4OAZA

Bldd ctd-c-di-gmp complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
PKLVLDLERLATVPAEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 27
structure length 75
sequence length 75
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4oazA00
2MC4A 4OAZA 5KHDA 4OAYA
chains in the Genus database with same CATH superfamily
2HZTA 2M3AA 2QUFA 3LSRA 3FXRA 3ERED 3I59B 2IA1A 4AUXA 3VOEA 3Q9VA 1YJ9I 3RZOJ 2M5WA 3TMOA 3MZ8A 2E35A 3H92A 3QPLA 1VF9A 2KRCA 3K4BA 2QQBA 4L5EA 4KNYA 1YW9A 1BOAA 5H2FC 2VJJA 1CF7A 3ZMTA 5FFZA 2UZKA 1LDJA 1U2WA 4CZZA 2NVUB 2QVOA 1FPQA 1E0EA 4OU0A 1F4KA 2RDPA 4XMYA 3CF2A 3HOXJ 4EGYA 4C2MJ 2P0WA 3EUHC 1ZG5A 4CA0A 2DBBA 1V5EA 3I71A 2L9SA 4Q48A 4XKBA 4M9ZA 3TO7A 4N9IA 1K83J 1IAWA 3BLYA 5LEKA 4RBOA 2L7FP 2VBWA 2EFNA 4LG0A 1IV8A 1K6YA 4XLNF 1FYKA 2K02A 3GLLA 4CCNA 4J01A 1XB4A 3QWLA 1FSEA 2XPUA 4WXDA 3OYKA 2CG4A 3CCEI 2IPQX 2OF7A 1LB2A 4B3XA 3G73A 1QVUA 5GTIC 2VI6A 5DCFA 3PUBA 1SVOA 3QU3A 1YRNA 1MGTA 4HAMA 1R58A 1DQUA 4CO8A 4XK4A 1G2HA 4XRFA 2A07F 4A6EA 2FQ3A 2X6OA 2W1OA 5E1ZB 3ABUA 5JLXA 2HOSA 1JKQC 2ME0A 2LY9A 1G3SA 1HQCA 4RB2C 4RGXA 1IN4A 1WFXA 1IJWC 1J0RA 1ENHA 2JPCA 3HKZA 5AIQA 5D5XB 2V1XA 4S04A 2STTA 2K5CA 4EJOA 3WGHA 3HYIA 3AG4H 3JCUC 2V1DA 5KVRA 3HDDA 2RC4A 3U2RA 2LD5A 3OL3A 4ZDLA 3KP5A 4QPQA 4HA8A 1TQMA 1WQ2A 2HQ5A 5FGMA 4E7ZA 1NH3A 2FOKA 2XAQA 3DBHB 3VWBA 4HLYA 3HOZJ 4XONA 4ANJA 5E3NA 3Q5FA 3PNVA 3I59A 3IL2A 1J09A 1BL0A 2E1MB 4YG2F 3TOBA 3S93A 5ERIA 2XPWA 3LA3A 4PZJA 1LVAA 3BTJA 5A2QZ 2HVSA 1Z3XA 2ZMEA 2X0LA 1BIBA 4NC6A 2R5YB 1W1WE 2KRFA 2HPIA 3DCFA 5FFXA 1W0TA 2RKHA 2VE9A 2R7XA 4GDFA 2DFEA 2Y2ZA 4OINF 5ILSA 3JRDA 2PMZN 4MEXF 3ULQB 2JUGA 2LY2A 5ILVA 2D2WA 1FWZA 1LE8A 2VODA 2H8WA 4EJUA 1TBXA 2E71A 4V19K 3C2GA 1F5TA 3V7CA 1DP3A 1G59A 2E2IJ 2A61A 1IZ1A 4HNVA 5LRRA 5GADJ 2F2EA 3DEEA 3DTKA 1HKSA 4GGGA 1Z05A 3I4PA 2R7UA 2R5ZA 1N25A 5HLHA 3JSOA 3GWZA 1BM9A 4JQFA 3HHGA 3GX4X 2W25A 4CYDA 4J19A 5B3SH 2XF5A 2P5LC 1ZR4A 5TISC 1P4WA 3TDZC 1LEAA 4Y33A 5LFAA 1PVEA 3IKVA 3ZN0A 3S1MJ 2MH2A 2ETHA 2VC0A 3ESWB 3ZQLA 3BTCA 3J7AY 3FHNA 3M4OJ 2VQGA 4IPAA 4EJTA 1TTYA 3DP7A 1V55H 3AFHA 3DFGA 2BY2A 4JX6A 3LA7A 2ESHA 2GOMA 1MBGA 4O5VA 4B4CA 4A12A 3VYSB 3LMMA 2IVMA 3W3CA 2HFHA 3ZGKA 1W36D 3S3MA 4PFOA 4Y17A 1W7PA 1B6AA 1PP7U 4RB1A 3FBNB 2HWVA 2CGPA 3GTGJ 1GHCA 2X6WA 2X1CA 3OYCA 3E7LA 3GF2A 5L3DA 2PFBA 3F8FA 1TL8A 1T56A 1T2KA 3GTJJ 2CW7A 2D1VA 2BHYA 1EH8A 3O8GA 3BR3A 1HKQA 5M3MJ 3JREA 3T5XA 4QWQA 2AXTC 4LJZF 1OYWA 2JZYA 4RM3A 3S17J 3LSMA 2HYFA 1G3WA 3GTLJ 5E3OA 4MIMA 2CO5A 2FEZA 3ZPLA 3WHCA 2GOXB 3WHBA 2EIMH 1HSTA 2MLGA 3A01A 1YG2A 1ZLKA 3DBLB 2XROA 1AKHA 3K4NA 1Z7LA 2CUFA 1T95A 2DTRA 2ZNZA 2JRTA 1PYVA 3KZYA 4DGWB 3PIOF 3OSGA 3HRUA 3OS0A 4NNJA 2X6YA 2NS0A 2FJ1A 4PJMA 5JVTA 2XRNA 5GAGJ 2UXNA 3WU2C 5E8GA 1U9OA 4KMUX 2VOOA 4BQQA 2HKOA 5CVRA 2X4HA 2G7HA 5ICGA 2AQFA 2ZXIA 4UHTA 4Y52J 2CQNA 3JRFA 1NG7A 1R23A 2GA1A 2HVQA 4Y3OA 1RUNA 1ZRCA 4FASD 3GZ5A 1SMTA 1H89C 4CUGA 2LK2A 2COBA 2FU4A 4ZYAA 3BJAA 2ISZA 1Z7UA 2CJJA 3I56I 2OBPA 9ANTA 2ZXWH 2F5DA 1VQPI 2JA5J 5E17F 3NWSA 2BW3A 4I2OA 2W00A 3A03A 1CGPA 5EJCA 2J5PA 3QOEA 1XMXA 1IDZA 4GO1A 4BE2A 3S2DJ 3IWZA 4ETSA 2ZMEC 2ID6A 5F0FA 4B48A 4A3LJ 1GT0C 4O6JA 4WK8F 2X6XA 1N78A 5CLSA 4HNTA 2R0QC 3GFLA 5IT3A 1XX5A 5FKMA 5LRSA 2Z3YA 3MD2A 3HSFA 4FE4A 4M74A 4PGGA 3UR3C 5M5XJ 2EV0A 4IXAA 4FX4A 5BQTA 1TWAJ 4XRMA 3JRCA 2E7XA 2Y75A 1BR1A 2XKPA 1TT5B 1BI1A 5J1RA 3RI4A 5TRDA 2V6EA 2LF7A 3BCBA 5BOXA 2LOOA 2DW4A 2K3PA 3E5UA 3CCJI 1D5YA 2QENA 2WA0A 1Z0XA 2AQEA 4HNUA 2WB1A 1ZHFA 3G71I 1S29A 4Y13A 1YHQI 3BQYA 4HX7A 4A3IJ 1VQ4I 4L5JA 1MMDA 2DOEA 3KYCB 2WADA 4LLNA 3R0AA 3K70C 2G9WA 3DTEA 3H9JA 4H0EA 3DLLF 2F5EA 5L3GA 4DNCA 4L9JA 2CV0A 3MEXA 1HOMA 2R7QA 2CFXA 1GVDA 3ASNH 4RB3C 3VB2A 2JUCA 4LIVA 1TP4A 1NTCA 2BE5F 1Z67A 2VL8A 5GP9A 4D5FA 1JTYA 5EG0A 1YS7A 2QKLB 3C3WA 2KP6A 2DA3A 2DA7A 1BI0A 3IH3A 1XD7A 1NG6A 1YTYA 3AG1H 2XAGA 3K1PA 3GFMA 2V4JC 2XHKA 2V6CA 2G0EA 1X4PA 1GDTA 2YX7A 1PJRA 5E20A 2DPUA 1IRXA 3W6VA 2QBYB 3JRGA 3EUHA 3HOSA 4E7LA 4M9XA 1TWFJ 3KIOA 3CCSI 1XGSA 1K7AA 2YSRA 3K69A 2W57A 2JVHA 3ABKH 3M8FA 2Y0SN 1A6QA 3SEZA 4IQ4A 2EFPA 2E2HJ 5CVJA 3KEOA 1Q1HA 5AIPA 3SZPA 1P2FA 5GAHJ 1I1SA 1IGNA 4FTHA 1BN5A 1HBXG 3LSGA 2KPMA 1J75A 4ZDOA 1ETVA 1MIJA 1OR7C 5KCMA 3W2WA 2FF4A 5J4YA 3MVPA 4C3JJ 5J1YA 4E7HA 3MWMA 4OAYA 3LAPA 1MNEA 2LDUA 1SD7A 3H5RA 4OMYA 3AL0B 2GZWA 4OMZA 4HX4A 3BPXA 1R9TJ 1A04A 4IEJA 4R1HA 4P5OA 4DQ2A 1Q1VA 4J00A 4D0PA 1NK3P 1MMNA 1RC9A 3NWTA 4EV0A 5EDNA 3FF5A 1VQ7I 2E1NA 4A0YA 4XSZF 1X1DA 4B1RA 1HDDC 2QEXI 2XSJC 3TDUC 2VOPA 2KQRA 4BU2A 1UG0A 4L5IA 3HTSB 2JRMA 2ZJQF 3U1KA 2JN6A 5HLIA 3IH4A 2R7TA 3GEZA 1K4TA 2PMZA 2KIFA 1K6OA 1MH4A 2QSFX 1F36A 2DN0A 2ZJ2A 4OIQF 1W5SA 4HX8A 4A69C 5FD5A 2CW0F 2KDZA 3CCLI 3IWFA 3LA2A 2XGDA 5CYVA 4ZYGA 1WVRA 3CUQA 1JJ6C 1JKRC 3V7SA 1Y8QB 4I76A 2BYVE 5IP7J 2ADUA 3PNYA 1HLVA 1SD4A 1UHWA 3VDXA 2UWMA 2DMQA 5C4JJ 1OYYA 5EEGA 4P96A 4MO7A 1FYLA 4H4KC 1HW5A 2QCOA 2KZGA 2QGUA 1LFUP 2VKVA 3J7ZI 1ETYA 4N9HA 3R6SA 1IG7A 2E1MC 2VKEA 2OCCH 5CPRB 3I9V2 2GXAA 3Q3SA 4RM2A 1AKHB 3K4JA 4RMNA 3QPHA 4F93B 1TQIA 3QPTA 3D5SC 5M5WJ 2DXIA 5E3MA 1E3OC 3ZQHA 4L9VA 4M72A 1T39A 3S15J 3LSHA 4IZZA 5ICCA 2DQRA 2P7VB 3KEQA 1XPXA 4PJNA 2QQAA 1B4AA 5BPIA 1VQ8I 2OD5A 1TZLA 3ZOBA 2ZC2A 3KP2A 3ZMZA 4ENJA 2BVLA 1FIAA 1LDKB 4IKFA 1R1UA 2GXGA 2A68F 1MDMB 1E3HA 1U5TB 1KQ0A 3ASOH 1IXCA 3E97A 4I7HA 1QQIA 4HDVA 1QU3A 2RNJA 1XSVA 1SC7A 3RKXA 4HRIA 2JSPA 3OIOA 4WXHA 4MHGA 1PDNC 1WJDA 3PFIA 5K7ZA 2TCTA 4S0HB 1TWCJ 2Q2EA 3F0CA 3FM5A 3FKJA 4KYWA 1JT6A 3P9CA 5KAFC 1JE8A 4PDKA 2LR8A 4RB0A 1VQNI 4UVCA 2KL4A 3FK7A 3GO5A 2CS3A 2XGXA 1S5LC 2ELJA 2HQAA 3BR0A 3VSKA 2CV1A 2KT0A 2Z33A 2UXXA 2VASA 4LG0B 1N77A 1ZN2A 2DFIA 3H3VK 1KU3A 2MH9A 1LDDA 2ICWG 1U9NA 3L2VA 1ERDA 1JJ8C 1AU7A 5B1BH 1O3SA 3WTUC 1IUYA 1FX7A 3AKZA 2GLOA 1ZRFA 1RRJA 1SAXA 2XV4S 4ESBA 5LGUA 2P5VA 3I4NJ 4NC7A 6PAXA 3ZMSA 2X51A 2GM4A 1KZHA 3CP8A 1Y0NA 3K4CA 4LITA 1AHDP 2ZCWA 4XLPF 3K70D 3M8JA 3SQNA 4ZYEA 3IKTA 3S1QJ 5D4SA 2KHMA 2XRLA 3BG7A 4FHTA 1D5VA 3S8PA 4KISA 1UCRA 4RGUA 4RDUA 3G6EI 2DI3A 2PI0A 2O03A 2FNAA 2DU9A 2Y0MA 2VJIA 5D6EA 3H5AA 4A2UA 3NARA 2W7NA 3JW4A 4LLLA 3CCVI 4MGRA 4PGHA 1JHFA 4CCKA 5J8CA 4IHWA 3PO3J 1GXPA 3F6OA 2QLZA 1HXDA 1X2NA 1WSUA 2NVYJ 4BNCA 4A93J 3TW7A 4PJJA 2KFDA 4UUSB 5BS6A 1SAUA 2QA4I 1H88C 2DDAA 1OCZH 2EWNA 4RAGA 3JRAA 1WI9A 4B8XA 3GVAA 3K4LA 3M9AA 1T0FC 4LD5A 4NUBA 1YOVB 1MBJA 2Q8KA 1WPKA 4YIFA 3HRSA 3R60A 2MABA 2VPLA 1MBHA 3K1NA 3GUDA 4U7BA 4BXXJ 1OKRA 3EUKL 2BVMA 2A69F 4XORA 1VQ9I 3REOA 4A3GJ 1XC5A 4MLOA 3WGIA 2IGMA 1WJCA 3ML6A 2OPTA 5JHUA 3F8BA 2D5VA 4U88A 2O9LA 4HDUA 4XLHA 5E8IA 1X3ZB 2F4MB 4XOTA 1FMWA 2NNNA 4BQOA 5HOOA 3OYMA 1Z9CA 1ZGJA 1DDNA 2KDOA 3DKXA 3HG9A 4G12A 3E6BA 1LE8B 1D8KA 1X3UA 2GA2A 2ZXJA 2LBFB 1R49A 4EEFG 1MMSA 3EQLF 1J5YA 1HSJA 2Y0SA 4AIKA 3L2WA 3RKWA 1SVMA 2LKPA 4GYIA 1XCBA 1WH7A 3UKGA 5FLXK 3DU6A 1R1VA 1B72A 2EZIA 1HW1A 5LLQA 3CO6C 3GBGA 1OCOH 3HSRA 4RA2A 1RR7A 2ELKA 3IC7A 1T8IA 1WCMJ 5GAEJ 2M4KA 3G1MA 4EQQA 5DEQA 2C6YA 4IRHA 5B1AH 2EQRA 2Z99A 1A5JA 4D7MA 1LVKA 5K5OA 2DT6A 2HQNA 2MYSA 3OYHA 5FLVA 1GV2A 2IXSA 3K7AJ 3WODF 5IYCJ 2KIQA 1XMAA 3R61A 3K1MA 1T08B 2HOTA 1FP2A 3WGGA 3QRFF 2KMUA 3HOUJ 1FT9A 4KN7X 3N4MA 3QOPA 2K27A 2XGEA 3BZKA 2W24A 4A3DJ 3CDIA 4BL0B 2E1OA 1D8JA 4F55A 2MD0A 1BBYA 4LB6B 5A2QK 3A0BC 1MD0A 5FLXZ 3LQRA 3A0HC 1TWHJ 4AWXB 1VQ6I 4HV5A 2JWTA 4WX9A 3TKYA 2FBIA 3QQAA 1RKWA 1BJAA 1YIOA 2JA7J 2CRGA 2WAFA 1E2XA 1F1ZA 3HOYJ 3HEFA 1JTXA 3HOVJ 1JKPC 1W36C 1Y1VJ 2STWA 3HSEA 3FKIJ 1IN6A 2YU9J 3K10A 5E3LA 2KIUA 2EPFA 1SVLA 3BROA 4YELA 5K5QA 4V2GA 1I50J 4G7ZF 2QYOA 5H20A 2VB6A 3ZMVA 4ZYDA 4G9YA 1LFBA 1T98A 3J80K 5DUKA 3JSPA 2WWYA 2EFOA 3DBRB 3CLOA 4IL6C 1MJAA 4MFDA 2HDDA 2H6CA 1R5GA 1OCRH 3K9TA 1DPUA 3F6VA 3OWTA 4UY8I 2LFBA 4L0ZB 3SFZA 2W48A 3BR1A 1FIPA 4X1EA 2WB1N 5HODA 2LTPA 3LL7A 3TGNA 3BG5A 3HIFA 4BEHB 4E7KA 3U1DA 2A6EF 4RLFA 2H1KA 1LKXA 3BG6A 3RKYA 3HKZN 5K7FA 3SXYA 4OWRB 2IS1A 2MA3A 5EYRA 1KA8A 1P4XA 1MDMA 1WJ5A 3D0SA 4XKCA 2VJ5A 1ZKGA 1ETOA 3S2HJ 3WTWC 2FX0A 2ELHA 2ISYA 2R5YA 4MTDA 2YUSA 4F92B 1KYZA 3BR5A 2PMUA 4BJ6C 2O8KA 1U0JA 5F08A 4HW0A 2HS5A 1FSHA 4XLCA 1YE9A 1P4AA 2K4BA 3EUAA 4NHJA 1AA7A 1R5HA 1X1CA 3FZVA 1H8AC 2EFQA 2BW3B 5EG0B 1U78A 4UVBA 4LG3A 3L2CA 4Q47A 5CVVA 4I02A 3CUOA 4M6YA 3OYJA 2OZ6A 4G94A 3FMSA 1IN8A 2HI3A 3IRRA 1EV7A 4QLCU 1FEXA 4A6DA 1UHSA 3OOPA 3ROUA 3OS1A 5M3FJ 1LEBA 3JTGA 1FBUA 2QBYA 4HSRA 2F48A 5ED4A 3K4MA 1WHUA 1XMKA 5HNHA 4L9TA 1FZPB 2P8TA 4YRVA 1MNDA 4CCJA 2A6HF 2XC7A 2BHZA 5F27A 3I4MJ 4KMFA 3TQNA 4ASNA 4A5MA 5HNFA 3LAJA 4BUPA 2LVSA 2JSCA 4I0AA 2RGVA 2DDBA 2HYGD 4L0YB 1UAAA 1BC7C 3F21A 5F04A 2OAZA 4XKWA 4C9YA 1EH7A 4LIUA 4LMYA 4BQAA 1Z6RA 2RQPA 5FJ8J 1LNWA 1O4XA 2F5FA 1RPWA 4Z2YA 4AU7A 2IA0A 4B3AA 4PSXA 1ZK8A 1WWXA 3IUOA 4D5CA 4ZH4F 2GQQA 4D9JA 3J81Z 3VYTB 3GYHX 3V4GA 4XRSG 2TDXA 4XIDA 1RKTA 3V8LA 3WTTC 3COAC 4XSXF 5C3EJ 3K2AA 3FIWA 2P6TA 1ONVA 2LKXA 4UUVA 5LHGA 1BW5A 1KQ8A 4I98B 2FA5A 2RNGA 1IDYA 2XAFA 3QP5A 3ABMH 1ETQA 1FY7A 1JGSA 3PJRA 4C3IJ 5F0CA 1U8RA 2Z16A 2ZSHB 5J6XA 1LJ9A 4Q4ZF 1EJ9A 3C2BA 1HDPA 3GLXA 1RZ4A 3ZMDA 1SFOJ 1FMVA 4CGZA 2X85A 3FISA 2N8GA 4M73A 3SDGA 2KISA 1Y39A 3OYGA 3KYDB 3SJMA 5FKKA 4QSHA 1YFHA 3WTSC 3OYLA 3SHFA 1IUFA 4LK1F 2IJLA 3HUGA 2WY8Q 4II3A 3H9QA 1G3TA 2MW8A 2OTLI 4HF1A 5FRMA 1MNMC 4FT8A 2M9HA 3PNTA 2BZTA 3K0LA 3M07A 2DPDA 5E18F 4XN3A 2W4SA 5FD6A 4UUSA 3GCMA 3RJPA 1T33A 1X1PA 2G7UA 4EM1A 4GXOA 4RS8A 3DXJF 4P1WA 2IGNA 3FXMA 3HXLA 3HTUA 4BDYA 2K9NA 2M7AA 4P9UA 2Y9ZA 4UVAA 1DU6A 2DAOA 1P92A 1R4MB 2FSWA 1QZYA 3DKWA 4XR6A 4JOMA 1QGPA 5DCMB 3DPUA 3A4CA 5DDGA 4FCYA 1I6XA 4KICA 4U0WA 1I39A 3VEPA 3V42A 5J3LA 3HRTA 5EF6A 3G1LA 3KP7A 3ECOA 2DFHA 3OS2A 2OJED 1S8NA 2GXBA 2OUMA 1B72B 4A3JJ 3HPGA 2H6BA 3B6AA 2JMWA 1YLFA 1X3WB 3GTKJ 1XS9A 3OYEA 4UB8C 1B8IB 2UV1A 2V1NA 1IF1A 3HPHA 4HZFA 4S05A 1T38A 3WU1B 3OIPA 5J47A 4BBRJ 4PCQA 4AYBN 2VKHA 3FXUA 2FOWA 3TP3A 2LBFA 1B59A 2R7FA 2VPRA 1MH3A 3X2QH 3MKWB 1EA3A 4XQFA 3M3YJ 2NOJB 1EH6A 1TW3A 2L9RA 1C0WA 5DUIA 3S3NA 2V1UA 3DV8A 2KKOA 3D5RC 1XDSA 4ITVA 5IT9Z 2DA2A 4NQWB 4YIRX 2R7WA 1RESA 2WAQA 5EGOB 1YW7A 1XN7A 2BY1A 4ZDPA 3GZ6A 3ZN1A 3JAMZ 3EPZA 2V7FA 4CSWA 2DYRH 2XDVA 3CD6I 1JUPA 2VC1A 3N05A 3ONQA 5F64A 4W1UA 3KP4A 1LQ1A 2O7OA 4M9SA 3GZNB 4B43A 1UMQA 3E6MA 1VI0A 1SFEA 2JA2A 3F9KA 2YPRA 3ZMUA 1YW8A 2LYCA 4AD9A 2DYSH 2O3FA 4G8XA 3I3LA 4UUTA 4CYCB 5K1YA 4UNOA 2HGCA 3BC8A 3F8MA 1Z77A 4XL9A 4XN0A 3KPHA 3WTXC 1IRGA 3O8HA 4M3DA 1R7JA 5CQEA 1ZQ3P 4BHCA 3OMYA 5FB2A 3GMEA 2M8EA 2L5QA 3HL2A 1YX5A 1OCPA 4HBLA 1QPIA 2O0YA 3FXOA 2ZXHA 2FBKA 1S6LA 2F5CA 1I3AA 3RYPA 3E6DA 4ESFA 3TBIA 1FJLA 2NS8A 3CF5F 2DMUA 3CTAA 2Z9OA 4GFBA 4CDGA 4BEHA 2JK3A 4ABZA 4A3EJ 5LGNA 3S14J 2LH9A 4M3FA 2A6TA 4XNFA 1U5TA 2HXIA 2XAUA 4N0BA 1YQAA 4HLXA 3EETA 4RGSA 5E1WA 3QODA 2BOLA 2E34A 1PP8F 5J1UA 1V54H 3MZHA 2RV8A 2L54A 5B66C 1RIOH 1XCVA 4WXCA 3F22A 1TNTA 4RGRA 2BBYA 4ENMA 3DU5A 4WWCA 2Q2EB 1GVJA 2CUEA 2LMDA 3GTMJ 1FOXA 4DYCA 5F0HA 3ZQ7A 2DK5A 3ZXSA 1VNDA 1FLIA 1I1GA 1K4SA 4ENKA 4KA4A 2L0KA 3KZIC 1JI8A 4MQ9F 3CJQB 4G6TB 3PFYA 4P55A 2VQCA 1TC3C 2NVQJ 1TT0A 3GW2A 5E79C 1X1BA 2OC6A 3DF8A 3OSFA 3HBLA 2JQ7A 1IV6A 1OQYA 4BJTA 1TWGJ 2HNHA 2NOGA 3T0YA 2VT2A 4XRSA 4LK0F 4YFXF 5F1JA 1BR4A 3AG3H 4C2TA 3CJNA 2XB5A 5IP9J 3ZCOA 3KYLA 2IEKA 5KAIC 2MD5A 1POGA 4IF4A 2JT1A 2R7OA 1FP1D 1Y6IA 1WJEA 1U5TC 2E5ZA 2IBDA 2NRAC 2FBHA 2K86A 4XBFA 2H8RA 2I5UA 1ZAOA 5LHHA 1ZGWA 4IHXA 4IRIA 3C2HA 1YX3A 3H0DA 5DTDA 4DZJA 1FTZA 3N97A 1JKOC 4BBSJ 2YX4A 3P5JA 1D1CA 3I54A 2IT0A 2EV6A 2EZKA 1V5FA 4BAYA 1VQLI 3GTPJ 4BY7J 4OIRF 1XGOA 5BNGA 4AIJA 4YFNF 2JA8J 5FKNA 3QYFA 2GIVA 3CUQB 3KLOA 4PFPA 4DYQA 3QP6A 4ZZDA 1K61A 3DQVC 2BXZA 1LUJB 3I58A 4MNUA 4MQVA 4LFUA 4BXUA 3T1BA 1A31A 2QSHX 3CMMA 2MLKA 4C30A 3F8NA 2EINH 2GBYA 2XF7A 4NBQA 3RPUA 2AS5F 1IW7F 2QQ8A 1T6SA 3HUGB 4O3MA 2HZDA 3L2UA 2HDCA 2CU7A 3KX2A 4IQJA 1GXQA 1O3RA 2L9NA 2FMLA 1USSA 3JRIA 5DD8A 2ACJA 1OPCA 4XICA 3BG9A 1NHAA 2E36A 4BACA 2F4OB 3HC7A 1OCCH 2XVCA 4G6DA 1XTAA 2M30A 3HHHA 4U87A 5IOZA 3ZQFA 1R6RA 2MFZA 4EGZA 3A1YA 2OQRA 2LG4A 2MBFA 4MTEA 5GPCA 4CCLA 4CCMA 1SEUA 3KFWX 3C1DA 3RDIA 2Y30A 3JR9A 3Q0UA 1W0UA 1D1BA 4F52A 2H27A 4XOPA 2VJ4A 3H0GJ 3ZQIA 3W2AA 1FTTA 5E1XA 4GYGA 5IT9K 1Y8RB 3PM1A 2VXDA 3FXQA 2HVRA 2VBYA 2IGOA 2K4JA 5HS7A 2WV1A 2R7VA 1GV5A 1E3PA 1TQPA 2LY1A 5KNLA 1G8XA 5LD2C 2LC2A 2AO9A 2L4AA 4F3QA 1JGGA 4PUSA 4B44A 2Y9YA 4EMSA 1FNNA 2DMTA 3PO2J 1HC8A 5H6RA 1X19A 3FBIB 2GWRA 5ILUA 2OQGA 4U7DA 2CYYA 4KUMA 2VKDA 4WCGA 3BJOA 3ISPA 3WTVC 4LB5A 1QHHD 4E4HA 2K7LA 3TOAA 1MZBA 3ZQCA 1YI2I 2MSYA 3MMYB 1RUOA 2ZJPF 2L7KA 2DTZA 1HF0A 1ZARA 2DA5A 4KDPA 3BDDA 3DPTA 4NQWA 3O2PE 3J80Z 4FX0A 3QU6A 1G4DA 2DA4A 1CF7B 1Z3YA 4HOBA 1K79A 1MMGA 4HF0A 4KIFA 1WJAA 1MBFA 3M7GA 4LGWA 2ZBKA 4NDLA 2PQ8A 5B5EC 3FX3A 3V7RA 3MCZA 2ZB9A 3H35A 2VONA 3ZQGA 3E0JB 2WAEA 3F23A 1MBEA 3B73A 3TW6A 3S1RJ 1YJNI 1ZREA 1ZLJA 4E6KG 3WTZA 3L00A 1RI7A 5J40A 3PSFA 3H36A 4P9FA 3T8RA 2VUMJ 3MFKA 3ZQQA 5DV5A 4HSTA 1XGNA 3CCQI 1BOBA 2ZJRF 5HS8A 1HA8A 1U8BA 2VLAA 1YS6A 4JX4A 4OIPF 3SEQA 5FKLA 2L7MP 3I64A 4W97A 3FM3A 3H3ZA 1UG2A 5EZHA 3SDBA 3EYIA 3I53A 1FOYA 1PUEE 1WI3A 3RZDJ 1P7IA 2CV2A 3JRHA 3FHZA 2DT5A 1QHGA 1D0XA 3DLAA 4XLEA 2A5YB 3AL0C 1S9HA 3CMYA 3HRMA 2AHQA 1H9TA 3S32A 4HEA2 4M3BA 1U6GA 4ENNA 2XKOA 4B47A 2O61A 2YU3A 1E17A 1I27A 3FDYA 1BW6A 2DCEA 2ECCA 4CCOA 4IHTA 2WV0A 2P81A 5LGTA 3J81K 1O3TA 1F9NA 1DGRM 1QZZA 2B7EA 3P9IA 5JR3A 2DT7B 5HDKA 4DW6A 3OR1C 4DJAA 4KT6A 2EV5A 4XM3A 3WE2A 3WU0A 4OAZA 3FK6A 2P4WA 3RTRA 4BYYA 2FD5A 1IRZA 3BOQA 2E19A 2RQQA 1TNSA 2H09A 4TV7A 3QAHA 3PL8A 5D8LB 5ICFA 2PX9A 2E2JJ 2QKMB 4GCVA 3G4SI 1KU9A 3GTOJ 2HU9A 5HVQC 2M45A 3V8KA 4V2FA 1ZG3A 4E7JA 2M8GX 3GFIA 1Y1WJ 1JT0A 1S7OA 3OYNA 4C2UA 5JI6A 1W5TA 4BHBA 3F72A 1QRYA 4JBAA 1IN5A 2EIJH 1VTNC 1OR7A 2VBXA 3BWGA 3JTHA 3HOWJ 4LLGF 3G2BA 3CJTB 2O8XA 2VQHA 3LWFA 4XKVA 4R79A 4A3KJ 2E60A 4I99C 3FWEA 2IS6A 4U0YA 1FOWA 3RCOA 3BCAA 5D6FA 5LBQA 2EFWA 2JJ7A 2UUZA 2ZFWA 4PK4A 2R7RA 1AOYA 3OOUA 2KZVA 3BQZA 4NB5A 1A36A 1R36A 3CP2A 4EM2A 3L2QA 4IHVA 1O57A 2K3FA 3MQ0A 2WC2A 3WG7H 2L4MA 2L3DA 2VE8A 3AAFA 1J9IA 1QVTA 1R4NB 4Y15A 1GLNA 2DK8A 1PUFB 3G3ZA 3DEWA 3CLQA 1ETXA 1S72I 4M6VA 1WJFA 1DP7P 2PLYA 2ECBA 3UNGC 3LNQA 4HPQA 2PJPA 3C18A 3SZGA 5D5UB 5D8KB 2DOAA 1WGXA 5IPAA 2CFOA 4KIBA 3RPUD 3A2KA 4BE0A 3FMQA 2V9VA 4M71A 4HQEA 3E5XA 4YIIA 5KHDA 1YIJI 1KU7A 1LPQA 2PG4A 2H1LA 2X48A 4NC8A 1OLTA 2BV6A 1KU2A 2IS4A 2XIGA 2CQKA 1BI2A 3U9GA 1T0FA 2F4IA 2W85A 2ZSIB 1Z6TA 4HYEA 5D5WB 1UHMA 3MKZA 2GAUA 2MC4A 2Y31A 2Z1DA 4YFKF 3M1CA 5EGOA 1EF4A 4IJAA 5CJ9A 3CDHA 4PJ0C 1MJBA 2IA2A 3OIQA 1SFUA 2A5WA 4I6ZA 3TEDA 3IH2A 1DUXC 4I09A 4ZYHA 4G7HF 1KGSA 1S7EA 2ME6A 1SD5A 3CC4I 2PEXA 4YEJA 4BHPA 2WAQN 1MJ9A 2DJIA 3S2WA 1P6RA 1EKEA 3KEYA 3RYRA 1F43A 4ZC3A 1L3LA 2XAJA 5IYDJ 4LOCA 4CH7A 1H9GA 2DA1A 2NS7A 2VT3A 5DCMA 3RSNA 5DS9A 2E1CA 2L01A 2B9SA 4DZPA 1J7KA 1MKMA 2M0CA 2OU2A 2NYXA 2OZUA 1VFCA 4D1QA 3LSIA 3CZ6A 3HJEA 4A5NA 2M87A 2Q0OA 3BZ6A 1UFMA 2HOEA 1MW7A 2EBIA 1G3YA 4L18B 2K9LA 4U0VA 5FKOA 5L3FA 2CQQA 3KETA 2DO7A 4KT5C 2CH0A 2PN6A 2HPMA 1HCRA 4Q5SF 1JXSA 2EB7A 3BY6A 3K6GA 1APLC 3R0JA 1Y56A 5J8FA 4Z6YA 2K40A 3CO7C 3TO9A 4B09A 1I5ZA 1HKTA 1JUSA 3IP4B 4BS9A 2F5VA 4M3GA 4IOAF 2DA6A 2FNPA 2YR2A 1H0MA 4HF2A 2OTJI 1O7LA 5F1RA 4G6QA 1ULYA 1ORKA 3LSTA 3OYDA 3H3UA 3OY9A 5C4XJ 2B0LA 4OOIA 1QBJA 2EZHA 5JVGF 1Z1DA 1SFXA 4G7OF 5HDGA 1XG1A 3FXKA 5CQGA 2CSOA 2LREA 2O6GE 4N4OB 3QYEA 2BEOA 1BIAA 5H6QA 1FC3A 4GRIA 2FQ4A 1KYWA 3KZZA 2HOAA 1W5CC 1D3YA 3PUFA 1IXRC 4ZTFA 2EH3A 1SMYF 1VQOI 3SFIA 3OV8A 5CVIA 2KIMA 3L9FA 2HXOA 2EJRA 5HLGA 1YYVA 2FXAA 3Q0VA 1ZH5A 1YJWI 3RQ4A 3W6KB 3OYAA 1L0OC 2IAIA 2L2OA 1OCTC 3GXOA 2EA2A 2Y69H 2XSDC 3M8EA 5BPDA 1ZTRA 1ETKA 3VODA 3CCMI 1OFCX 1ON2A 2V26A 3LSKA 2BXYA 3SZTA 3S16J 2HYJA 3FXLA 3PQJA 2L7ZA 2P5KA 3CQZJ 4BQNA 1DU0A 3HB9A 4AYBA 2K85A 5TJJA 2KLOA 2ZO4A 2M7BA 3ERMA 1R22A 3A02A 2R5ZB 4ON0A 4E7SA 3M1EA 3O6BB 3J7AO 2DLLA 2JPBA 3LQQA 4MEYF 3L2RA 4X6AJ 1B9NA 4BGDA 1P9QC 1B9MA 3FMRA 1WZ2A 4JK1X 4DBQA 2RAEA 2FMYA 2XPVA 3OYFA 1I3QJ 2I10A 5IP6A 2OCEA 1B1BA 1M1EB 1REPC 5F6FA 5J4VA 4BXFA 2L9VA 5FLMJ 3DTIA 2EILH 1QZEA 4EM0B 5M5YJ 4D7NA 3CC2I 2K9QA 2GIZA 3V8JA 1X4OA 2DMNA 1QPMA 3TO6A 4ZJZA 5IYBJ 4EATA 2VN2A 3HOTA 2NVXJ 1YO5C 1R1TA 2PMHA 3WE3A 2Q1ZB 1U3EM 1IN7A 1K78B 2LKSA 2H94A 1IRFA 5GPAA 2CMPA 4AC0A 3OYIA 2OA4A 4L9NA 1D0ZA 4IHSA 2X1EA 1UELB 3IV5A 4MFEA 2YS9A 3CJRB 2NNYA 2NVTJ 1SD6A 3MZYA 4II2A 4WF2A 4BDZA 2JTVA 3CMAI 3Q0WA 3TL4X 3MN2A 4UV8A 4QIWN 3KCCA 1BR2A 1WKMA 2IP2A 3VYRB 5GTHC 2CW8A 2ZKZA 5HS9A 5K7HA 3WTYC 5CVUA 3VPRA 2E7WA 2JVGA 3A01B 2D1HA 3VYUB 3NAUA 3K2ZA 1WRJA 3QPSA 4BJ5C 2PJRB 1SANA 4JP0A 5CKTA 2MC3A 1OJLA 1B8IA 4E70A 4IVNA 3KE2A 3BZCA 5L3BA 2R4GA 4JYKA 1X1AA 4HQMA 2M4GA 4DBRA 2R7SA 3ELKA 3EDPA 4DOZA 1J59A 3PSIA 2X1DA 1IXSB 1TLHB 2WTEA 3KP3A 5DM7F 4A3FJ 2DQLA 4RAFA 2WY7Q 4RAYA 4AVZA 1A6IA 2P6SA 2PBIA 4KIGA 1P7JA 5JFRA 1ZRDA 3E1SA 1TW2A 2WBMA 5DYMA 2O5RA 4C3HJ 1WH5A 3JAMK 2XASA 4CXFA 3GTQJ 2K9MA 5L3EA 4E7IA 2DODA 4AIDA 1ZGAA 3GFJA 4EVIA 4IRGA 5K5RA 2F6CA 1VQKI 3D5LA 4UV9A 5HDNA 3B02A 4K2EA 2HDWA 2P7CB 3HM5A 4AIHA 1O3QA 1RNLA 4FISA 1YRNB 3WG9A 5TGTA 1ZG1A 2R93J 3AG2H 1FBSA 2NAZA 3RPQA 1IC8A 5D5VB 2LNBA 1Z21A 4CICA 3CDLA 2W82A 4RLQA 2XAHA 5IY5H 2COMA 2LLKA 2MG4A 1I6HJ 2DOFA 3I5UA 3ZP5A 5JHFA 4N4NB 3NRVA 1D1AA 1JHHA 1ODDA 2R92J 4KJZA 1YITI 4IOCF 1OYIA 2V9PA 3DWLE 2QSGX 2R7ZJ 1RETA 4KITB 1FOKA 2MGQA 2RREA 2XB0X 3PQKA 1X58A 2KJCA 5LHIA 2CUZA 2FUG2 1S3JA 1ZELA 2R3SA 3LFKA 4EJVA 1XSDA 3CC7I 2VQLA 4UXNA 1O7FA 1NK2P 4IX7A 3PIPF 1USTA 1LFPA 4CZCA 1DGWY 3HGYA 2ZNYA 3DKYA 1AWCA 2NXNB 2IS2A 1ITYA 2ESNA 2J5OA 5HLTA 4JX5A 3P9KA 1MBKA 3CESA 4I0BA 2JA6J 1R00A 2ZMEB 3ZR8X 4FQGA 2R7DA 4BH9A 4A0ZA 4A3BJ 1SFKA 2BGCA 2LSOA 5BMZA 2IRFG 3CCRI 2RVCA 4HG2A 4KFCA 4DYRA 4EJWA 3VSLA 4BKXA 3H1CA 2AXLA 1UB9A 1RR8C 3NQOA 2HTJA 3ABLH 2QQ9A 3R4KA 3IAS2 2XUBA 3EYYA 3H9GA 5D4RA 1STZA 3C7JA 2IGKA 1S7AA 2Z5UA 3E3VA 1WJBA 1BA5A 3BR6A 1J2XA 3KP6A 3RKQA 4IO9F 3MKYB 2DFFA 1ZYRF 4DIQA 3W6JB 3O3KA 2ID3A 2BY0A 5EZGA 3ECHA 2FE3A 3KLNA 5DD4A 2DJNA 1HW2A 2DMPA 4IHYA 2EZLA 2K9SA 2LP0A 1N75A 1OISA 4BY1J 2CQXA 4A0XA 4Y4RA 1UJ8A 4HV6A 1XDUA 2QM3A 1W7PD 3K4KA 3LFUA 1BJZA 1R71A 1R5ID 1GUUA 2OV7A 3SYTA 2M1BA 2E5NA 1Z91A 5EEHA 3IAM2 3LSJA 4M6XA 4OIOF 2HQRA 1MSEC 3RQIA 3BR2A 1CQTA 3BG3A 1XSXA 2IW5A 1Y0UA 3P7NA 3BP8A 2QF7A 2Z2SB 3IHUA 3Q9SA 2W84A 5JLWA 4A3CJ 2V9KA 1MMAA 4PSWA 3T8TA 5FROA 3CCUI 4ZTJA 3DPLC 1W7PB 2VIXA 1PUFA 1G6NA 3VFZA 2HKXA 3DEUA 2QWWA 2LF8A 4AM3A 4F91B 4KN4X 5L3CA 5ICEA 2HEOA 1VZ0A 5LEJA 2KJBA 3U21A 3G1OA 5AONA 4F7ZA 4RAZA 5EEAA 4QPOA 3CUQC 3S1NJ 2M34A 3OR2C 1JUMA 2EIKH 3L7WA 3E6CC 3BTLA 3OL4A 3H5NA 3BTIA 5IOYA 4UB6C 1BI3A 3J7YJ 1KONA 4XLFA 3ZRGA 2TRTA 3BT9A 4A3MJ 1V5GA 5DM6F 1IO2A 4CYCA 1KQ9A 2ZFUA 1QA6A 3CMEI 3F8CA 3TP0A 3LOCA 2KRHA 2QZ8A 2Y48A 3HZJA 4ZZLA 2CQ7A 2BY3A 1ZR2A 1XGMA 3I55I 1K78A 3L09A 5C44J 2M2EA 3LSPA 3S3OA 3MAJA 4M3EA 1VQ5I 4X0GA 2HR3A 3HGGA 1OMIA 1V4RA 1ETWA 2VBZA 2XF6A 3E5QA 2VXZA 2EK5A 5FO5A 1MSFC 1FBQA 1D0YA 2XGCA 3OYBA 1W4MA 3FXJA 2L02A 5KK1A 3I0TA 1QO0D 3IRQA 3BJ6A 3ABTA 2EA4A 2LRDA 4XLAA 1A35A 2CUJA 3W2VA 4AVPA 1ACIA 3QYBA 4I01A 2RN7A 1UZCA 2A05A 4PJLA 4ESJA 1BC8C 4Y7NJ 2M0MA 1VQMI 2V79A 3F3XA 3RIRA 2CWEA 2FRHA 3NEUA 4FETA 3JRBA 2PJRA 2B63J 2A3SA 3MKLA 1FYMA 3CCYA 4CHUA 1DPRA 3D1NI 3B6CA 1V3FA 2HTSA 4FE7A 3L1PA 4BE1A 5FRNA 2D45A 2I8DA 4QTRA 4R8HA 3BPVA 1ON1A 1X2MA 1QNTA 2X9DA
chains in the Genus database with same CATH topology
4YEJA 3PNYA 2LBFA 3VDXA 2DJIA 2M3AA 2UWMA 3KEYA 4ZC3A 3MKWB 1EA3A 4XQFA 4H4KC 2NOJB 4CH7A 3RSNA 3TMOA 3S3NA 2E1MC 5CPRB 3I9V2 3D5RC 2KRCA 3K4BA 4ITVA 4D1QA 3LSIA 4NQWB 4RM2A 2R7WA 3CZ6A 3K4JA 4RMNA 2WAQA 4ZDPA 4F93B 2VJJA 1MW7A 3EPZA 2K9LA 2V7FA 4CSWA 2XDVA 3D5SC 2DXIA 2CH0A 2HPMA 1E0EA 3N05A 3LSHA 3ONQA 4IZZA 4XMYA 3CF2A 3K6GA 2P0WA 3EUHC 4PJNA 4CA0A 1TZLA 1V5EA 2L9SA 4XKBA 1Y56A 4B43A 2BVLA 3IP4B 3BLYA 1LDKB 4IKFA 4BS9A 2F5VA 2JA2A 3F9KA 1K6YA 2LYCA 4CCNA 4J01A 3I3LA 1QU3A 3BC8A 4XL9A 3OYDA 4XN0A 3OY9A 3OYKA 4HRIA 5CQEA 2JSPA 3OMYA 1WJDA 2L5QA 4B3XA 1YX5A 3HL2A 3PUBA 2ZXHA 3FKJA 5CQGA 2LREA 4N4OB 3QYEA 1DQUA 2KL4A 3TBIA 4GRIA 2CS3A 2ELJA 2HQAA 2W1OA 3VSKA 4BEHA 2CV1A 2LH9A 2VASA 1N77A 4ZTFA 3L2VA 1WFXA 1ERDA 2A6TA 4XNFA 2XAUA 3AKZA 3HKZA 3QODA 2BOLA 2K5CA 3RQ4A 3OYAA 2L2OA 4NC7A 2X51A 3OL3A 3CP8A 3K4CA 4ZDLA 3DU5A 4LITA 4QPQA 2Q2EB 4E7ZA 3K70D 3M8JA 3VWBA 2V26A 3LSKA 4XONA 4ANJA 2KHMA 3BG7A 3S8PA 4BQNA 4KISA 3PNVA 3ZXSA 4AYBA 1J09A 2KLOA 2E1MB 2M7BA 2VJIA 1JI8A 3H5AA 3CJQB 4G6TB 3S93A 4E7SA 3PFYA 2VQCA 2W7NA 1TT0A 1X1BA 2HVSA 3L2RA 1Z3XA 4CCKA 4BGDA 2OC6A 1P9QC 2HPIA 4DBQA 2R7XA 3OYFA 4PJJA 1SAUA 4BJTA 2HNHA 2JUGA 2LY2A 4BXFA 1BR4A 3DTIA 4C2TA 3K4LA 3C2GA 1T0FC 3ZCOA 3KYLA 4NUBA 1DP3A 1X4OA 1G59A 2R7OA 1Y6IA 2MABA 4ZJZA 1WJEA 2E5ZA 4EATA 2VPLA 3DEEA 3DTKA 4U7BA 3HOTA 2R7UA 3EUKL 2Q1ZB 2BVMA 4XORA 3C2HA 1YX3A 3H0DA 4JQFA 4MLOA 2IGMA 2CMPA 1WJCA 3OYIA 1D1CA 1D0ZA 2XF5A 1V5FA 2X1EA 1UELB 4XLHA 4XOTA 3CJRB 1FMWA 4Y33A 4BQOA 5LFAA 5HOOA 3OYMA 2KDOA 3DKXA 3HG9A 3QYFA 4II2A 4BDZA 4PFPA 3J7AY 3FHNA 3TL4X 2VQGA 3DQVC 3AFHA 2LBFB 1BR2A 3VYRB 2Y0SA 3CMMA 3L2WA 2CW8A 2GOMA 4C30A 2JVGA 2XF7A 3VYSB 3LMMA 3W3CA 3VYUB 3ZGKA 1W36D 3DU6A 3HUGB 4PFOA 3S3MA 2HZDA 4BJ5C 3L2UA 2PJRB 3FBNB 3KX2A 4IQJA 5CKTA 2X6WA 2X1CA 3OYCA 2L9NA 3GBGA 4BACA 3HC7A 2R4GA 2CW7A 2M4KA 1X1AA 4U87A 1R6RA 2MFZA 3A1YA 2M4GA 4DBRA 2LG4A 2R7SA 4CCLA 4CCMA 3PSIA 4DOZA 2X1DA 4RM3A 1LVKA 3LSMA 2DT6A 2MYSA 3OYHA 1D1BA 4F52A 2IXSA 2WY7Q 4AVZA 4XOPA 2VJ4A 2GOXB 3W2AA 3E1SA 2WBMA 2O5RA 2KMUA 3K4NA 1Z7LA 1T95A 2VXDA 2K9MA 2HVRA 4E7IA 1PYVA 2IGOA 4BL0B 4DGWB 2R7VA 4F55A 2MD0A 2LY1A 3OS0A 4NNJA 1G8XA 2X6YA 5KNLA 5LD2C 2F6CA 2LC2A 3D5LA 4PJMA 4F3QA 4PUSA 4B44A 2HDWA 1X19A 3FBIB 2WAFA 4BQQA 5TGTA 2VKDA 1W36C 1QHHD 4E4HA 2AQFA 1Z21A 2ZXIA 3K10A 2W82A 4RLQA 1NG7A 2HVQA 4Y3OA 3MMYB 4YELA 2L7KA 4FASD 2VB6A 5JHFA 4N4NB 3DPTA 4CUGA 1D1AA 4KJZA 4ZYAA 1Z3YA 3DWLE 4KITB 1MMGA 2RREA 3OWTA 1WJAA 3NWSA 2BW3A 2CUZA 2FUG2 2W00A 1ZELA 3QOEA 3H35A 4BE2A 3E0JB 2WAEA 2VQLA 4E7KA 3LL7A 4BEHB 4IX7A 4B48A 4E6KG 4RLFA 1LFPA 1LKXA 3BG6A 3PSFA 4CZCA 1DGWY 3DKYA 2X6XA 1N78A 3ZQQA 2IS1A 4OWRB 2IS2A 4HSTA 5HLTA 1WJ5A 4HNTA 4XKCA 2VJ5A 1BOBA 3CESA 1HA8A 2VLAA 3MD2A 3ZR8X 3UR3C 4F92B 3SEQA 4BJ6C 1U0JA 1SFKA 4XLCA 4HG2A 1YE9A 3EUAA 3SDBA 1AA7A 1BR1A 1X1CA 3VSLA 2BW3B 4LG3A 2CV2A 2V6EA 3BCBA 2LOOA 2K3PA 3OYJA 1QHGA 1D0XA 3DLAA 4XLEA 3AL0C 1S9HA 3IAS2 3S32A 2WA0A 4HEA2 3H9GA 2AQEA 4HNUA 2WB1A 2IGKA 3OS1A 4B47A 1WJBA 3FDYA 4HSRA 2DCEA 4CCOA 1MMDA 3K4MA 3MKYB 5HNHA 2WADA 4YRVA 1MNDA 4DIQA 3K70C 1DGRM 3DTEA 3H9JA 4CCJA 2XC7A 2DT7B 3OR1C 4DJAA 2CV0A 4KT6A 5HNFA 4XM3A 2R7QA 1N75A 4OAZA 4BUPA 3RTRA 4Y4RA 4LIVA 1UAAA 2VL8A 2RQQA 3K4KA 3LFUA 4C9YA 4XKWA 4LIUA 2QKLB 2OV7A 2KP6A 3PL8A 3SYTA 2E5NA 2QKMB 3IAM2 2HU9A 1NG6A 4AU7A 5HVQC 4PSXA 2Z2SB 4E7JA 2V4JC 3IUOA 3OYNA 2V9KA 1MMAA 4C2UA 1X4PA 4D9JA 4PSWA 1PJRA 5FROA 3VYTB 1IRXA 3HOSA 3DPLC 4E7LA 4ZTJA 2VIXA 2RNGA 4F91B 3G2BA 1VZ0A 2VQHA 4XKVA 4R79A 2E60A 2JVHA 3PJRA 3U21A 2IS6A 3SEZA 2Z16A 2ZSHB 4IQ4A 4QPOA 3OR2C 3RCOA 3BCAA 3OL4A 1FMVA 2X85A 3H5NA 2UUZA 2R7RA 4PK4A 1KONA 3OOUA 2KZVA 3LSGA 4XLFA 3OYGA 2KPMA 4ZDOA 1OR7C 5KCMA 3ZRGA 3CP2A 3W2WA 3L2QA 3OYLA 1V5GA 4E7HA 2ZFUA 4OAYA 1MNEA 2WY8Q 3H9QA 4II3A 2KRHA 5FRMA 3H5RA 3AL0B 1GLNA 3S3OA 4X0GA 3PNTA 4XN3A 1WJFA 2XF6A 2W4SA 2VXZA 4P5OA 3UNGC 4HPQA 1D0YA 3SZGA 4J00A 2DOAA 3OYBA 1MMNA 3NWTA 2CFOA 4P1WA 3RPUD 2IGNA 3HXLA 3A2KA 4BE0A 4BDYA 2M7AA 1X1DA 2LRDA 4XLAA 5KHDA 2XSJC 2KQRA 4BU2A 2CUJA 3W2VA 4XR6A 4JOMA 1UG0A 4NC8A 3QYBA 1OLTA 3DPUA 3A4CA 2IS4A 4PJLA 3V42A 2R7TA 2F4IA 2M0MA 2ZSIB 2PMZA 3MKZA 2MC4A 2Z1DA 3M1CA 3OS2A 4FETA 2OUMA 3OIQA 2PJRA 2A5WA 3HPGA 3OYEA 4BE1A 2UV1A 5FRNA 2V1NA 2I8DA 3HPHA 3OIPA 2VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC4 A;  4OAZ A;  5KHD A;  4OAY A; 
#chains in the Genus database with same CATH topology
 2HZT A;  2M3A A;  2QUF A;  3LSR A;  3FXR A;  3ERE D;  3I59 B;  2IA1 A;  4AUX A;  3VOE A;  3Q9V A;  1YJ9 I;  3RZO J;  2M5W A;  3TMO A;  3MZ8 A;  2E35 A;  3H92 A;  3QPL A;  1VF9 A;  2KRC A;  3K4B A;  2QQB A;  4L5E A;  4KNY A;  1YW9 A;  1BOA A;  5H2F C;  2VJJ A;  1CF7 A;  3ZMT A;  5FFZ A;  2UZK A;  1LDJ A;  1U2W A;  4CZZ A;  2NVU B;  2QVO A;  1FPQ A;  1E0E A;  4OU0 A;  1F4K A;  2RDP A;  4XMY A;  3CF2 A;  3HOX J;  4EGY A;  4C2M J;  2P0W A;  3EUH C;  1ZG5 A;  4CA0 A;  2DBB A;  1V5E A;  3I71 A;  2L9S A;  4Q48 A;  4XKB A;  4M9Z A;  3TO7 A;  4N9I A;  1K83 J;  1IAW A;  3BLY A;  5LEK A;  4RBO A;  2L7F P;  2VBW A;  2EFN A;  4LG0 A;  1IV8 A;  1K6Y A;  4XLN F;  1FYK A;  2K02 A;  3GLL A;  4CCN A;  4J01 A;  1XB4 A;  3QWL A;  1FSE A;  2XPU A;  4WXD A;  3OYK A;  2CG4 A;  3CCE I;  2IPQ X;  2OF7 A;  1LB2 A;  4B3X A;  3G73 A;  1QVU A;  5GTI C;  2VI6 A;  5DCF A;  3PUB A;  1SVO A;  3QU3 A;  1YRN A;  1MGT A;  4HAM A;  1R58 A;  1DQU A;  4CO8 A;  4XK4 A;  1G2H A;  4XRF A;  2A07 F;  4A6E A;  2FQ3 A;  2X6O A;  2W1O A;  5E1Z B;  3ABU A;  5JLX A;  2HOS A;  1JKQ C;  2ME0 A;  2LY9 A;  1G3S A;  1HQC A;  4RB2 C;  4RGX A;  1IN4 A;  1WFX A;  1IJW C;  1J0R A;  1ENH A;  2JPC A;  3HKZ A;  5AIQ A;  5D5X B;  2V1X A;  4S04 A;  2STT A;  2K5C A;  4EJO A;  3WGH A;  3HYI A;  3AG4 H;  3JCU C;  2V1D A;  5KVR A;  3HDD A;  2RC4 A;  3U2R A;  2LD5 A;  3OL3 A;  4ZDL A;  3KP5 A;  4QPQ A;  4HA8 A;  1TQM A;  1WQ2 A;  2HQ5 A;  5FGM A;  4E7Z A;  1NH3 A;  2FOK A;  2XAQ A;  3DBH B;  3VWB A;  4HLY A;  3HOZ J;  4XON A;  4ANJ A;  5E3N A;  3Q5F A;  3PNV A;  3I59 A;  3IL2 A;  1J09 A;  1BL0 A;  2E1M B;  4YG2 F;  3TOB A;  3S93 A;  5ERI A;  2XPW A;  3LA3 A;  4PZJ A;  1LVA A;  3BTJ A;  5A2Q Z;  2HVS A;  1Z3X A;  2ZME A;  2X0L A;  1BIB A;  4NC6 A;  2R5Y B;  1W1W E;  2KRF A;  2HPI A;  3DCF A;  5FFX A;  1W0T A;  2RKH A;  2VE9 A;  2R7X A;  4GDF A;  2DFE A;  2Y2Z A;  4OIN F;  5ILS A;  3JRD A;  2PMZ N;  4MEX F;  3ULQ B;  2JUG A;  2LY2 A;  5ILV A;  2D2W A;  1FWZ A;  1LE8 A;  2VOD A;  2H8W A;  4EJU A;  1TBX A;  2E71 A;  4V19 K;  3C2G A;  1F5T A;  3V7C A;  1DP3 A;  1G59 A;  2E2I J;  2A61 A;  1IZ1 A;  4HNV A;  5LRR A;  5GAD J;  2F2E A;  3DEE A;  3DTK A;  1HKS A;  4GGG A;  1Z05 A;  3I4P A;  2R7U A;  2R5Z A;  1N25 A;  5HLH A;  3JSO A;  3GWZ A;  1BM9 A;  4JQF A;  3HHG A;  3GX4 X;  2W25 A;  4CYD A;  4J19 A;  5B3S H;  2XF5 A;  2P5L C;  1ZR4 A;  5TIS C;  1P4W A;  3TDZ C;  1LEA A;  4Y33 A;  5LFA A;  1PVE A;  3IKV A;  3ZN0 A;  3S1M J;  2MH2 A;  2ETH A;  2VC0 A;  3ESW B;  3ZQL A;  3BTC A;  3J7A Y;  3FHN A;  3M4O J;  2VQG A;  4IPA A;  4EJT A;  1TTY A;  3DP7 A;  1V55 H;  3AFH A;  3DFG A;  2BY2 A;  4JX6 A;  3LA7 A;  2ESH A;  2GOM A;  1MBG A;  4O5V A;  4B4C A;  4A12 A;  3VYS B;  3LMM A;  2IVM A;  3W3C A;  2HFH A;  3ZGK A;  1W36 D;  3S3M A;  4PFO A;  4Y17 A;  1W7P A;  1B6A A;  1PP7 U;  4RB1 A;  3FBN B;  2HWV A;  2CGP A;  3GTG J;  1GHC A;  2X6W A;  2X1C A;  3OYC A;  3E7L A;  3GF2 A;  5L3D A;  2PFB A;  3F8F A;  1TL8 A;  1T56 A;  1T2K A;  3GTJ J;  2CW7 A;  2D1V A;  2BHY A;  1EH8 A;  3O8G A;  3BR3 A;  1HKQ A;  5M3M J;  3JRE A;  3T5X A;  4QWQ A;  2AXT C;  4LJZ F;  1OYW A;  2JZY A;  4RM3 A;  3S17 J;  3LSM A;  2HYF A;  1G3W A;  3GTL J;  5E3O A;  4MIM A;  2CO5 A;  2FEZ A;  3ZPL A;  3WHC A;  2GOX B;  3WHB A;  2EIM H;  1HST A;  2MLG A;  3A01 A;  1YG2 A;  1ZLK A;  3DBL B;  2XRO A;  1AKH A;  3K4N A;  1Z7L A;  2CUF A;  1T95 A;  2DTR A;  2ZNZ A;  2JRT A;  1PYV A;  3KZY A;  4DGW B;  3PIO F;  3OSG A;  3HRU A;  3OS0 A;  4NNJ A;  2X6Y A;  2NS0 A;  2FJ1 A;  4PJM A;  5JVT A;  2XRN A;  5GAG J;  2UXN A;  3WU2 C;  5E8G A;  1U9O A;  4KMU X;  2VOO A;  4BQQ A;  2HKO A;  5CVR A;  2X4H A;  2G7H A;  5ICG A;  2AQF A;  2ZXI A;  4UHT A;  4Y52 J;  2CQN A;  3JRF A;  1NG7 A;  1R23 A;  2GA1 A;  2HVQ A;  4Y3O A;  1RUN A;  1ZRC A;  4FAS D;  3GZ5 A;  1SMT A;  1H89 C;  4CUG A;  2LK2 A;  2COB A;  2FU4 A;  4ZYA A;  3BJA A;  2ISZ A;  1Z7U A;  2CJJ A;  3I56 I;  2OBP A;  9ANT A;  2ZXW H;  2F5D A;  1VQP I;  2JA5 J;  5E17 F;  3NWS A;  2BW3 A;  4I2O A;  2W00 A;  3A03 A;  1CGP A;  5EJC A;  2J5P A;  3QOE A;  1XMX A;  1IDZ A;  4GO1 A;  4BE2 A;  3S2D J;  3IWZ A;  4ETS A;  2ZME C;  2ID6 A;  5F0F A;  4B48 A;  4A3L J;  1GT0 C;  4O6J A;  4WK8 F;  2X6X A;  1N78 A;  5CLS A;  4HNT A;  2R0Q C;  3GFL A;  5IT3 A;  1XX5 A;  5FKM A;  5LRS A;  2Z3Y A;  3MD2 A;  3HSF A;  4FE4 A;  4M74 A;  4PGG A;  3UR3 C;  5M5X J;  2EV0 A;  4IXA A;  4FX4 A;  5BQT A;  1TWA J;  4XRM A;  3JRC A;  2E7X A;  2Y75 A;  1BR1 A;  2XKP A;  1TT5 B;  1BI1 A;  5J1R A;  3RI4 A;  5TRD A;  2V6E A;  2LF7 A;  3BCB A;  5BOX A;  2LOO A;  2DW4 A;  2K3P A;  3E5U A;  3CCJ I;  1D5Y A;  2QEN A;  2WA0 A;  1Z0X A;  2AQE A;  4HNU A;  2WB1 A;  1ZHF A;  3G71 I;  1S29 A;  4Y13 A;  1YHQ I;  3BQY A;  4HX7 A;  4A3I J;  1VQ4 I;  4L5J A;  1MMD A;  2DOE A;  3KYC B;  2WAD A;  4LLN A;  3R0A A;  3K70 C;  2G9W A;  3DTE A;  3H9J A;  4H0E A;  3DLL F;  2F5E A;  5L3G A;  4DNC A;  4L9J A;  2CV0 A;  3MEX A;  1HOM A;  2R7Q A;  2CFX A;  1GVD A;  3ASN H;  4RB3 C;  3VB2 A;  2JUC A;  4LIV A;  1TP4 A;  1NTC A;  2BE5 F;  1Z67 A;  2VL8 A;  5GP9 A;  4D5F A;  1JTY A;  5EG0 A;  1YS7 A;  2QKL B;  3C3W A;  2KP6 A;  2DA3 A;  2DA7 A;  1BI0 A;  3IH3 A;  1XD7 A;  1NG6 A;  1YTY A;  3AG1 H;  2XAG A;  3K1P A;  3GFM A;  2V4J C;  2XHK A;  2V6C A;  2G0E A;  1X4P A;  1GDT A;  2YX7 A;  1PJR A;  5E20 A;  2DPU A;  1IRX A;  3W6V A;  2QBY B;  3JRG A;  3EUH A;  3HOS A;  4E7L A;  4M9X A;  1TWF J;  3KIO A;  3CCS I;  1XGS A;  1K7A A;  2YSR A;  3K69 A;  2W57 A;  2JVH A;  3ABK H;  3M8F A;  2Y0S N;  1A6Q A;  3SEZ A;  4IQ4 A;  2EFP A;  2E2H J;  5CVJ A;  3KEO A;  1Q1H A;  5AIP A;  3SZP A;  1P2F A;  5GAH J;  1I1S A;  1IGN A;  4FTH A;  1BN5 A;  1HBX G;  3LSG A;  2KPM A;  1J75 A;  4ZDO A;  1ETV A;  1MIJ A;  1OR7 C;  5KCM A;  3W2W A;  2FF4 A;  5J4Y A;  3MVP A;  4C3J J;  5J1Y A;  4E7H A;  3MWM A;  4OAY A;  3LAP A;  1MNE A;  2LDU A;  1SD7 A;  3H5R A;  4OMY A;  3AL0 B;  2GZW A;  4OMZ A;  4HX4 A;  3BPX A;  1R9T J;  1A04 A;  4IEJ A;  4R1H A;  4P5O A;  4DQ2 A;  1Q1V A;  4J00 A;  4D0P A;  1NK3 P;  1MMN A;  1RC9 A;  3NWT A;  4EV0 A;  5EDN A;  3FF5 A;  1VQ7 I;  2E1N A;  4A0Y A;  4XSZ F;  1X1D A;  4B1R A;  1HDD C;  2QEX I;  2XSJ C;  3TDU C;  2VOP A;  2KQR A;  4BU2 A;  1UG0 A;  4L5I A;  3HTS B;  2JRM A;  2ZJQ F;  3U1K A;  2JN6 A;  5HLI A;  3IH4 A;  2R7T A;  3GEZ A;  1K4T A;  2PMZ A;  2KIF A;  1K6O A;  1MH4 A;  2QSF X;  1F36 A;  2DN0 A;  2ZJ2 A;  4OIQ F;  1W5S A;  4HX8 A;  4A69 C;  5FD5 A;  2CW0 F;  2KDZ A;  3CCL I;  3IWF A;  3LA2 A;  2XGD A;  5CYV A;  4ZYG A;  1WVR A;  3CUQ A;  1JJ6 C;  1JKR C;  3V7S A;  1Y8Q B;  4I76 A;  2BYV E;  5IP7 J;  2ADU A;  3PNY A;  1HLV A;  1SD4 A;  1UHW A;  3VDX A;  2UWM A;  2DMQ A;  5C4J J;  1OYY A;  5EEG A;  4P96 A;  4MO7 A;  1FYL A;  4H4K C;  1HW5 A;  2QCO A;  2KZG A;  2QGU A;  1LFU P;  2VKV A;  3J7Z I;  1ETY A;  4N9H A;  3R6S A;  1IG7 A;  2E1M C;  2VKE A;  2OCC H;  5CPR B;  3I9V 2;  2GXA A;  3Q3S A;  4RM2 A;  1AKH B;  3K4J A;  4RMN A;  3QPH A;  4F93 B;  1TQI A;  3QPT A;  3D5S C;  5M5W J;  2DXI A;  5E3M A;  1E3O C;  3ZQH A;  4L9V A;  4M72 A;  1T39 A;  3S15 J;  3LSH A;  4IZZ A;  5ICC A;  2DQR A;  2P7V B;  3KEQ A;  1XPX A;  4PJN A;  2QQA A;  1B4A A;  5BPI A;  1VQ8 I;  2OD5 A;  1TZL A;  3ZOB A;  2ZC2 A;  3KP2 A;  3ZMZ A;  4ENJ A;  2BVL A;  1FIA A;  1LDK B;  4IKF A;  1R1U A;  2GXG A;  2A68 F;  1MDM B;  1E3H A;  1U5T B;  1KQ0 A;  3ASO H;  1IXC A;  3E97 A;  4I7H A;  1QQI A;  4HDV A;  1QU3 A;  2RNJ A;  1XSV A;  1SC7 A;  3RKX A;  4HRI A;  2JSP A;  3OIO A;  4WXH A;  4MHG A;  1PDN C;  1WJD A;  3PFI A;  5K7Z A;  2TCT A;  4S0H B;  1TWC J;  2Q2E A;  3F0C A;  3FM5 A;  3FKJ A;  4KYW A;  1JT6 A;  3P9C A;  5KAF C;  1JE8 A;  4PDK A;  2LR8 A;  4RB0 A;  1VQN I;  4UVC A;  2KL4 A;  3FK7 A;  3GO5 A;  2CS3 A;  2XGX A;  1S5L C;  2ELJ A;  2HQA A;  3BR0 A;  3VSK A;  2CV1 A;  2KT0 A;  2Z33 A;  2UXX A;  2VAS A;  4LG0 B;  1N77 A;  1ZN2 A;  2DFI A;  3H3V K;  1KU3 A;  2MH9 A;  1LDD A;  2ICW G;  1U9N A;  3L2V A;  1ERD A;  1JJ8 C;  1AU7 A;  5B1B H;  1O3S A;  3WTU C;  1IUY A;  1FX7 A;  3AKZ A;  2GLO A;  1ZRF A;  1RRJ A;  1SAX A;  2XV4 S;  4ESB A;  5LGU A;  2P5V A;  3I4N J;  4NC7 A;  6PAX A;  3ZMS A;  2X51 A;  2GM4 A;  1KZH A;  3CP8 A;  1Y0N A;  3K4C A;  4LIT A;  1AHD P;  2ZCW A;  4XLP F;  3K70 D;  3M8J A;  3SQN A;  4ZYE A;  3IKT A;  3S1Q J;  5D4S A;  2KHM A;  2XRL A;  3BG7 A;  4FHT A;  1D5V A;  3S8P A;  4KIS A;  1UCR A;  4RGU A;  4RDU A;  3G6E I;  2DI3 A;  2PI0 A;  2O03 A;  2FNA A;  2DU9 A;  2Y0M A;  2VJI A;  5D6E A;  3H5A A;  4A2U A;  3NAR A;  2W7N A;  3JW4 A;  4LLL A;  3CCV I;  4MGR A;  4PGH A;  1JHF A;  4CCK A;  5J8C A;  4IHW A;  3PO3 J;  1GXP A;  3F6O A;  2QLZ A;  1HXD A;  1X2N A;  1WSU A;  2NVY J;  4BNC A;  4A93 J;  3TW7 A;  4PJJ A;  2KFD A;  4UUS B;  5BS6 A;  1SAU A;  2QA4 I;  1H88 C;  2DDA A;  1OCZ H;  2EWN A;  4RAG A;  3JRA A;  1WI9 A;  4B8X A;  3GVA A;  3K4L A;  3M9A A;  1T0F C;  4LD5 A;  4NUB A;  1YOV B;  1MBJ A;  2Q8K A;  1WPK A;  4YIF A;  3HRS A;  3R60 A;  2MAB A;  2VPL A;  1MBH A;  3K1N A;  3GUD A;  4U7B A;  4BXX J;  1OKR A;  3EUK L;  2BVM A;  2A69 F;  4XOR A;  1VQ9 I;  3REO A;  4A3G J;  1XC5 A;  4MLO A;  3WGI A;  2IGM A;  1WJC A;  3ML6 A;  2OPT A;  5JHU A;  3F8B A;  2D5V A;  4U88 A;  2O9L A;  4HDU A;  4XLH A;  5E8I A;  1X3Z B;  2F4M B;  4XOT A;  1FMW A;  2NNN A;  4BQO A;  5HOO A;  3OYM A;  1Z9C A;  1ZGJ A;  1DDN A;  2KDO A;  3DKX A;  3HG9 A;  4G12 A;  3E6B A;  1LE8 B;  1D8K A;  1X3U A;  2GA2 A;  2ZXJ A;  2LBF B;  1R49 A;  4EEF G;  1MMS A;  3EQL F;  1J5Y A;  1HSJ A;  2Y0S A;  4AIK A;  3L2W A;  3RKW A;  1SVM A;  2LKP A;  4GYI A;  1XCB A;  1WH7 A;  3UKG A;  5FLX K;  3DU6 A;  1R1V A;  1B72 A;  2EZI A;  1HW1 A;  5LLQ A;  3CO6 C;  3GBG A;  1OCO H;  3HSR A;  4RA2 A;  1RR7 A;  2ELK A;  3IC7 A;  1T8I A;  1WCM J;  5GAE J;  2M4K A;  3G1M A;  4EQQ A;  5DEQ A;  2C6Y A;  4IRH A;  5B1A H;  2EQR A;  2Z99 A;  1A5J A;  4D7M A;  1LVK A;  5K5O A;  2DT6 A;  2HQN A;  2MYS A;  3OYH A;  5FLV A;  1GV2 A;  2IXS A;  3K7A J;  3WOD F;  5IYC J;  2KIQ A;  1XMA A;  3R61 A;  3K1M A;  1T08 B;  2HOT A;  1FP2 A;  3WGG A;  3QRF F;  2KMU A;  3HOU J;  1FT9 A;  4KN7 X;  3N4M A;  3QOP A;  2K27 A;  2XGE A;  3BZK A;  2W24 A;  4A3D J;  3CDI A;  4BL0 B;  2E1O A;  1D8J A;  4F55 A;  2MD0 A;  1BBY A;  4LB6 B;  5A2Q K;  3A0B C;  1MD0 A;  5FLX Z;  3LQR A;  3A0H C;  1TWH J;  4AWX B;  1VQ6 I;  4HV5 A;  2JWT A;  4WX9 A;  3TKY A;  2FBI A;  3QQA A;  1RKW A;  1BJA A;  1YIO A;  2JA7 J;  2CRG A;  2WAF A;  1E2X A;  1F1Z A;  3HOY J;  3HEF A;  1JTX A;  3HOV J;  1JKP C;  1W36 C;  1Y1V J;  2STW A;  3HSE A;  3FKI J;  1IN6 A;  2YU9 J;  3K10 A;  5E3L A;  2KIU A;  2EPF A;  1SVL A;  3BRO A;  4YEL A;  5K5Q A;  4V2G A;  1I50 J;  4G7Z F;  2QYO A;  5H20 A;  2VB6 A;  3ZMV A;  4ZYD A;  4G9Y A;  1LFB A;  1T98 A;  3J80 K;  5DUK A;  3JSP A;  2WWY A;  2EFO A;  3DBR B;  3CLO A;  4IL6 C;  1MJA A;  4MFD A;  2HDD A;  2H6C A;  1R5G A;  1OCR H;  3K9T A;  1DPU A;  3F6V A;  3OWT A;  4UY8 I;  2LFB A;  4L0Z B;  3SFZ A;  2W48 A;  3BR1 A;  1FIP A;  4X1E A;  2WB1 N;  5HOD A;  2LTP A;  3LL7 A;  3TGN A;  3BG5 A;  3HIF A;  4BEH B;  4E7K A;  3U1D A;  2A6E F;  4RLF A;  2H1K A;  1LKX A;  3BG6 A;  3RKY A;  3HKZ N;  5K7F A;  3SXY A;  4OWR B;  2IS1 A;  2MA3 A;  5EYR A;  1KA8 A;  1P4X A;  1MDM A;  1WJ5 A;  3D0S A;  4XKC A;  2VJ5 A;  1ZKG A;  1ETO A;  3S2H J;  3WTW C;  2FX0 A;  2ELH A;  2ISY A;  2R5Y A;  4MTD A;  2YUS A;  4F92 B;  1KYZ A;  3BR5 A;  2PMU A;  4BJ6 C;  2O8K A;  1U0J A;  5F08 A;  4HW0 A;  2HS5 A;  1FSH A;  4XLC A;  1YE9 A;  1P4A A;  2K4B A;  3EUA A;  4NHJ A;  1AA7 A;  1R5H A;  1X1C A;  3FZV A;  1H8A C;  2EFQ A;  2BW3 B;  5EG0 B;  1U78 A;  4UVB A;  4LG3 A;  3L2C A;  4Q47 A;  5CVV A;  4I02 A;  3CUO A;  4M6Y A;  3OYJ A;  2OZ6 A;  4G94 A;  3FMS A;  1IN8 A;  2HI3 A;  3IRR A;  1EV7 A;  4QLC U;  1FEX A;  4A6D A;  1UHS A;  3OOP A;  3ROU A;  3OS1 A;  5M3F J;  1LEB A;  3JTG A;  1FBU A;  2QBY A;  4HSR A;  2F48 A;  5ED4 A;  3K4M A;  1WHU A;  1XMK A;  5HNH A;  4L9T A;  1FZP B;  2P8T A;  4YRV A;  1MND A;  4CCJ A;  2A6H F;  2XC7 A;  2BHZ A;  5F27 A;  3I4M J;  4KMF A;  3TQN A;  4ASN A;  4A5M A;  5HNF A;  3LAJ A;  4BUP A;  2LVS A;  2JSC A;  4I0A A;  2RGV A;  2DDB A;  2HYG D;  4L0Y B;  1UAA A;  1BC7 C;  3F21 A;  5F04 A;  2OAZ A;  4XKW A;  4C9Y A;  1EH7 A;  4LIU A;  4LMY A;  4BQA A;  1Z6R A;  2RQP A;  5FJ8 J;  1LNW A;  1O4X A;  2F5F A;  1RPW A;  4Z2Y A;  4AU7 A;  2IA0 A;  4B3A A;  4PSX A;  1ZK8 A;  1WWX A;  3IUO A;  4D5C A;  4ZH4 F;  2GQQ A;  4D9J A;  3J81 Z;  3VYT B;  3GYH X;  3V4G A;  4XRS G;  2TDX A;  4XID A;  1RKT A;  3V8L A;  3WTT C;  3COA C;  4XSX F;  5C3E J;  3K2A A;  3FIW A;  2P6T A;  1ONV A;  2LKX A;  4UUV A;  5LHG A;  1BW5 A;  1KQ8 A;  4I98 B;  2FA5 A;  2RNG A;  1IDY A;  2XAF A;  3QP5 A;  3ABM H;  1ETQ A;  1FY7 A;  1JGS A;  3PJR A;  4C3I J;  5F0C A;  1U8R A;  2Z16 A;  2ZSH B;  5J6X A;  1LJ9 A;  4Q4Z F;  1EJ9 A;  3C2B A;  1HDP A;  3GLX A;  1RZ4 A;  3ZMD A;  1SFO J;  1FMV A;  4CGZ A;  2X85 A;  3FIS A;  2N8G A;  4M73 A;  3SDG A;  2KIS A;  1Y39 A;  3OYG A;  3KYD B;  3SJM A;  5FKK A;  4QSH A;  1YFH A;  3WTS C;  3OYL A;  3SHF A;  1IUF A;  4LK1 F;  2IJL A;  3HUG A;  2WY8 Q;  4II3 A;  3H9Q A;  1G3T A;  2MW8 A;  2OTL I;  4HF1 A;  5FRM A;  1MNM C;  4FT8 A;  2M9H A;  3PNT A;  2BZT A;  3K0L A;  3M07 A;  2DPD A;  5E18 F;  4XN3 A;  2W4S A;  5FD6 A;  4UUS A;  3GCM A;  3RJP A;  1T33 A;  1X1P A;  2G7U A;  4EM1 A;  4GXO A;  4RS8 A;  3DXJ F;  4P1W A;  2IGN A;  3FXM A;  3HXL A;  3HTU A;  4BDY A;  2K9N A;  2M7A A;  4P9U A;  2Y9Z A;  4UVA A;  1DU6 A;  2DAO A;  1P92 A;  1R4M B;  2FSW A;  1QZY A;  3DKW A;  4XR6 A;  4JOM A;  1QGP A;  5DCM B;  3DPU A;  3A4C A;  5DDG A;  4FCY A;  1I6X A;  4KIC A;  4U0W A;  1I39 A;  3VEP A;  3V42 A;  5J3L A;  3HRT A;  5EF6 A;  3G1L A;  3KP7 A;  3ECO A;  2DFH A;  3OS2 A;  2OJE D;  1S8N A;  2GXB A;  2OUM A;  1B72 B;  4A3J J;  3HPG A;  2H6B A;  3B6A A;  2JMW A;  1YLF A;  1X3W B;  3GTK J;  1XS9 A;  3OYE A;  4UB8 C;  1B8I B;  2UV1 A;  2V1N A;  1IF1 A;  3HPH A;  4HZF A;  4S05 A;  1T38 A;  3WU1 B;  3OIP A;  5J47 A;  4BBR J;  4PCQ A;  4AYB N;  2VKH A;  3FXU A;  2FOW A;  3TP3 A;  2LBF A;  1B59 A;  2R7F A;  2VPR A;  1MH3 A;  3X2Q H;  3MKW B;  1EA3 A;  4XQF A;  3M3Y J;  2NOJ B;  1EH6 A;  1TW3 A;  2L9R A;  1C0W A;  5DUI A;  3S3N A;  2V1U A;  3DV8 A;  2KKO A;  3D5R C;  1XDS A;  4ITV A;  5IT9 Z;  2DA2 A;  4NQW B;  4YIR X;  2R7W A;  1RES A;  2WAQ A;  5EGO B;  1YW7 A;  1XN7 A;  2BY1 A;  4ZDP A;  3GZ6 A;  3ZN1 A;  3JAM Z;  3EPZ A;  2V7F A;  4CSW A;  2DYR H;  2XDV A;  3CD6 I;  1JUP A;  2VC1 A;  3N05 A;  3ONQ A;  5F64 A;  4W1U A;  3KP4 A;  1LQ1 A;  2O7O A;  4M9S A;  3GZN B;  4B43 A;  1UMQ A;  3E6M A;  1VI0 A;  1SFE A;  2JA2 A;  3F9K A;  2YPR A;  3ZMU A;  1YW8 A;  2LYC A;  4AD9 A;  2DYS H;  2O3F A;  4G8X A;  3I3L A;  4UUT A;  4CYC B;  5K1Y A;  4UNO A;  2HGC A;  3BC8 A;  3F8M A;  1Z77 A;  4XL9 A;  4XN0 A;  3KPH A;  3WTX C;  1IRG A;  3O8H A;  4M3D A;  1R7J A;  5CQE A;  1ZQ3 P;  4BHC A;  3OMY A;  5FB2 A;  3GME A;  2M8E A;  2L5Q A;  3HL2 A;  1YX5 A;  1OCP A;  4HBL A;  1QPI A;  2O0Y A;  3FXO A;  2ZXH A;  2FBK A;  1S6L A;  2F5C A;  1I3A A;  3RYP A;  3E6D A;  4ESF A;  3TBI A;  1FJL A;  2NS8 A;  3CF5 F;  2DMU A;  3CTA A;  2Z9O A;  4GFB A;  4CDG A;  4BEH A;  2JK3 A;  4ABZ A;  4A3E J;  5LGN A;  3S14 J;  2LH9 A;  4M3F A;  2A6T A;  4XNF A;  1U5T A;  2HXI A;  2XAU A;  4N0B A;  1YQA A;  4HLX A;  3EET A;  4RGS A;  5E1W A;  3QOD A;  2BOL A;  2E34 A;  1PP8 F;  5J1U A;  1V54 H;  3MZH A;  2RV8 A;  2L54 A;  5B66 C;  1RIO H;  1XCV A;  4WXC A;  3F22 A;  1TNT A;  4RGR A;  2BBY A;  4ENM A;  3DU5 A;  4WWC A;  2Q2E B;  1GVJ A;  2CUE A;  2LMD A;  3GTM J;  1FOX A;  4DYC A;  5F0H A;  3ZQ7 A;  2DK5 A;  3ZXS A;  1VND A;  1FLI A;  1I1G A;  1K4S A;  4ENK A;  4KA4 A;  2L0K A;  3KZI C;  1JI8 A;  4MQ9 F;  3CJQ B;  4G6T B;  3PFY A;  4P55 A;  2VQC A;  1TC3 C;  2NVQ J;  1TT0 A;  3GW2 A;  5E79 C;  1X1B A;  2OC6 A;  3DF8 A;  3OSF A;  3HBL A;  2JQ7 A;  1IV6 A;  1OQY A;  4BJT A;  1TWG J;  2HNH A;  2NOG A;  3T0Y A;  2VT2 A;  4XRS A;  4LK0 F;  4YFX F;  5F1J A;  1BR4 A;  3AG3 H;  4C2T A;  3CJN A;  2XB5 A;  5IP9 J;  3ZCO A;  3KYL A;  2IEK A;  5KAI C;  2MD5 A;  1POG A;  4IF4 A;  2JT1 A;  2R7O A;  1FP1 D;  1Y6I A;  1WJE A;  1U5T C;  2E5Z A;  2IBD A;  2NRA C;  2FBH A;  2K86 A;  4XBF A;  2H8R A;  2I5U A;  1ZAO A;  5LHH A;  1ZGW A;  4IHX A;  4IRI A;  3C2H A;  1YX3 A;  3H0D A;  5DTD A;  4DZJ A;  1FTZ A;  3N97 A;  1JKO C;  4BBS J;  2YX4 A;  3P5J A;  1D1C A;  3I54 A;  2IT0 A;  2EV6 A;  2EZK A;  1V5F A;  4BAY A;  1VQL I;  3GTP J;  4BY7 J;  4OIR F;  1XGO A;  5BNG A;  4AIJ A;  4YFN F;  2JA8 J;  5FKN A;  3QYF A;  2GIV A;  3CUQ B;  3KLO A;  4PFP A;  4DYQ A;  3QP6 A;  4ZZD A;  1K61 A;  3DQV C;  2BXZ A;  1LUJ B;  3I58 A;  4MNU A;  4MQV A;  4LFU A;  4BXU A;  3T1B A;  1A31 A;  2QSH X;  3CMM A;  2MLK A;  4C30 A;  3F8N A;  2EIN H;  2GBY A;  2XF7 A;  4NBQ A;  3RPU A;  2AS5 F;  1IW7 F;  2QQ8 A;  1T6S A;  3HUG B;  4O3M A;  2HZD A;  3L2U A;  2HDC A;  2CU7 A;  3KX2 A;  4IQJ A;  1GXQ A;  1O3R A;  2L9N A;  2FML A;  1USS A;  3JRI A;  5DD8 A;  2ACJ A;  1OPC A;  4XIC A;  3BG9 A;  1NHA A;  2E36 A;  4BAC A;  2F4O B;  3HC7 A;  1OCC H;  2XVC A;  4G6D A;  1XTA A;  2M30 A;  3HHH A;  4U87 A;  5IOZ A;  3ZQF A;  1R6R A;  2MFZ A;  4EGZ A;  3A1Y A;  2OQR A;  2LG4 A;  2MBF A;  4MTE A;  5GPC A;  4CCL A;  4CCM A;  1SEU A;  3KFW X;  3C1D A;  3RDI A;  2Y30 A;  3JR9 A;  3Q0U A;  1W0U A;  1D1B A;  4F52 A;  2H27 A;  4XOP A;  2VJ4 A;  3H0G J;  3ZQI A;  3W2A A;  1FTT A;  5E1X A;  4GYG A;  5IT9 K;  1Y8R B;  3PM1 A;  2VXD A;  3FXQ A;  2HVR A;  2VBY A;  2IGO A;  2K4J A;  5HS7 A;  2WV1 A;  2R7V A;  1GV5 A;  1E3P A;  1TQP A;  2LY1 A;  5KNL A;  1G8X A;  5LD2 C;  2LC2 A;  2AO9 A;  2L4A A;  4F3Q A;  1JGG A;  4PUS A;  4B44 A;  2Y9Y A;  4EMS A;  1FNN A;  2DMT A;  3PO2 J;  1HC8 A;  5H6R A;  1X19 A;  3FBI B;  2GWR A;  5ILU A;  2OQG A;  4U7D A;  2CYY A;  4KUM A;  2VKD A;  4WCG A;  3BJO A;  3ISP A;  3WTV C;  4LB5 A;  1QHH D;  4E4H A;  2K7L A;  3TOA A;  1MZB A;  3ZQC A;  1YI2 I;  2MSY A;  3MMY B;  1RUO A;  2ZJP F;  2L7K A;  2DTZ A;  1HF0 A;  1ZAR A;  2DA5 A;  4KDP A;  3BDD A;  3DPT A;  4NQW A;  3O2P E;  3J80 Z;  4FX0 A;  3QU6 A;  1G4D A;  2DA4 A;  1CF7 B;  1Z3Y A;  4HOB A;  1K79 A;  1MMG A;  4HF0 A;  4KIF A;  1WJA A;  1MBF A;  3M7G A;  4LGW A;  2ZBK A;  4NDL A;  2PQ8 A;  5B5E C;  3FX3 A;  3V7R A;  3MCZ A;  2ZB9 A;  3H35 A;  2VON A;  3ZQG A;  3E0J B;  2WAE A;  3F23 A;  1MBE A;  3B73 A;  3TW6 A;  3S1R J;  1YJN I;  1ZRE A;  1ZLJ A;  4E6K G;  3WTZ A;  3L00 A;  1RI7 A;  5J40 A;  3PSF A;  3H36 A;  4P9F A;  3T8R A;  2VUM J;  3MFK A;  3ZQQ A;  5DV5 A;  4HST A;  1XGN A;  3CCQ I;  1BOB A;  2ZJR F;  5HS8 A;  1HA8 A;  1U8B A;  2VLA A;  1YS6 A;  4JX4 A;  4OIP F;  3SEQ A;  5FKL A;  2L7M P;  3I64 A;  4W97 A;  3FM3 A;  3H3Z A;  1UG2 A;  5EZH A;  3SDB A;  3EYI A;  3I53 A;  1FOY A;  1PUE E;  1WI3 A;  3RZD J;  1P7I A;  2CV2 A;  3JRH A;  3FHZ A;  2DT5 A;  1QHG A;  1D0X A;  3DLA A;  4XLE A;  2A5Y B;  3AL0 C;  1S9H A;  3CMY A;  3HRM A;  2AHQ A;  1H9T A;  3S32 A;  4HEA 2;  4M3B A;  1U6G A;  4ENN A;  2XKO A;  4B47 A;  2O61 A;  2YU3 A;  1E17 A;  1I27 A;  3FDY A;  1BW6 A;  2DCE A;  2ECC A;  4CCO A;  4IHT A;  2WV0 A;  2P81 A;  5LGT A;  3J81 K;  1O3T A;  1F9N A;  1DGR M;  1QZZ A;  2B7E A;  3P9I A;  5JR3 A;  2DT7 B;  5HDK A;  4DW6 A;  3OR1 C;  4DJA A;  4KT6 A;  2EV5 A;  4XM3 A;  3WE2 A;  3WU0 A;  4OAZ A;  3FK6 A;  2P4W A;  3RTR A;  4BYY A;  2FD5 A;  1IRZ A;  3BOQ A;  2E19 A;  2RQQ A;  1TNS A;  2H09 A;  4TV7 A;  3QAH A;  3PL8 A;  5D8L B;  5ICF A;  2PX9 A;  2E2J J;  2QKM B;  4GCV A;  3G4S I;  1KU9 A;  3GTO J;  2HU9 A;  5HVQ C;  2M45 A;  3V8K A;  4V2F A;  1ZG3 A;  4E7J A;  2M8G X;  3GFI A;  1Y1W J;  1JT0 A;  1S7O A;  3OYN A;  4C2U A;  5JI6 A;  1W5T A;  4BHB A;  3F72 A;  1QRY A;  4JBA A;  1IN5 A;  2EIJ H;  1VTN C;  1OR7 A;  2VBX A;  3BWG A;  3JTH A;  3HOW J;  4LLG F;  3G2B A;  3CJT B;  2O8X A;  2VQH A;  3LWF A;  4XKV A;  4R79 A;  4A3K J;  2E60 A;  4I99 C;  3FWE A;  2IS6 A;  4U0Y A;  1FOW A;  3RCO A;  3BCA A;  5D6F A;  5LBQ A;  2EFW A;  2JJ7 A;  2UUZ A;  2ZFW A;  4PK4 A;  2R7R A;  1AOY A;  3OOU A;  2KZV A;  3BQZ A;  4NB5 A;  1A36 A;  1R36 A;  3CP2 A;  4EM2 A;  3L2Q A;  4IHV A;  1O57 A;  2K3F A;  3MQ0 A;  2WC2 A;  3WG7 H;  2L4M A;  2L3D A;  2VE8 A;  3AAF A;  1J9I A;  1QVT A;  1R4N B;  4Y15 A;  1GLN A;  2DK8 A;  1PUF B;  3G3Z A;  3DEW A;  3CLQ A;  1ETX A;  1S72 I;  4M6V A;  1WJF A;  1DP7 P;  2PLY A;  2ECB A;  3UNG C;  3LNQ A;  4HPQ A;  2PJP A;  3C18 A;  3SZG A;  5D5U B;  5D8K B;  2DOA A;  1WGX A;  5IPA A;  2CFO A;  4KIB A;  3RPU D;  3A2K A;  4BE0 A;  3FMQ A;  2V9V A;  4M71 A;  4HQE A;  3E5X A;  4YII A;  5KHD A;  1YIJ I;  1KU7 A;  1LPQ A;  2PG4 A;  2H1L A;  2X48 A;  4NC8 A;  1OLT A;  2BV6 A;  1KU2 A;  2IS4 A;  2XIG A;  2CQK A;  1BI2 A;  3U9G A;  1T0F A;  2F4I A;  2W85 A;  2ZSI B;  1Z6T A;  4HYE A;  5D5W B;  1UHM A;  3MKZ A;  2GAU A;  2MC4 A;  2Y31 A;  2Z1D A;  4YFK F;  3M1C A;  5EGO A;  1EF4 A;  4IJA A;  5CJ9 A;  3CDH A;  4PJ0 C;  1MJB A;  2IA2 A;  3OIQ A;  1SFU A;  2A5W A;  4I6Z A;  3TED A;  3IH2 A;  1DUX C;  4I09 A;  4ZYH A;  4G7H F;  1KGS A;  1S7E A;  2ME6 A;  1SD5 A;  3CC4 I;  2PEX A;  4YEJ A;  4BHP A;  2WAQ N;  1MJ9 A;  2DJI A;  3S2W A;  1P6R A;  1EKE A;  3KEY A;  3RYR A;  1F43 A;  4ZC3 A;  1L3L A;  2XAJ A;  5IYD J;  4LOC A;  4CH7 A;  1H9G A;  2DA1 A;  2NS7 A;  2VT3 A;  5DCM A;  3RSN A;  5DS9 A;  2E1C A;  2L01 A;  2B9S A;  4DZP A;  1J7K A;  1MKM A;  2M0C A;  2OU2 A;  2NYX A;  2OZU A;  1VFC A;  4D1Q A;  3LSI A;  3CZ6 A;  3HJE A;  4A5N A;  2M87 A;  2Q0O A;  3BZ6 A;  1UFM A;  2HOE A;  1MW7 A;  2EBI A;  1G3Y A;  4L18 B;  2K9L A;  4U0V A;  5FKO A;  5L3F A;  2CQQ A;  3KET A;  2DO7 A;  4KT5 C;  2CH0 A;  2PN6 A;  2HPM A;  1HCR A;  4Q5S F;  1JXS A;  2EB7 A;  3BY6 A;  3K6G A;  1APL C;  3R0J A;  1Y56 A;  5J8F A;  4Z6Y A;  2K40 A;  3CO7 C;  3TO9 A;  4B09 A;  1I5Z A;  1HKT A;  1JUS A;  3IP4 B;  4BS9 A;  2F5V A;  4M3G A;  4IOA F;  2DA6 A;  2FNP A;  2YR2 A;  1H0M A;  4HF2 A;  2OTJ I;  1O7L A;  5F1R A;  4G6Q A;  1ULY A;  1ORK A;  3LST A;  3OYD A;  3H3U A;  3OY9 A;  5C4X J;  2B0L A;  4OOI A;  1QBJ A;  2EZH A;  5JVG F;  1Z1D A;  1SFX A;  4G7O F;  5HDG A;  1XG1 A;  3FXK A;  5CQG A;  2CSO A;  2LRE A;  2O6G E;  4N4O B;  3QYE A;  2BEO A;  1BIA A;  5H6Q A;  1FC3 A;  4GRI A;  2FQ4 A;  1KYW A;  3KZZ A;  2HOA A;  1W5C C;  1D3Y A;  3PUF A;  1IXR C;  4ZTF A;  2EH3 A;  1SMY F;  1VQO I;  3SFI A;  3OV8 A;  5CVI A;  2KIM A;  3L9F A;  2HXO A;  2EJR A;  5HLG A;  1YYV A;  2FXA A;  3Q0V A;  1ZH5 A;  1YJW I;  3RQ4 A;  3W6K B;  3OYA A;  1L0O C;  2IAI A;  2L2O A;  1OCT C;  3GXO A;  2EA2 A;  2Y69 H;  2XSD C;  3M8E A;  5BPD A;  1ZTR A;  1ETK A;  3VOD A;  3CCM I;  1OFC X;  1ON2 A;  2V26 A;  3LSK A;  2BXY A;  3SZT A;  3S16 J;  2HYJ A;  3FXL A;  3PQJ A;  2L7Z A;  2P5K A;  3CQZ J;  4BQN A;  1DU0 A;  3HB9 A;  4AYB A;  2K85 A;  5TJJ A;  2KLO A;  2ZO4 A;  2M7B A;  3ERM A;  1R22 A;  3A02 A;  2R5Z B;  4ON0 A;  4E7S A;  3M1E A;  3O6B B;  3J7A O;  2DLL A;  2JPB A;  3LQQ A;  4MEY F;  3L2R A;  4X6A J;  1B9N A;  4BGD A;  1P9Q C;  1B9M A;  3FMR A;  1WZ2 A;  4JK1 X;  4DBQ A;  2RAE A;  2FMY A;  2XPV A;  3OYF A;  1I3Q J;  2I10 A;  5IP6 A;  2OCE A;  1B1B A;  1M1E B;  1REP C;  5F6F A;  5J4V A;  4BXF A;  2L9V A;  5FLM J;  3DTI A;  2EIL H;  1QZE A;  4EM0 B;  5M5Y J;  4D7N A;  3CC2 I;  2K9Q A;  2GIZ A;  3V8J A;  1X4O A;  2DMN A;  1QPM A;  3TO6 A;  4ZJZ A;  5IYB J;  4EAT A;  2VN2 A;  3HOT A;  2NVX J;  1YO5 C;  1R1T A;  2PMH A;  3WE3 A;  2Q1Z B;  1U3E M;  1IN7 A;  1K78 B;  2LKS A;  2H94 A;  1IRF A;  5GPA A;  2CMP A;  4AC0 A;  3OYI A;  2OA4 A;  4L9N A;  1D0Z A;  4IHS A;  2X1E A;  1UEL B;  3IV5 A;  4MFE A;  2YS9 A;  3CJR B;  2NNY A;  2NVT J;  1SD6 A;  3MZY A;  4II2 A;  4WF2 A;  4BDZ A;  2JTV A;  3CMA I;  3Q0W A;  3TL4 X;  3MN2 A;  4UV8 A;  4QIW N;  3KCC A;  1BR2 A;  1WKM A;  2IP2 A;  3VYR B;  5GTH C;  2CW8 A;  2ZKZ A;  5HS9 A;  5K7H A;  3WTY C;  5CVU A;  3VPR A;  2E7W A;  2JVG A;  3A01 B;  2D1H A;  3VYU B;  3NAU A;  3K2Z A;  1WRJ A;  3QPS A;  4BJ5 C;  2PJR B;  1SAN A;  4JP0 A;  5CKT A;  2MC3 A;  1OJL A;  1B8I A;  4E70 A;  4IVN A;  3KE2 A;  3BZC A;  5L3B A;  2R4G A;  4JYK A;  1X1A A;  4HQM A;  2M4G A;  4DBR A;  2R7S A;  3ELK A;  3EDP A;  4DOZ A;  1J59 A;  3PSI A;  2X1D A;  1IXS B;  1TLH B;  2WTE A;  3KP3 A;  5DM7 F;  4A3F J;  2DQL A;  4RAF A;  2WY7 Q;  4RAY A;  4AVZ A;  1A6I A;  2P6S A;  2PBI A;  4KIG A;  1P7J A;  5JFR A;  1ZRD A;  3E1S A;  1TW2 A;  2WBM A;  5DYM A;  2O5R A;  4C3H J;  1WH5 A;  3JAM K;  2XAS A;  4CXF A;  3GTQ J;  2K9M A;  5L3E A;  4E7I A;  2DOD A;  4AID A;  1ZGA A;  3GFJ A;  4EVI A;  4IRG A;  5K5R A;  2F6C A;  1VQK I;  3D5L A;  4UV9 A;  5HDN A;  3B02 A;  4K2E A;  2HDW A;  2P7C B;  3HM5 A;  4AIH A;  1O3Q A;  1RNL A;  4FIS A;  1YRN B;  3WG9 A;  5TGT A;  1ZG1 A;  2R93 J;  3AG2 H;  1FBS A;  2NAZ A;  3RPQ A;  1IC8 A;  5D5V B;  2LNB A;  1Z21 A;  4CIC A;  3CDL A;  2W82 A;  4RLQ A;  2XAH A;  5IY5 H;  2COM A;  2LLK A;  2MG4 A;  1I6H J;  2DOF A;  3I5U A;  3ZP5 A;  5JHF A;  4N4N B;  3NRV A;  1D1A A;  1JHH A;  1ODD A;  2R92 J;  4KJZ A;  1YIT I;  4IOC F;  1OYI A;  2V9P A;  3DWL E;  2QSG X;  2R7Z J;  1RET A;  4KIT B;  1FOK A;  2MGQ A;  2RRE A;  2XB0 X;  3PQK A;  1X58 A;  2KJC A;  5LHI A;  2CUZ A;  2FUG 2;  1S3J A;  1ZEL A;  2R3S A;  3LFK A;  4EJV A;  1XSD A;  3CC7 I;  2VQL A;  4UXN A;  1O7F A;  1NK2 P;  4IX7 A;  3PIP F;  1UST A;  1LFP A;  4CZC A;  1DGW Y;  3HGY A;  2ZNY A;  3DKY A;  1AWC A;  2NXN B;  2IS2 A;  1ITY A;  2ESN A;  2J5O A;  5HLT A;  4JX5 A;  3P9K A;  1MBK A;  3CES A;  4I0B A;  2JA6 J;  1R00 A;  2ZME B;  3ZR8 X;  4FQG A;  2R7D A;  4BH9 A;  4A0Z A;  4A3B J;  1SFK A;  2BGC A;  2LSO A;  5BMZ A;  2IRF G;  3CCR I;  2RVC A;  4HG2 A;  4KFC A;  4DYR A;  4EJW A;  3VSL A;  4BKX A;  3H1C A;  2AXL A;  1UB9 A;  1RR8 C;  3NQO A;  2HTJ A;  3ABL H;  2QQ9 A;  3R4K A;  3IAS 2;  2XUB A;  3EYY A;  3H9G A;  5D4R A;  1STZ A;  3C7J A;  2IGK A;  1S7A A;  2Z5U A;  3E3V A;  1WJB A;  1BA5 A;  3BR6 A;  1J2X A;  3KP6 A;  3RKQ A;  4IO9 F;  3MKY B;  2DFF A;  1ZYR F;  4DIQ A;  3W6J B;  3O3K A;  2ID3 A;  2BY0 A;  5EZG A;  3ECH A;  2FE3 A;  3KLN A;  5DD4 A;  2DJN A;  1HW2 A;  2DMP A;  4IHY A;  2EZL A;  2K9S A;  2LP0 A;  1N75 A;  1OIS A;  4BY1 J;  2CQX A;  4A0X A;  4Y4R A;  1UJ8 A;  4HV6 A;  1XDU A;  2QM3 A;  1W7P D;  3K4K A;  3LFU A;  1BJZ A;  1R71 A;  1R5I D;  1GUU A;  2OV7 A;  3SYT A;  2M1B A;  2E5N A;  1Z91 A;  5EEH A;  3IAM 2;  3LSJ A;  4M6X A;  4OIO F;  2HQR A;  1MSE C;  3RQI A;  3BR2 A;  1CQT A;  3BG3 A;  1XSX A;  2IW5 A;  1Y0U A;  3P7N A;  3BP8 A;  2QF7 A;  2Z2S B;  3IHU A;  3Q9S A;  2W84 A;  5JLW A;  4A3C J;  2V9K A;  1MMA A;  4PSW A;  3T8T A;  5FRO A;  3CCU I;  4ZTJ A;  3DPL C;  1W7P B;  2VIX A;  1PUF A;  1G6N A;  3VFZ A;  2HKX A;  3DEU A;  2QWW A;  2LF8 A;  4AM3 A;  4F91 B;  4KN4 X;  5L3C A;  5ICE A;  2HEO A;  1VZ0 A;  5LEJ A;  2KJB A;  3U21 A;  3G1O A;  5AON A;  4F7Z A;  4RAZ A;  5EEA A;  4QPO A;  3CUQ C;  3S1N J;  2M34 A;  3OR2 C;  1JUM A;  2EIK H;  3L7W A;  3E6C C;  3BTL A;  3OL4 A;  3H5N A;  3BTI A;  5IOY A;  4UB6 C;  1BI3 A;  3J7Y J;  1KON A;  4XLF A;  3ZRG A;  2TRT A;  3BT9 A;  4A3M J;  1V5G A;  5DM6 F;  1IO2 A;  4CYC A;  1KQ9 A;  2ZFU A;  1QA6 A;  3CME I;  3F8C A;  3TP0 A;  3LOC A;  2KRH A;  2QZ8 A;  2Y48 A;  3HZJ A;  4ZZL A;  2CQ7 A;  2BY3 A;  1ZR2 A;  1XGM A;  3I55 I;  1K78 A;  3L09 A;  5C44 J;  2M2E A;  3LSP A;  3S3O A;  3MAJ A;  4M3E A;  1VQ5 I;  4X0G A;  2HR3 A;  3HGG A;  1OMI A;  1V4R A;  1ETW A;  2VBZ A;  2XF6 A;  3E5Q A;  2VXZ A;  2EK5 A;  5FO5 A;  1MSF C;  1FBQ A;  1D0Y A;  2XGC A;  3OYB A;  1W4M A;  3FXJ A;  2L02 A;  5KK1 A;  3I0T A;  1QO0 D;  3IRQ A;  3BJ6 A;  3ABT A;  2EA4 A;  2LRD A;  4XLA A;  1A35 A;  2CUJ A;  3W2V A;  4AVP A;  1ACI A;  3QYB A;  4I01 A;  2RN7 A;  1UZC A;  2A05 A;  4PJL A;  4ESJ A;  1BC8 C;  4Y7N J;  2M0M A;  1VQM I;  2V79 A;  3F3X A;  3RIR A;  2CWE A;  2FRH A;  3NEU A;  4FET A;  3JRB A;  2PJR A;  2B63 J;  2A3S A;  3MKL A;  1FYM A;  3CCY A;  4CHU A;  1DPR A;  3D1N I;  3B6C A;  1V3F A;  2HTS A;  4FE7 A;  3L1P A;  4BE1 A;  5FRN A;  2D45 A;  2I8D A;  4QTR A;  4R8H A;  3BPV A;  1ON1 A;  1X2M A;  1QNT A;  2X9D A; 
#chains in the Genus database with same CATH homology
 4YEJ A;  3PNY A;  2LBF A;  3VDX A;  2DJI A;  2M3A A;  2UWM A;  3KEY A;  4ZC3 A;  3MKW B;  1EA3 A;  4XQF A;  4H4K C;  2NOJ B;  4CH7 A;  3RSN A;  3TMO A;  3S3N A;  2E1M C;  5CPR B;  3I9V 2;  3D5R C;  2KRC A;  3K4B A;  4ITV A;  4D1Q A;  3LSI A;  4NQW B;  4RM2 A;  2R7W A;  3CZ6 A;  3K4J A;  4RMN A;  2WAQ A;  4ZDP A;  4F93 B;  2VJJ A;  1MW7 A;  3EPZ A;  2K9L A;  2V7F A;  4CSW A;  2XDV A;  3D5S C;  2DXI A;  2CH0 A;  2HPM A;  1E0E A;  3N05 A;  3LSH A;  3ONQ A;  4IZZ A;  4XMY A;  3CF2 A;  3K6G A;  2P0W A;  3EUH C;  4PJN A;  4CA0 A;  1TZL A;  1V5E A;  2L9S A;  4XKB A;  1Y56 A;  4B43 A;  2BVL A;  3IP4 B;  3BLY A;  1LDK B;  4IKF A;  4BS9 A;  2F5V A;  2JA2 A;  3F9K A;  1K6Y A;  2LYC A;  4CCN A;  4J01 A;  3I3L A;  1QU3 A;  3BC8 A;  4XL9 A;  3OYD A;  4XN0 A;  3OY9 A;  3OYK A;  4HRI A;  5CQE A;  2JSP A;  3OMY A;  1WJD A;  2L5Q A;  4B3X A;  1YX5 A;  3HL2 A;  3PUB A;  2ZXH A;  3FKJ A;  5CQG A;  2LRE A;  4N4O B;  3QYE A;  1DQU A;  2KL4 A;  3TBI A;  4GRI A;  2CS3 A;  2ELJ A;  2HQA A;  2W1O A;  3VSK A;  4BEH A;  2CV1 A;  2LH9 A;  2VAS A;  1N77 A;  4ZTF A;  3L2V A;  1WFX A;  1ERD A;  2A6T A;  4XNF A;  2XAU A;  3AKZ A;  3HKZ A;  3QOD A;  2BOL A;  2K5C A;  3RQ4 A;  3OYA A;  2L2O A;  4NC7 A;  2X51 A;  3OL3 A;  3CP8 A;  3K4C A;  4ZDL A;  3DU5 A;  4LIT A;  4QPQ A;  2Q2E B;  4E7Z A;  3K70 D;  3M8J A;  3VWB A;  2V26 A;  3LSK A;  4XON A;  4ANJ A;  2KHM A;  3BG7 A;  3S8P A;  4BQN A;  4KIS A;  3PNV A;  3ZXS A;  4AYB A;  1J09 A;  2KLO A;  2E1M B;  2M7B A;  2VJI A;  1JI8 A;  3H5A A;  3CJQ B;  4G6T B;  3S93 A;  4E7S A;  3PFY A;  2VQC A;  2W7N A;  1TT0 A;  1X1B A;  2HVS A;  3L2R A;  1Z3X A;  4CCK A;  4BGD A;  2OC6 A;  1P9Q C;  2HPI A;  4DBQ A;  2R7X A;  3OYF A;  4PJJ A;  1SAU A;  4BJT A;  2HNH A;  2JUG A;  2LY2 A;  4BXF A;  1BR4 A;  3DTI A;  4C2T A;  3K4L A;  3C2G A;  1T0F C;  3ZCO A;  3KYL A;  4NUB A;  1DP3 A;  1X4O A;  1G59 A;  2R7O A;  1Y6I A;  2MAB A;  4ZJZ A;  1WJE A;  2E5Z A;  4EAT A;  2VPL A;  3DEE A;  3DTK A;  4U7B A;  3HOT A;  2R7U A;  3EUK L;  2Q1Z B;  2BVM A;  4XOR A;  3C2H A;  1YX3 A;  3H0D A;  4JQF A;  4MLO A;  2IGM A;  2CMP A;  1WJC A;  3OYI A;  1D1C A;  1D0Z A;  2XF5 A;  1V5F A;  2X1E A;  1UEL B;  4XLH A;  4XOT A;  3CJR B;  1FMW A;  4Y33 A;  4BQO A;  5LFA A;  5HOO A;  3OYM A;  2KDO A;  3DKX A;  3HG9 A;  3QYF A;  4II2 A;  4BDZ A;  4PFP A;  3J7A Y;  3FHN A;  3TL4 X;  2VQG A;  3DQV C;  3AFH A;  2LBF B;  1BR2 A;  3VYR B;  2Y0S A;  3CMM A;  3L2W A;  2CW8 A;  2GOM A;  4C30 A;  2JVG A;  2XF7 A;  3VYS B;  3LMM A;  3W3C A;  3VYU B;  3ZGK A;  1W36 D;  3DU6 A;  3HUG B;  4PFO A;  3S3M A;  2HZD A;  4BJ5 C;  3L2U A;  2PJR B;  3FBN B;  3KX2 A;  4IQJ A;  5CKT A;  2X6W A;  2X1C A;  3OYC A;  2L9N A;  3GBG A;  4BAC A;  3HC7 A;  2R4G A;  2CW7 A;  2M4K A;  1X1A A;  4U87 A;  1R6R A;  2MFZ A;  3A1Y A;  2M4G A;  4DBR A;  2LG4 A;  2R7S A;  4CCL A;  4CCM A;  3PSI A;  4DOZ A;  2X1D A;  4RM3 A;  1LVK A;  3LSM A;  2DT6 A;  2MYS A;  3OYH A;  1D1B A;  4F52 A;  2IXS A;  2WY7 Q;  4AVZ A;  4XOP A;  2VJ4 A;  2GOX B;  3W2A A;  3E1S A;  2WBM A;  2O5R A;  2KMU A;  3K4N A;  1Z7L A;  1T95 A;  2VXD A;  2K9M A;  2HVR A;  4E7I A;  1PYV A;  2IGO A;  4BL0 B;  4DGW B;  2R7V A;  4F55 A;  2MD0 A;  2LY1 A;  3OS0 A;  4NNJ A;  1G8X A;  2X6Y A;  5KNL A;  5LD2 C;  2F6C A;  2LC2 A;  3D5L A;  4PJM A;  4F3Q A;  4PUS A;  4B44 A;  2HDW A;  1X19 A;  3FBI B;  2WAF A;  4BQQ A;  5TGT A;  2VKD A;  1W36 C;  1QHH D;  4E4H A;  2AQF A;  1Z21 A;  2ZXI A;  3K10 A;  2W82 A;  4RLQ A;  1NG7 A;  2HVQ A;  4Y3O A;  3MMY B;  4YEL A;  2L7K A;  4FAS D;  2VB6 A;  5JHF A;  4N4N B;  3DPT A;  4CUG A;  1D1A A;  4KJZ A;  4ZYA A;  1Z3Y A;  3DWL E;  4KIT B;  1MMG A;  2RRE A;  3OWT A;  1WJA A;  3NWS A;  2BW3 A;  2CUZ A;  2FUG 2;  2W00 A;  1ZEL A;  3QOE A;  3H35 A;  4BE2 A;  3E0J B;  2WAE A;  2VQL A;  4E7K A;  3LL7 A;  4BEH B;  4IX7 A;  4B48 A;  4E6K G;  4RLF A;  1LFP A;  1LKX A;  3BG6 A;  3PSF A;  4CZC A;  1DGW Y;  3DKY A;  2X6X A;  1N78 A;  3ZQQ A;  2IS1 A;  4OWR B;  2IS2 A;  4HST A;  5HLT A;  1WJ5 A;  4HNT A;  4XKC A;  2VJ5 A;  1BOB A;  3CES A;  1HA8 A;  2VLA A;  3MD2 A;  3ZR8 X;  3UR3 C;  4F92 B;  3SEQ A;  4BJ6 C;  1U0J A;  1SFK A;  4XLC A;  4HG2 A;  1YE9 A;  3EUA A;  3SDB A;  1AA7 A;  1BR1 A;  1X1C A;  3VSL A;  2BW3 B;  4LG3 A;  2CV2 A;  2V6E A;  3BCB A;  2LOO A;  2K3P A;  3OYJ A;  1QHG A;  1D0X A;  3DLA A;  4XLE A;  3AL0 C;  1S9H A;  3IAS 2;  3S32 A;  2WA0 A;  4HEA 2;  3H9G A;  2AQE A;  4HNU A;  2WB1 A;  2IGK A;  3OS1 A;  4B47 A;  1WJB A;  3FDY A;  4HSR A;  2DCE A;  4CCO A;  1MMD A;  3K4M A;  3MKY B;  5HNH A;  2WAD A;  4YRV A;  1MND A;  4DIQ A;  3K70 C;  1DGR M;  3DTE A;  3H9J A;  4CCJ A;  2XC7 A;  2DT7 B;  3OR1 C;  4DJA A;  2CV0 A;  4KT6 A;  5HNF A;  4XM3 A;  2R7Q A;  1N75 A;  4OAZ A;  4BUP A;  3RTR A;  4Y4R A;  4LIV A;  1UAA A;  2VL8 A;  2RQQ A;  3K4K A;  3LFU A;  4C9Y A;  4XKW A;  4LIU A;  2QKL B;  2OV7 A;  2KP6 A;  3PL8 A;  3SYT A;  2E5N A;  2QKM B;  3IAM 2;  2HU9 A;  1NG6 A;  4AU7 A;  5HVQ C;  4PSX A;  2Z2S B;  4E7J A;  2V4J C;  3IUO A;  3OYN A;  2V9K A;  1MMA A;  4C2U A;  1X4P A;  4D9J A;  4PSW A;  1PJR A;  5FRO A;  3VYT B;  1IRX A;  3HOS A;  3DPL C;  4E7L A;  4ZTJ A;  2VIX A;  2RNG A;  4F91 B;  3G2B A;  1VZ0 A;  2VQH A;  4XKV A;  4R79 A;  2E60 A;  2JVH A;  3PJR A;  3U21 A;  2IS6 A;  3SEZ A;  2Z16 A;  2ZSH B;  4IQ4 A;  4QPO A;  3OR2 C;  3RCO A;  3BCA A;  3OL4 A;  1FMV A;  2X85 A;  3H5N A;  2UUZ A;  2R7R A;  4PK4 A;  1KON A;  3OOU A;  2KZV A;  3LSG A;  4XLF A;  3OYG A;  2KPM A;  4ZDO A;  1OR7 C;  5KCM A;  3ZRG A;  3CP2 A;  3W2W A;  3L2Q A;  3OYL A;  1V5G A;  4E7H A;  2ZFU A;  4OAY A;  1MNE A;  2WY8 Q;  3H9Q A;  4II3 A;  2KRH A;  5FRM A;  3H5R A;  3AL0 B;  1GLN A;  3S3O A;  4X0G A;  3PNT A;  4XN3 A;  1WJF A;  2XF6 A;  2W4S A;  2VXZ A;  4P5O A;  3UNG C;  4HPQ A;  1D0Y A;  3SZG A;  4J00 A;  2DOA A;  3OYB A;  1MMN A;  3NWT A;  2CFO A;  4P1W A;  3RPU D;  2IGN A;  3HXL A;  3A2K A;  4BE0 A;  4BDY A;  2M7A A;  1X1D A;  2LRD A;  4XLA A;  5KHD A;  2XSJ C;  2KQR A;  4BU2 A;  2CUJ A;  3W2V A;  4XR6 A;  4JOM A;  1UG0 A;  4NC8 A;  3QYB A;  1OLT A;  3DPU A;  3A4C A;  2IS4 A;  4PJL A;  3V42 A;  2R7T A;  2F4I A;  2M0M A;  2ZSI B;  2PMZ A;  3MKZ A;  2MC4 A;  2Z1D A;  3M1C A;  3OS2 A;  4FET A;  2OUM A;  3OIQ A;  2PJR A;  2A5W A;  3HPG A;  3OYE A;  4BE1 A;  2UV1 A;  5FRN A;  2V1N A;  2I8D A;  3HPH A;  3OIP A;  2VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...