4WXRA 2WMYA 1YCDA 4YPVA 2DHDA 4D9BA 4D3YA 3RBZA 1P2SA 1M6YA 1PZEA 3A7EA 3MQ2A 4N12A 3BWDD 4N7BA 5IBPA 3RJMA 3QE3A 5C4GB 4DXHA 1KJWA 1XA4A 3VPHA 2BGTA 4D3XA 3AEXA 4A23A 3KPYA 4GR9A 4NAVA 2BDEA 2WAOA 2HRCA 1O9BA 4DCTA 5C7YA 5J43A 1HX7A 1P81A 5CJ2A 3L8EA 3QVGB 5FIUA 2WJYA 2OBXA 1O5OA 2Q4BA 3MD0A 4V0ME 1UPXA 1TTQB 3AUSA 2QT9A 1MVOA 3HNPA 1O6BA 2I80A 2E9SA 4FHGA 3OLYA 1K4MA 4PCUA 1VJ0A 5BP7A 3GFSA 3ASZA 3GK3A 4N5IX 3GO4A 1SG6A 3GGOA 2K87A 3LT2A 3N07A 2UXCB 2ST1A 5FCDA 4J2OA 4EYGA 3RT7A 1DB3A 2I7XA 3BIFA 4IX1A 2X7HA 5IBRA 4FDVA 2ANBA 5LYYA 4PVCA 2PGAA 1M0TA 2I2BA 4ER3A 3IEIA 1J90A 3AFMA 1VLZA 4IILA 1L8QA 3FVRA 3IXQA 4INZA 1AUPA 3RABA 5BMVB 4UAGA 1Q1GA 1AO0A 2QPLA 4Q6BA 2WM8A 5K3BA 1JYFA 3ESRA 4EHHA 1L5YA 2XGOA 1VLVA 2A5DA 4NAHA 3RUCA 5MF6A 4R2WA 4X5OA 1JIXA 4C0BA 1PUJA 3RADC 2QBYA 3M81A 3PEYA 2ASEA 1R88A 1N3YA 1RPNA 3O2SB 5AKXA 5KNBD 3UIEA 2QMUA 3FBWA 3ESCA 4RNDB 4YCBA 2H2HA 2RGYA 3BD7A 3VR4H 5ERYA 2JHPA 4FXOA 3WIOA 4YVFA 1ZCBA 2QUJA 3B5JA 3S1AB 4YQZA 1O2DA 4A2PA 4D0LB 4Q93A 4MUEA 3RVJA 3SJUA 2BUAA 4L8LA 2RG7A 4G0OA 1R5BA 4NF2A 1PLLA 3AJAA 2XX3A 3X1MA 4TZKA 4UNQA 2HJ9A 2EW2A 1IIBA 1FS5A 3BQ9A 3JQ9A 5CYFA 5I5GA 2CJFA 1VBKA 3ITNA 4E4RA 1XDDA 5A3VA 2N47A 4BB9A 4KXLA 3U7HB 3AYXB 2WYVA 4DG9A 1HFWA 2WD7A 4HPXB 4RVSA 2PLAA 2CSXA 2FCRA 2HU7A 2GVDC 1YZGA 4XI9A 1SULA 1L8OA 1U6IA 3DW1X 1MAAA 4FMPA 5ARDA 3ZWPA 5LM3A 5IC5A 5DYTA 1O89A 1RE0A 1SHUX 4IGAA 3B1YA 4LF9B 4DIDA 1U0LA 3CTMA 1RJGA 3A28A 4ZT3A 3DHVA 3IPLA 3L6UA 2Z2IA 1U81A 4KE8A 4KKXB 4LDPA 4CLEA 2QU8A 4HK4A 1PVVA 3LX8A 3ONFA 2WQ6A 1SKQA 3GYGA 5JI3E 1FQOA 2XYGA 3PQFA 1G6KA 4D8TA 2FEKA 4LX0A 4AKEA 1LJLA 3L77A 4H7FA 2O3TA 4J2HA 2VDRB 4B85A 2I2DA 3R7SA 2IS6A 2C42A 2PA0A 4AWAA 1PD0A 4IHQA 5CNJA 3VBEA 2A57A 3IKVA 2G09A 4EI8A 3A04A 3HFSA 1IZYA 1KBZA 2PV0A 1FNDA 4CWAA 1OXKB 4P3PA 1NG9A 3IO5A 4IUDS 1YUMA 3IEKA 2AS0A 3M3HA 5ALDA 3VYUB 3RKSA 3H6HA 2Y1CA 3KTFA 4DCVA 2C98A 3KLMX 5EXTA 2JATA 2HW8A 2IQ5A 3X43A 4PLTA 2AC7A 4HSEA 4YRDA 2P2DA 5JSYA 2R4TA 1UBEA 3TMYA 3ZHBA 3W1VA 4ERXA 1DWPA 4NOKA 4P0QB 3NVKI 4JFRA 5FTJA 3I2HA 3U48A 4MS1B 2P2ZA 2KE5A 3AF1A 4MS3A 1RLOA 3DEKA 3R0JA 4RIEA 4DMGA 4HLQB 3PNMA 1XL0A 1NBEA 3GOQA 2PWYA 4BNUA 2CHGA 2LE0A 1EK2A 2GFQA 2JGJA 2V55B 3GPDG 3ZOZA 1OF1A 4G97A 1T43A 1FXUA 1ZIXA 4IHAA 5EIBD 4OFXA 4LHSA 1LWNA 4I8IA 5ADUS 2XVXA 4AZ0A 3B60A 4TWIA 5BNWA 4U02A 5CA1F 1XZNA 3CV3A 2F8SA 2EBHX 1KY2A 3AY6A 3GJRA 4OMUA 4H6WA 1T2VA 4MLDA 3HYRA 4OREX 4PO1A 1PZMA 2FF7A 1R0SA 4JU9A 4WJZA 1O57A 3FFTA 3WC4A 3O9VA 1G21B 2J6IA 3AF2A 2GRAA 3DPSA 3S5UA 4TYNA 3THWA 1Q57A 2HU5A 3SU8A 2PA3A 4TTPA 3FFXA 3WIVA 1MOZA 3BHNA 1IONA 4IJ6A 4Y6SA 5HIJA 5GPBA 5LQKA 3S2UA 5JXHA 3LBFA 4LNUA 4R8KA 4K1XA 3R8CA 3ZX5A 2Q3FA 2ZJ4A 4BO4A 1J56A 1N9ZA 4LHEA 1K9SA 2H92A 2NUAB 3VZCA 4Q7LA 3QWFA 5BQFA 1ECLA 2GHRA 1V1RB 2EZ8A 3HJTA 4GOJA 4KQ9A 3UXMA 1CY7A 4X65B 3KSUA 3PDUA 4UREA 2H0RA 2ADFA 2I9KA 3PFBA 4Q4HB 4FP9A 2BGLA 1QAOA 3P0FA 1TUBB 4TYMA 3ZWXA 3KXKA 5F2NA 2ZWAA 1QH0A 3D6FA 3L8MA 2PVCA 2AMVA 3LZDA 4ZU1X 2O2ZA 1SOWA 2WOOA 4JXXA 3EQ9A 1N5RA 2J9YB 2X13A 3UAGA 5L7WA 4O4LB 1EGAA 1NDQA 3JR7A 2QQEA 3JVEA 4ABYA 5GJWC 3KYDB 4GOKA 4UUNA 5AI6A 2GBFA 3ZY3A 1LBHA 1DX9A 2OPHA 2I87A 3PX2A 2VJAA 3HNRA 1KAOA 1K86A 2Y8EA 3I2YX 4F4CA 1FLVA 3H5LA 4ZICA 1QVVA 4BQOA 3GDHA 2MSCB 2Q29A 4CMCA 2IYQA 2HYDA 1CNMA 3JD2A 2IOYA 4AIRA 5EOVA 3K20A 4JLPA 4L73A 1XCPA 4Q18A 5IRCD 3NQ41 2QLBA 4MCAA 3O26A 2HF8A 4ACBA 3QOXA 4DCMA 4KDCA 4CR7A 2OVFA 1Q1BA 1WVMA 3CH4B 4FZVA 1JWAB 1U0SY 5AVRA 2IZOA 3VZBA 2AFHE 2AK3A 3DE5X 4RY8A 3N75A 4LYGA 5ELLA 3OLXA 1M6VB 3JY6A 3KZXA 421PA 2MYNA 3I9KA 1G66A 1VPDA 1YQEA 2WYIA 2CL6X 3MYRA 4CR8A 1A1VA 1X7DA 4LCEA 2ZWIA 2NPOA 1COWD 4RTOA 4G09A 3S99A 1KDVA 5E6UB 2EKLA 4G65A 1L7MA 1G42A 5JSKA 1BVUA 4R2JA 1H94A 3L8ZA 1CD5A 3FTQA 3K71B 1IVSA 1PG0A 4EPWA 2BUCA 4LWPA 2WU1A 2BMAA 1I8TA 2I91A 1QH8B 4S0XA 5AVUA 2GEBA 5F23A 3PEEA 3ZQKA 2FMHA 4JC5A 4X7PA 4BEJA 3ND9A 4C3OB 1J9GA 2WQZA 4R8VA 3PWSA 5BQ5A 5J4LA 5JS8A 2CEAA 4KR6A 1H22A 1Y5MA 3SOPA 1KQFA 1JILA 3CW2A 4G1EB 4L7QA 4BAUA 4KDEA 1I9CA 2ECOA 2FPPA 2HRRA 4Q4AA 1N5MA 3DAFA 4JT8A 2DSNA 3BH6A 1GU1A 3RJ9A 2WAMA 2RC6A 1W75A 5L7YA 1EP1B 2QUZA 5YASA 3WB1A 5KTYA 4V0SA 3U0VA 4YX9A 1J99A 2IXGA 3FBGA 4GX2A 4R98A 2AKEA 3F1KA 1DRKA 1KI4A 5HK8A 5JV5A 2BSQA 2NLOA 3PNPA 2ATCA 4IWYA 4YFVA 4OXNA 2IW1A 1UXOA 2OV8A 3K53A 2Z1DA 1T5IA 1IXZA 1L7AA 2P5SA 1K0FA 2ZYHA 4Z86A 5JAUA 4GSYA 3WMEA 1OGYA 4ZZ3A 4LDQA 3WLRA 4C3VA 2O05A 4GPD1 4A2QA 4JSTA 4QXRA 3NEYA 1BFDA 3EODA 1BYUA 4IXTA 4ASUA 1XEWX 1KO4A 1GVHA 3FTNA 2FEPA 4RADA 3TD6A 4N65A 1WM1A 1DGQA 5DTJA 1KETA 3VDRA 3OHPA 2Q4TA 1SEVA 4LGVA 3UT5A 3IBGA 3JAKB 1RSZA 2REBA 2OD9A 4M6WA 5CEJA 3KUXA 1F2UA 4HTFA 1YHNA 2BLLA 1HDXA 2BMJA 4FFLA 4WPGA 4LYAA 3Q7PA 3W9YA 3BJMA 1LBEA 1JPUA 1PJZA 2B78A 4WFIA 5HE9A 4KR7A 3E6AA 1NG1A 4XR4A 2B5OA 3OT1A 3M1IA 4KVGA 1XPRA 1W73A 5ALMA 4N01A 1U7PA 2GPAA 4QQKA 3JAMA 4F3TA 3NETA 4PTZA 2PSSA 4CEIA 3TOZA 3A9VA 2YQ5A 3UHJA 4ZCMA 1LLQA 3GNSA 5CVDA 3RVDA 4MRAA 3GCDA 2DTDA 2HHAA 3B3JA 1T8WA 1B8OA 1QRAA 3WQRA 1AQLA 3K7EA 1CZKA 1LK0A 3L0YA 4LJ6A 3UHOA 2YZ7A 3E7PA 3G0BA 3HWSA 3CKYA 3LPAA 1CJSA 4X1KA 3EPKA 4OJYA 2GPTA 1R4MA 1EUCB 4TKZA 3NKVA 3VV2A 3JZMA 4IIYA 5C1DA 2IT1A 3P97A 4C6RA 4QNRA 5LMNB 5I9TA 1SVKA 5A5GA 5K09A 1CY4A 2PGJA 4ZCQA 4PXAA 5JAQA 3WKAA 4KITB 3PIIA 4RQUA 4R8LA 3WYEA 1HDOA 4H0NA 4XIJA 2P1DA 2QM0A 3TKLA 4PLGA 2PZBA 5K3EA 1JU4A 1JDVA 3RH0A 4F12A 2DOKA 4CM1A 1N9GA 4Y1GA 3SEFA 5JSFA 2CSUA 2OXTA 2WFLB 2GYVA 4URFA 2P6RA 5KJCA 1JBQA 4E88A 3D7RA 2Q8NA 4LRQA 1YQ9A 2X2OA 1UPFA 3CCCA 4G0YA 4MDHA 2ZKLA 4D99A 1X7XB 5IVPA 1EM8B 2Z95A 1D9ZA 1UK6A 2J67A 3DEIA 1KQGA 3OIVA 2IIQA 5KTRA 1K06A 4MRPA 5TX7A 3VGPA 3RW9A 3VPSA 4RHXA 3KZMA 1CQIB 2ZPAA 3E2PA 4O2BF 2FWIA 3AETB 4YV2A 5F64A 1Y80A 3BCRA 3B2QA 1VSTA 3KYIB 2I66A 3EH1A 5HDBB 3VSEA 5CB4B 1RYMA 1LFDB 3NPAA 4KXUA 2EF1A 3RG8A 2BE9A 5KTKA 2GEUA 1PR1A 2HAEA 4NK4A 4G36A 1MFPA 2H6EA 3DMYA 1P60A 4ITUA 2AN5A 4RW0A 4KOEC 2JLRA 3H3XA 2V8OA 4QXOA 3U37A 3DTVD 4Q3EA 3OTGA 2O6LA 1YJXA 4CMEC 2R1TB 2XTZA 3KEGA 1VECA 4WIAA 3OKPA 1EFAA 1A9OA 4YQEA 2ES4A 1QE0A 2RB5A 1RWPA 2IHTA 3ESAA 4OFBA 1CRQA 3F47A 4QYTA 4CCWA 2PGLA 4IHJB 4KQKA 1U0HC 2A6PA 2MSEB 2XSZA 4KXVA 5EJ5A 1P7WA 2JGKA 4Y2YA 5JNSA 4H7PA 1DJQA 3CJRA 4HFNA 2XE8A 3NBYC 5DN9A 2C4WA 3I83A 5JAZA 5FWNA 3FMPB 4AO7A 2CLOB 1T5SA 3HV2A 3MTBA 3OP4A 3EEFA 3MQFA 4FLMA 4EUFA 2OGUA 1E1MA 2Z3VA 3EDOA 4AY5A 3M9WA 2VCYA 3FYDA 5H82A 3WJ1A 1ITZA 3DYVA 2VYNA 4GLFA 3FRIA 5DHSA 1UZUA 1ZINA 3L7LA 3SHFA 1OIVA 3VI4B 3ZNNA 2B4RO 5JNWA 5EP3A 3VKGA 3I72A 4TYWA 1E4EA 1GPBA 3TPFA 1MG5A 3GUHA 1D4FA 4JEIA 2OQ2A 5LB2A 4BATA 4JEUA 2J3KA 1Y5IA 2R8PA 1XVAA 1ZRSA 3E1GA 1OVGA 4QUJA 2PUTA 3NBUA 3K1AB 3REQA 1U2PA 1F2TA 3BEOA 4YR9A 2REQB 3KKZA 4TYYA 3MIZA 5KKNB 3KSAC 1Z2NX 1R0LA 2NW6A 3PB3A 3E4CA 1DCMA 4HDAA 2AJBA 4TSFA 4C0AC 5HIMA 1MN6A 3K6SA 3AMVA 1Q0LA 1H4TA 4QO8A 1O97C 3PYXA 1VYUA 1U8XX 2HBQA 1XTUA 3P96A 1XRRA 1J0BA 3MN1A 3MLEA 1W4AA 4WN9B 4RZIA 5SZKB 1QF7A 3KL4A 2H8KA 3A9UA 3HDHA 1UKEA 2XQKA 4JP8A 4MQ6A 4RKRA 4C0LA 4HBGA 2OE2A 1JDJA 5LFAA 2OBFA 1QGYA 2HR1A 4WDQA 4NYIQ 4HN2A 5JCJA 2UXBB 3PKZA 5E7IA 3QF7A 1M33A 1PUXA 1U3CA 3IP1A 4KWTA 3VUFA 1ORDA 2I71A 2FPIB 2H1VA 2VXCA 2W4QA 3OU7A 4JX8A 3AILA 4KE7A 4MJLA 4Y6LA 2WILA 4E33A 5F9FA 3MMXA 4D25A 1P1KA 1HGXA 1OZ0A 2C04A 4IQGA 4QO7A 1FPMA 2JHFA 1BROA 2D06A 3B8HA 2H65A 1H6CA 1OREA 2FQQA 1KOJA 1A2OA 1QHYA 2JF0A 3FIUA 1M34B 3IQZA 3MT0A 3MVEA 3KTDA 5T5QA 1KQ3A 1I6KA 1H4VB 3PQ2A 4I6EA 4OCZA 4EY8A 1RJEA 2QTLA 4MJXA 3N8GA 4D74A 4BNLA 3WR5A 4MKZA 3SXPA 4EJSB 3U13A 5DN6D 4RTJA 2FW6A 2HA4A 4M83A 3JQBA 3EEIA 3ODPA 4CKWA 3JD4A 2FZEA 3PVSA 4HRAA 1SHKA 4K7JA 4C3UA 3I01M 4DVJA 4NIMA 3OPVA 1F14A 1B8UA 4KGZA 5K2OA 3V8QA 2C1ZA 5FULA 5IJWA 2Y1XA 3PKIA 4R2KA 7REQA 1ESMA 1GXSA 2W90A 3IKTA 4INOA 4PIMA 5HQTA 1IEQA 2PQ0A 2CF5A 4JODA 5LBTA 2N46A 1C1DB 1ZJ5A 2I7CA 2ZFUA 1E59A 4P8RA 4BDTA 3WS7A 2ZDGA 5EPOA 2HCJB 1GTSA 4M0UA 2R1VA 1JQEA 3JPYA 4DBVO 2OLKA 1LGYA 1P4GA 2Y0PA 3QYAA 1SNYA 4YP6A 2KM1A 5H5JA 2R6GA 3P26A 2CK3D 2Q7XA 1ZJWA 4BNXA 4K9QA 3BWCA 3VH4A 4BTLA 3LUKA 1OAAA 1NKTA 2CXOA 4CNQA 5BN4A 1DC8A 1GGHA 2QX9A 4XIIA 4EY3A 3ISTA 4J1SA 1Q7RA 4D8XA 3E5MA 3BHMA 4PZPA 1P9NA 1R9NA 4PG7A 5GONF 4CLDA 2PL1A 5FUXA 1I4DD 2UDPA 3EIXA 3MJEA 4LV5B 3SQDA 3AFGA 4AD8A 1C0IA 3DEFA 3SHTA 1MZPA 3FD8A 3E9EA 5JNUA 3A9WA 4I6JA 3O3CA 4EARA 1I5RA 2NVWA 5HG0A 1YD7A 3GJYA 2Q1SA 4O02B 3SPXA 3OD1A 2RK6A 3WHLA 4HDRB 3HZRA 1BDIA 1XCJA 1TYBE 4FOTA 3TCNA 3I34X 5HUJA 2GZDA 4NY1A 1P80A 5KHAA 4HAXA 4D96A 1NBMA 2C5SA 1GPDG 1S5PA 4TTVA 4YMHA 3PI7A 4S1WA 4HG2A 2CLFB 4Z54A 4FEYA 4M1OA 5FOTA 3PGLA 3BWVA 3G0DA 1TYEB 5L95A 2QU7A 2W9XA 1V1MA 5A03A 3O8QB 4PFKA 1Z6QA 3K4PA 3TWOA 3CCFA 2R8RA 2ZUSA 3KVYA 1KZ6A 1UEJA 3A0UA 1LDGA 4QSMA 3EGOA 1XJCA 1NJ1A 2RI1A 2FPMA 4FPXA 4JLNA 2IK8A 5SICE 4ZI7F 3WYGA 1YFZA 4F38A 4V03A 2HKIA 1JKJB 3QZUA 3GUCA 2BVNA 4BFYA 3FA2A 5GGXA 3L8YA 3QJGA 4YA6A 2Q9UA 1EQUA 4RTRA 2PUJA 1KAMA 3B36A 4MK4A 4M0DA 1T0UA 4QFCA 4AFNA 1JG2A 2JGLA 2W6OA 4HNQA 4UDXX 5FTNA 5TS3A 5KJEA 4Y0NA 4F3RA 1T3LA 3NJ8A 3EAQA 4Z9YA 2Q3HA 1G0NA 4AZ3B 1PN3A 2DETA 3E0QA 3AR7A 4MCHA 3IPCA 5DK6A 3V7WA 1VBFA 2JCYA 4N49A 4MR9B 1XMIA 4Q3NA 2FPGB 3W2TA 5FDFA 4H7IA 3EOZA 5FUQA 4X8OA 1RQXA 3OAAA 3O8OB 3QFFA 5IUNC 4UHFA 1ZQ1A 2GAFA 4QGAA 5AJTA 3W04A 4B82A 2XMDA 3QPAA 3H65A 4EJFA 1JMKC 3QEAZ 4GNKA 2ARKA 1GQYA 3GGPA 1U90A 3EQZA 1X7WA 4N5DA 3HPQA 2H1SA 1ZUHA 3DUWA 3C6KA 4O4IA 3KQLA 1A5BB 1U5BA 1X1RA 2BTQA 3T35A 4Q0MA 1KRHA 1EAYA 5C3MA 4O4IF 2WZQA 1JZTA 3SF8B 3IP3A 1YQGA 3RVRA 4FN5A 2PLWA 3HYTA 5BN3B 2XLBA 2ZVQX 4WA7A 3ZHVA 1P72A 4BU1A 2AN3A 5BSMA 1GIAA 3KXLA 2YWRA 4DNPA 3Q10A 2OK8A 3B9QA 3HYSA 1Y8RA 4OH7A 1BO6A 4QFMA 1OFIA 2H59A 4X9XA 1N0HA 3PENA 3SE0A 2ZRCA 4E5YA 4PGMA 3PRJA 4PSUA 3G2NA 3CLVA 4ZU6X 2I65A 1NF8A 1BEUB 1TVKA 2FNAA 4MOWA 3DM9B 4FX5A 5CLQA 1UC5B 1XQ9A 1GADO 2GERA 3D1JA 3I04A 1U5CA 2GN9A 2QJFA 4GOLD 3RVLA 2V7BA 5J59A 3TH5A 1CT9A 1TJPB 2YNMA 3E58A 1B42A 2PUCA 2RHOA 5G0UA 1ORWA 5F73A 2EF0A 1EFDN 2NO1A 3QPVA 3K94A 1V6CA 2CFRA 3PDWA 4ID3A 4YH1A 4FB4A 1YZKA 1R0XA 1TI7A 3LVBA 1ZRHA 2LZ0A 1GT91 1I5EA 3LCJA 3MSCA 4O5OA 4L8VA 2OZPA 1M5UA 2VYVD 3IMKA 4FSDA 3PUWA 3C98A 1N7GA 1IZ7A 1KGDA 1SBCA 1TO2E 2NT4A 1IBKB 4L5YA 1RJ9B 4C4OA 3B52X 1M1YA 5C8YB 2OG1A 3LECA 2AD1A 4FINA 4MW7A 2E49A 4Q9NA 1UWVA 4P35A 1WV1A 2C9DA 3HA7A 3WL6A 2WSIA 3V9PA 4PVDA 2I2CA 2CC2A 3TSAA 4BKPA 1B6RA 3KK0A 5DM4A 2H57A 4R9RA 5HGXA 3UMCA 3ORSA 3OFVA 5K99A 3AC0A 2HIAA 3LP5A 4BUJA 4LSMA 3MRSA 4MKHA 4N40A 4OHBA 3Q72A 4OQQA 2X19A 3KVRA 5DHFA 4JT2A 1YZNA 4F2PA 2VF7A 1CS4C 2O3RA 3QA3E 3ZJ4A 1WDKA 1KYTA 2V97A 3IOEA 3AESB 1LSUA 1MVNA 1TMOA 2P9QA 2IPXA 1US8B 2V6BA 3L4BA 2DVMA 5ER6A 4CIAA 2XDAA 4GZ3A 4RZ3A 1QLHA 5IU6A 4OSPA 1M74A 4K88A 2Q6KA 3KSBC 2H07A 4XQCA 3DMNA 2XOEA 3N9IA 4EYOA 5BN1A 3OTOB 2JFVA 2OO3A 4J4BA 1O95A 2H08A 2IWHA 1VMKA 2NQTA 1DJLA 1KGSA 1BAPA 4ECEA 2P62A 1DQRA 1L7DA 3HL4A 3NEPX 1JHYA 4KC0A 5CA1B 1JR3A 4OEHA 5JWOA 2UZ1B 3VTZA 1MEJA 4DCUA 5G3ZA 5CFNA 1RIIA 4YMSA 5CGQB 2IE0A 3DKIA 3Q0EA 2JI4A 4DMFA 2WABA 1JG6A 4BO5A 1O0CA 4CF3A 3OKCA 4OHUA 3RU3A 1G16A 4EVRA 5CTAA 3MWKA 4FC6A 2O2XA 3A2NA 3J7TA 2A33A 4KQWA 1R1DA 2OL4A 3KJIA 4RZXA 1Y1SA 3INYA 3X0DA 1GR1A 2JCSA 2IH4A 1T1GA 3BMCA 3V3TA 1XVVA 2BC9A 2JIPA 3OOSA 1R8JA 1LNZA 2RCYA 4J0DA 4WCVA 3STVA 2BF4A 1FTWA 3F46A 1KJ8A 3NWOA 1K4KA 3GN2A 1XD2B 3QIVA 2I3BA 4TQUS 3GLIB 1Z6YA 3G8CA 5H3CA 4UPEA 1I24A 1W6RA 4Z7QB 2R6AA 5K0FA 5CYPA 1XL1A 3OWHA 1JFFB 2PR2A 4W1QA 3T1TA 3DDZX 1E6MA 3UJ9A 1XQWA 4AF7A 2WDPA 3EVZA 3KPWA 3OESA 3U7EB 3AUTA 1IM5A 2JJMA 3KFVA 1T9DA 2R8ZA 4CM4B 4D8WA 4UNIA 3T7CA 4HNSA 1Z73A 2EIHA 2KB0A 3L84A 4H1TA 3OBBA 4D7AA 4OYRA 3EXHB 3NTLA 1RHKA 1XRMA 1ZW6A 3T0IA 1XZIA 2X8WA 1I13A 1Z2AA 5HR5A 2R8EA 4M0LA 3PFGA 5LXTB 4DR1B 1H9CA 3K1TA 1UPAA 4H3KB 2JIRA 5FX2A 1VP9A 1UMBB 2NVUA 1X80A 3RODA 4C4SA 2FGJA 1YGPA 3GIDA 3PR3A 3FKSA 2J3QA 5IHXA 5AW8A 5H3LA 2CMHA 2FWRA 2GSWA 3EWSA 3GLTA 1E99A 5ALPA 3OECA 2ERYA 3QBVA 4J6EA 2YCLA 3IQWA 1SU4A 2AOUA 4O6VA 2FSSA 4BE4A 3VAYA 1GSAA 2CCJA 1LDYA 3TLEA 4QUAA 1PD1A 1X8JA 2W8BA 2ZR9A 3CF6R 3PXAA 2AG6A 2F4NA 4YDRA 1U0TA 2JIZA 5CUQA 5LLSA 1PFVA 5PNTA 5JJKA 2HSGA 5JC1A 3LUCA 4IUCS 2WPNA 4Q03A 4YAWA 4B3XA 4EDHA 4R9UC 2A7XA 2BFWA 4A2WA 4ARAA 3TK1A 2QTHA 3L4KA 4NV1A 4U7FA 5FWAA 4CT4B 1PO7A 3AVXA 2DPGA 2GXQA 4HB2A 5TMDA 1FFXA 4B7AA 2ON6A 4JMPA 3D6TB 1SQ6A 3FAZA 3S3TA 4O4JA 4KXMA 3VC7A 3OQJA 5JR3A 1U3WA 2ACVA 2OFXA 1M2KA 2JFYA 2W11A 4EW2A 2J31A 4LQDA 1UL1X 3KQVA 5A02A 3HR8A 3HJCA 4C7JA 4FUTA 4NONA 2ZBRA 2F9FA 1RR6A 4Z99A 3VHLB 5K20A 4BMXA 3JX9A 3LDUA 4BBPA 5I7SA 5ALFA 1TEXA 1WP9A 2EC5A 3JVDA 4FZ3A 4XQEA 3ZV3A 1UMCB 2FPXA 5EMNA 2CBXA 4Q3AA 3GP8A 3DDNA 2J3IA 3GOHA 4L3WA 4V0LA 1BXRB 4BFLA 2A8YA 4FVTA 4BFCA 5KCZA 1AE1A 4YO7A 2VTKA 3NDPA 3CEAA 4C21A 2N0SA 1KOGA 2CWDA 1FRZA 4FGLA 3FWHA 4F4FA 2PS1A 1HNNA 4BLUA 3GLUA 4MJ7A 5FEMA 1JG4A 4UU7A 1F1JA 1C8VB 4B3CA 1C9EA 3UT0A 1CFZA 4B32A 2BGRA 3UY4A 4YP1A 3T5PA 3VVMA 1HFJA 1IN8A 1Y1PA 1QV7A 3EAGA 4HGNA 1NZFA 3QENA 4I1RA 4DLUA 1BU5A 1R4AA 1S2NA 2PPLA 2VXYA 3I9V1 4WK4B 3G2LA 4LI0A 1BC5A 4V0RA 1T35A 4E7OA 3O5AA 2O8DB 4ZD6A 1TE2A 1W0JD 1BD3A 2G04A 2ZXUA 3NBKA 2IIPA 2VJBA 4V1CI 2ZDQA 5EJMA 4H6PA 1SXJD 4YCAA 2D3WA 2HXGA 2J0UA 1H65A 4JUDX 5EFOA 5ETJA 1UXIA 1EUQA 4XIFA 4AKGA 3WMXA 3AHDA 3RF6A 4TT3A 2PY6A 5EP2A 5TARA 1T1JA 3I9FA 4PLWA 1GFWA 1EWYA 3A14A 2IX9A 2JIDA 2VUTA 3CNOA 5DNYB 3G9ZA 3V9AA 2Y9PB 4CKBB 5CYGA 1P9RA 1UP4A 1XHFA 2ZCUA 2EBUA 2RHJA 4FGZA 1TKAA 1VJRA 4TZ0A 4P3YA 2FZ4A 4QEKA 2IYOA 5KYYB 3FMIA 1IPHA 1E5QA 3GFPA 3K0SA 1JPNA 1VHLA 2A58A 2DQYA 3OE1A 1ADJA 2HO4A 4NYJQ 2YXDA 4OQMA 4CG3A 5ITVA 2OGTA 3KOOA 2BELA 2PZJA 3OX3A 3EHDA 4NNOA 2XKKA 2WTXA 4Z4GA 1EXNA 1WDWB 5CR9A 4F93B 2C3YA 2F3QA 2F8TA 2XADA 2Z4TA 3CUSA 1EA5A 1RLUA 1DXHA 3NOQA 4BNZA 2AC2A 1PRYA 5HF5A 2WPDD 2O2GA 4W82A 5AOCA 1HLPA 2P6OA 3BX1A 1ABFA 2CXUA 1OLSB 3CX7A 3HWRA 3P52A 4ZQIA 1UR5A 4ZVRA 2DPYA 1XDWA 3IEUA 1VJCA 4JJ8A 5CD9A 3A1CA 4K81B 1GG9A 2J45A 4UKDA 4EBFA 3UKOA 3HXQA 3VTFA 4YJFA 2B82A 2VDVE 2ZATA 4RJLA 4KTTE 8AT1A 3CH5A 3MJTA 3F6SA 5DFAA 2AV6A 1I32A 4M9UA 3QEBZ 3RBVA 4TTJA 5GQSA 3RD5A 4I08A 3R77A 4OH1A 2R8OA 4ZQEA 3KYCA 2OHIA 2P75A 1UC4B 4FMDF 4FHDA 1OI2A 1FMTA 1SBTA 3DH0A 3ICOA 3YASA 1JNXX 2YYYA 1VHWA 1VPTA 4EMBA 1JPVA 1NQUA 2DT8A 3DNPA 1S3GA 2OMKA 4QODA 4ID9A 1WSBA 1ICEA 4RH3A 3MTQA 2XMZA 1BJKA 1EX7A 3BGVA 4I4LA 4D3ZA 1N7IA 1X92A 2DGDA 3GT0A 3ER8A 1P0PA 4JJIA 1BW9B 4DRZA 4FJ0A 2YWGA 2V6GA 3UPUA 1YRLA 4UQPA 1ZJ6A 3TLBA 2TS1A 1AX9A 2XECA 3JQPA 4E22A 1ZC3A 4DUYB 4CGZA 4RCVA 3D6NB 1YB5A 1V8PA 2UUBB 1OYOA 3H9JA 2RJ3A 9ABPA 2QTAA 1KYZA 3DPIA 4I36A 1LDMA 5LPNA 3DMRA 5AJHA 3MJ4A 3COVA 2FVXA 1XMXA 1ZNWA 4XGNA 5AKLA 4YQYA 4WXPA 1P1IA 4RVOA 2AK2A 4B2YA 3O1IC 4GWLA 1EFPB 3DT6A 3C7DB 3BXEA 3UTDA 3VM6A 3VSDA 4AG6A 1E9DA 2EFEB 4V3BA 1E9AA 1PYOA 4K9MA 4WUVA 2P67A 2VHQA 3DEZA 4XQ0A 1NVAA 1RI2A 1QG2A 5J2UB 2PYIA 3FW1A 1RKBA 1R4ZA 4QZVA 4QUBA 5C1BA 4LV6A 4FFSA 2AMLA 1GCOA 2WJHA 4LOLA 4EFKA 2HLHA 4NCXA 4BZZA 1NUHA 2QAJA 1GLGA 4BVGA 1GM5A 3NIFB 3SLRA 2J4CA 3U2QA 3UC9A 4BHTA 4IIUA 1QIJA 5K0SA 3DZIA 1FNBA 1FRFS 3LQKA 4NRDA 2W71A 3GH3A 4O8CA 3U1TA 4HJXA 4CZ2A 4DIFA 4F9FA 4MAFA 4D4GA 3C1TA 3CKKA 4LSWA 5HJ5A 3TLGA 5G0TA 3VQTA 1J0CA 3HKCA 3UVEA 1KMHB 2ZTHA 5L6LB 1YDEA 4U7WA 4D4LA 3N2KA 4R51A 2DF8A 3H8VA 3VKUA 4UUOA 2CXNA 3KELA 3OCVA 4LRTB 4LXYA 4TT8A 1XNJA 5A6SA 2ZYSA 4ZZ0A 4GMXA 4WCFB 2I2XB 3IP9A 4KR3A 2PO5A 4AKTA 3UAZA 3PUVA 3A4IA 1I01A 2FWJA 4NS1A 2C84A 1W4RA 5CG2A 2QRMA 5D3MA 2CLKB 3UKDA 5B6IA 3D7KA 3NCHA 1ULZA 4IQ4A 1X7GA 2O9JA 3DLAA 4KIWA 1W4LA 4RL6A 4WBNA 2GLUA 1G4HA 1N2SA 2IQIA 2BCGY 1DKNA 1ZUWA 2DMRA 3SZLA 1YF3A 2PBLA 4EHLA 3EVNA 4KSBA 5I9BA 4ODIA 4NFYA 1XN1A 4WLVA 5JBQA 1UOEA 5LIRA 5FPQA 3I64A 5CXUA 4ES6A 1TZJA 2UAGA 2E2WA 3O6VA 1E2PA 1MQ9A 1E1QA 4YRQA 1R8QA 4BX3A 3BXXA 4JYBA 3L6DA 1KI1A 1I6MA 1G5QA 1Y48E 4G5FA 3KUUA 3MIIA 4DYVA 2QW1A 1LLFA 2WSLA 3DV0A 3ILYA 1MC5A 2C2HA 4EGCB 1KS2A 5KNDD 5LL6P 5ISMA 4M8SA 1VFPA 3EDYA 3VJMA 3LKVA 4G0UA 1NVDA 2QNIA 3D81A 4RQBA 3CJQA 3IMEA 1S89A 3EJWA 3IT2A 5LYJF 3WGNA 2DBZA 1NPYA 1W0KD 1MQAA 2X8LA 3BGSA 1F12A 4BQSA 2HM7A 2VP3A 4YYZA 4R7ZA 3DF7A 1GUDA 3FZYA 3JTEA 1PEYA 2ECKA 5GM2A 1R7RA 2YX1A 3B8EA 3DMPA 3ACDA 5E7QA 4LK3A 4A8TA 5GONB 2OB2A 2QPTA 2ASVA 3FCXA 2QGNA 4KMRA 4BFXA 4E5NA 3UWMA 3PDCA 2X14A 1X38A 1H0RA 3EQ8A 1LRJA 1W4BA 2HY7A 2FDXA 1R3UA 2HK9A 3I1JA 3LWDA 1WPGA 4KXQA 3ZWAA 1HTTA 3FJYA 4ENPA 1ABBA 1PFGA 2OAEA 4FYPA 1B73A 2CLCX 3FUUA 5ERXA 1G8YA 3C3JA 3PHJA 4HNVA 5D51S 4E4YA 4GMGA 5BRJA 1G5HA 4XYBA 3KQKA 1V3UA 4PX2A 4D9KA 1QDEA 2OWDA 2QW8A 1PI3A 4UQOA 2NU7A 2PUAA 1U0GA 1XTPA 1L5WA 3EUAA 2Z1MA 4R6XA 1XQ6A 4ZQHA 3WFIA 3QXCA 1DP4A 3MELA 3ZC3A 4IQFA 5CEEA 3NGMA 2JAXA 4BN0A 2XNHA 5KSPA 1DC7A 2OKCA 1Z9BA 2PRIA 5EIXA 4KV9A 1BMTA 3PFWO 3UJCA 3FUTA 4ZI7B 2BFFA 3T61A 1OWNA 2XKJE 3AI1A 3KKLA 4QDTA 3QEKA 1SUIA 5EEGA 1HDRA 4PAQA 3ZU5A 2XQGA 3H1BA 5G0SA 2X0KA 1U2RA 2SNIE 4EK9A 4F5EA 1SCNE 2E5LB 3M3DA 3DNMA 4C0WA 1KMCA 4QG7A 4QARA 3P71T 2QGZA 1HF3A 5C3UA 2IHKA 3QW4B 1SO8A 3LIIA 2YV4A 1CUBA 3MXTA 1GZVA 1OFUX 3DE0X 1FYVA 1WDMA 1RHQA 1A4UA 4WVLA 1OTXA 3OFSA 1Y8AA 3P4UA 1YUBA 5ALQA 5FUYA 2IIBA 1SXJE 2AXEA 3IVCA 2QSUA 4UU8A 2VOJA 3TZQA 5BW4A 2O8CA 4M0MA 4NU0A 1TIBA 1YQWA 1KP3A 3NV7A 3ZDYB 4CV3A 3R5FA 1FX0B 1USGA 1ZESA 2Q1YA 2X5JO 3HRIA 1NQOA 3FM9A 3UMVA 5J5VA 1EFCA 4JYMA 3AT1A 2JIQA 4ZGWA 4K26A 2BYTA 3NTRA 4IYJA 2NMVA 5L3QB 1KZ7B 3ECCA 4GOOD 3B6KA 1FFSA 3GRZA 4FZ5A 4C0JA 2R85A 1KAGA 3UUGA 1ZL2A 2ANCA 2AUNA 2CJWB 1BOFA 1ECFA 3ELDA 2BFEA 3GZNA 4W99A 3QFCA 4PPQA 4TYPA 3UMYA 4CL8A 3RV4A 5EN4A 1R4NA 1CUGA 1Q21A 1NBWB 2V7VA 4GZ5A 4NBRA 5D6NA 1HKHA 4TLDA 5CFZA 3TPCA 2P6MA 3OZIA 3K6JA 3VYWA 4E51A 1MAWA 1ISFA 3IRUA 3PUKA 4LZLA 2NYAA 4W9NA 1L1FA 4C7BA 1QKIA 2DR0A 4P0PB 3N6RA 2DBQA 3GRPA 4HI0E 4B4UA 3VZDA 3R5XA 5GVSA 1PX0A 5JASA 2OZKA 5TS2A 2VDWB 5IN4A 1HZZA 4G25A 1D07A 2JFGA 3A05A 1TZKA 4FBLA 4KYVA 3ZY5A 2VKTA 3ABIA 1NUPA 2ORWA 3ME5A 4HGQA 4EG1A 2J59A 1J4AA 1CETA 3DO8A 3E70C 5H9VA 4BFSA 2JASA 1GPJA 3MS4A 4ZALA 3CNQS 3KEQA 3VO9A 5EKSA 4L76A 3EDQA 3IRVA 3CUKA 5KJ1A 5KOHB 1UIMA 2ERCA 2C3OA 4UE3S 4IF4A 2Q45A 2P3QA 3HZZA 2ZIFA 2HQ1A 3PG5A 4ZOCA 4BN5A 1V0JA 2BAGA 3JAWA 3ONVA 1ADYA 4S0ZA 1OH8A 4RQAA 4U2BA 4XGIA 2ZSAA 4BYGA 5JS7A 2ZS8A 3B82A 1P19A 4WK0B 5HSGA 3TLZA 1KR2A 1LPAB 4OI0A 3K30A 2IE8A 3VR3A 2JI8A 3COJA 2HO5A 4WY8A 1IZZA 2ZWMA 4NI5A 3DXXA 4DRXB 1VLHA 3VR5A 4LF8B 4X54A 4V39A 3V48A 2I4MA 5DK4A 2LTAA 3STWA 1YJBA 2G0TA 1AMOA 2JFUA 4LJ5A 1GSIA 1MT0A 2DLDA 3RFUA 3T9BA 2Q5FA 1ECCA 1SIOA 2XOKA 3CISA 4Y2JA 5B1IA 1Z06A 5EUCA 4IOLA 1C2YA 2TMDA 2ZBVA 3K0CC 3MRXA 1ZK4A 4MV5A 4OGGA 1ETHA 4P0TA 4R16A 2YQZA 3ZXUB 1CJUC 3W77A 1RTKA 2ECQA 1SCAA 3D02A 2BF7A 3G7SA 4ZARA 4BQNA 3DR5A 4UHBA 2O8FA 4FONA 2GZRA 2O2HA 3MPUA 1SD1A 1QIDA 4GXTA 1YZQA 5KQLA 4YUZA 3MM4A 1RWQA 1TFRA 3K1JA 4BP9A 1GP2A 1Z28A 1O8BA 2RGDA 1XF1A 1NAIA 1PNOA 1SKYE 2VPQA 1ZXBA 1Z7YA 2K6GA 1G8FA 2LIVA 3FWPA 4P08A 3C6XA 3L8CA 3H5IA 3MMNA 1KJNA 3QM1A 4L5IA 2RIRA 4S2EA 2NYRA 4GI2A 3TECE 4MP8A 4BFVA 1QWOA 1GILA 1HWYA 3IHTA 3NDIA 4JBGA 4MRRA 4PTLA 2X4IA 3D43A 3HYCA 5C31A 2B35A 3RB8A 2YKGA 3ADDA 1JDSA 1RC1A 2ZUCA 1GCIA 2ZRLA 3FSGD 3O92A 3PDIB 3HWX1 3VYVA 3ZHTA 3GXOA 3VXKA 1RMYA 4EX7A 1SHZA 2OCKA 2BBOA 4BFUA 1G291 3S4YA 2W6ID 4Q5IA 3KTAB 3GQBB 3H75A 2OBMA 4OQXA 2P9TA 1IY8A 3IAXA 3VNSA 3OWOA 4J9VA 1LDNA 4Z2AA 1EG2A 1NJSA 1ZH4A 3M2TA 3PE6A 4K5QA 3LQFA 4LWOA 1TX4B 2WWHA 1DHTA 4F8YA 3ZD7A 1GDDA 2CNOA 3L5OA 3LLMA 2JAOA 2PZEA 1XYGA 1UBOS 2I78A 1U9ZA 3WBBA 4D4MA 4OBWA 3BTVA 5EQDA 4XSGA 1RJDA 2I1QA 1SVOA 2W37A 2D5IA 2R8YA 3W05A 4DB2A 2CNBA 2OHVA 4NZMA 4ZQCB 3VYTB 5KOYA 1L5LA 2J0QA 1Y3DE 2LKCA 1WX1A 3RC3A 3A6HA 3QEMA 1BWRA 4DSAA 1GDTA 4ZJZA 3E8MA 4CQMD 3X1YA 3AUJB 1IZ0A 4FFMA 5HJEA 2ZRPA 4TMTA 1NOKA 4EHKA 2D59A 2GMWA 2GZ2A 3PGKA 4AYTA 2OLJA 5DNDA 3HI6A 3Q3IA 3IB3A 1V7PC 5AKKA 4JI6B 3V2UA 1NNEA 1KZHA 3ETEA 3K8YA 4I9NA 4ZQGA 4DM4A 3K8QA 4FZJA 4DG8A 1WXXA 4E15A 2QR2A 3ZWMA 1E1NA 3T7KA 3I2IA 1TNDA 1CDEA 3FE2A 5H8WA 2I6SA 4PNZA 2ZCJA 3OJWA 2XZDA 3LYHA 3W6OA 1SVWA 3NJ4A 2PN1A 1K27A 4JQYA 3ZN2A 5DGIA 5ILQA 2DR3A 2BI8A 1E5VA 2A9FA 4B34A 4NDZA 4P32A 4B17A 1CV2A 1BCRA 2C00A 1KZ4A 2JI6A 3C3KA 3C45A 5TJ9A 5EA2A 3ZYCA 5CVTA 3ZQ4A 1JB9A 3LO8A 4J49A 3VUEA 1KEVA 2GBGA 1I4EB 3DAGA 4P86A 3W90A 1XZLA 1LZKA 2HA3A 3ELUA 4KW7A 5JOQA 5ALJA 1Y3FE 3ZHOA 2P77A 3QVMA 5JTTA 2EATA 2P79A 5K0JA 5IH7A 4BEWA 2XCTB 4F1WA 3AERA 3AHGA 4FD2A 4EI2A 4EPYA 3IURA 8ABPA 1TT5B 5E1OA 1VGRA 2IUEA 3WV4A 3SVTA 3O90A 2O1XA 1NRXA 3I6IA 2CBGA 4X6YA 3SN6A 4HQLA 4UBJA 1GNRA 3H2SA 1SCKA 2JNWA 5HTOA 4M0PA 4HDNB 5E1BA 3U40A 3SX0A 2PZLA 5K4AA 1AK9A 3GLFA 3HO1A 4BJHB 2AC4A 3WNBA 4UW9A 1TQ2A 4MQ5A 2YY7A 3WA6A 2BI7A 4HS9A 3Q7EA 4L9SA 4O63O 3D7LA 4ENVA 2ZVDA 3A25A 4CXMA 4A36A 1MU0A 1C0LA 3PD1A 4G63A 5FR2A 3SHOA 1YE5A 3NG1A 5D2CA 3QKSA 4DA0A 2PMCA 3VNBA 1UJ5A 3NBXX 1KQOA 1GPKA 1SBIA 1HR0B 5G2OA 1ZAYA 3AGQA 4NR0A 1B8NA 4GIBA 1R2QA 5D01A 4C5AA 2YS7A 1EGHA 4P6VF 4Y2HA 3SDSA 3T41A 3L0DA 4TLEA 2VBCA 1E7SA 3I9OA 2F3SA 4ZEWA 5HKKD 1SXJB 4P84A 1I3NA 4ZAZA 5JW6A 5K05A 5A9TA 1SVNA 3RKUA 3ETCA 3HS3A 1SUAA 5E9QA 1H9AA 1XK6A 4OP3A 1CP3A 4MVXA 4LDJA 5FO0A 4I99A 1QS0A 4CODB 2ZE5A 1F2DA 2HWKA 2OILA 1WO8A 2AFIE 3CFYA 3CZQA 1O5TA 3OCCA 4R1OA 4G0MA 1S02A 3DVQX 5ELMA 3UJDA 3WWYA 2Z04A 1VYVA 4UUMA 1OB5A 1FVFA 3FR8A 3L01A 4B80A 4JI7B 5HJ7A 1L1RA 1ZISA 5AXAA 1F6WA 3ZCXA 4AJOA 4ITVA 1VCMA 2J6BA 4URXR 1M73E 3EG9B 4K8RB 3A2LA 4HVLA 3OFJA 1KIFA 1ZU4A 1Z26A 2GZAA 2HJVA 4QYIA 4BVFA 4HAVA 1A9TA 1K98A 2SBTA 1AQJA 1U0JA 1VXOA 1MC1A 3EGEA 1SOMA 4Z1OA 4YJHA 3ET4A 1YIOA 3T6KA 3B7WA 4G9EA 4I9FA 5DB4A 5AVWA 2PD3A 1RZRD 5GWXA 3LXRA 1QIGA 4X6XA 4J3JA 4AYXA 4ER0A 4NOJA 2ZIXA 5T4EA 1ZMBA 3G9TA 3OC0A 4OY3A 4RPGA 3W6ZA 3GV0A 1SQFA 1N6HA 1JDUA 4X1YB 3I2FA 2ORED 2GCOB 4EGFA 1K3TA 3CUVA 3FCAA 3KC2A 3MNFA 4TWZA 4KG7A 5DWDA 2JW5A 2VTEA 5HMLA 4A6EA 2QG6A 2Z5FA 4B4KA 5JXWA 3UG6A 4HNGA 3E15A 4MRNA 3WK5A 1XHEA 1MPXA 3E82A 3EEQA 3K31A 1XC7A 2CXSA 3M6IA 3NR2A 3DQPA 4COKA 5C8XA 5L4LA 4DCPA 1A69A 3SZGA 5ECDA 2WYWA 4JC4A 2OV3A 3II6X 3MRVA 3P9NA 4LZWA 1GFIA 2BTEA 5C8DA 2QP3A 4WLFA 1D1SA 2IYNA 4CLOA 1D1QA 1F0PA 1WIWA 2RHLA 3K9LA 4MA0A 1UBCA 2C94A 3KB1A 4MVJP 1KZ9A 4CLHA 2PD4A 4B76A 4AUMA 5GTDA 1DAEA 1JXAA 1QM5A 3K0AA 3P9SA 2HGSA 3Q3GE 4EI9A 1TF2A 2H4XA 4LE2A 3PPWA 1S01A 4CM8B 4RHEA 1CIPA 4RTNA 4PU0A 1UOOA 2HQBA 3UH0A 3B13B 4KFRA 4NABA 1TO1E 2WBLC 1I7DA 1SB8A 3PYMA 1KIMA 1OXTA 4QELA 3A4TA 2PL9A 2XODA 5TQ2B 4IDOA 2GM4A 3AVYA 2JGAA 5JZMA 5B4UA 1ORHA 4DC0A 4RNCA 1N0UA 5CJJA 1CUEA 2R4QA 4PSCA 2O48X 2EWMA 2J6CA 3SJ7A 2I3AA 3VISA 1D6JA 2WSBA 3EIEA 4Q82A 1UK7A 1W1IA 4KN9S 1NA5A 1VDMA 3VJKA 5LQAA 1BA2A 3PCTA 1JIIA 1OUMA 4I50F 3EB9A 3DKPA 1CUHA 3Q7TA 2OHHA 2GO1A 1BVRA 2FFQA 4Y8VA 2GD6A 3I8SA 4ALKA 5G1PA 5GAJA 3OE7D 3AEUB 1RXVA 1JJBA 2I29A 2GSDA 3AGPA 2AZMA 4B6PA 1U1IA 3M9XA 1UMDB 3OQMA 2P68A 3G8AA 3FUCA 3UBTA 2IUFA 3ZKAA 1DTWA 1JJ7A 1QO0A 3LUBA 2BEWA 1N32B 1ZJJA 4JQZA 1DV1A 1Z0UA 1OPRA 1C8KA 3B7GA 5IJAA 1HL3A 4M87A 2AUTA 4EUSA 4WZBA 2EFGA 2AFRA 1P6XA 4MPDA 3AIOA 4L7VA 5ALLA 2DUMA 4MI1