4OATA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with isoleucine.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
total genus 138
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oatA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oatA01
1LBIA 3CZCA 4Y9TA 1QP4A 2PUGA 2ZAYA 4Z4IA 4EVRA 3OO1A 3LUAA 1ZITA 4TLLB 2VYCA 5KQGA 4MYRA 4MS1A 4KV7A 3F6PA 3HXMA 1F51E 3N6VA 1MIHA 2LPMA 2MSKA 1U04A 1KGSA 2JCGA 4MS1B 4O1IA 3IDOA 3Q41A 3QX9A 1EAYA 4IGAA 1QP0A 1DCKA 1R8JA 4MLCA 4N0QA 2JBAA 4B09A 1RZRD 1DZ3A 1MB0A 3UKJA 1QO0D 2PJUA 1BDJA 1NTRA 4YV7A 3BRQA 5F64A 3QELA 2IDMA 1YS7A 4KQ9A 1DBQA 2QZJA 4W5OA 4CBVA 1JX6A 4OBBA 1NXVA 1DC8A 3OQMA 3MYYA 1A04A 3B2NA 1U2QA 2MYPA 3GT7A 4LDZA 4N41A 3OLWA 4M88A 5CHYA 2FEPA 2PMCA 3QLTA 3QX8A 2JVIA 4EGSA 1A0OA 5JNWA 4D74A 4YCSA 3H6HA 3NNDA 4DADA 2VUIB 4H3HB 1KRXA 3LOPA 3T6KA 4G86A 4MR7A 3EAFA 4H3KB 1FFWA 5HQJA 2AYZA 4Z4GA 2CWDA 4IRXA 3A0RB 1LJLA 4ETIA 1M5UA 2CHEA 1APBA 3A3KA 2JVJA 1DBPA 2MSWA 3HUUA 3NNSA 5IC5A 4NQRA 1PNRA 2FQWA 1KMIY 2GI4A 4MQFA 1JBEA 4KMRA 5B3JC 1PHRA 2QU7A 2FMFA 1TM2A 4NV3A 4RS3A 3W9SA 3CLKA 1URPA 3Q7TA 4F3TA 3HEBA 5EWLB 1USKA 1BDIA 4KRFA 1D4ZA 2WY2D 2HQOA 2MYNA 2FEWB 2CD7A 3H5OA 1RXEA 3H5WA 1VRVA 1ISSA 4Q7EA 1CHNA 3FDFA 1TVMA 2NT3A 1C0EA 1RPJA 3OMXA 1YS6A 3LKBA 5FWYB 4W5QA 1K68A 2JB9A 1U8TA 4Z0NA 1ZHHA 2A9QA 3CHYA 4MR8A 1DCMA 5TQ2A 4RXMA 1VPWA 4YO7A 4RV5A 3OLVA 3ROFA 3RVKA 4N03A 2NZVG 3JTEA 4KZKA 5KI6A 1YK1A 1JL3A 5JS1A 3DGFC 3MIZA 3KKEA 2WJAA 1JH9A 4H60A 4RWEA 3D02A 2FVYA 3NHZA 2PUDA 1D2AA 1PNTA 4RK0A 1QNLA 2QW1A 1WETA 1QKKA 1GCAA 2PUBA 2E4WA 4G97A 3HV2A 5TPWA 3RVLA 3RVRA 3L49A 4MQEB 3ROTA 1EHCA 3IPCA 5DGCA 1ABFA 2HPHA 3H1GA 1ZGZA 1JWLA 4KK4A 4XFKA 2WB4A 5KQPA 2F8SA 5FBHA 1EFAA 4RK7A 3JPWA 3KYJB 3M6MD 4PE5B 3FFTA 5KQMA 1NXXA 3M9WA 4HNQA 1YIOA 2FMKA 3SNKA 5DLEA 3HDVA 2FEKA 2FKAA 2MYUA 1M5TA 3FGZA 4YWHA 2MYTA 3LUHA 4IMIB 3EQ2A 4KREA 2R48A 4ZPJA 3N0XA 3O2JA 2H0AA 4LE1A 1FFGA 3RVMA 1U0SY 3F7NA 2F8TA 1QQBA 1TMYA 3O74A 4N47A 1I3CA 4Z9BA 2W42A 1GUDA 1ZDMA 3CU5A 1AB5A 3FMVA 3E61A 5JS2A 2ID9A 3I5AA 2IPMA 4MR8B 4LZLA 4KFCA 1YTUA 2FLWA 1S8NA 4P98A 4RY9A 4RXTA 4XASA 2FTKE 4LX8A 3SM9A 4F06A 2FMIA 2IPNA 1FQWA 1ZY2A 3CTPA 3CZ5A 1Z17A 2FN9A 3HO1A 3DGEC 1ISRA 5CNKA 1D1QA 1ZH2A 4KQCA 3MMNA 4MPTA 4P1ZA 4XXHA 4F12A 4EY3A 5BRJA 3I09A 2QSJA 3MF4A 1Z2EA 1FFSA 3BBLA 3EULA 3K9CA 3QEMB 3BILA 5JNRA 1JLKA 2Q5CA 3OLXA 2PAFA 4EUKA 5C5CA 2L17A 4G0MA 4MQFB 4RK5A 1PUXA 3N8IA 4IMJB 5HM6A 5TQJA 4ZMRA 1BAPA 2DRIA 4KK3A 3LUFA 2E4YA 1ZVVA 1A2OA 2IPAB 3OM1A 2PUCA 3HK2A 2VK2A 3F6CA 2PL9A 2RJNA 4G0XA 3H5LA 1DRJA 4PEVA 5FWXA 4RDCA 2E4XA 5BR1A 3GV0A 4F11A 1P6UA 7ABPA 4XARA 2E4VA 4JP1A 1MAVA 3CFYA 3IP9A 3JY6A 4OATA 4FE7A 3EDCA 1Z2DA 2FSPA 2R4QA 4DQDA 1NXSA 2B1JA 1PEYA 4WXMA 2IOYA 1SD5A 3DLBA 1UDRA 5DCLA 1DC7A 1PEAA 2QVCA 4TLMB 5TQ0B 4G0ZA 5ABPA 4WXEA 5TQ0A 3O1IC 1NXWA 4RY0A 3QEKA 4MRMB 1ZESA 4E7OA 4L85A 1GUBA 3N75A 6CHYA 3QELB 3RVPA 3TO5A 4Z4FA 4EVSA 5B3JA 3TMYA 2A9PA 4YP9A 5EWMA 5IX8A 4QYMA 3LUGA 1TLFA 5FBKA 1MB3A 2PL1A 4PYRA 1BVHA 1FSPA 3CNBA 3D8UA 5KWSA 3EJWA 2YHBA 2JK1A 5HKOA 4LE2A 1YMUA 4KNYA 2AYXA 1J56A 5ED4A 1RNLA 1YK0A 3MM4A 4GNRA 3RVJA 2R47A 3TB6A 4EYGA 4WZZA 5TPZD 4KPYA 4Q6WA 1Z25A 4F8JA 3H1FA 1HEYA 1T34A 1Z12A 1IIBA 4W5RA 3O1HB 3UK0A 3FFWA 5CNJA 3O21A 2WMYA 1ZGGA 1SXHA 1LJUA 3QEMA 3CRNA 3LUKA 3KLOA 4G0PA 1P8AA 2FMHA 2L2QA 5KC9A 3H1EA 3GBVA 5GQSA 3HS3A 4RXUA 2NT4A 3VNBA 2CHFA 2QVGA 4RU1A 1XWWA 3LUCA 2NUBA 5IUKC 2GWRA 3GRCA 1JF8A 1USIA 3F73A 2OENG 3DBIA 4RK6A 4RKRA 3GWGA 3VNAA 2OQRA 1JYFA 3E3MA 3SQNA 3DZDA 3N53A 3HSYA 3JVDA 4G0OA 4W5NA 2WRZA 3HUTA 3C3WA 4ETMA 4OTZA 1QP7A 3HJFA 2HSGA 5TPZA 5JNSA 3LUJA 3LFTA 4WT7A 4MS4A 2PE5A 1OXKB 1XHFA 5GOTA 4FB4A 2RGYA 4JA2A 2ID7A 2YHAA 2HQBA 3KS9A 5IEJA 3H5TA 4JAVC 1EWKA 3KYIB 3HVRA 3N0WA 3N0RA 1QO0A 4RZSA 3HZHA 4JASB 4S04A 5EWMB 1C4WA 3QLVA 3C6QA 1USGA 1JFVA 3JVIA 1H9CA 3O75A 4PICA 2L19A 2PUFA 1M2FA 3CG0A 3RVQA 4MR9A 2FXIA 3HM9A 1YVUA 1YMVA 5D2CA 1JHZA 4TN5A 5PNTA 2E4UA 2M1ZA 3C3MA 3OO0A 4EYKA 5IEBA 5JNVA 5IUNC 3H6GA 4MQEA 3S99A 1Z16A 1JDPA 3A0UA 5TPWB 5DTEA 1QMPA 4YGXB 4RK4A 4NCBA 5EWJB 1ZH4A 5DKFA 2LP4Y 1E6LA 3H5VA 1DCFA 2LIVA 1Z26A 4N0PA 1ZN2A 2R25B 5EWJA 5TQ2B 1DP4A 3CS3A 4HYEA 3LMKA 5TE9A 4XLTA 3QLUA 2FQYA 2B4AA 1W25A 2IYNA 2KYRA 3JPYA 1E6KA 1LBHA 3M9XA 1SXIA 2QXYA 3DLHA 5FWYA 3T8YA 3OQNA 3JS5A 4WWHA 2HQRA 2O20A 4LDAA 4MR9B 3URMA 3FFXA 3IPAA 2FQXA 1VLZA 5KC8A 3O2QB 3O1JC 4ML3A 1MVOA 2L18A 4QPJC 3GYBA 5EWLA 2J48A 4L4UA 2X7XA 1GCGA 3IP7A 4HNSA 5T3YA 2PUEA 4NICA 1KRWA 3H5IA 4PZ0A 2NZUG 3LKVA 4YLEA 4XAQA 5IUJC 4S05A 5T7BA 3RH0A 1K66A 1JDNA 2HJ9A 3O2SB 3C3KA 3OM0A 3SG0A 3GBPA 5JNUA 4MS3A 4YRZA 3KG2A 3KHTA 3RVSA 4Z99A 4IF4A 4JOQA 1SRRA 4MS4B 1JYEA 1Z13A 3L6UA 5BQ3A 1CYEA 3R0JA 1D5WA 2ZWMA 4TMYA 4MR7B 3KCNA 4MS3B 1BA2A 3KLNA 2PKXA 3G85A 4D6YA 4RY8A 2N9UA 1ABEA 3P9YA 4QYWA 3OLZA 1DG9A 3MQ4A 5I4CA 1B00A 4YR7A 2BGGA 3H75A 5BRAA 1QPZA 1SXGA 3ILHA 3G1WA 4OG2A 4DN6A 3NBMA 4ZMSA 2PUAA 1E6MA 3LUDA 4G0YA 3OLYA 5IBQA 2GX6A 2WJWA 4O1HA 1CEYA 4Z9AA 2FN8A 1M2EA 3QK7A 1NATA 3Q15C 3EQZA 2E4ZA 1NY5A 3NHMA 4EYQA 4RSMA 1W9HA 5HSGA 5CNIA 3Q7SA 1ZAYA 2QR3A 5IULC 2RDMA 3TD9A 4Z4HA 4EYOA 9ABPA 5JNTA 3IP6A 2IKSA 1TJYA 3I45A 2P4UA 4UHJA 5CNMA 1DJMA 3SY8A 5KQLA 3MA0A 3UUGA 2JRLA 3ILYA 4GPAA 1NXOA 2MSLA 2V0NA 2M98A 2LBPA 4O5AA 4RKQA 1D1PA 4OLAA 6ABPA 3OQOA 4ZYLA 1E2BA 4MRMA 4MGEA 4Z4CA 2A9OA 4MAAA 4YS6A 4W5TA 2QV0A 1P2FA 1JFTA 3TX6A 2H3HA 3EGCA 3RVOA 4QICA 3IP5A 3RVNA 2FW0A 3A10A 1LK0A 1VKRA 1Z18A 1U2PA 5C5EA 2A9RA 2GBPA 3QLVC 8ABPA 4JB2A 1L5YA 5FWXB 3KTOA 3GL9A 1JFSA 3HCWA 3Q9SA 3SAJA 1EWVA 4Q6BA 4JB0A 1NXPA 1P6QA 4N76A 4OLBA 1BDHA 1DRKA 1F4VA 1Z15A 2GKGA 5E3JA 3BRSA 3I42A 4IILA 1OXBB 3HDGA 3T38A 3KJXA 3Q7RA 3QLUC 3C97A 2I6FA 4FE4A 1EWTA 3T95A 1QQAA 4ZJPA 2FLKA 3BREA 2WWVD 4D6XA 3EODA 4RK1A 4G0QA 3NNNA 4LRQA 1XHEA 3OMWA 1NXTA 1GLGA 4WUTA 3CG4A 3LTEA 4EVQA 3CKMA 2VUHB 4E7PA 4HNRA 1RXIA 1DBWA 2RJOA 2JVKA 4LE0A 1L5ZA 3KSMA 3GA5A 3K4HA 4Z4EA 4KVFA 3RQIA 4NCAA 4MLDA 1RZRA 2P9HA 1AB6A 1Y1LA 2LUOA 2PLNA 2IPLA 2XDYA 2TMYA 2JBAB 4UHKA 4ETNA
chains in the Genus database with same CATH superfamily
2ZSUA 1PNOA 1E1QD 3HB0A 2X7HA 3PHCA 1KI1A 3HBAA 3KOMA 3O47A 1SXJA 4F7WA 3JYNA 1KQGA 3DO8A 3MBIA 3S3TA 4RTJA 3RTBA 3KZOA 3M70A 1M54A 3OEHD 4UQOA 2I8AA 4RCYA 3P26A 3N6VA 4LS3A 4A82A 4X7PA 1BROA 1J8VA 2H4FA 3ENNA 3NBXX 4LOAA 1E5DA 1M7BA 1V0JA 2OWEA 1U9ZA 2XUAA 3FKQA 4Z51A 1C2YA 3GGPA 3RVDA 2A58A 2P6RA 4RGVA 4WNCA 2HW8A 1M34B 1N3IA 3ISTA 3V4OA 1QHYA 5F21A 4B79A 2QUIA 5AM5A 3UKJA 1IQ0A 1PR2A 1QMGA 2P2DA 4JODA 4YJFA 3GUYA 3IQXA 3L3BA 1SCIA 3BRQA 4Q34A 1Q19A 2G82A 1P9OA 1ZW1A 2RIPA 2F1IA 1U1GA 4KQ9A 4TM8A 4KITB 1KP3A 2I62A 3UHAA 5DI3A 1NXVA 4Y9DA 3OJOA 4L8GA 5BPFA 5AICA 2CNWA 2IOFA 4HQRA 1WDWB 5I8WA 4CTMA 3R6DA 1W0JA 3DHYA 2ZDHA 4PSVA 1PFGA 1M0SA 4PZDA 2PX3A 5AJXA 3W5UA 4FDMA 2BHNA 4PGAA 4RJLA 5EXPA 4V39A 2NUAA 1G7RA 2Q62A 3MRTA 2A0XA 1ECCA 4PFSA 1IK4A 5LQDA 5J2TA 3IOCA 4QWMA 1U1CA 4P6VF 1XNHA 4CT0A 5JPDA 2ZYRA 1G20B 1A9XB 3BTUA 4QPPA 4F1JA 3DEYX 3GLRA 1YR2A 1XZLA 4KFRA 2B78A 4O4LA 1IRXA 4AQYB 2V6IA 1GQSA 1IHYA 1TCAA 1CJCA 2QT9A 2ZBDA 3I9NA 4KLRA 3NHAA 4OVKA 3HCPA 3L6CA 4S0XA 1O77A 4R0VA 5CW2A 5IM4A 1G8KA 1A7UA 3HCFA 3VR4H 4URUR 3ZHVA 4AJLA 1O0CA 1R5OA 4F6CA 1Y4UA 1KMIY 5K8TA 2VRNA 4R9UC 2QZSA 1IMJA 5CB0A 1Q1EA 5I7FA 1FC0A 3Q9NA 3VR5A 1TE2A 5G0UA 2Z4TA 3QW4B 5K8IA 3O84A 4NNOA 3IRUA 5CK5A 1ZUNB 5BR4A 1N2IA 3I30X 1FLVA 4B8WA 1IQUA 1Y9ZA 3ESQA 5AI0A 3WGLA 3EN0A 2QRQA 4F1WA 4MV7A 4Y6GB 3TTTA 1DX9A 3G49A 4GWGA 3KQLA 1P61B 4V3BA 2Z04A 5DDIP 1G8JA 2PYZA 4RHEA 2JDIA 2C7PA 1KZHA 4DUGD 2BZ1A 1VXOA 4MV4A 3WLHA 3LBHA 2O8EB 5LXTB 1G8FA 3KUDA 3QZUA 2BHRA 3QHAA 4RFLA 3V9PA 3VAYA 1JXMA 3ESCA 5CA0A 2Y1CA 5F51A 4DDTA 1UMCB 2LVBA 1LRJA 3FYHA 1JQDA 3GGJA 1CR4A 1AUPA 3LY5A 4BVFA 3JQ8B 2ODNA 4U7GA 4DDHA 2NPIA 3FDIA 3OU6A 5HIJA 4BE4A 1G8YA 3BKXA 1NVAA 3NYWA 4FYVA 4F85A 2MMCA 3LPCA 1PTJC 2JD0A 4Q19A 5CVUA 3G9UA 2VJKA 2CJYA 2IP1A 4INJA 4NWIA 3V8EA 3PNBA 1TJ5A 3HVUA 3GLFE 1C9NA 2BUCA 3AR9A 1UWLA 2VJDA 2YVAA 3L46A 1JDTA 3M6MD 5EIFA 1QQ6A 1GTRA 3DH0A 3KFXA 4KNWA 4HAYA 2C96A 4PLPA 2PA3A 4WNIA 2Q1YA 4KWEA 3KXIA 4ENUA 3NFYA 4XWKA 3HDVA 3C1AA 4OQEA 4OJQA 3IHLA 3JD2A 1BQ3A 3SF8B 4E5KA 2R48A 1TVKB 5BVHB 2YNMC 2ACWA 4URYR 4TLCA 3V80A 1P4SA 1Z0KA 1ZVKA 4GEGA 3K0FB 3RVMA 4PYJA 3A1CA 4EG8A 3M6VA 4HVAA 1J90A 3HUDA 3FG9A 4BB6A 2P79A 2G9ZA 2YQZA 5LD2B 3VMMA 1KR2A 4KFTA 3EMBA 3QVKA 4GX0A 4E2XA 1OY1A 4R1SA 4Q9JA 2ZRFA 1CY0A 4J0JA 3V7UA 2Q1SA 4A8TA 4MITA 4LBVA 3NJ8A 3OUTA 1QK5A 3WGKA 2F62A 3EVDA 1W75A 4P32A 3I52A 5EERA 1GIAA 2PH7A 1XRMA 3O8QA 4P1ZA 1N0UA 4MHOA 3EVAA 1QK4A 4JJZA 3STWA 4PQFA 1VKNA 1NLZA 4K28A 4L15A 1LW7A 2WSSD 3TLZA 5DNCA 3OCXA 1CR6A 4XB1A 4MKFA 5COQA 4FR0A 3RS8A 4QJ3A 4O02B 2Q5CA 3RIYA 2OXEA 2QTBA 1FVOA 4J0KA 4ZVSA 3DT9A 2ZI5A 1TCUA 3ZHCA 3PHLA 5EKXA 1KHHA 3H13A 1UFQA 4UU7A 4Z3DA 3GVHA 3R77A 4J0FA 1B0AA 1MB2A 3B89A 4GX1A 4TXLA 5C31A 3P0EA 2E4YA 1VHWA 2I7VA 3GZNB 3IQIX 2VJMB 2NZWA 3ORQA 2I87A 3BTVA 6REQA 1WS6A 2CLMB 4ZVVA 3F6CA 4O63O 2RJNA 3ZY4A 1M2WA 3AFNA 2AH5A 3GF4A 1ZU5A 1GRVA 5IZ4A 5IAOA 4Q3OA 3MOGA 3A6PC 1T13A 4JR2A 1N9ZA 3LS2A 3TJZA 4DQDA 2I2DA 2X7JA 4TYQA 4HV4A 5JAZA 1XMQB 5K8LA 2PYIA 1Q7CA 1VKHA 1PJTA 3C4JA 4GPTA 4YQZA 3K0EA 4POOA 1JA1A 1M0WA 1AZLA 2HHHB 1XA3A 1CR0A 5JAPA 3AI3A 1V37A 3VA7A 5JEEA 4BAZA 5ECYA 3S81A 1LW6E 3OPNA 1XLWA 4UBNA 1U3GA 1L5LA 1N3BA 1VBFA 5JAIA 1HX7A 3PDIB 5AM0A 2ATVA 3W8NA 2VOJA 3KKQA 1UPXA 1EA7A 1SQSA 3KSBC 3QEJA 1O9GA 5E7QA 2BTEA 4HB3A 3LOQA 4LF7B 5A0VA 3U5TA 4IEIA 1WUIS 2IITA 2PL3A 3VKGA 1XUOA 3HDHA 5CXSA 3T12A 3E9QA 4N3BA 2WZBA 2YVQA 2VJPA 3AI2A 4INOA 3NUGA 3QXCA 2P9TA 2F64A 4N39A 1Z25A 4ROSA 1JR4A 2AFRA 2O4UX 2ZOSA 3LVBA 1N5RA 1IIBA 4DM7A 3C41J 1QU2A 1JDZA 3WGTA 3O1HB 4YJHB 5FH9A 3UGJA 2CJWA 4OHKA 3HO6A 1LJUA 3NALA 4LJ8A 4RIHA 3QUCA 1A4IA 1B8VA 4XTRA 1DPFA 4YREA 4F97A 5A1TA 1P8AA 3LQ2A 3QVMA 4TX1A 4O59O 3VGPA 2BWJA 1TW2A 1GHTA 3EDQA 3U1VA 4IQFA 5JYDA 2C04A 1SU4A 3HS3A 5KWVA 2NT4A 2PGAA 4WKOA 5ISMA 4IFIA 4E7PA 3IERA 1IUNA 1K5HA 3H2YA 4ZQIA 5D3ZA 1ZJ5A 3KD2A 5M7EA 3TG8A 1W8DA 2PK3A 3FPLA 5AIAA 2R2GA 4X41A 3K5HA 5LQSA 4D9KA 4ZO9A 1IUOA 1JYFA 4ZQFA 1DEAA 1HDGO 1Z5ZA 1G55A 3HSYA 4JBXA 4O4IB 4EABA 4F86A 5JJIA 1C9MA 3EBPA 5KVAA 2WRZA 1VYUA 1Y80A 2H5JA 3KJQA 3RC2A 4NRDA 2P6MA 3EPRA 5IMSA 5KTNA 3DC2A 4CG0A 3TSYA 1S2OA 2WQ6A 2IS6A 3NT5A 3QKRB 4F71A 2FZGA 2XRFA 1NL3A 2GNAA 2PGXA 1D1TA 1NVTA 1XEAA 4MCHA 1SXJC 1LI7A 4OUDB 4HQ0A 4UUPA 2I2FA 1RKVA 3GEMA 3WO1A 5B7QA 4MB6A 5BSFA 1KEWA 4I1PA 3C3BA 1ISGA 3S0JA 2OHGA 1NLUA 1KSFX 2R8OA 3FIJA 2JGNA 1NV9A 2JCVA 3PDCA 1BD3A 1RADA 1XCMA 1I4OA 1LSOA 2DBZA 2MIIA 3AJ9A 3IBTA 3P9NA 4ZPXA 5ALJA 5ALSA 4BNNA 1QSGA 2P5TB 4MDYA 3PYMA 4A15A 2QL9A 3FLMA 5DSTA 5T3UA 3WV4A 1WPXA 3HEMA 3KR1A 3OKCA 3C3EA 2WIDA 3D4PA 4LRYA 2F4NA 3WVNA 3DVAB 3ZQJA 3HM9A 1YASA 1SBNE 2I8CA 2IDJA 2R1VB 4HL6A 3A4TA 4JL6A 5LKRA 2E4UA 3QMVA 2FP4A 5CDFE 5KYKA 3G89A 2YJ5A 3TKLA 1UOEA 2GPJA 2Q3BA 1NG1A 1ONNA 2BFCB 3SDSA 3AEUA 4I50F 5EIAA 4W5HA 3U4QA 2LP4Y 1E6LA 4J9UE 4L8WB 4F4CA 2QHXA 4YIHA 3QKWA 3Q7PA 2J4CA 3HWSA 5H4GA 3I1IA 4DJTA 2TMGA 5BV1A 5FOXA 3ZLUA 1NASA 2D13A 2KI5A 2YWFA 2ASVA 1XN4A 2PVCA 4X71A 2UYOA 3EA5A 1RPNA 3ENZA 3PHBE 1HTTA 5CCBA 2KYRA 3NO4A 1S2GA 5KNBH 3SS9X 3STTA 3L7LA 2JFPA 3CLTC 2I67A 2YDXA 3FCAA 3G2OA 3DEKA 1XKXA 2EWVA 2ONCA 1RJEA 4GR9A 2V1UA 2OAGA 3Q1KA 2EFCB 3KZVA 3V8QA 2FSIA 5I4BA 5CLJA 4N49A 4TXHA 1RKBA 4ML3A 3O1JC 1RAIA 4C3UA 5K6AC 3N7TA 1Y3FE 1YO6A 2C0PA 1CUUA 4F38A 4NZNA 4EHHA 4MRVA 1U4SA 1Q1QA 1E2QA 1NQVA 2DQYA 4PZUA 3N2ZB 4X8LA 3FOEC 3U7FB 2AI1A 2ZULA 2W4QA 2NUPA 2PGJA 1YHNA 2VYND 1OXVA 5EOVA 3ZW9A 4DQLA 1CF9A 2F9LA 3GDOA 2BTOA 3VC2A 2XCSB 3N2KA 2NO6A 5AKHA 3ICVA 1XGKA 1KEKA 5DWDA 1Y6FA 3KHTA 1UXOA 5E4TA 3I9V1 1AZSC 4UU1A 2QPTA 2W6QA 2XEXA 3K73O 4XZ3A 3E84A 1JDBC 4RS4A 4ARCA 4NABA 2C77A 1I13A 1OU0A 3I2IA 4AJPA 2QVLA 3EC2A 2I80A 5DTQA 5HFAA 1JH8A 1BS1A 1JFSA 4GHWA 3G85A 4L0QA 2Y1GA 4G0UA 3GEHA 1E1YA 3OBBA 4KG7A 4MRPA 5HK8A 1J21A 5KDDA 4US2R 3VU1A 1WTCA 1UZLA 1JS1X 1QNFA 1YBFA 2O0LA 1TUGA 2H08A 4A8PA 4NU5A 1SBCA 4I5DA 4KKVA 2VLBA 3ASUA 4TMTA 4ZEOA 4Z6KA 2VK1A 1E3DA 1Z0AA 2H51A 1KVUA 2O2EA 2C7OA 4QRDA 3LO5A 3RB8A 1WHTB 3K7EA 2DWQA 2G1JA 2RHTA 2YYZA 3IOEA 3FTCA 2R7LA 3FRJA 2P9ZA 3L40A 4DJAA 2Z1MA 1HI9A 4S1VA 4DR4B 5K5EA 4BV2A 1UIRA 3OQ6A 3Q15C 4NU8X 1W5SA 2Z95A 2IUUA 3U5ZB 3A4NA 2PJDA 2ZATA 3D4BA 3F6BX 1ARZA 3LJKA 3NC4A 4G5QA 1JT9A 4KL8S 4U7JA 4E5SA 5LMUB 1U6JA 1WPQA 2AD5A 4UVEA 2GEKA 4DTIA 2QTHA 3GLHA 3WXMA 1CQXA 4S12A 3D7LA 1P9NA 5AYVA 3RFXA 4B4WA 3FPAA 1N7JA 3PKZA 4JT2A 4UJ3A 3DM9B 4EGAA 4J29A 5CX1A 5BV7A 3IUYA 4YQEA 2H2FA 3IEIA 2YZKA 4LXHA 4PTLA 3DDNA 4CMJA 3AEUB 2E4AA 4TUYA 1D8AA 3L9XA 2IXFA 3I9OA 1DIHA 4MXDA 1R15A 2WKSA 3IEVA 2D06A 1PCXA 5B4TA 3AEQB 1W46A 2OSVA 4LYFA 4X6LA 2LWIA 4F3YA 3KQNA 5REQA 3BXEA 2ORED 3OOEA 1N2CB 3ZWCA 2V7WA 3L07A 1PUJA 3BQ9A 3R6TA 2E49A 2WTMA 3TVTA 4DCNA 4XVHA 3LLUA 4A4DA 4ZEMA 2REQA 1T0JB 2IDKA 5JANA 4LXUA 1AUVA 1T4DA 1U2PA 4LRSB 3FJYA 1YHYA 2IHZA 1OD6A 3BHJA 2VZ9A 4FBMA 4HQ6A 2GBPA 1OB5A 4NXMB 2C83A 1K6MA 4X97A 4DWWA 8ABPA 4AUMA 3TLMA 1L5YA 1TIBA 4F45A 1VPLA 3KKPA 5FQNA 3Q9SA 3SNHA 3VAAA 1RZRD 5AKEA 2G4CA 4ZT3A 1QHSA 3D6MA 3Q40A 1ZIDA 4ON9A 3W6NA 3KQPA 1BDHA 1SCNE 2FEAA 3CF4G 4V24A 2IWRA 5JV5A 1XR3A 3GDFA 2OT3B 5EUQB 4GLJA 1A7AA 3I42A 4ZI7A 3Q3JB 1NNLA 3UMVA 3BMNB 4C4PA 3N5CA 1Y81A 4UUBA 5A5GA 3I8SA 2MR6A 3CXRA 2F8MA 1YACA 2YASA 4U1RA 1EWTA 3BJIC 2C54A 4HI0E 4PGGA 2ZJFA 3P2YA 5ANRB 1JQKA 4P0QB 1WUKS 3EODA 3PLAE 3NNNA 1C81A 4ZTZB 2DCMA 1HZZC 2RK6A 5FDFA 1PBTA 3O8DA 5CG1A 2DOKA 1SIWA 2VUHB 4IHAA 5H68A 3RHSA 4C0SA 2NO0A 2F3RA 4ENQA 1XVIA 1DJNA 2JAQA 1AURA 1BWSA 2YYSA 5AW6A 4Y2YA 3A6JA 4WRRA 2ZK7A 4LHXA 1C3OB 1TA4A 3VUFA 3DVQX 4C30A 3HHPA 1IOVA 3IAM6 5M3BA 3FMGA 4Y2QA 4F4JA 1HZZA 2IUTA 2OCXA 3G8YA 5C34B 4CMIA 2BYTA 4Q7JB 2ZSKA 3FLBA 4RIIA 4C01A 5KHLB 5THQA 2ZVPX 4E0BA 1LI4A 2QP3A 1F51E 1V11B 1NR1A 2RH5A 4CT4B 1XWFA 4EI7A 3AI1A 2F3SA 2JCGA 2QJOA 2P4EA 2QPOA 4P2GA 1GDTA 5IDWA 1XDWA 5D3MB 1TK2A 4A6DA 5JAMA 4EHJA 4W7HA 1UC8A 1A95A 1FJHA 4XSGA 3RYHB 1Q91A 4EY7A 3PGVA 1BDJA 1NTRA 2IV7A 4WJLA 4X20B 1W0KD 5TMBA 3QFSA 1SZJG 3RVBA 1GQFA 1EFRD 4LV6A 3U0VA 5DVZA 4P4GA 2OV6A 2QZJA 2FWNA 3BH6A 3ELDA 1JSRA 3GFPA 4DCCA 4CMEA 1TOAA 1F9AA 4FMDB 5AK3A 4BMOB 3W7AA 3G17A 4QLAA 3AHDA 4ZOLB 2PPLA 3OLWA 5E8RA 2EIXA 2NO5A 4O2AF 5JNWA 3FRHA 4BGUA 4EAAA 1QX4A 3WWPA 3VR3D 4HDMA 4P4SB 2FR8A 1TEZA 2O8DB 2BFWA 1NWCA 1Y5NA 4N6GA 1F2UB 4KHZA 2HMYB 4KIUA 4I36A 3SF0A 2QA5A 1THGA 2JRCA 4AWBA 3CCBA 5HQJA 2XKKA 5LQKA 1A4XA 4ARZA 2IIQA 1HT0A 1EK5A 1M5UA 1U98A 4KQGA 2R8XA 1RWWA 1JNYA 1SRQA 2OO5C 1DBPA 1XBTA 2MSWA 3NTOA 3IKVA 2Y9PB 4RIGA 3VO1A 1EFRA 3UF0A 3WQBA 4DZZA 1O95C 5I47A 1G21B 1XTBA 3EVFA 3CX4A 2I55A 4RELA 1AK1A 1KJYA 3C3YA 3H5AA 3TXYA 2OVFA 2RONA 3GVCA 1Q92A 1JIKA 3IDSA 5HJ5A 5LYYA 3W9SA 2IE0A 4XSHA 1URPA 4OP2A 4BMYA 1P1RA 4LHVA 5FQOA 3EDRA 5HYVA 5LD2C 2XQGA 1G8HA 3EYAA 3U3MA 1D4ZA 4X94A 2WY2D 2V7GA 3N0VA 3QY9A 2ZT6A 3F4KA 1HSOA 2A67A 3DCIA 3KTDA 4L1KA 3T1YB 1UBLS 3CINA 1F6DA 3ZDRA 1JIXA 4UKDA 5JFOA 4DDKA 2GAFA 4ERXA 2PL5A 4PAWA 3OMXA 2H1VA 3ZQ4A 3SYNA 1P6XA 3LC7O 1YZLA 4TT3A 3ZD9A 1ORTA 4AP5A 1F6BA 1OPXA 1QRRA 1JHPA 1K6EA 3CX8A 5DISB 2ROQA 3FOAA 3LT2A 4AWXA 3R20A 1E4OA 4UAVA 5M34A 2HSWA 2CXHA 2FWRA 3Q7IA 2AG0A 2J31A 2QWXA 1J2YA 5ERYA 4EDHA 4M98A 3D8RA 2R00A 1PNTA 4QNMA 2Y8EA 4KDRA 1GR1A 5D6OA 3OA0A 4MB0A 1BSVA 1XEXB 4QOSA 3FHLA 4EL5A 1EHIA 1HE2A 3IULA 3E8SA 4AJIA 1YZGA 1N78A 2C9CA 2GXSA 3CWZA 4GE3A 1A9OA 3L1HA 4ILKA 3KT3A 5TV2A 2WB4A 4Z49A 5FV7A 1KK1A 4Z0HO 1Y7PA 2VTDA 2FG7C 3ZBUA 1WE2A 2LD4A 1SU8A 5C7OO 1ORHA 3R8FA 1NXXA 3MNFA 3M9WA 4R9SA 2C4HA 3FYSA 5FP0A 2W6MA 5ALOA 5C18A 2IIVA 4K6OA 1ZA1A 4KW7A 2CBXA 5JC1A 1QGUB 4Z3OA 2JEYA 5TDHA 2APJA 1R0KA 1LDMA 1BH6A 1XZPA 2ETXA 3MSXA 4QU0A 5L51A 3UAGA 4C5AA 3AESB 1W19A 4KDFA 1QQBA 3TLYA 2QTRA 4FIZA 2XMCA 1U90A 2NN3C 3OFSA 4KBGA 4WINA 4K40A 4Z9BA 5LC1A 3TWOA 1YQXA 2H2WA 3LFUA 2J46A 3E22B 4WX2B 4GMHA 4QUJA 2ZRIA 1QIIA 3M4ZA 3NVDA 3C6MA 4LG1A 4ZV9A 1ILWA 3F9RA 4F06A 4RD2A 5EE9A 2OSBA 1E3JA 4EY6A 3HA3A 1UBHS 5JCZA 2A0YA 1X2BA 2NSJA 4RAOA 1FUIA 4UUAA 5J1SB 1U8EA 4PG4A 3KQKA 1DWOA 4MKGA 4UD2A 4RPHA 4E33A 4NTZA 4XEUA 3WK4A 4BKUA 3I09A 3A70A 1YJCA 4BX0A 4LPSA 1XZCA 2IEIA 5L95A 2VP6A 3DL4A 1KIFA 1N4AA 2N47A 1CQIA 3NHLA 4W7IA 1OYYA 1AGXA 1M6NA 4GSYA 4JSTA 4Y98A 3BIOA 3U4MA 4BLSA 1A3CA 2C2WA 1H0HA 4O25A 4QXPA 3KYDA 1Q1BA 2DRIA 2BFMA 1IM8A 3HLTA 4ZREA 1CB0A 1HFWA 1T36A 2AFHB 5KAMA 1HYGA 2D2FA 2H7YA 2J6CA 1T2DA 4P92A 1Z0DA 4WXPA 2QVZX 1XVUA 4HDQB 4YQYA 3KQVA 1S4MA 2HTEA 3ZHSA 3T7DA 4Q21A 1W581 1WUJS 4UTPA 1KPHA 3GRKA 3EDCA 1V9LA 1Z2DA 3LX6A 4ZJYA 2W43A 2O54A 3IIIA 3JRNA 1NXSA 2MTBA 4ZRMA 3STHA 1JA9A 4M1YA 4F96A 4AKHA 2FPGA 3SE7A 121PA 4RTQA 1Y5RA 3E9DA 2NXNA 4Z0PA 1YR7A 3DWFA 1ZC3A 1HV8A 4TKVB 2OG2A 4LZJA 1DV2A 1T29A 2ZJZA 3BF8A 2E2WA 3CUEF 4P3PA 3ER9A 2WHXA 3BRCA 4WOCA 2ZBFA 2CEAA 1LC0A 4KIWA 2FFBA 3KPYA 1FVFA 1QWSA 3PZRA 2IX3A 5GV8A 3ZJVA 4X93A 2C92A 1JB1A 2M6LA 5AJVB 2G36A 3HB4X 4TYYA 1F5NA 1MC1A 2GCPA 4TRJA 4EG3A 1XZNA 5KKCA 1SC9A 2NV0A 2FRDA 2NG1A 4KO1S 4YP9A 3O3MB 4LC9A 3E1KA 3FTFA 4D9HA 4NJMA 3W3AD 2E7ZA 1OXSC 1JEQA 1T4BA 1GTVA 1ZK2A 2EW1A 3I28A 3K9WA 3LBNA 3D8UA 4J2TA 3R24A 4WADA 4WFKA 1A5BB 2ONKA 4H08A 3MK31 1CQZA 4BECA 3UIEA 5EQDA 1M1UA 1RHJA 1HEIA 4MUAA 2AYXA 1W5EA 4M60A 2AG1A 2DFVA 3V5NA 3GLHB 4BXOB 1MJGA 2R44A 3EDMA 1XCGB 2B1GA 2C7BA 2GPWA 3H4VA 2JI8A 4BQEA 3ZVMA 2JG3A 2OILA 3TGPA 2HDHA 4X1KB 2Y0DA 3L84A 3KQTA 3L1KA 3CVJA 5DK6A 4HUTA 1JIUA 3UA3A 1ZGGA 1V5WA 1IJFA 1ADBA 1ULUA 1XTSA 3DKPA 5EJ5A 4D42A 1HMPA 4I3GA 4D9EA 4U2CA 1AV6A 4GC9A 4O2AA 4Z53A 4QZVA 2O0HA 1OX5A 2VEOA 4TQGA 1XRLA 4ZZ0A 1YNSA 1XD2B 5J4LA 3SYRA 1H9BA 2XNSA 3G5UA 3B52X 4JA0A 3C4QA 3LK7A 2GWRA 4OL0A 3M1AA 4IQ8A 1JF8A 3ED5A 3F2VA 1Y5LA 1VE5A 2OENG 3JWJA 4UBIA 2RARA 2XA9A 3GWGA 4E1VA 4K0KB 2AC2A 2C97A 1ZRNA 1QC5B 2G25A 1G1AA 2VYNA 3FVTA 3G2PA 4MVJI 3ZKWB 2QZZA 2XSZA 1NF8A 3O2NA 4B73A 1NBHA 4CWAA 1PT5A 5EZ5A 1RS0A 3TD6A 4IFBA 4TL9A 3LFTA 4KP7A 4WT7A 4F72A 5K05A 2PE5A 4B17A 1AK2A 4K2HA 5LBTA 4Q12A 1ZD2P 3LPLA 4E22A 2XCLA 5CW1A 1F2VA 1Z2PX 1XHLA 2OXCA 1YXMA 3FBTA 3FI0A 2R6DA 3R8CA 4E2WA 2OQVA 3D6UA 3L6EA 2WJGA 4PX5A 3N0RA 8LDHA 3TLCA 3RRMA 1TCBA 1HORA 1KEZA 3CONA 3F90A 4MHTA 1Q7GA 2BMFA 1I10A 1V43A 3Q3CA 3UAXA 2NU7B 1ZW6A 1VLQA 1NW4A 3AEZA 5HM8A 3EPPA 3HJHA 3PSAA 4C0LA 4RLSA 3C74A 1TAGA 1U8YA 2B20A 2Q21A 3GT0A 3UFXA 4AJOA 2V9PA 4BNLA 1N9GB 1Z2AA 3TKYA 3GEDA 3HY6A 4E4YA 1D2EA 1UJ4A 3KVRA 3MMSA 2FPGB 3WMGA 1VOTA 4IIEA 4TYNA 1M1ZA 3GLTA 4H7JA 3A1UA 3SZLA 2GN9A 3H6GA 4KEAA 2EKLA 3ML1A 3OE7D 3ADKA 4CN9A 4CR6A 4YDQA 3NC0C 3L05A 1BWRA 1E61A 2CYCA 3JR7A 5EPEA 2X3YA 2Y4OA 1C3XA 3DP7A 1ACLA 4RK4A 3SU8A 4YJ3F 1ZH4A 2VNHA 4NCBA 3NORA 2FWAA 1AKWA 1FDWA 3WXBA 2OBLA 4JQSA 5CX1B 4DIOA 2I91A 1GPMA 1U5BA 3WB0A 4LY3A 4A92A 3WLOA 5ALHA 3U4GA 4R5MA 3UYLA 1FA9A 5TE9A 1RXWA 4UUNA 3Q8LA 2FQYA 4IIUA 1OI3A 2R8YA 3R0VA 1EFUA 1E6KA 2HU2A 16PKA 2WNHA 2V7PA 5FF9A 2YXPX 1W88A 4IX9A 4N18A 1FP7A 4U0JA 3M6WA 3RF6A 2QLLA 3T8YA 5A4MS 3AL0C 1F14A 2H7CA 1IBCA 4IDFA 1EXNA 1KXZA 5ALZA 2AC7A 1MJGM 3AUSA 1HKUA 3ZWAA 5LYJB 4CCAA 3G0OA 4IQ0A 3HYSA 2L18A 4RHFA 4WLEA 4B3SB 3M49A 1R8QA 2C4WA 4CIWA 3DJYA 2H63A 3GPBA 4LIPD 2GWHA 3ZDZB 5IT9A 1FW6A 1OX6A 4K6FA 3EUEA 5KQRA 4Z4QA 3CVOA 2MCFA 4EHDA 1RIFA 4RF4A 1T3LA 2O8CA 3P9XA 1Y63A 5E4FA 3GP5A 5KTSA 2YCBA 3FVWA 1SVLA 2BVNA 4ND8B 1X1SA 2HJ9A 3RC1A 4ZVUA 1V16A 1KDZA 1OAOC 4NK5A 4M0PA 4C5CA 5CPFA 2Y67A 1K7EB 2LDXA 3Q2IA 1XCLA 4YR9A 3FJOA 5SYNA 3RK1A 1H66A 1Z38A 2REBA 5BQ3A 4BMDA 5KDLA 1KVQA 3KB1A 3P2KA 3GG9A 4UPDA 1KK2A 3M6XA 2CLEB 2DUMA 2PIAA 2D8AA 3FDXA 1QS0B 2WLTA 3OOYA 5D5HA 3ZE6A 4EFDA 4Q3KA 4GOXA 5A4FS 2IXDA 3DQPA 4O4HF 4JUFA 4PPNA 1J0EA 1FVXA 4L73A 4J3FA 3U3OA 3PXCX 1YE8A 2P75A 1GFSA 3GCWA 4LGYA 5IJXA 4CDMA 2XRZA 2H4HA 1PBNA 3H75A 4JI2B 5FLXA 2JLWA 3R3ZA 1LF0A 4DN6A 1FBNA 5ILQA 2WINI 3FYUC 3RREA 1KMHB 3I1JA 3IS3A 1JLLA 1ZSVA 1FFEA 2XUJA 2WUWE 3PIRA 3ZKAA 3TZLA 4AUEA 1RACA 3M83A 4NZYA 4Z9AA 2YOFA 1DC4A 5AKKA 1A4RA 1IZYA 5JH7B 3OD1A 4B6FA 3KXKA 1RMTA 3MWJA 1WMAA 4G1BA 4RSMA 2H1RA 2QAGC 3DNFA 4M1SA 4EENA 2ZJ2A 3HV0A 3FUUA 4HOYA 3T3PB 4KFSA 3VSCA 5H3LA 1VZ3A 4E46A 3Q87B 2QB5A 3AF0A 3QF7A 3T7EA 3FOBA 3Q5GA 5BV8A 1P2DA 1JRLA 1U94A 3UOAB 1J7KA 2BKVA 2BJVA 1OLUB 1U28A 2X41A 2Z3VA 2ZSAA 4V0ME 4EF4A 3ER6A 1DTEA 5CNMA 3ZGNA 3VAZA 2YHSA 1FSFA 4BV9A 4JX9A 3ZGYA 2JFFA 1TC1A 4J0IA 3Q9LA 4LRUA 4N5MA 4HSGA 1T43A 1AM4D 1OFVA 2HJHA 1EGVB 3DYIA 1YQTA 1RAHA 3OQOA 2RGXA 2VBIA 1EFCA 3PQ3A 2D00A 2ZUWA 4LBYA 2WU4A 5ELLA 2ATEA 4B6PA 4D26A 3P94A 4L4YA 3ADOA 2WTNA 3CO5A 2AOUA 5AHKA 1YKGA 5KX5F 3DXXA 4D4LA 3IP5A 2AXPA 4LY9A 1Q21A 3E48A 4KYTA 3U9TA 1AQLA 1Z18A 4DR5B 3HUEA 1LQUA 5HF9A 1EUDB 1UP7A 1KVSA 1MLDA 2YQ4A 4BLWA 5L3VA 4LMAA 1L4NA 2X0NA 5CA1B 5F23A 1ECJA 2BSQA 2XIQA 3AFMA 5CFRA 1KYTA 2MSEB 1AS2A 1L9XA 3JQRA 3LM8A 3P9QA 4LCJA 3UMFA 5L53A 2GF2A 2JHPA 1AT1A 3FA2A 2I6UA 2QRPA 4OMFG 2CLIB 4Q6BA 1MHTA 4MVJD 2SKEA 3SIRA 3WGZA 2BZ0A 3DC7A 3K1TA 4M87A 5CLLA 3K72B 4JLNA 4BO9A 4Z1MD 5F3WB 2HPVA 2VK8A 4EPTA 4G5XA 2XOEA 4II2A 3EZYA 1M9NA 2WJVA 4NOJA 3CGWA 4YMHA 4LF6B 4J6FA 4WZAB 3JQAA 1VMKA 5G40A 4ZQEA 2A1TS 4S1OA 4ZIRA 1M33A 4GQIA 3BREA 4QUKA 1PIWA 1GL3A 3I9LA 3PCXA 2FWJA 5I7VA 1QIGA 4I1IA 4WUTA 4QBKA 4R3WA 5DJ5A 5I7WA 3IGFA 2FP3A 3DSRA 3NANA 1CC1S 1EE1A 2OCLA 3KAKA 5EA2A 2F9FA 4DARA 4ER5A 4V3CA 2HPAA 4U6NA 3W8RA 1RT9A 3WLSA 1JHXA 5FR1A 4FUQA 1WQ1R 2AOTB 2JI7A 5IJ9A 4BNUA 1EFHA 2BONA 4PVDA 2E18A 4YRSA 3EEBA 4PZ9A 4QOJA 4UHKA 4WFIA 4ETNA 5BQOA 5I8ZA 4Y9TA 3ZY5A 1TYCA 4UM5A 4FGLA 4BVLA 1DC3A 4YP6A 4OHPA 3UNXA 1CIJA 4CEJA 2XMRA 3F6PA 2HT1A 1TTQB 3LGSA 2TMKA 4P82A 2MSKA 1B23P 3W6PA 1IXZA 1UMDB 4D9MA 1DT5A 2AN9A 1O1YA 4HWOA 1CUZA 3V4RA 1O8BA 3RGWS 3LP5A 1MABA 1MPTA 5DPMA 3WKDA 2LKDA 2RBKA 3A9UA 4FDUA 4N0QA 4NYIQ 3IOBA 4XJSA 3V2HA 2JIRA 2PJUA 3D7SA 3EIQA 4I9GA 4AS2A 4BFZA 5F64A 1GZ3A 2V7QD 3QELA 1W5TA 4WOBA 5EVCA 4QUAA 4AY5A 3UWPA 4BFYA 4AI6A 3NONA 1Z08A 2I3ZA 4G9GA 2Q7XA 1XRJA 1CS0A 5AQEA 2FUKA 1A04A 1IVYA 4TROA 5J1TB 2HMTA 5TQVA 3RT7A 5A03A 1T1EA 4G5SA 2RHRA 2QGNA 1ZCZA 3OY7A 1NUPA 3R2JA 4RA6B 3RO7A 4EY4A 4HAUA 1P0FA 4URVR 1OFGA 2PFSA 1Z5VA 2KHZA 2FOIA 3HLKA 4OJTA 4M1TA 4QFDA 1ZN7A 1XVAA 2XTNA 2O3JA 4B76A 2QRMA 2P4HX 3ON5A 1QE5A 1QTIA 3WMFA 1ZUIA 2DT8A 3WY9A 4C7OB 1R37A 2HLDA 2XVYA 4OYYA 2EXXA 4C0BA 3ADCA 2W93A 3S2FA 3NT4A 3M6IA 3NAQA 2CNBA 5TF4A 2O1SA 3WHIA 3PE6A 1HTBA 1APBA 3JZFA 2W2NA 3ZDCA 3RYIA 1LV8A 2XCIA 2XB2A 1G9XA 5JY6A 1VJRA 1U65A 2C94A 3SDBA 3T5GA 2UVPA 2Q99A 5G4LA 3WYAA 3VZSA 3WGGA 4DOMA 4CKYA 2A9FA 4IIYA 3UO8B 2QU7A 4Q1FA 1TM2A 4NMXB 1FRNA 2AXEA 1YJAA 4JLSA 4UMEA 1P91A 5J40A 1S2DA 3PEFA 5EXTA 5LOVB 2P0AA 3DAHA 4X45A 3DZIA 4X1YA 1KY5A 4BYMA 2ZUSA 4CF6A 1OT3A 3PUYA 3TTXA 4P9NA 4FOLA 5LOVA 2I2WA 3C3PA 5DBHX 1A98A 3NTRA 5JD3A 2BEWB 5SZKB 2ES4A 4C20A 4ZJZA 4ZZ1A 1FFAA 1BS9A 2H2IA 3U7QA 3COVA 5EINA 1GZ5A 2A1IA 1FQKA 2ZR9A 4LJSA 2JB9A 4E5PA 4YRNA 1NI5A 4WZAE 2RIRA 3AFOA 1XXHB 2P67A 1KE2A 2FV8A 2XQJA 3GQVA 2XEDA 3ELYA 4Q0MA 5TQ2A 1NKVA 3W6OA 1Q1NA 1X39A 1JAYA 2V0CA 3NEJA 4RV5A 4EO7A 1PJZA 4K6GA 4AC9A 1JL3A 5I3ZA 3O8LA 3LYLA 3BD8A 4L78A 2QM7A 1NU6A 1WXXA 4M7WA 1WCIB 1O3YA 1N2JA 3FMPB 1GVNB 2QV7A 4HVLA 1QKKA 2W6ID 1JG7A 1TADA 1U7TA 4G97A 4GNKA 5A9RA 4A8JB 3F97A 5EHNA 4HEJA 3IPCA 5DGCA 3KC2A 1JFFA 2HPHA 3UB2A 5MN6A 3HYRA 3CUSA 4IEFB 3QWBA 4KK4A 5ARBA 4XFKA 1L5VA 1FMTA 1X9HA 1CP3A 3QVLA 1FZTA 1QH8B 5AW9A 3CIOA 3L92A 3HXQA 4OHWA 2XGMA 1HSZA 2XNCA 3WRXC 3FTQA 3ZVNA 4EHLA 2WFZA 3R6WA 4IG9A 1LDEA 4J8PA 1LXCA 4NBKA 1GAXA 2WQZA 3LH5A 4A7PA 5E9WA 3EZ2A 1OA1A 1WTAA 1Z39A 4S2UA 3GH3A 3SNKA 5DLEA 1B26A 2PZGA 1L5GB 2FKAA 5ALEA 4RZ2A 4KQIA 3FUXA 4DKXA 2X2FA 1TTHA 2YXLA 4L3VA 4JOSA 2P68A 2PX5A 2ZKIA 4U9UA 4D43A 4ZVOA 2OHVA 4LE1A 4K2AA 5JADA 5KPJA 2HF7A 2G0AA 1GG2A 4LHYA 4Q9AA 1L3IA 1XQ6A 4LNUB 1YDMA 1X7XB 2FX5A 4PR3A 1CG6A 4BLTA 5ED0A 1MO3A 1W4ZA 2OXFA 1K7CA 1NC3A 4JITA 2JF0A 3RCBA 3D9QX 4YECA 1EDDA 1IBRA 1GPYA 2C59A 3P0HA 5A04A 3IB6A 4FM9A 3A04A 4GOND 3PA6A 2HDNB 4G56A 4LAFA 4LNAA 1HDIA 3AOGA 3FNHA 3T52A 2NQ8A 4D44A 2VSXA 5KX5A 5LMCA 3LQ4A 4DB4A 4ZARA 5IXSA 2NIPA 1C1XA 4QARA 4RVHA 1EGMB 2FSUA 1XQVA 3FPKA 2I6GA 1PRYA 4KMSA 1VLLA 4NCXA 4Q01A 4WY2A 3HCBA 5LYJA 5EZYF 3J80A 4AP9A 4QUHA 3AX6A 1VG8A 1T0HB 3BBLA 1FDVA 3PQDA 3QEMB 4QYIA 1S2MA 5C5CA 3G9XA 3E81A 3EVNA 2VF7A 4LYDA 2H85A 4WCFA 5COBA 3QNWA 1PUXA 5CVVA 4ZOCA 3KNZA 4DNQA 1RHUA 5BWNA 1DAIA 2CFOA 5CB8A 3AHEA 4WK0B 2GVNA 3V8PA 3AVPA 3WWEA 2F8LA 2IPAB 4I50B 1I24A 1RQRA 2ZZKA 1XQWA 2ZTVA 1ZJJA 5DW3A 4RM2A 1RLUA 4HDSB 3SHVA 5CBPA 4RDCA 5BR1A 4F11A 1T5LA 5DOZA 7ABPA 1JSLA 4ZXPA 3CFYA 3IP9A 5EN4A 2DUNA 1Y8ZA 4FE7A 2VP5A 2AUNA 4ZO4A 5EFZA 1T9HA 1PGPA 4ARSA 1ESMA 2IDZA 2PLWA 3U09A 3S70A 3V1MA 2CMFA 2EATA 2BFAA 1GG8A 3QOXA 1KERA 1RWNA 3IT0A 3NUZA 4RA6A 4FMPA 1C8VB 3JYLA 4KQKA 3UHJA 1J8QA 4MUIA 4CIDA 3TW0A 1QVVA 3PHGA 2EP7A 2WSBA 4D3ZA 1GZ4A 1NXWA 2XUFA 2QL6A 5KYXB 4YJ2F 4Z8YA 4ONEA 1LLQA 2BCJQ 4HXYA 3N75A 1Z0SA 3VYUB 3RVPA 4Z4FA 1VJGA 1G63A 2QG9A 4Y1GA 3A06A 2W58A 3H18A 4B6EA 1BVHA 2OGWA 3Q9UA 4Y7DA 4ATNA 1MJHA 2BI4A 1RU3A 4R51A 4UW9A 3UWDA 2W0MA 1X7DA 4WMLA 4UHCA 2W8BA 4KXXA 4MA0A 2OHHA 4MUHA 5D85A 1G7CA 1WEKA 3HWX1 4RD1A 1JEEA 1J56A 4LY6A 4UMVA 3UGTA 1D8TA 4DLYA 4Q1AA 1R8YA 1CQPA 3AINA 3ZWXA 3ACCA 1VE7A 3FPBA 4HDOB 1T4CB 4HWRA 3DDOA 1OX4B 4L74A 2IGTA 1IDOA 4ZCQA 3IQWA 4CMIB 5CNJA 4M4SA 4L8YA 4QT4A 4RGBA 1U2ZA 1TQ4A 1VDZA 1QB8A 2GZMA 3EWNA 3U4DA 4MAMA 4M0FA 5J4VA 4NF2A 5HMLA 1TKAA 2Q6KA 1R3UA 4RV9A 1NIPA 3D4OA 3U62A 1ORDA 4J43A 4Y6LA 2X2PA 3PDJA 4KN8A 3MUNA 3K8OE 2WV9A 1E8DA 4H7KA 4HRYA 1KRHA 4UTXA 1JLRA 1XTUA 1X92A 2J6BA 4ETMA 3GLGB 4DTCA 2AOVA 1NNEA 1L4FA 3VISA 4FWIB 4IJWA 4WECA 4CMHA 2XCUA 1Q1ZA 3I83A 3IC5A 1W0JD 1GGHA 3LPAA 4IG4A 1L7NA 2UZIR 4BO7A 1WDLA 4MMZB 4W63A 4WN9A 3F5SA 4NPAA 3ZLTA 2X2OA 4GLFA 1TEXA 1LNSA 3DOHA 2WF9A 1G5TA 3VMFA 2F90A 2P5UA 1QIFA 3C3JA 1ADJA 1DJOA 1JHUA 1XZGA 2JCBA 1PJAA 5IM5A 3U3JA 2ZRBA 1RKUA 4IIGA 4CMEC 1A97A 4KHPB 4CEHB 1RBQA 4BCBA 3IEUA 3WIBA 1AO0A 3WB1A 4AMVA 1GADO 1W36D 4D3XA 3QYPA 1LKZA 1IXKA 4R7GA 1HDOA 3EBLA 3U4CA 5F7XA 1X1DA 1LZLA 2PUFA 4L5CA 3UJHA 2AN5A 4XA8A 3X1JA 1MU0A 4GGMX 1T9BA 3DHVA 3N76A 4QOEA 2JIOA 4QJIA 2XH8A 1V1RA 5E6SB 2YHIA 1B43A 5DHRA 4IDGA 4JP5A 3SEZA 3WK5A 1OFUA 3AOEA 5FL3A 5EIEA 1T0BA 1FK8A 3IXMA 2J9ZB 3MWEA 4TUYB 4B7AA 2Q07A 4ALJA 4AYTA 3F9IA 1ODJA 1W35A 4FQ5A 4YT5A 4LYEA 3NPMA 3JQEA 3MJSA 2GZ3A 1KEEA 2UXDB 4CKCB 1ZN2A 2X5JO 4RKFA 2AEEA 1UBTS 1X13A 2FUEA 1S3SA 4HYEA 1XFDA 4XLTA 4D99A 4NMWA 4J1NA 3GLVA 1OSNA 2MU1A 1WIWA 3JPYA 1ZPDA 1G3UA 3DOJA 1Z7BA 2B7CA 4G5FA 4R8KA 4U2BA 5A6SB 4ZOQI 1AE1A 1KS9A 1N5MA 4LDAA 4G4GA 4B40A 2RHMA 3FFXA 3CR3C 1E0SA 4HEA6 5JDIA 3GMIA 4ND7A 5A3JA 2GDZA 3W6ZA 4KXFB 4C0AC 5HFNA 3UPUA 5EE0A 5K3SA 1EB8A 4Q37A 3VR4A 4KSCA 3MWYW 3BL5A 2W70A 2C4MA 5KOHB 3I05A 3SXUA 2VS1A 3L1VA 1SURA 2BGJA 1NOJA 3Q5DA 1E3WB 1P5HA 2PO5A 3EVCA 3R5FA 4GGPA 5FTWA 3O7WA 1C0PA 2XNJA 3ESYA 1R5NA 2JK0A 2C2KA 3LF1A 4RZXA 4YDSA 5B1IA 1Y8RB 4XAQA 3QOYA 4TWRA 2PBRA 2WUGA 3HKDA 3ESRA 3E15A 3EZ6A 4KXNA 4MX8A 4NECA 4TLBA 2RGRA 1ZXLA 3EBOA 2FDCA 1YBHA 1NFQA 1V9CA 1MJFA 1KFJB 4LSGA 1OFTA 4JI4B 1FYXA 5ELMA 3HVKA 4CLDA 3ZCTA 2F1OA 2GHTA 1EWRA 2ODPA 2WUFA 1I2ZA 1SAYA 2F1HA 3N2GB 4HXFB 4MS3B 2MDTA 4QOIA 5TX7A 1XQXA 2ZCJA 4D8YA 4WOKA 2SKDA 3INRA 2ENWA 3DDZX 4D6YA 4DCTA 3PDWA 1V3QE 1P4HA 1EQ2A 3GD5A 3HY3A 3ZV4A 1JG2A 2FFHA 4D97A 2Q3JA 2GAJA 2EAUA 3U3RA 1Q20A 2PU7A 4XE5A 1IU9A 1OZAA 4KRYA 4OPMA 5ALYA 2R1TB 2HM7A 4U5QA 2GOYA 5I7AA 4E5VA 1AZTA 3CLUC 1Z7WA 3UWSA 3BTSA 2VSYA 3DD5A 3CUUA 5CYGA 4CQMA 5LJIA 4J7UA 5LR6A 2VF2A 2X8BA 1HZJA 3V4SA 5ALIA 1C3EA 3LFHA 5KOYA 1ODIA 3F46A 1GPLA 1OIWA 5INTA 1FOEB 1HYHA 1C4KA 2WWYA 5AI4A 3DTVB 4YCDA 2YMMA 3S5JA 3PNPA 1WZUA 1BN6A 4P34A 5CH8A 3NI2A 3WLRA 2BJHA 2J67A 1E2FA 3NT2A 3TXXA 4BE9A 2QE7A 3EXIA 2XCOA 1LBSA 1JPJA 2P9JA 1E3MA 3PB3A 1DJMA 3NHSA 1H6CA 2DUWA 2X9VA 2HN9A 2JRLA 1B42A 3CT6A 4ZEVA 3S4YA 3WL6A 2FE1A 4DWVA 1HFEL 1JYSA 1Y6JA 4BLUA 1ZAKA 1Z0FA 5CPBA 4YCMA 1S5PA 4HDKB 4Y6PA 4ZQHA 4FKZA 2P91A 1ZSNA 2IWHA 2J9FA 1CHDA 5JXIA 5K4GA 4ISBA 2V3CC 1XVLA 3EGXA 5T41A 3ZGOA 3SLGA 5JHGB 3E05A 1N77A 2H3HA 1T4MA 2H2AA 3RVOA 2C5EA 1EBFA 2NU7A 2WYHA 3VTKA 4AMUA 4DDUA 4WFJA 3R41A 1YZNA 4CEHA 4RYLA 3WNQA 2HZ7A 2H5LA 1XYVA 3K0AB 1GY8A 4YAJA 2ARKA 4Y9SA 4CV0A 1CUSA 4RTMA 3SMQA 4ABYA 1OWPA 2FYTA 4B9AA 4F0JA 5FWXB 1DRUA 1D1SA 4LJ5A 3ZIAD 3RYIB 2X4LA 3NHRA 5JWOA 2AK3A 4M54A 5HJ7A 2JGKA 4F9TA 2VAWA 4EKGA 1USUA 3NWBA 2QTFA 1EDZA 3OZUA 4OF4A 2LKCA 4ND1A 3L5KA 4MUXA 3H1AA 3SX2A 3RIXA 4M37A 1C3JA 2C9OA 2K2WA 2YVKA 4BMNA 3U3ZA 3RNOA 3QPVA 3DAOA 3AJRA 5KJFA 1AQ6A 1MQ8B 1UP4A 1L4MA 3KPUA 1F0NA 1T9CA 2CYBA 2R62A 3T95A 1EXVA 4IBOA 2PRJA 2FI1A 1ZNWA 1CYDA 3JD0A 1HDCA 1EM8A 4TKUB 1ELOA 4DCGA 2AJTA 3WMXA 4I9UA 1LDYA 1I5EA 1ZH0A 3S40A 2UUAB 3B8EA 1YA4A 3EE6A 3RSZA 1NSTA 3KSUA 1SUWA 4NHEA 1J33A 2QMOA 4LE0A 5B1YA 1U0LA 2P2CA 3FTNA 4CUJA 5BNZA 3IELA 4YI5A 4GUDA 1TM5E 1K3UB 2LUOA 3RBXA 5CDTA 3HR4A 5LSAA 5D7BA 2C4TA 2B37A 4KDCA 1I9CA 1JHRA 3IMGA 2J3IA 1RCUA 2QSZA 3DMYA 1SVMA 2VT7A 2WE8A 4EB0A 1RC8A 1NZFA 2Z5LA 2ZYIA 5ALXA 4JFAA 1Z4OA 2W2VA 3S7TA 3OZWA 1SH7A 1QZTA 3LW7A 4B6QA 3PCTA 2P35A 3A6LA 1G6OA 4RZIA 4MIYA 4DAEA 4P4TA 2QRNA 1G5QA 5G4KB 1HNWB 4RTKA 1DCKA 2VK4A 1S01A 2BHLA 2D2EA 1ZJ6A 4MLCA 2VQ6A 2Z2KA 4XVRA 3Q8XB 4G0VA 4M0KA 5T4HA 2FRXA 3CKYA 3FYDA 1U6IA 3TCNA 4BRSA 4E4RA 4E11A 1E9DA 4QTUB 4HVCA 4HZIA 1Q0SA 4R9NA 1UKBA 2G08A 4NBVA 4CBVA 5FNVB 3FPSA 3HXKA 2SECE 3LGAA 5JJBA 4YAFA 5D5QA 4M7OA 3EWSA 3UOGA 3ZV5A 2H4JA 3IODA 1WEHA 2H54A 2VC2B 5CTAA 1GUAA 2B82A 5HA5A 4CF3A 1LV7A 3WDKA 2ZYAA 3PT5A 1YF3A 3ZK8A 2D5CA 3B1KA 1A0OA 4OFBA 4QYXA 3H6HA 3KKKA 1QS0A 3VYTB 3TLXA 4C4TA 4DSNA 4O0MA 3T6KA 1XJ5A 4EATA 1DFIA 4HWPA 3GELA 5EIOA 5BSGA 2CUTA 3OSUA 3UICA 1FP1D 2Z6QA 1TD1A 1VDMA 1SPXA 2VA8A 3R5TA 2NO1A 1C9EA 2AGVA 2O2ZA 3H6KA 3LIIA 4ETIA 2ZZNA 2CK3A 1UXKA 1K5GA 3OLQA 4BFSA 4AT1A 2FCAA 2R6JA 3ULKA 2IY8A 1YR9A 4NC9A 5AW8A 1PNRA 3DT8A 1UK8A 2OHFA 2X13A 1V1JA 1FDSA 2Y05A 4PC6A 3VH3A 2BEWA 1XI2A 2IX9A 5LZ4A 3DCYA 3I6IA 3V1LA 1CDEA 3GAMA 3AFGA 1T2EA 1GGMA 4CODB 4UTNA 3WYDA 4MVJA 2E55A 4DA4A 4MI1A 3D2LA 3PFGA 2OKGA 1SVSA 1RJ9B 5SYMA 1PR6A 2H1LA 2RKOA 4WAUA 1DMSA 4I1YA 1C0EA 1S8FA 3JQFA 1W88B 5EPOA 1ZMOA 4W5QA 3H4IA 3PGMA 1K68A 3X1DA 4BUZA 4RTRA 1U8TA 3H83A 1FFXA 1KHTA 3D6VA 4G4IA 5ADWA 1QWOA 5A4KA 1F8GA 1PD0A 4WSOA 3OLVA 1K63A 3H7IA 1PS0A 3CXUA 3SX4A 1BXGB 4QVGA 2Y1OA 1PK9A 4UATA 1YJQA 4ZVQA 5JAHA 4QVKA 4JQCA 3BGWA 1GXSB 1RIIA 3LYHA 1C7ZA 5IG2A 2IS2A 3Q2OA 1EVKA 1TVKA 1W94A 3N74A 1XQYA 2WD9A 1HT2E 3MTGA 2WF5A 3E7XA 3UANA 2DEUA 2O8BB 1M1YA 2SNIE 1QVZA 2TSYB 1YS9A 2CEKA 3QI2A 1MW8X 3KPJA 1A5ZA 5IYZA 5L4SA 1F7VA 3TL3A 3KOOA 1RM5A 4ZC1A 4OB6A 2Q27A 3JPWA 4IOJA 2P3LA 3ANNA 3G68A 2HY7A 2HLHA 3P4XA 4IDDA 2NU8A 2B30A 3B1WA 1NSYA 2E6KA 4CM5A 1OUMA 2NZYA 4K3VA 5BR7A 1B7GO 2F55A 2GBLC 1KAOA 1NTOA 1M34E 2HWUA 4KV9A 3D6TB 4U5XA 3L6BA 3RUAA 3C8DA 1TU3A 4QUDA 2AOWA 4NOKA 4JGIA 2VYVA 3NWEA 3PENA 5FFMA 4W7SA 4YRLA 1RRCA 1GPBA 4MQUA 3ACBA 4IYJA 3QFCA 5ALWA 5K01A 2Q4TA 3GEPA 3GFQA 3HFJA 4YUWA 1NW6A 2H2GA 1D6MA 4BLRA 4GMGA 1J24A 1S89A 2G5TA 2XD4A 2BRUA 1MDBA 3MINA 3E9ZA 3U9LA 3WQHA 2CJXA 1S8NA 5GMOA 3SM9A 5H80A 3QLEA 2IPNA 2C5GA 2Y0CA 2GILA 2K6GA 3FYUA 4ANFA 2XRMA 4X54A 5JSFA 1E18A 2RI6A 5AI8A 1D07A 2HEGA 1GSHA 1T5DX 1DAGA 1ZH2A 1C8KA 2WWGA 5B6PA 4F5EA 3COYA 1Q1AA 5JIBA 2QQEA 4KWIA 1R8SA 4WD3A 1VI6A 2JJ8A 5BRJA 4I55F 4XWYA 1EIZA 4AFNA 4G3XA 5DW0A 2ZTLA 5K2MA 3WKBA 2HDOA 2QRGA 5C1OA 1SHZA 3K9CA 4BNDA 4YAIA 3T5BA 3WKCA 3MB8A 4B48A 3AUUA 1GPH1 2QRZA 3PTZA 1ZEMA 2BEUA 5CAEB 1KZ9A 4ARIA 4EFKA 5GIPE 2YJ6A 3O90A 2YY5A 1OZ0A 5FIUA 1GYQA 1YDGA 2UZ1A 5KUTA 1YIAA 4GICA 4OUKX 2GVDC 3HVIA 3OQVA 1QZUA 5DN6A 4B43A 4CDNA 2PUCA 1E3IA 3B85A 4UVGA 3T7SA 1DKLA 2JAXA 2FHSA 5ENVA 1E1QA 2G4VA 4PEVA 2IYAA 9MHTA 4ZAXA 4XARA 1SELA 1SJ9A 5F4ZA 3JY6A 2WNSA 4NV1A 1RI4A 3PDIA 1I1HA 4XDHA 4NPHA 4AJHA 4BVHA 1FNBA 1H2ZA 2NUAB 4QKQA 4I55A 2R4QA 5KHOC 5EJAA 4I8XA 4ESOA 1I01A 4PNHA 1G2PA 1VTKA 2BC9A 2DHDA 3GPDG 3IA2A 4CNQA 2UU9B 1Z5GA 1PEAA 2C3OA 5EKTA 3EFHA 4LJ7A 1RWQA 1Z07A 4KO3S 3QEKA 4RY0A 5KZMB 1SVIA 4E7OA 4D80A 1GAEO 3GP3A 4IO0A 4ER7A 1GN9A 4BEWA 4NMHA 3DAFA 4ZD6A 6CHYA 2I7TA 3NP9A 1Y5MA 1X1BA 1K6JA 3L43A 5EJ2A 4CJXA 2Q9UA 2PX2A 1TLFA 1KIMA 1LPPA 4RVDA 3L9WA 2ZJ1A 4V0OA 4KR9A 3UJ3X 4QOHA 1YR8A 4YJGB 3PFHA 3QX7A 2OAP1 1RBMA 4J94A 1VIMA 1XK7A 1YMUA 2XJ4A 4X85A 3JAKA 4BZZA 1M1XB 3K9HA 4P38A 3PHIA 1QO9A 3QFTA 2NZJA 4GNRA 3SHQA 3KT8A 3SZOA 3TSAA 4PF1A 1SHTX 1OAKA 3AR6A 1G4HA 2WAMA 1MG0A 1UQRA 3P96A 4R0MA 3DZFA 5IJAA 4PBSA 1N9KA 1XMVA 4JXJA 4W5RA 4TKLA 4Y2PA 1MRSA 4QBGB 1KJWA 2CZQA 1RCTE 3JQ7B 3F6SA 1ZOSA 2CFSA 3PICA 3L0CA 2P3OA 5F5XA 1N36B 1SIBE 4QEDA 1JBQA 4JT9A 2XGGA 2GFQA 2QAGA 3DR5A 1NUQA 5HCNA 3U2QA 1Z8FA 1JEAA 1X15A 4G63A 2R5WA 1CZKA 1LPOA 3OJ0A 2EOAA 2V4UA 4H1WA 5GVSA 3WRVA 1GSAA 2ZDQA 1JIVA 5H82A 1ORRA 4E51A 1JG1A 3DDWA 1IBKB 1UP6A 1C0KA 4DGSA 3MJCA 2XMSA 5DNDA 3SQDA 2V45A 3OT1B 4G0OA 3T34A 4IF6A 3T5TA 4A23A 4UFNA 2UYYA 3O0TA 4YMTA 5BY2A 4KI0A 4BJ1A 4MCAA 4ZI7B 1BW9A 4MO9A 3TIVA 4GE0A 4MSUA 1HG1A 2IXBA 2FNAA 4ZYYA 1PFKA 1EFVA 3D2AA 4UAUA 4FSXA 2HSZA 4BN5A 2I9PA 3WP0A 1RRFA 2RHBA 4LV8B 3GOHA 3AV0B 4V02A 5EJ6A 4JAVC 3KYIB 3V42A 2JCXA 4CL8A 3OIFA 1B2RA 5BUCA 1JWLA 4QYTA 5CA1A 1T10A 2QSUA 1QO0A 2NTNA 3ZWQA 1TW3A 1AKUA 5H5JA 2B21A 1Z0JA 3R7AA 2CYAA 2HSJA 2WF8A 1YR1A 3IKMB 3U56A 1JFVA 4FEEA 2NTYC 3AVVA 4XPZA 1XX6A 1H8EA 1YUNA 2B8WA 3CR7A 5TNXA 5IKEA 1S2IA 3OJLA 4GD3Q 2VLIA 2ZRNA 4W5WA 4W8OA 2WB2A 2OAQ1 4F6RB 3M5DA 5EIBD 3TQRA 1V1MB 1N5IA 3VKHA 3A0UA 2VR1A 1OILA 3FLEA 4LSWA 1E96A 1Y3DE 1REQA 3HFRA 3PQ2A 2N42A 3HI6A 3Q6NA 2IQ5A 3KELA 4PHTA 1E9RA 1TZ2A 3FGOA 1ESEA 3H5RA 5DLQC 3UBMA 4DBZA 3PD1A 1AKNA 1FS5A 2BP7A 3DULA 4LN1A 5DNVA 3ZDDA 4BQOA 1QJCA 4CG2A 4ER6A 3VZPA 1Q1GA 1T1SA 4PO9A 3WWDA 1GPAA 2B35A 3G2LA 3QVSA 2NW6A 4NBLA 2IYNA 3IDFA 3KPWA 4PO1A 4RVOA 2GD2A 3K92A 3R3WA 2RHLA 3ZCQA 3SQXA 3WLIA 2IUYA 4PIPA 2EZ4A 2EQBA 1QFJA 2VWQA 3CLHA 2YRWA 4OD0A 4BB9A 2B0CA 1EG2A 1TGYA 2YWCA 4DAOA 2PANA 2EQAA 3TRKA 1FP4A 2R8BA 4WWHA 4EUNA 1E1RA 1TYZA 4MR9B 1T3GA 4A2CA 2EV9A 2IUFA 3AEYA 4QUGA 5KNDA 1SQ6A 3O2QB 3OFNA 4UCXA 3IQHX 4MQBA 5T4FA 2YWJA 2ZVJA 1ODSA 3OWHA 2C8JA 2XYVA 4I19A 3TW4A 4FZ3A 3HP1A 4TTTS 2DPYA 1YRLA 1KS2A 4E09A 1WLYA 1SZPA 4EUSA 3ZBPA 1E5VA 3TGLA 4X3CA 2Q3FA 1L4YA 2Q6TA 3I76A 4PZ0A 3FVRA 3ZJ5A 3BZBA 1JEYB 2FVXA 4S05A 1AS3A 4JDUA 1DJPA 2QUBA 1K66A 2O6LA 3O2SB 4OUDA 5ETJA 1CK4A 4KQFA 4BNIA 1NRIA 3M6LA 4IZHA 5EP3A 1P7WA 5K3AA 3FE2A 2WWWA 3KAPA 4ARUA 4LGCA 2JS7A 2BKAA 2ST1A 3L0ZA 3L8HA 5IF9A 4BMSA 1Z13A 1TMKA 5LPNA 4EIWA 4XM0A 3ADBA 5F4BA 5EE3A 3FRIA 3WS7A 2DBQA 1UM9A 4JUBA 2VQ3A 5D00A 3AVTA 4EPRA 4DT1B 2VP4A 3OX4A 1LK5A 1SG6A 3AL3A 4IOLA 1E1CB 2OZKA 4OIFA 3V1YA 1EFPB 5LIRA 4YUAA 2GCGA 2UXCB 2B8TA 1MOZA 2VPTA 3IYLW 3QE2A 3BXOA 4FFBB 1HKHA 1Y1RA 2EJUA 4RY8A 2OXTA 2I71A 4ZYWA 1JWAB 4UBKA 3N3BC 3M0EA 2AJ8A 3UA4A 3OZSA 3S7ZA 3SXPA 4YR7A 2R8RA 3O5AA 1SXGA 4OQMA 4F4IA 1QFSA 2X8JB 4FOTA 5HRAA 4XWWA 3VR6A 1MZPA 4TQUS 1A7JA 2HCTA 1NKSA 5IBQA 1FY2A 1D0SA 1YAHA 3QM1A 1ZR2A 2P6UA 3B6IA 1QRSA 1MAUA 2I3AA 3FHJA 1ODKA 2X8LA 4MK4A 3K5IA 2FQQA 4BO0A 3NX4A 1GRCA 3IPRA 3P7MA 1OX4A 1NY5A 1QORA 3L02A 2YDYA 2NPOA 4YMVA 4BP9A 2ACEA 3SM3A 1COWD 2WJPA 3BH0A 3KJNA 3OX2A 4ZXFA 3O4RA 4J1TC 3AKYA 4L5AA 4TWJA 5CNIA 2HPZA 4GBJA 4G9EA 5H7XA 4A1FA 5JCJD 1GVHA 3SQWA 1UMCA 3D3NA 4IM7A 5DBFA 1ESCA 3KYCB 4L22A 4PZYA 1W36C 4ZU6X 1PP4A 3ASVA 4L0DA 5UKDA 1VE9A 1WMEA 5JS6A 4BNFA 5LXTA 1HOXA 4HB4A 2IH5A 3BDIA 3DFZA 4JI6B 4I5IA 3WGQA 4F4UA 2D2VA 2LBPA 3B9PA 3OZAA 4UBMA 2IHVA 4CLHA 4URHA 4ZYLA 4P53A 1UBRS 2FPPB 3KXPA 4HZUA 3PNOA 4PPGA 2GXAA 5JY1A 3TTVA 3BOSA 2QBYB 3LPDA 4P80A 4DQKA 4NDNE 3QF4A 4YLGA 4ZT6A 3P0IA 1CS4C 1RI2A 1WSWA 3ESAA 4HXGA 4E94A 4RABA 3H2GA 1KJIA 4UFOA 1LK0A 3PEWA 1G5HA 1MENA 2V6MA 5C5EA 1RKQA 4EDFA 1R66A 3KVNA 4QBIA 4EYSA 1AUQA 4NV0A 2A9RA 3HMKA 2ADFA 2BSAA 1X80B 4QQ8A 3NPAA 5FLEX 1AMUA 3OG9A 1SNYA 1PWXA 4A36A 2OWDA 1RTTA 2G71A 3TM5A 3VHXA 5M29A 1ODLA 5I01A 4X3OA 2MMGA 2QD2A 2VUUA 3WOHA 3SAJA 1FVHA 3M1IA 4EF6A 5JT1A 4IIHA 4PYMA 4D56A 3TSCA 1NXPA 2ZKLA 3HCAA 1ACJA 1WXDA 4A0FA 3GLGE 3E0QA 3H7AA 3PX2A 5AMXA 3IAS1 2WJZB 3TRIA 1WZIA 4CCYA 3JVUA 4FMCF 2ZUDA 2YV1A 4KUEA 3PGKA 4UCWA 1BS2A 1AQNA 4MV5A 2D5AA 2HCJB 2BE7A 5SYAA 4GGOA 1D6SA 4FUTA 4FDAA 2HWWA 5HIMA 4Z8XA 3R7SA 3R74A 2PUWA 2Y27A 3B1VA 3KJZA 1J9ZA 4FX2A 2Q6OA 1S3IA 4M9SA 5DASA 3KQQA 5PGMA 4Q7KA 2VDUE 2QE6A 3KHKA 4MZXA 2W83A 3GGSA 2BMJA 4RK1A 2I7XA 4WTOA 2V0GA 4R2IA 1OV6A 5H83A 2PGDA 4ENSA 1B6SA 1Q15A 1QP8A 5C32A 3AUXA 1N3LA 3KV3O 3H8WA 3T3GA 3UT5A 1JJVA 3LOUA 1IHUA 4U63A 4WA8A 2DP4E 3UAOA 5HCUA 3WBKA 4Z4EA 4BO8A 4ZFNA 4NDAA 5AW1A 2WT4A 4UEOA 3RQIA 2UUBB 5CP8A 3PJFA 3CJRA 2DZDA 2PDAA 2CSXA 1WXHA 1KI3A 2VCYA 3TTWA 1EI9A 1MABB 1G66A 5KTKA 1I30A 3ROMA 5EL0A 4HRAA 1ZITA 3K6RA 1UKEA 2QYSA 3NWOA 3REQB 3TNJA 2O5EA 4FLFA 2UV8A 1PT9A 3NIBA 2XNDA 1O97D 3L2OB 4I8IA 1QAOA 2JEOA 2RMKA 4CEJB 4JP3A 1MCZA 3EGDA 1XO1A 1NP6A 1FTQA 3IMEA 5DO9A 2YN0A 3RLFA 3THWB 3CLUD 3OJXA 4NJEB 2ZXEA 1SR8A 1CDOA 4BBAA 2ENUA 3ROQA 4CCWA 3JQCA 1IUKA 1UK7A 2Q2QA 1YULA 4GR4A 1JIQA 4O4JA 4RMGA 1KQNA 2IDMA 3GH1A 4YX9A 1XAIA 4S1NA 4RDHA 1T5SA 2XUOA 3N2EA 4OBBA 3FZYA 3N2YA 2HREA 3UMJA 3VVCA 5JAUA 3HZOA 3OQHA 4ZGBA 2KS6A 3KQYA 4TKVA 1D9ZA 3OFJA 3WA7A 1K8YB 4QDZA 3T06B 1G7SA 2GVZC 1WMDA 4DPMA 5EEHA 3GJ4A 1Y4ZA 3TSWA 1NOIA 4L3OA 5J5VA 2JVIA 1RDFA 2JBHA 3N59A 5ICEA 1A8SA 2VCEA 3CRVA 3G2NA 3A9RA 3NNDA 3S2EA 2QMEA 4GXQA 5BSKA 1OXUA 3A6HA 1LLDA 1NQOA 3I9JA 4G86A 4PM4A 1MV5A 2JGAA 2YH2A 3EW9A 4MR7A 5IDYA 4B32A 2DHRA 1COZA 1P8JA 4RMHA 3U6BA 3VR2A 2CVHA 4ED9A 1WDKA 4WK4B 3SVZA 3TRDA 2GKSA 2FZCA 4OHMA 3Q5EA 1XLTC 2O2DA 1NULA 2EG5A 3C85A 1T4GA 4Q3CA 1D2MA 2PR2A 2A4MA 2DM6A 4CKBB 2VHXA 3ZXXA 2FQWA 4PRLA 3LTNC 1E0DA 1FTYA 2PWPA 5CLIA 5DHAA 4AMYA 1Z7EA 3J7TA 2FMFA 4QUEA 4TV8B 5AM1A 2Q41A 5FNZA 2OYCA 1OWLA 4NPCA 1DPGA 3S2GA 1E1LA 1FE8A 4PLZA 2OZLB 4F84A 4UTRA 2J87A 1W1IA 1UINA 3BWVA 4H7DA 1PI3A 2FEWB 3H5WA 1BN7A 4KQ6A 3AW9A 2EX1A 2J9FB 2IXTA 1G16A 1QYDA 1VJ0A 3H8JA 1E1RD 3TJRA 5CB4F 2LCIA 1RPJA 1OZGA 3AF2A 2PVSA 4G65A 4RIFA 1VKJA 5K3FB 5KYYB 2XA2A 1OWOA 2RHDA 2HBYA 2Q1WA 4FC6A 3BE8A 4HS4A 2NVOA 4OQYA 4BX9A 4HYQA 4IHKA 2GAAA 4MRSA 3AEKA 4RXMA 4CW7A 5LQJA 4D8VA 1E66A 1QZXA 2BFEA 2V6FA 3DHWC 3N28A 3RVKA 3C87A 3KYCA 1V6AA 4XEHA 2OCIA 4EBBA 3FMIA 5AVUA 2PCJA 5EJMA 1U63A 1KDVA 1G20A 5DIFA 5EAIA 1RRMA 4E2ZA 1Y7IA 2WTBA 4OJKA 2V97A 5K0BA 1L4LA 1QGUA 4MV8A 1ULAA 1DUSA 5DMHA 3OWXA 3RG8A 1E1NA 3KO8A 3UTCA 4EM6A 5K8UA 3SJBA 2FGJA 2OXIA 2B1IA 3WL3A 3I4FA 1NMSA 3A7EA 1SCQA 3CMCO 2GZSA 3DG9A 1KEUA 2FW9A 2IUSA 2WUEA 1NQXA 2XI4A 4KWHA 1TECE 4MGKR 1MP0A 2X8AA 2XLCA 1V5EA 5EHXA 4P3KA 1HQYE 3RKSA 1ETHA 1QHXA 3LLMA 4HD8A 1U7XA 1XJ0A 2VHVA 3O4HA 3O7MA 2OE2A 3GN1A 3IHWA 2EEZA 2L69A 3IAUA 4O4JB 4RJKA 4C22A 4D96A 4M38A 4FXOA 4WDRA 3LC1O 5JZ9A 1ZJ4A 4G2TA 2BEJA 4LYYA 4LMRA 4UVDA 1GZ6A 1VJTA 2EKQA 4LQLA 3LUHA 4KREA 1POXA 1BXKA 1DUIA 1I4WA 1L8QA 4RZHA 3A4MA 4IKOA 1NZJA 4RJJA 4ZPJA 4DT1A 2A3RA 4JXKA 5E4YA 5CB4A 1U0SY 2FPLA 4YIKA 1LSSA 2ZAGA 4YJKA 2ZBPA 3CUTA 3K71B 5ES4B 3O93A 4E2YA 2C9DA 3GAAA 3OJWA 3OX1A 4B5LA 4DEXA 1DDGA 2JFNA 1HE1C 4QU9A 4RVFA 1SBIA 1BE1A 1L4BA 4L3WA 3AUFA 2G72A 2GCOB 4LZLA 1J39A 1RHKA 2FLWA 2XVMA 2ZS7A 1QOQB 3NH6A 2GEJA 2Y71A 2OB1A 3ENVA 3VI3B 3BK2A 4CIAA 3NBKA 1EHYA 3W9UA 3CTPA 1GZ7A 3P0FA 1A1SA 4G1MB 2HEIA 2ZWAA 5A5DA 3DMHA 4HLUA 3COJA 3HO1A 1TO1E 2ORWA 2CLKB 2P1ZA 4HQNA 3MFYA 3ZJYA 1SOUA 3HPQA 3LQYA 1X94A 2AI3A 3EIEA 4Q4HA 3RADC 3H0CA 5JBQA 3CLTD 2C2ZA 2I4IA 3CUVA 3SYMA 3WWYA 2XNKA 1IOZA 2ADOA 4OSEA 3RAJA 4YHHB 3PPWA 1OC2A 1XRQA 3CURA 1E2UA 3HJTA 3TJMA 4D92A 2PAFA 3IUSA 1F8FA 2GAOA 5GZ1A 4I0WB 1U02A 2WFLA 4MV6A 1HBJA 1YCFA 3JZDA 4JFRA 5LUAA 1TRKA 3TDKA 2NMVA 2V5UA 1I5RA 4ZI5A 1N7IA 5G3YA 2QVBA 1RRVA 1XZBA 4HDRB 4OXXA 1DEHA 5BYBA 3OIVA 6YASA 4BRUA 1DRJA 3PNSA 1PJCA 5TEVA 5C8YA 4F3RA 4OYRA 3FF4A 4IHJF 4R41A 4JP1A 2BH9A 4MCJA 2CL6X 4PNPA 4XD7D 2DPLA 2DTDA 4HAWA 4ZAFA 2QN7A 5BT8A 4C14A 2B1JA 2HH9A 4LVCA 2GYUA 5E6SA 7ADHA 1U1EA 1R0LA 2ZBVA 4Z1OA 1UDRA 3MILA 4QX6A 4XCVA 3FCCA 5JISA 3TOCA 1FLNA 3N3AC 4BE7B 4BEBA 1E3SA 5J2UA 2VHEA 3GZTB 4BNXA 3SCZA 1LDNA 1WZCA 2VP0A 1IC6A 3DR3A 1W0KA 5DLYA 3PITA 4BNZA 3FHTA 3GYGA 2JLSA 1GUBA 1R0YA 3PNVA 3IVGA 5AW0A 4MGHA 3G6KA 2BFBA 3IUEA 4LI3X