4OAZA

Bldd ctd-c-di-gmp complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
PKLVLDLERLATVPAEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative DNA-binding protein
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Dna binding protein
total genus 27
structure length 75
sequence length 75
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4oazA00
4OAYA 2MC4A 5KHDA 4OAZA
chains in the Genus database with same CATH superfamily
1LPQA 4V2FA 5DD8A 1MBGA 2F48A 1MDMA 4JX6A 2KFDA 2R4GA 4KA4A 4KIFA 4I09A 4YIFA 4F3QA 4CICA 1JT0A 4QPOA 3FXUA 4HW0A 2IJLA 3WGGA 1ZK8A 1E3HA 4IXAA 5HNHA 4HNTA 1UFMA 1W1WE 1T0FC 2K3FA 3KZZA 1T95A 1VQ8I 1WI9A 3F6OA 1ZN2A 1FOKA 1V5GA 3HSFA 4AU7A 2DA7A 1XGMA 2X1EA 1YIOA 4N9IA 3E6DA 3VPRA 1B8IB 3L2QA 1S7AA 2DYRH 5LEKA 2CFOA 1U5TC 1OISA 3EQLF 5M5YJ 4JQFA 2L3DA 1ERDA 1FOYA 5CKTA 1K78B 2ZCWA 3ASNH 4MHGA 2K9LA 1S9HA 1MDMB 3EUAA 2DOFA 3CLQA 1FYKA 4XLHA 4XLCA 4E7ZA 3JRHA 2M87A 3NEUA 5E3OA 1F1ZA 4P5OA 3GO5A 4U0VA 5A2QZ 1TBXA 4CA0A 1OCOH 2WV0A 4J19A 4L9JA 1REPC 2VIXA 2XPUA 3KFWX 3RDIA 2VKEA 3VSKA 2Z2SB 2TDXA 4CZZA 2VXZA 2M0CA 1QVTA 3S16J 1PUEE 3KLNA 1OR7C 4I98B 3IRRA 3CCUI 1SD7A 1FSEA 4RS8A 1MBFA 4AD9A 2WA0A 2H09A 3U2RA 2ICWG 4G6TB 1TZLA 1TW3A 3CJRB 1IZ1A 3TW6A 4S0HB 5F1RA 1LDDA 3OYDA 1RPWA 3ELKA 4NC6A 3W2VA 3ZP5A 2V6EA 3OYBA 1DP7P 1QPMA 4M72A 2IS1A 2UXNA 1U5TB 2MH2A 3H92A 3OYCA 3J81K 2QEXI 4BDZA 2IGOA 2VODA 3RYRA 4D0PA 2E1CA 5TJJA 2BY1A 4U88A 3OYNA 1ZAOA 3DBLB 1L0OC 2A6EF 2MFZA 3WGIA 2AO9A 1PYVA 2V1DA 2QVOA 3KIOA 2RKHA 1K83J 2ZNYA 3JAMZ 4A3CJ 2GM4A 1KONA 2H8RA 2HOEA 5BS6A 1SAXA 4CUGA 3PIOF 4GYIA 4RAYA 1TWGJ 3BTJA 4IVNA 3DPTA 5ICFA 1DDNA 2VBYA 4XBFA 1SVOA 2PX9A 3KYCB 3LNQA 3BG7A 2R7VA 5D8LB 4BL0B 3SZGA 2O0YA 3GTPJ 3GLLA 3ZR8X 4U0YA 2IS6A 2M7BA 2AXTC 5GPCA 5EZHA 2NNYA 4W97A 4ZYDA 3KETA 3OOUA 3GTQJ 3KE2A 1YJ9I 1KYWA 4QPQA 5DEQA 3HL2A 2K85A 3WTSC 2R0QC 3RPUD 3ZXSA 3DBHB 3H9QA 4ESJA 1IG7A 3TDZC 3OYLA 4YFNF 4YIRX 2KISA 3L09A 1OJLA 2QM3A 2YU9J 3RIRA 1V4RA 1FEXA 1RKTA 3Q0VA 3FM5A 3CCSI 3FHNA 3RPUA 2A07F 3JRFA 4AVPA 4RB1A 4ZH4F 3L00A 3ECHA 2HVQA 3RI4A 2F5DA 2PMHA 2GOXB 5C4XJ 3M4OJ 4M3EA 1MMAA 1EV7A 3R61A 4XICA 3W6KB 2Z1DA 3HSRA 3RPQA 4IHXA 1JJ6C 3H36A 3M8EA 1BBYA 4LB6B 1ZLJA 1R36A 3BP8A 2EILH 2DFIA 4EQQA 4WCGA 1X19A 3FKIJ 2IA1A 2LD5A 1SFOJ 2DT6A 2D5VA 2NVUB 4BJ6C 1YFHA 5GADJ 4L5EA 3BQYA 4PGGA 1G8XA 4XN0A 3K2AA 3FXRA 3ZMZA 2ZFWA 3RZOJ 1JHHA 3BJ6A 4PSWA 1MJAA 5F1JA 4A3FJ 3CD6I 2BV6A 1ZGJA 2EIMH 3F8NA 4PJJA 2HTSA 3HPGA 1CQTA 2HVSA 4GFBA 2VBZA 1RRJA 1MBEA 1LNWA 2HPIA 2PLYA 3KPHA 1LQ1A 1ACIA 1YG2A 3GEZA 3U21A 4B09A 3E1SA 2Y9ZA 2EQRA 5L3DA 1UG0A 5DYMA 2VC0A 1WJDA 4IHTA 2DA3A 3HM5A 3PIPF 4DZPA 4PFPA 3IKTA 3J80Z 2A68F 3K4NA 3PQJA 4HNUA 4LG3A 1QPIA 2HS5A 5C4JJ 3TW7A 2OF7A 2Z16A 1P7JA 3SFIA 4ZDOA 4LK0F 2F5CA 2L2OA 1YJWI 4EV0A 5DS9A 2E71A 2QCOA 4MGRA 1B9MA 4XM3A 2A61A 2XAUA 3CJTB 4RDUA 3FX3A 2CJJA 4UVAA 1MNEA 3PM1A 2OC6A 4A3LJ 2FBIA 1MJBA 1ETKA 3ZCOA 3R0AA 3BROA 2EZIA 2JK3A 2UV1A 2OAZA 2F5EA 1R7JA 3IAS2 4L5JA 1EJ9A 1V5FA 4B1RA 4I01A 2D45A 3E6CC 1TQMA 2HZDA 4IF4A 2VB6A 2LH9A 4HYEA 2BVMA 1LVAA 2H27A 2DMUA 3FBNB 1K6OA 1B59A 4RB0A 2MW8A 3Q5FA 5CLSA 4B43A 5HS7A 4F55A 4CCJA 2BY3A 2P4WA 4KMFA 1SD5A 5IP6A 4A3IJ 3DU5A 5D5WB 4ENKA 1IN7A 4DYQA 3AG4H 4LG0A 3L2RA 4LK1F 4A3EJ 3AG1H 1EKEA 1Z0XA 3TDUC 4C2MJ 3OYKA 5E17F 1SVMA 3OYAA 3F8MA 1X1DA 1YX3A 2L5QA 3KZYA 3LSIA 4K2EA 4Q5SF 2X85A 1JT6A 2FF4A 2QGUA 3OYHA 2CWEA 4JX5A 1X1BA 3F23A 2L7FP 5H6RA 3K1NA 1XGSA 1R00A 4RGSA 4ENNA 2OUMA 1D1CA 3OR2C 4NB5A 3DWLE 3K4KA 4XKVA 1LJ9A 1ODDA 3WGHA 1P92A 3IWFA 1P7IA 1Z77A 1BJZA 3WTTC 2VPLA 3KP4A 1QQIA 5FKKA 5LHIA 3TEDA 3W6VA 3I54A 1UJ8A 2DJIA 2X6OA 3FZVA 1Y6IA 2IXSA 2LY2A 1G2HA 3A4CA 5B3SH 4HG2A 2W57A 4FE7A 3G1LA 2JQ7A 1E0EA 1Z91A 3IUOA 1MBJA 3EPZA 1T6SA 3RSNA 4RAZA 1ZR2A 4IKFA 2D2WA 4HV5A 4CCMA 2VKDA 4HV6A 2XAHA 1N75A 4RM2A 3MZYA 2R7TA 5K5QA 4ZZLA 2DT5A 2WY8Q 4RBOA 5CJ9A 1W0TA 3S2WA 3WODF 5IY5H 4OAZA 5CVRA 2XF7A 4CXFA 2V6CA 3G1OA 3OR1C 4G6DA 3RKYA 3ROUA 2PEXA 2ESNA 4XRMA 1ZRDA 2DK8A 1JJ8C 5HS9A 1IXCA 2K86A 3C2GA 3C1DA 3ZMSA 4AVZA 4BS9A 3ABLH 1M1EB 2RGVA 1VF9A 2TRTA 3MCZA 1YW9A 4HNVA 1N78A 4UUSA 4LOCA 4OU0A 3LAPA 3SZTA 5M5WJ 2MH9A 2IP2A 2BEOA 1ON1A 4I99C 3CMAI 2BZTA 1MZBA 4LLLA 4XORA 1TW2A 2KRCA 3Q9SA 2ZJQF 3HTUA 4HOBA 2P0WA 1G3WA 2PJPA 3HOYJ 1YIJI 1I6XA 3B73A 2HYJA 1LEAA 3DFGA 5AIQA 1VZ0A 3ESWB 3S1RJ 3GTMJ 1G59A 1V55H 4OIOF 4BKXA 3K0LA 3T5XA 1Z1DA 4I2OA 2CUFA 1KZHA 2FE3A 3QQAA 3FXMA 2NYXA 1S6LA 3BR6A 5J1YA 2R7DA 4FASD 2H6CA 4LLGF 3EUHA 5IT9Z 1J09A 3CZ6A 1BW6A 3TBIA 2BXYA 1OPCA 1H0MA 2AXLA 4DGWB 3MZ8A 3N97A 3N4MA 1HKSA 1OCRH 3WG9A 2DPUA 5M5XJ 2O7OA 3GW2A 4E7HA 2OJED 5CQEA 2CW0F 2V7FA 4ON0A 3I0TA 3KLOA 1ETOA 1QBJA 4BDYA 2IT0A 2XC7A 2COMA 5FKNA 4BHPA 3OIQA 2GXBA 4UUVA 2E36A 5CVUA 1H88C 2DW4A 4IEJA 4UXNA 5LRRA 1GV2A 3RTRA 3AL0B 3REOA 2XGDA 2GXGA 5LHGA 3DXJF 2Y31A 4EGYA 4XRSG 2CQQA 4B47A 4MIMA 3PNYA 3H5AA 3GTLJ 2ZMEC 4OAYA 3CCLI 4ESFA 2F4IA 3OS1A 5J1RA 1ZQ3P 3I4NJ 1I1GA 4XKCA 3DCFA 4NDLA 3TOBA 4YELA 5JHFA 2Z3YA 3KEQA 4KITB 2R7QA 4A69C 3D5LA 4CYDA 2CW8A 2OZUA 2KKOA 1P4XA 2WBMA 3P9KA 2E2IJ 3WTZA 2CUEA 3DEUA 1TP4A 4UB6C 1YX5A 5LLQA 3CUOA 1FSHA 2RN7A 4CDGA 5IOZA 2STWA 5FKOA 1Z7UA 2MG4A 2LF7A 1QU3A 2Q8KA 3CCVI 3HOZJ 1UCRA 1XC5A 4S04A 4JOMA 2W24A 2BYVE 1Q1VA 1Y8RB 3HOXJ 1XN7A 4B3XA 2XRNA 3I3LA 3K4LA 4RB3C 3JSPA 2ID3A 3VDXA 1XTAA 3BG3A 2VLAA 2G9WA 4RB2C 1ZH5A 4EEFG 4N9HA 5L3GA 3VSLA 2A5YB 3A0BC 2EV5A 2WY7Q 2V9PA 5HLTA 1E2XA 3K7AJ 1PP7U 1ZG3A 5ICGA 1EH7A 4Y33A 2ZMEB 3AAFA 5D5VB 4NNJA 1TWHJ 4O5VA 1ITYA 3RQ4A 3HB9A 4NBQA 4MFDA 1ORKA 3A03A 3B6CA 2HYFA 2IVMA 4A0XA 3LSRA 3WHBA 2E34A 2H94A 3KX2A 1HBXG 2KDOA 4PK4A 5FFXA 2E60A 4ZJZA 3BY6A 1U8BA 3QP5A 4FX4A 2B0LA 1LDKB 2G7HA 3MKYB 3FXJA 2AS5F 4QTRA 4C30A 3CTAA 3JREA 2Y2ZA 1PJRA 2M30A 1XB4A 1UG2A 1Z9CA 1WH5A 3RCOA 2CQNA 3E3VA 1J5YA 2VPRA 4ZYAA 2EA2A 2BW3A 3SJMA 3AG3H 3HGYA 1DGWY 2Y75A 5D8KB 1KU9A 2X6YA 5FLXZ 4MQ9F 2JZYA 2IGMA 2ZXIA 4WF2A 2B9SA 4M3GA 2M7AA 3CCQI 1SEUA 2VE9A 1WJBA 3OYJA 4NHJA 1JXSA 1EH6A 2HKXA 1KU7A 3S2HJ 4C2UA 3R6SA 1IC8A 2K9MA 5KK1A 1YS7A 4B3AA 4XLPF 3IL2A 4Z6YA 2MLGA 2L9SA 2YU3A 4LITA 3BR2A 1S5LC 2K4BA 2XUBA 5HLGA 4XONA 1YW8A 4GGGA 4YG2F 1GLNA 2DK5A 5EEAA 2ZNZA 4HSTA 1RZ4A 2JRTA 4IZZA 3JR9A 1DP3A 3MN2A 2Y69H 2EZKA 4J00A 5FKMA 2IEKA 4BQOA 2CSOA 2XF5A 4M3DA 2Z33A 5JVGF 1LEBA 2BW3B 4C9YA 4JBAA 3O6BB 4UY8I 2CMPA 4LIUA 3G2BA 2X48A 3GZ6A 3SQNA 4G12A 1DUXC 2DFHA 1LFBA 3I59B 4LGWA 1R5HA 3BG5A 4RLQA 3MAJA 2A3SA 4IO9F 2QQBA 3CO7C 1IUFA 5D4SA 2IAIA 3UNGC 1WHUA 4BHBA 9ANTA 5FD6A 3LWFA 1AOYA 4KN4X 3S32A 2ECBA 3V7SA 2A6TA 3DBRB 2R3SA 4D7MA 2XAFA 3OL3A 2F4MB 5H6QA 4H4KC 3GVAA 3GZ5A 1FY7A 3GTOJ 3RKWA 1YHQI 3M3YJ 1ZG5A 5ILVA 2LR8A 3KZIC 5FRNA 1RETA 4DYRA 3WTUC 4G6QA 1S72I 3M7GA 1X3WB 2LLKA 3NAUA 2KZVA 2LC2A 1UMQA 3IH2A 3SZPA 2MSYA 4BBRJ 3HRTA 3OS0A 5TISC 1Z67A 1Y0NA 1H89C 4A0YA 2DO7A 2XIGA 2QENA 4KDPA 2VT2A 2PMUA 1U78A 2DA2A 1Z05A 3LSKA 2RNGA 2LP0A 1JKQC 3I9V2 2LY9A 4HDVA 3W2WA 2CRGA 5JR3A 2X6XA 1TT5B 2BGCA 1A04A 2FJ1A 2FQ4A 4BE0A 5E79C 2A5WA 2M45A 4E7SA 4BE1A 4BH9A 1B72A 4UNOA 2ELJA 2WWYA 1HC8A 2CUJA 2ZC2A 1E3PA 1BI0A 2COBA 2VOPA 2LBFA 4OOIA 1BR4A 3G3ZA 2EFPA 1V54H 3F8BA 2HQ5A 1MSEC 1T0FA 4ZC3A 1SFEA 2L0KA 1IN6A 1YITI 2VOOA 1LE8A 1IDYA 2BBYA 4BGDA 3VYUB 4D1QA 4KUMA 3D1NI 2LOOA 1YI2I 3EYIA 1AHDP 3SHFA 4I7HA 4IOCF 1W4MA 2V79A 5K7FA 3CUQA 2DMTA 1OYIA 4DNCA 5L3FA 2ACJA 2BVLA 2QQ8A 2Y0SN 4C2TA 2OPTA 3V4GA 3OOPA 2DI3A 2DA5A 4PZJA 1W5CC 3CCEI 2QA4I 4IQJA 1LB2A 1X2NA 4BQAA 5FKLA 5E8GA 3VYRB 3BR1A 3BG9A 4BJTA 4D9JA 4ABZA 4ZTJA 3HRUA 1HSJA 2JN6A 3QPSA 3WE3A 5HOOA 4IX7A 1L3LA 4XKBA 1FLIA 2OCCH 2LBFB 4A5MA 5KHDA 1K61A 1D1BA 2KIUA 4DZJA 2ME6A 2HTJA 1IXSB 2XROA 1KGSA 1K79A 1LE8B 5DDGA 5E20A 4FTHA 4ZDPA 1OFCX 3J81Z 2XHKA 3DPUA 1F5TA 5GTHC 2QBYA 1FYLA 5EEHA 4F52A 3CUQB 4WK8F 1A36A 1FP2A 5H20A 3HSEA 2W48A 3VYTB 3ZQLA 1D0YA 4PJLA 4QIWN 1R4NB 3I71A 5K7ZA 4A3MJ 5D5XB 3U9GA 1H9GA 1IGNA 1X1CA 3PNVA 4X0GA 4BXFA 3LMMA 3CCRI 2RAEA 1I3AA 1VFCA 1A31A 2ME0A 5EJCA 3ERED 5L3BA 1IO2A 4FHTA 3SFZA 1UHMA 4E7KA 3BPXA 2VQLA 4PSXA 1B6AA 1MMNA 3PL8A 2LSOA 1AU7A 3VWBA 2R7RA 2YS9A 3DLLF 1FT9A 1HDPA 2DU9A 3RKQA 2QBYB 2LVSA 1W7PA 1T8IA 3ZQGA 1B4AA 4RAFA 1STZA 3A1YA 5ILUA 3L1PA 1UAAA 3DTEA 1YW7A 3WU2C 2EIJH 2P5VA 1X58A 4QWQA 1ZG1A 3PFIA 4KICA 3GFIA 1OCPA 2FQ3A 4F7ZA 2JUCA 3L2CA 4M71A 3LAJA 3L2UA 1SC7A 2HGCA 2DCEA 2FBHA 2H8WA 2YPRA 4L9TA 1KU3A 1VNDA 1Y0UA 2BE5F 4G7ZF 3BC8A 3RJPA 4XQFA 3AKZA 5E18F 3K6GA 2AQFA 1D5YA 3K70D 3MZHA 1NHAA 1J0RA 2XB0X 2HFHA 4HX4A 2O6GE 2BOLA 4IL6C 2ID6A 3BZ6A 3D5SC 2P7VB 2PFBA 3C7JA 4PGHA 5AONA 3SDGA 4FQGA 2ESHA 1W7PB 5EG0A 3CMYA 3CC4I 4RA2A 4YIIA 3BT9A 3IV5A 3U1DA 2VJ5A 2RC4A 2ECCA 3O3KA 1FJLA 4HF2A 1ZTRA 2K02A 5K1YA 3R0JA 1H8AC 3IP4B 3G4SI 3H0DA 3DQVC 3F8CA 1GVDA 3ECOA 3LSMA 1G3TA 1YQAA 2V4JC 3LL7A 1FBQA 3Q3SA 3HOUJ 2LNBA 2R7WA 1YO5C 1D8KA 2FSWA 3ZMVA 1K6YA 1LFPA 3L7WA 3D5RC 3M07A 2CH0A 2GAUA 5LGNA 4LFUA 1GXPA 4FT8A 1I39A 1Y1WJ 4ZTFA 3LA2A 3K1PA 2X6WA 5D6FA 2VUMJ 1LKXA 5EG0B 2Y48A 3M9AA 1YE9A 2XF6A 1O7LA 4BYYA 3RZDJ 2VQCA 1ETYA 3CDIA 1J2XA 5E1WA 4C3HJ 2KPMA 2RQPA 2EFNA 5LD2C 1DPUA 1V3FA 1WCMJ 2LDUA 4CZCA 2XPVA 1S7EA 1N25A 1E3OC 1P9QC 1O7FA 3L9FA 5HVQC 3SDBA 3FBIB 1YRNA 3GWZA 3GZNB 2E1MB 2VONA 1QHGA 3UR3C 2PJRA 3FXOA 2HZTA 1JKRC 3ONQA 5BOXA 2P8TA 5B66C 1K4TA 4A3BJ 3HEFA 2I10A 2FA5A 2O8KA 4A3JJ 2CYYA 2VXDA 1J9IA 2MLKA 3K2ZA 4UV8A 1NG7A 4HF1A 4XN3A 3AG2H 1ZREA 4Z2YA 1XS9A 3IAM2 2HKOA 3KEOA 1XCVA 4D5CA 3MEXA 3FXLA 4LMYA 4HLYA 1VQ4I 2F6CA 4XOTA 1I5ZA 1VQKI 4IOAF 3GX4X 2XGCA 2F2EA 4AM3A 3HTSB 3K1MA 1HXDA 5B1BH 1YRNB 5E3MA 2CQXA 4JK1X 3DEEA 3CDLA 3LA7A 4QLCU 4L0ZB 3NRVA 4OINF 1Z3XA 2E19A 3WTVC 1Z6RA 4CCOA 1Z6TA 1DU0A 4BU2A 3V42A 1P2FA 2AHQA 2GWRA 2PJRB 2JA6J 3ASOH 2DOAA 4P9UA 2BXZA 4A3GJ 1N77A 4LG0B 2IBDA 2MGQA 3ZQFA 2OCEA 5D6EA 4DYCA 2JVGA 3GYHX 3D0SA 2DT7B 3ZQCA 1OLTA 1VQ6I 5H2FC 1Z3YA 3HJEA 2DODA 1I50J 3BWGA 1WPKA 2K9NA 1XDSA 2LY1A 1MMDA 2QKMB 1IDZA 3DTIA 4FX0A 1FBUA 2EWNA 4XNFA 3ZMDA 4BEHA 2K7LA 4PJNA 2Y30A 3QU6A 3S1QJ 4F93B 4IPAA 5J4YA 2Q2EA 4EJVA 4HQMA 4TV7A 4AWXB 4A12A 3H9GA 2QSHX 2JA8J 3NQOA 3L2VA 4RGUA 1EH8A 4P96A 2YR2A 4B48A 2MD0A 3UKGA 4ZDLA 4GXOA 4XMYA 3SXYA 4ZZDA 2EV0A 3MD2A 1VQMI 5LRSA 4KFCA 4E7LA 2G0EA 1ZRCA 3KCCA 3E97A 3S3NA 1BA5A 5E3LA 4L0YB 1WSUA 3KP5A 1FPQA 1SFXA 2VBWA 4HAMA 3CJNA 2QF7A 4MQVA 2W85A 1S3JA 1XMKA 4XKWA 1NK2P 3LSJA 3KYLA 2NAZA 5IP9J 3IC7A 4LB5A 2Q0OA 4KIGA 4CYCA 4KT6A 3TGNA 3WU0A 3GMEA 3GXOA 1YTYA 2VKVA 1IJWC 4JP0A 2BHZA 4BEHB 5CQGA 1CGPA 3CJQB 3AL0C 1S29A 4X6AJ 1T2KA 1FMWA 2QQ9A 2FBKA 3LOCA 4Y13A 2MABA 3DPLC 5J47A 1OMIA 5JLWA 2ADUA 2QUFA 3PQKA 1XSVA 3G1MA 2QKLB 5EYRA 4YFXF 4L18B 2QQAA 3ZRGA 2CV2A 3P7NA 3QPLA 3V8KA 4Y4RA 2OZ6A 3EUHC 2R5YA 2GLOA 1WJAA 3OY9A 1QZZA 1ON2A 3KP7A 3J7AY 1BN5A 3S2DJ 1LFUP 2Y0SA 1FOWA 3GTJJ 1EF4A 1XD7A 5J40A 1R1VA 1QRYA 4IRHA 2KRHA 3QODA 1JGGA 2E2HJ 4UUSB 3JRGA 2LFBA 3BTCA 1HF0A 2WAFA 3WG7H 1POGA 3FWEA 2B63J 3FK6A 3VB2A 2GIZA 2XAGA 3LSGA 1ETWA 2Z5UA 5IT9K 2I8DA 4Y7NJ 1FWZA 3OYGA 3OYEA 2QSGX 3CQZJ 3V7CA 2CV0A 4HA8A 1WJEA 3GLXA 3PSIA 2FXAA 4PFOA 4PCQA 2NVQJ 1VQPI 5KVRA 4PJMA 1AWCA 3QU3A 3B6AA 1O3SA 1MNDA 2RREA 3F8FA 4BACA 1LVKA 2GA2A 2F4OB 5TRDA 3H5NA 1PP8F 2R5YB 1KYZA 4S05A 4KMUX 3RYPA 4GYGA 3VYSB 1XCBA 2HQRA 1X2MA 1GVJA 3F72A 2LK2A 3TMOA 1HA8A 2NXNB 3JCUC 4HSRA 4D7NA 2XRLA 4NUBA 3MWMA 3KEYA 2D1VA 1IRGA 2DOEA 2H1LA 3C2HA 2PBIA 3MMYB 2ZXJA 4YEJA 1W0UA 5J8FA 2L9NA 1BOAA 1OYYA 3TO7A 4EM2A 3BJOA 2WC2A 2DDAA 4EGZA 2EFQA 3M1CA 2R7FA 1TWCJ 3GFJA 1KA8A 3PFYA 3SEQA 1FIPA 2VBXA 3QAHA 3T1BA 2V9VA 3HDDA 1JUSA 2ISYA 2HU9A 3CF2A 1DQUA 3T8TA 4BQNA 2C6YA 3BR3A 2KZGA 4V2GA 4DJAA 4I76A 2OV7A 1T98A 3BTIA 3HXLA 4MFEA 3ZOBA 2OU2A 2K27A 4GDFA 1PUFA 2KMUA 4CSWA 2FOWA 1UHWA 1AKHA 3W2AA 2HNHA 3IHUA 3OYFA 1A5JA 3E5UA 2BY0A 4KJZA 2QLZA 1R1UA 2DA1A 3ABUA 4EMSA 3QOPA 2VN2A 2MC3A 3DKXA 4NQWA 2JUGA 3EETA 1F4KA 4F91B 2E1OA 1Z21A 3FIWA 2W7NA 2CG4A 2L54A 2VJJA 4Y3OA 4E70A 1U8RA 5HLIA 4UUTA 5E8IA 5C3EJ 2KP6A 1EA3A 4M3BA 1D3YA 1VQNI 3CO6C 5EGOA 2CS3A 4XIDA 3JRIA 3JTHA 2O5RA 5FB2A 4E7IA 1PUFB 2STTA 4Y17A 3EUKL 3K9TA 1SD4A 5C44J 1BI2A 1XG1A 2EB7A 2ELKA 2XB5A 1IXRC 2PG4A 3H3UA 4M6XA 1JKPC 2OTJI 1WI3A 5IT3A 4LLNA 3OSFA 2HI3A 2JMWA 1JHFA 3MKLA 3WHCA 4GRIA 1TT0A 2R7UA 3T8RA 2XSJC 2RV8A 1HCRA 3JW4A 5EEGA 2XAJA 3ZMUA 1IV6A 4G8XA 3RKXA 1WVRA 3IKVA 2KQRA 3DKYA 2M0MA 5HDNA 3HGGA 4Y15A 5GP9A 4AIKA 5IPAA 5FGMA 2M8GX 1R4MB 4ESBA 4N4NB 1VI0A 2PMZN 4A93J 2V9KA 4XRFA 1VQOI 2YSRA 3FMQA 4XR6A 4IHSA 2V1UA 1CF7A 4XRSA 2FMLA 2DQLA 1VQ5I 5LGTA 2W4SA 2KL4A 1MGTA 4HDUA 2K5CA 5E1XA 1FYMA 1T08B 3ZPLA 3VODA 3F21A 1UZCA 1RC9A 3FDYA 2IW5A 5DM7F 2JA5J 2G7UA 2K40A 2JRMA 2HOTA 1FTZA 1FMVA 4IHYA 3BR0A 1GV5A 3BR5A 3K4MA 2IRFG 1YS6A 4M6VA 1GT0C 1B1BA 5CVVA 4E6KG 1GUUA 1FOXA 3CESA 3C3WA 2VJIA 2K9SA 2JPCA 3MQ0A 4M3FA 4M74A 1UB9A 2GA1A 2L9VA 3DF8A 5F6FA 4B44A 4BBSJ 5M3MJ 3LQRA 3VFZA 1ZKGA 1LUJB 5FD5A 2XGXA 2VC1A 5CVIA 2YX4A 5CPRB 2CGPA 3P9CA 4LIVA 1R49A 2DBBA 2VI6A 2XVCA 3TO6A 2JJ7A 1B8IA 2KJBA 5DCMA 4UV9A 1X1PA 1CF7B 4HX7A 1TC3C 4LD5A 3HOVJ 3GFMA 2MD5A 2P6SA 2B7EA 2EPFA 3LA3A 4HEA2 4B8XA 1X3UA 3E5QA 3QYEA 4BHCA 5F04A 3J7ZI 2FNPA 5F27A 4G7OF 3JTGA 1D0XA 2VT3A 4ASNA 4RM3A 5BQTA 3QPTA 1ZLKA 5DTDA 1RUOA 3WTWC 4HZFA 4DBRA 1Y1VJ 2OQRA 3QYBA 1U2WA 4G9YA 3HZJA 4FE4A 4YRVA 5FLMJ 4BY7J 1VQ9I 2L9RA 4OWRB 3BZCA 2LMDA 4LJZF 1RIOH 1WH7A 2JT1A 5JVTA 2V26A 3ABMH 5BNGA 4A6DA 2XPWA 1O57A 3PUBA 3K4BA 5F64A 3S1MJ 2DPDA 4GCVA 5DCMB 1QO0D 2X51A 4Y52J 3TOAA 3CUQC 1MH3A 1P4WA 3QPHA 4NC7A 3CC7I 1X4PA 5GTIC 1ZELA 3FMRA 2CO5A 5A2QK 3BCAA 2ZJPF 1XGNA 2FEZA 2GOMA 1ULYA 2L7MP 2I5UA 1F36A 3F9KA 5K7HA 3JRCA 4JYKA 1I3QJ 3CP8A 4I02A 3VEPA 4HQEA 4EJWA 1U5TA 4X1EA 3KP6A 3KP3A 1OCCH 2EBIA 2N8GA 2IGNA 4GO1A 3TP3A 1FX7A 1ZHFA 1U9OA 5CYVA 1FNNA 1U0JA 4II3A 4M9SA 2F5FA 4OMYA 3PSFA 2X1DA 4XLNF 3IRQA 4WXCA 4RGXA 2QSFX 2Y0MA 4U7DA 4KISA 4FETA 2W00A 1ZARA 3GUDA 1B72B 3BCBA 1B9NA 1I1SA 2FD5A 3E7LA 3OV8A 2XGEA 1D1AA 3F0CA 3HHGA 5KAIC 2L02A 3I4MJ 1IN8A 2LKXA 1O4XA 2K4JA 1D0ZA 3QWLA 3M8FA 4UVBA 5E1ZB 3I56I 1RESA 3ZQ7A 1O3RA 4PDKA 4HX8A 4RLFA 1KQ0A 3KYDB 3ML6A 3OS2A 1MNMC 1OR7A 4M6YA 3S14J 3ABTA 3QP6A 4WWCA 2H1KA 1E17A 3JAMK 4KNYA 4I0BA 1WGXA 5FRMA 3SEZA 1MSFC 1IRFA 2DTZA 5GAHJ 2W84A 1KQ9A 2YX7A 4EJUA 1Y39A 5JHUA 1J59A 5LFAA 3ULQB 2DMNA 5DM6F 4BQQA 2EFOA 3T0YA 4ZYGA 3HKZN 2ELHA 1BR2A 2VE8A 3E6BA 1NK3P 1BIAA 3EDPA 1BI3A 1BW5A 2WAQN 2VKHA 2NOJB 3DP7A 2ZO4A 5IOYA 3NWTA 4XLFA 2HDCA 1QVUA 2HDDA 3J7AO 2HXOA 4EATA 3K4JA 5GPAA 1W7PD 4I6ZA 1HKTA 3K4CA 5GAEJ 2V1XA 1J7KA 4OMZA 5IP7J 1QHHD 3NARA 1R1TA 2EZHA 2DA4A 3Q0WA 5JFRA 1RKWA 2WB1N 3FHZA 1W36C 1W36D 1R71A 1O3QA 4L5IA 3EYYA 5DV5A 4A2UA 2R7ZJ 2GXAA 3PJRA 3G6EI 4UHTA 4XK4A 4J01A 3OYMA 4A0ZA 1IN5A 2RNJA 1RNLA 5KNLA 2GZWA 1PVEA 3BDDA 3HPHA 1A35A 3S17J 1BOBA 3ERMA 1ENHA 4HF0A 2M2EA 1KQ8A 1W5TA 5B5EC 2E35A 1VQLI 1SFKA 4QSHA 2FNAA 2XAQA 4W1UA 3S1NJ 3VOEA 4WXHA 4H0EA 3K70C 3OIPA 2M1BA 2ZXHA 5BPDA 1JKOC 4XOPA 1D8JA 3OYIA 2KLOA 2M34A 4CGZA 3TO9A 3JRDA 1JUPA 1ZYRF 4A6EA 1H9TA 1MKMA 4KIBA 3V8LA 1PDNC 3S3MA 5CVJA 4XL9A 5TGTA 1K7AA 2X9DA 5ERIA 2O3FA 3WE2A 2MC4A 3WU1B 3HOTA 1WJCA 2E1MC 2M4GA 2P81A 3I58A 3BOQA 2CUZA 1SMYF 1QA6A 4ETSA 2IPQX 1R58A 2LKSA 3M1EA 5FFZA 2OD5A 3FF5A 4EM0B 1XPXA 4KT5C 5L3CA 2LF8A 3A01A 1F43A 1XMAA 2JVHA 2NNNA 5DD4A 4XLAA 2J5OA 4EM1A 4YFKF 2J5PA 3I5UA 3J7YJ 4FCYA 1QZYA 5AIPA 4ENJA 4M73A 2OBPA 1MW7A 3CMEI 3ZGKA 3ZMTA 3W6JB 1HOMA 4ANJA 1WKMA 3J80K 3CCMI 1BIBA 1TWFJ 2ZKZA 2ETHA 1R23A 4C3IJ 2TCTA 2NOGA 1R6RA 4RMNA 4M9XA 3HOWJ 2ZBKA 4F92B 1X1AA 3TP0A 2L4MA 3G71I 1APLC 4BY1J 3ZN1A 2DJNA 2L7ZA 5J1UA 3F3XA 2DTRA 4AIJA 4E7JA 3H5RA 3C2BA 1MH4A 3H35A 4CCKA 2OTLI 1RUNA 1UHSA 2M4KA 3QYFA 3I4PA 3H0GJ 3A01B 2XASA 2MYSA 4ZYHA 3JRBA 4UVCA 2HEOA 2HVRA 4MTEA 1I27A 1NH3A 2OQGA 2CW7A 3LSPA 5DUKA 4MEXF 4G7HF 2DA6A 4R79A 4HBLA 4PJ0C 2ZSHB 3PO2J 2HWVA 2R92J 1A6QA 2O9LA 5EDNA 2WADA 1IV8A 1X4OA 1T56A 3H9JA 4M9ZA 5BPIA 2E7WA 2W25A 2A05A 2XSDC 2WV1A 3MKWB 5HLHA 2ZFUA 5IYCJ 4CHUA 2PMZA 4IHVA 2X4HA 4P55A 3BTLA 2M8EA 3HBLA 2P5KA 3P9IA 1XSXA 2FMYA 3CCJI 2KIMA 6PAXA 4AYBN 3W3CA 1R22A 1G6NA 2MBFA 3CF5F 4EJOA 1IAWA 5DUIA 4MEYF 3X2QH 4DBQA 1U3EM 5ILSA 5HS8A 5ED4A 1W5SA 2PN6A 2FUG2 5DCFA 3E6MA 1SVLA 2RVCA 4CCLA 3HRMA 2CFXA 4U7BA 2K3PA 2VQHA 2HYGD 1HSTA 4Q47A 1VTNC 3GFLA 3Q9VA 3E0JB 1NTCA 3GTKJ 4OIRF 2UXXA 1SFUA 3DV8A 1J75A 1ZGAA 2CU7A 2WAEA 2P5LC 1ETXA 2FX0A 3QRFF 4JX4A 5B1AH 1SANA 1OYWA 2PI0A 1MD0A 2NVXJ 4KN7X 1MMSA 1TLHB 4XSZF 4U87A 2DFFA 2VL8A 4BXUA 3WTYC 3HC7A 3ZN0A 5LBQA 2EJRA 3O8GA 3ZQHA 2XDVA 3HYIA 2NS7A 3BPVA 4O3MA 2DFEA 1JGSA 2HPMA 2GBYA 2E1NA 3H1CA 1HKQA 2IA2A 2JA2A 5J3LA 3A0HC 3A02A 3C18A 4MNUA 1WQ2A 1WWXA 2QYOA 2JA7J 4DQ2A 2Y9YA 5E3NA 5EZGA 1U9NA 3ABKH 4ITVA 2DYSH 3S3OA 4XLEA 1TNTA 2WTEA 4UB8C 3S8PA 2W82A 3BLYA 2KHMA 4AIDA 2Z99A 1XSDA 3FXQA 2HOAA 3DTKA 5FROA 1WFXA 5K5RA 2V1NA 3K10A 2P6TA 3CDHA 4IHWA 4CCNA 2ZJRF 1USTA 3IWZA 4RAGA 1SD6A 3R60A 2DMPA 5LEJA 3TKYA 1TL8A 4RGRA 3F6VA 2ZJ2A 1HW1A 2R7XA 5F0CA 1V5EA 1LDJA 1BC8C 4O6JA 1X3ZB 3LSTA 2JSCA 4I0AA 2Q2EB 2XKPA 2MA3A 3FMSA 4R8HA 2O61A 1IUYA 3LFKA 2EIKH 3RQIA 1C0WA 4PUSA 3HUGA 1T33A 3OWTA 2UWMA 4C3JJ 3Q0UA 1XDUA 4A3KJ 4G94A 2IS4A 1UELB 5D4RA 3KP2A 5HNFA 1ETQA 1JTXA 2DN0A 2M5WA 4WXDA 1ZRFA 2EV6A 3MVPA 2IS2A 5IYDJ 1MJ9A 2UUZA 3DLAA 3HIFA 1MBHA 1RR7A 1R5ID 1R5GA 2IA0A 3IH3A 4BAYA 4CYCB 1HLVA 3NWSA 1GDTA 1DPRA 1P4AA 4L9NA 2X1CA 4EVIA 2DXIA 1IRZA 2M9HA 5JLXA 4ENMA 5FJ8J 3TL4X 5LHHA 1Y8QB 4OIPF 1DGRM 2RDPA 3PUFA 2BHYA 4BE2A 2Z9OA 3S15J 1BJAA 5L3EA 3LSHA 3HUGB 4II2A 5J6XA 1S7OA 1HW5A 1WJFA 5KAFC 2DDBA 3V7RA 2IGKA 1D5VA 2KIFA 3O2PE 4V19K 1U6GA 2LG4A 2E2JJ 1YOVB 1WJ5A 2M3AA 5K5OA 2UZKA 1G3SA 2DLLA 4E4HA 5HDKA 1Z7LA 4CH7A 1JI8A 2CQ7A 4HLXA 1P6RA 4BNCA 3HKZA 1T38A 3CP2A 1BR1A 1IW7F 2AQEA 2NS8A 2W1OA 5ICCA 4DOZA 2WAQA 1IRXA 3ISPA 2DAOA 2K9QA 3BJAA 2KRFA 3HG9A 5LGUA 2KIQA 4OIQF 2BY2A 2L4AA 5HDGA 3I55I 5J4VA 4EJTA 2A69F 2JSPA 1I6HJ 1A6IA 2NS0A 1MIJA 4MTDA 2GQQA 4AUXA 5F0HA 3E5XA 4R1HA 2O03A 5GAGJ 1GXQA 1RI7A 2WB1A 2VASA 4DIQA 3B02A 1MBKA 1QNTA 3JRAA 1YYVA 1XMXA 3WTXC 2HDWA 2KDZA 5ICEA 2ZMEA 3OL4A 5HODA 1KU2A 1IN4A 1JE8A 1VQ7I 3FXKA 3QOEA 1FP1D 1TTYA 3GTGJ 1DU6A 3G73A 3CC2I 3OSGA 2EZLA 1BI1A 4WX9A 4BUPA 4AIHA 3AFHA 3ZQQA 4IRIA 1SMTA 4IRGA 2EFWA 2QWWA 2D1HA 1K4SA 2JWTA 3HOSA 2X0LA 2O8XA 3BZKA 2EINH 2FRHA 1XGOA 1BL0A 3PO3J 3CLOA 2E5NA 1ONVA 2HOSA 2ISZA 2EK5A 1R9TJ 2XV4S 3GF2A 2NVTJ 4D5FA 1QZEA 1T39A 3DU6A 2HR3A 4XSXF 1GHCA 2P7CB 5IYBJ 1JUMA 2Q1ZB 1AKHB 3N05A 2R7SA 2HXIA 3V8JA 2LTPA 3LQQA 4BXXJ 2JPBA 2RQQA 1F9NA 1Q1HA 1SAUA 1OCTC 3K69A 4MLOA 1G3YA 3ZQIA 4DW6A 5F08A 1NG6A 2L01A 1HDDC 2CV1A 4NQWB 1QGPA 2ZXWH 3FKJA 1S8NA 2FOKA 3LFUA 3DKWA 2FU4A 2HQAA 1TNSA 5JI6A 3MKZA 2R93J 3I53A 1HQCA 5EF6A 1MMGA 1TQPA 2NVYJ 3TQNA 1JTYA 2KJCA 4BJ5C 1YLFA 3CMMA 5D5UB 3H3VK 5EGOB 1RR8C 5F0FA 2DMQA 1ETVA 5FLXK 2LYCA 4A3DJ 1G4DA 4KYWA 4NC8A 2L7KA 3A2KA 1FTTA 2EA4A 4P9FA 2GIVA 3OIOA 1WRJA 2LKPA 5KCMA 4ZYEA 5M3FJ 4A5NA 3IH4A 2PQ8A 3BQZA 3R4KA 1OQYA 4Q48A 4N4OB 3MFKA 3I59A 1AA7A 3P5JA 2H6BA 1YJNI 3SYTA 2R5ZA 1XX5A 4N0BA 2ZSIB 2XKOA 4IJAA 4IQ4A 2YUSA 4HPQA 3HRSA 3L2WA 1BC7C 1TQIA 1O3TA 1ZGWA 4P1WA 5BMZA 1OKRA 2OA4A 1IF1A 3FM3A 3H3ZA 3BG6A 3GCMA 2E5ZA 4B4CA 1FBSA 2A6HF 3U1KA 3S93A 4Q4ZF 1TWAJ 3OMYA 2VJ4A 1FC3A 4AC0A 1OCZH 3F22A 3PNTA 3CCYA 1BM9A 3FK7A 2ZB9A 2VQGA 2EH3A 3DEWA 3I64A 3GBGA 1FIAA 3O8HA 1FZPB 5FLVA 1WZ2A 2HQNA 4MO7A 2F5VA 2KT0A 4L9VA 3COAC 2LREA 2JTVA 4AYBA 2R7OA 2CQKA 2E7XA 4FISA 5FO5A 2NRAC 4HRIA 1HW2A 3FISA 2R5ZB 3HHHA 1Y56A 4U0WA 4CO8A 5J8CA 2QZ8A 3M8JA 1USSA 2DQRA 2LRDA 1ZR4A 1K78A 3JSOA
chains in the Genus database with same CATH topology
4KITB 2JVGA 2R7QA 3D5LA 2DT7B 2CW8A 2R4GA 5KNLA 2WBMA 3HPHA 1OLTA 1BOBA 4F3QA 1Z3YA 1YX5A 4QPOA 1SFKA 2LY1A 3K70C 3OIPA 1MMDA 2QKMB 1QU3A 3DTIA 2ZXHA 5HNHA 4HNTA 4JOMA 4XOPA 1T0FC 4XNFA 4BEHA 1T95A 2KLOA 3OYIA 4PJNA 1V5GA 4B3XA 4F93B 4AU7A 3I3LA 3K4LA 3VDXA 2X1EA 2VLAA 3H9GA 3S3MA 4XL9A 3L2VA 5TGTA 3L2QA 2CFOA 2MC4A 3HOTA 3VSLA 1WJCA 2E1MC 4B48A 2MD0A 2M4GA 4ZDLA 2CUZA 4JQFA 1ERDA 4XMYA 5CKTA 2WY7Q 3MD2A 5HLTA 2K9LA 1S9HA 4E7LA 3S3NA 3EUAA 4Y33A 4XLHA 4XLCA 4NNJA 2JVHA 4E7ZA 4XLAA 3RQ4A 4XKWA 1MW7A 3ZGKA 4P5OA 3KYLA 4CA0A 4ANJA 4KT6A 4BEHB 3KX2A 5CQGA 2KDOA 4PK4A 3CJQB 3AL0C 1R6RA 4RMNA 2E60A 2VIXA 1FMWA 3VSKA 4ZJZA 2MABA 2Z2SB 3DPLC 4F92B 2VXZA 1X1AA 1LDKB 1OR7C 2QKLB 3MKYB 4C30A 3ZRGA 2CV2A 4E7JA 3H5RA 4Y4RA 1PJRA 3EUHC 3H35A 1WJAA 4CCKA 2WA0A 3RCOA 3OY9A 4G6TB 3OYDA 1TZLA 3CJRB 3J7AY 2M4KA 4ZYAA 2Y0SA 3QYFA 2BW3A 3W2VA 2V6EA 3OYBA 2MYSA 2IS1A 2KRHA 3QODA 1DGWY 3OYCA 2X6YA 4BDZA 2HVRA 2IGOA 2WAFA 2IGMA 2ZXIA 3OYNA 2CW7A 2M7AA 4R79A 3LSGA 1WJBA 3OYJA 2ZSHB 2MFZA 2I8DA 1PYVA 4C2UA 3OYGA 3OYEA 2K9MA 2CV0A 2WADA 1KONA 1WJEA 1X4OA 2L9SA 3H9JA 3PSIA 4PFOA 4CUGA 4LITA 4PJMA 4XONA 1GLNA 4HSTA 1MNDA 2RREA 3DPTA 3MKWB 4BACA 1LVKA 2ZFUA 4IZZA 3H5NA 1DP3A 4J00A 2PMZA 3BG7A 2R7VA 4BQOA 3VYSB 4BL0B 2XF5A 3SZGA 3W3CA 1HA8A 2BW3B 3TMOA 3ZR8X 4C9YA 2IS6A 2M7BA 2CMPA 4HSRA 4LIUA 3G2BA 4NUBA 3KEYA 4DBQA 3OOUA 2FUG2 3C2HA 3MMYB 4YEJA 2L9NA 4RLQA 4QPQA 4CCLA 4U7BA 2K3PA 2VQHA 3HL2A 3RPUD 3ZXSA 3UNGC 3H9QA 3OYLA 3S32A 3M1CA 3E0JB 2A6TA 3PFYA 3SEQA 3OL3A 4H4KC 2HU9A 2WAEA 3CF2A 1DQUA 3FHNA 4BQNA 5FRNA 4DJAA 2HVQA 2OV7A 2GOXB 4U87A 3HXLA 2VL8A 1MMAA 2KZVA 3HC7A 2KMUA 4CSWA 2LC2A 2XDVA 3W2AA 2HNHA 2Z1DA 3OYFA 2HPMA 4KJZA 3OS0A 2JA2A 3DKXA 2JUGA 3LSKA 2RNGA 1X19A 3I9V2 4F91B 4ITVA 3S3OA 1Z21A 3W2WA 4XLEA 2W7NA 3S8PA 2X6XA 2DT6A 2W82A 3BLYA 4BJ6C 2VJJA 2KHMA 4Y3OA 4BE0A 3DTKA 2A5WA 5FROA 4E7SA 4BE1A 1G8XA 2ELJA 2KP6A 4XN0A 1WFXA 2V1NA 1EA3A 2CUJA 3K10A 4PSWA 4CCNA 2LBFA 1BR4A 4PJJA 3HPGA 2HVSA 2CS3A 4ZC3A 2HPIA 2O5RA 2R7XA 1V5EA 4E7IA 2Q2EB 3U21A 3E1SA 4BGDA 1UG0A 3EUKL 3VYUB 4D1QA 2LOOA 1WJDA 4PUSA 4PFPA 2BVLA 3K4NA 4C2TA 4HNUA 4LG3A 2UWMA 3OWTA 2Z16A 4ZDOA 2IS4A 4IQJA 2L2OA 3VYRB 1UELB 4BJTA 4GRIA 4XM3A 1TT0A 4D9JA 5HNFA 4ZTJA 2XAUA 2R7UA 2XSJC 5HOOA 4IX7A 5JHFA 1MNEA 4XKBA 2IS2A 2OC6A 2LBFB 2UUZA 3DLAA 3ZCOA 2KQRA 3DKYA 2M0MA 5KHDA 1D1BA 2UV1A 3NWSA 3IAS2 2X1CA 2DXIA 1V5FA 3TL4X 4ZDPA 2HZDA 2VB6A 2LH9A 1DGRM 3DPUA 4N4NB 2BVMA 4F52A 2V9KA 3FBNB 4BE2A 4XR6A 3LSHA 3HUGB 4II2A 4B43A 4F55A 4CCJA 1WJFA 3VYTB 1D0YA 4PJLA 2IGKA 2W4SA 2KL4A 3DU5A 2K5CA 2LG4A 3L2RA 1WJ5A 2M3AA 1X1CA 3FDYA 3PNVA 4E4HA 4X0GA 1Z7LA 4CH7A 4BXFA 3LMMA 3OYKA 1JI8A 3OYAA 1FMVA 1X1DA 1YX3A 2L5QA 3LSIA 3HKZA 3K4MA 3CP2A 1BR1A 2X85A 4E7KA 4E6KG 2AQEA 3OYHA 2W1OA 2VQLA 4DOZA 2WAQA 1IRXA 4PSXA 1MMNA 3CESA 3HG9A 1X1BA 2VJIA 3PL8A 4B44A 3VWBA 2R7RA 2OUMA 1D1CA 3OR2C 3DWLE 3K4KA 4XKVA 5CPRB 2JSPA 4LIVA 2VPLA 3A1YA 1UAAA 3DTEA 2WB1A 2VASA 4DIQA 2DJIA 1Y6IA 2IXSA 2LY2A 4HEA2 3QYEA 3A4CA 2HDWA 4HG2A 3L2UA 1D0XA 3OL4A 2DCEA 4RM3A 3QOEA 1E0EA 3IUOA 3BC8A 4DBRA 4XQFA 3AKZA 3K6GA 4BUPA 2AQFA 3QYBA 3AFHA 3K70D 3EPZA 3ZQQA 3RSNA 4IKFA 4YRVA 4CCMA 2VKDA 2BOLA 4OWRB 3HOSA 1N75A 3D5SC 4RM2A 2V26A 2R7TA 2E5NA 3PUBA 3K4BA 2WY8Q 2X51A 2VJ5A 4OAZA 2XF7A 3DU6A 4NC7A 1X4PA 1ZELA 3OR1C 3IP4B 3BCAA 2GOMA 3DQVC 3LSMA 3H0DA 2Q1ZB 2R7SA 3N05A 2V4JC 3LL7A 3F9KA 3C2GA 2R7WA 3CP8A 4AVZA 1SAUA 2RQQA 4BS9A 1N78A 4MLOA 1K6YA 1LFPA 2IGNA 1NG6A 2CV1A 3D5RC 4NQWB 2CH0A 3FKJA 1U0JA 4II3A 3LFUA 4ZTFA 3PSFA 2HQAA 2X1DA 2X6WA 3MKZA 4XORA 4KISA 4FETA 2KRCA 2W00A 1LKXA 3BCBA 2P0WA 1MMGA 1YE9A 2XF6A 4BJ5C 2VQCA 3CMMA 1D1AA 1VZ0A 1G59A 2KPMA 1D0ZA 5LD2C 2LYCA 4NC8A 2L7KA 4CZCA 3A2KA 4RLFA 1P9QC 3OS2A 5HVQC 3SDBA 3FBIB 5KCMA 2E1MB 4FASD 1QHGA 4N4OB 1AA7A 3UR3C 5FRMA 1J09A 2PJRA 3CZ6A 3SEZA 3SYTA 3TBIA 3ONQA 2ZSIB 4DGWB 5LFAA 4IQ4A 4BQQA 4HPQA 2VXDA 1BR2A 5CQEA 3L2WA 4E7HA 2V7FA 1NG7A 4XN3A 4P1WA 2VKHA 2NOJB 3NWTA 4BDYA 3IAM2 4XLFA 2XC7A 4EATA 3K4JA 3OIQA 3BG6A 3K4CA 2F6CA 2E5ZA 4XOTA 3RTRA 3AL0B 3S93A 1QHHD 3OMYA 2VJ4A 3PNTA 3DEEA 4B47A 2VQGA 3PNYA 3H5AA 3GBGA 1Z3XA 1W36C 1W36D 2F5VA 4CCOA 4OAYA 4BU2A 3V42A 2LREA 4AYBA 2F4IA 2R7OA 3OS1A 2PJRB 3PJRA 4HRIA 2DOAA 4XKCA 1Y56A 4J01A 1N77A 3OYMA 3M8JA 2LRDA 4YELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAY A;  2MC4 A;  5KHD A;  4OAZ A; 
#chains in the Genus database with same CATH topology
 1LPQ A;  4V2F A;  5DD8 A;  1MBG A;  2F48 A;  1MDM A;  4JX6 A;  2KFD A;  2R4G A;  4KA4 A;  4KIF A;  4I09 A;  4YIF A;  4F3Q A;  4CIC A;  1JT0 A;  4QPO A;  3FXU A;  4HW0 A;  2IJL A;  3WGG A;  1ZK8 A;  1E3H A;  4IXA A;  5HNH A;  4HNT A;  1UFM A;  1W1W E;  1T0F C;  2K3F A;  3KZZ A;  1T95 A;  1VQ8 I;  1WI9 A;  3F6O A;  1ZN2 A;  1FOK A;  1V5G A;  3HSF A;  4AU7 A;  2DA7 A;  1XGM A;  2X1E A;  1YIO A;  4N9I A;  3E6D A;  3VPR A;  1B8I B;  3L2Q A;  1S7A A;  2DYR H;  5LEK A;  2CFO A;  1U5T C;  1OIS A;  3EQL F;  5M5Y J;  4JQF A;  2L3D A;  1ERD A;  1FOY A;  5CKT A;  1K78 B;  2ZCW A;  3ASN H;  4MHG A;  2K9L A;  1S9H A;  1MDM B;  3EUA A;  2DOF A;  3CLQ A;  1FYK A;  4XLH A;  4XLC A;  4E7Z A;  3JRH A;  2M87 A;  3NEU A;  5E3O A;  1F1Z A;  4P5O A;  3GO5 A;  4U0V A;  5A2Q Z;  1TBX A;  4CA0 A;  1OCO H;  2WV0 A;  4J19 A;  4L9J A;  1REP C;  2VIX A;  2XPU A;  3KFW X;  3RDI A;  2VKE A;  3VSK A;  2Z2S B;  2TDX A;  4CZZ A;  2VXZ A;  2M0C A;  1QVT A;  3S16 J;  1PUE E;  3KLN A;  1OR7 C;  4I98 B;  3IRR A;  3CCU I;  1SD7 A;  1FSE A;  4RS8 A;  1MBF A;  4AD9 A;  2WA0 A;  2H09 A;  3U2R A;  2ICW G;  4G6T B;  1TZL A;  1TW3 A;  3CJR B;  1IZ1 A;  3TW6 A;  4S0H B;  5F1R A;  1LDD A;  3OYD A;  1RPW A;  3ELK A;  4NC6 A;  3W2V A;  3ZP5 A;  2V6E A;  3OYB A;  1DP7 P;  1QPM A;  4M72 A;  2IS1 A;  2UXN A;  1U5T B;  2MH2 A;  3H92 A;  3OYC A;  3J81 K;  2QEX I;  4BDZ A;  2IGO A;  2VOD A;  3RYR A;  4D0P A;  2E1C A;  5TJJ A;  2BY1 A;  4U88 A;  3OYN A;  1ZAO A;  3DBL B;  1L0O C;  2A6E F;  2MFZ A;  3WGI A;  2AO9 A;  1PYV A;  2V1D A;  2QVO A;  3KIO A;  2RKH A;  1K83 J;  2ZNY A;  3JAM Z;  4A3C J;  2GM4 A;  1KON A;  2H8R A;  2HOE A;  5BS6 A;  1SAX A;  4CUG A;  3PIO F;  4GYI A;  4RAY A;  1TWG J;  3BTJ A;  4IVN A;  3DPT A;  5ICF A;  1DDN A;  2VBY A;  4XBF A;  1SVO A;  2PX9 A;  3KYC B;  3LNQ A;  3BG7 A;  2R7V A;  5D8L B;  4BL0 B;  3SZG A;  2O0Y A;  3GTP J;  3GLL A;  3ZR8 X;  4U0Y A;  2IS6 A;  2M7B A;  2AXT C;  5GPC A;  5EZH A;  2NNY A;  4W97 A;  4ZYD A;  3KET A;  3OOU A;  3GTQ J;  3KE2 A;  1YJ9 I;  1KYW A;  4QPQ A;  5DEQ A;  3HL2 A;  2K85 A;  3WTS C;  2R0Q C;  3RPU D;  3ZXS A;  3DBH B;  3H9Q A;  4ESJ A;  1IG7 A;  3TDZ C;  3OYL A;  4YFN F;  4YIR X;  2KIS A;  3L09 A;  1OJL A;  2QM3 A;  2YU9 J;  3RIR A;  1V4R A;  1FEX A;  1RKT A;  3Q0V A;  3FM5 A;  3CCS I;  3FHN A;  3RPU A;  2A07 F;  3JRF A;  4AVP A;  4RB1 A;  4ZH4 F;  3L00 A;  3ECH A;  2HVQ A;  3RI4 A;  2F5D A;  2PMH A;  2GOX B;  5C4X J;  3M4O J;  4M3E A;  1MMA A;  1EV7 A;  3R61 A;  4XIC A;  3W6K B;  2Z1D A;  3HSR A;  3RPQ A;  4IHX A;  1JJ6 C;  3H36 A;  3M8E A;  1BBY A;  4LB6 B;  1ZLJ A;  1R36 A;  3BP8 A;  2EIL H;  2DFI A;  4EQQ A;  4WCG A;  1X19 A;  3FKI J;  2IA1 A;  2LD5 A;  1SFO J;  2DT6 A;  2D5V A;  2NVU B;  4BJ6 C;  1YFH A;  5GAD J;  4L5E A;  3BQY A;  4PGG A;  1G8X A;  4XN0 A;  3K2A A;  3FXR A;  3ZMZ A;  2ZFW A;  3RZO J;  1JHH A;  3BJ6 A;  4PSW A;  1MJA A;  5F1J A;  4A3F J;  3CD6 I;  2BV6 A;  1ZGJ A;  2EIM H;  3F8N A;  4PJJ A;  2HTS A;  3HPG A;  1CQT A;  2HVS A;  4GFB A;  2VBZ A;  1RRJ A;  1MBE A;  1LNW A;  2HPI A;  2PLY A;  3KPH A;  1LQ1 A;  1ACI A;  1YG2 A;  3GEZ A;  3U21 A;  4B09 A;  3E1S A;  2Y9Z A;  2EQR A;  5L3D A;  1UG0 A;  5DYM A;  2VC0 A;  1WJD A;  4IHT A;  2DA3 A;  3HM5 A;  3PIP F;  4DZP A;  4PFP A;  3IKT A;  3J80 Z;  2A68 F;  3K4N A;  3PQJ A;  4HNU A;  4LG3 A;  1QPI A;  2HS5 A;  5C4J J;  3TW7 A;  2OF7 A;  2Z16 A;  1P7J A;  3SFI A;  4ZDO A;  4LK0 F;  2F5C A;  2L2O A;  1YJW I;  4EV0 A;  5DS9 A;  2E71 A;  2QCO A;  4MGR A;  1B9M A;  4XM3 A;  2A61 A;  2XAU A;  3CJT B;  4RDU A;  3FX3 A;  2CJJ A;  4UVA A;  1MNE A;  3PM1 A;  2OC6 A;  4A3L J;  2FBI A;  1MJB A;  1ETK A;  3ZCO A;  3R0A A;  3BRO A;  2EZI A;  2JK3 A;  2UV1 A;  2OAZ A;  2F5E A;  1R7J A;  3IAS 2;  4L5J A;  1EJ9 A;  1V5F A;  4B1R A;  4I01 A;  2D45 A;  3E6C C;  1TQM A;  2HZD A;  4IF4 A;  2VB6 A;  2LH9 A;  4HYE A;  2BVM A;  1LVA A;  2H27 A;  2DMU A;  3FBN B;  1K6O A;  1B59 A;  4RB0 A;  2MW8 A;  3Q5F A;  5CLS A;  4B43 A;  5HS7 A;  4F55 A;  4CCJ A;  2BY3 A;  2P4W A;  4KMF A;  1SD5 A;  5IP6 A;  4A3I J;  3DU5 A;  5D5W B;  4ENK A;  1IN7 A;  4DYQ A;  3AG4 H;  4LG0 A;  3L2R A;  4LK1 F;  4A3E J;  3AG1 H;  1EKE A;  1Z0X A;  3TDU C;  4C2M J;  3OYK A;  5E17 F;  1SVM A;  3OYA A;  3F8M A;  1X1D A;  1YX3 A;  2L5Q A;  3KZY A;  3LSI A;  4K2E A;  4Q5S F;  2X85 A;  1JT6 A;  2FF4 A;  2QGU A;  3OYH A;  2CWE A;  4JX5 A;  1X1B A;  3F23 A;  2L7F P;  5H6R A;  3K1N A;  1XGS A;  1R00 A;  4RGS A;  4ENN A;  2OUM A;  1D1C A;  3OR2 C;  4NB5 A;  3DWL E;  3K4K A;  4XKV A;  1LJ9 A;  1ODD A;  3WGH A;  1P92 A;  3IWF A;  1P7I A;  1Z77 A;  1BJZ A;  3WTT C;  2VPL A;  3KP4 A;  1QQI A;  5FKK A;  5LHI A;  3TED A;  3W6V A;  3I54 A;  1UJ8 A;  2DJI A;  2X6O A;  3FZV A;  1Y6I A;  2IXS A;  2LY2 A;  1G2H A;  3A4C A;  5B3S H;  4HG2 A;  2W57 A;  4FE7 A;  3G1L A;  2JQ7 A;  1E0E A;  1Z91 A;  3IUO A;  1MBJ A;  3EPZ A;  1T6S A;  3RSN A;  4RAZ A;  1ZR2 A;  4IKF A;  2D2W A;  4HV5 A;  4CCM A;  2VKD A;  4HV6 A;  2XAH A;  1N75 A;  4RM2 A;  3MZY A;  2R7T A;  5K5Q A;  4ZZL A;  2DT5 A;  2WY8 Q;  4RBO A;  5CJ9 A;  1W0T A;  3S2W A;  3WOD F;  5IY5 H;  4OAZ A;  5CVR A;  2XF7 A;  4CXF A;  2V6C A;  3G1O A;  3OR1 C;  4G6D A;  3RKY A;  3ROU A;  2PEX A;  2ESN A;  4XRM A;  1ZRD A;  2DK8 A;  1JJ8 C;  5HS9 A;  1IXC A;  2K86 A;  3C2G A;  3C1D A;  3ZMS A;  4AVZ A;  4BS9 A;  3ABL H;  1M1E B;  2RGV A;  1VF9 A;  2TRT A;  3MCZ A;  1YW9 A;  4HNV A;  1N78 A;  4UUS A;  4LOC A;  4OU0 A;  3LAP A;  3SZT A;  5M5W J;  2MH9 A;  2IP2 A;  2BEO A;  1ON1 A;  4I99 C;  3CMA I;  2BZT A;  1MZB A;  4LLL A;  4XOR A;  1TW2 A;  2KRC A;  3Q9S A;  2ZJQ F;  3HTU A;  4HOB A;  2P0W A;  1G3W A;  2PJP A;  3HOY J;  1YIJ I;  1I6X A;  3B73 A;  2HYJ A;  1LEA A;  3DFG A;  5AIQ A;  1VZ0 A;  3ESW B;  3S1R J;  3GTM J;  1G59 A;  1V55 H;  4OIO F;  4BKX A;  3K0L A;  3T5X A;  1Z1D A;  4I2O A;  2CUF A;  1KZH A;  2FE3 A;  3QQA A;  3FXM A;  2NYX A;  1S6L A;  3BR6 A;  5J1Y A;  2R7D A;  4FAS D;  2H6C A;  4LLG F;  3EUH A;  5IT9 Z;  1J09 A;  3CZ6 A;  1BW6 A;  3TBI A;  2BXY A;  1OPC A;  1H0M A;  2AXL A;  4DGW B;  3MZ8 A;  3N97 A;  3N4M A;  1HKS A;  1OCR H;  3WG9 A;  2DPU A;  5M5X J;  2O7O A;  3GW2 A;  4E7H A;  2OJE D;  5CQE A;  2CW0 F;  2V7F A;  4ON0 A;  3I0T A;  3KLO A;  1ETO A;  1QBJ A;  4BDY A;  2IT0 A;  2XC7 A;  2COM A;  5FKN A;  4BHP A;  3OIQ A;  2GXB A;  4UUV A;  2E36 A;  5CVU A;  1H88 C;  2DW4 A;  4IEJ A;  4UXN A;  5LRR A;  1GV2 A;  3RTR A;  3AL0 B;  3REO A;  2XGD A;  2GXG A;  5LHG A;  3DXJ F;  2Y31 A;  4EGY A;  4XRS G;  2CQQ A;  4B47 A;  4MIM A;  3PNY A;  3H5A A;  3GTL J;  2ZME C;  4OAY A;  3CCL I;  4ESF A;  2F4I A;  3OS1 A;  5J1R A;  1ZQ3 P;  3I4N J;  1I1G A;  4XKC A;  3DCF A;  4NDL A;  3TOB A;  4YEL A;  5JHF A;  2Z3Y A;  3KEQ A;  4KIT B;  2R7Q A;  4A69 C;  3D5L A;  4CYD A;  2CW8 A;  2OZU A;  2KKO A;  1P4X A;  2WBM A;  3P9K A;  2E2I J;  3WTZ A;  2CUE A;  3DEU A;  1TP4 A;  4UB6 C;  1YX5 A;  5LLQ A;  3CUO A;  1FSH A;  2RN7 A;  4CDG A;  5IOZ A;  2STW A;  5FKO A;  1Z7U A;  2MG4 A;  2LF7 A;  1QU3 A;  2Q8K A;  3CCV I;  3HOZ J;  1UCR A;  1XC5 A;  4S04 A;  4JOM A;  2W24 A;  2BYV E;  1Q1V A;  1Y8R B;  3HOX J;  1XN7 A;  4B3X A;  2XRN A;  3I3L A;  3K4L A;  4RB3 C;  3JSP A;  2ID3 A;  3VDX A;  1XTA A;  3BG3 A;  2VLA A;  2G9W A;  4RB2 C;  1ZH5 A;  4EEF G;  4N9H A;  5L3G A;  3VSL A;  2A5Y B;  3A0B C;  2EV5 A;  2WY7 Q;  2V9P A;  5HLT A;  1E2X A;  3K7A J;  1PP7 U;  1ZG3 A;  5ICG A;  1EH7 A;  4Y33 A;  2ZME B;  3AAF A;  5D5V B;  4NNJ A;  1TWH J;  4O5V A;  1ITY A;  3RQ4 A;  3HB9 A;  4NBQ A;  4MFD A;  1ORK A;  3A03 A;  3B6C A;  2HYF A;  2IVM A;  4A0X A;  3LSR A;  3WHB A;  2E34 A;  2H94 A;  3KX2 A;  1HBX G;  2KDO A;  4PK4 A;  5FFX A;  2E60 A;  4ZJZ A;  3BY6 A;  1U8B A;  3QP5 A;  4FX4 A;  2B0L A;  1LDK B;  2G7H A;  3MKY B;  3FXJ A;  2AS5 F;  4QTR A;  4C30 A;  3CTA A;  3JRE A;  2Y2Z A;  1PJR A;  2M30 A;  1XB4 A;  1UG2 A;  1Z9C A;  1WH5 A;  3RCO A;  2CQN A;  3E3V A;  1J5Y A;  2VPR A;  4ZYA A;  2EA2 A;  2BW3 A;  3SJM A;  3AG3 H;  3HGY A;  1DGW Y;  2Y75 A;  5D8K B;  1KU9 A;  2X6Y A;  5FLX Z;  4MQ9 F;  2JZY A;  2IGM A;  2ZXI A;  4WF2 A;  2B9S A;  4M3G A;  2M7A A;  3CCQ I;  1SEU A;  2VE9 A;  1WJB A;  3OYJ A;  4NHJ A;  1JXS A;  1EH6 A;  2HKX A;  1KU7 A;  3S2H J;  4C2U A;  3R6S A;  1IC8 A;  2K9M A;  5KK1 A;  1YS7 A;  4B3A A;  4XLP F;  3IL2 A;  4Z6Y A;  2MLG A;  2L9S A;  2YU3 A;  4LIT A;  3BR2 A;  1S5L C;  2K4B A;  2XUB A;  5HLG A;  4XON A;  1YW8 A;  4GGG A;  4YG2 F;  1GLN A;  2DK5 A;  5EEA A;  2ZNZ A;  4HST A;  1RZ4 A;  2JRT A;  4IZZ A;  3JR9 A;  1DP3 A;  3MN2 A;  2Y69 H;  2EZK A;  4J00 A;  5FKM A;  2IEK A;  4BQO A;  2CSO A;  2XF5 A;  4M3D A;  2Z33 A;  5JVG F;  1LEB A;  2BW3 B;  4C9Y A;  4JBA A;  3O6B B;  4UY8 I;  2CMP A;  4LIU A;  3G2B A;  2X48 A;  3GZ6 A;  3SQN A;  4G12 A;  1DUX C;  2DFH A;  1LFB A;  3I59 B;  4LGW A;  1R5H A;  3BG5 A;  4RLQ A;  3MAJ A;  2A3S A;  4IO9 F;  2QQB A;  3CO7 C;  1IUF A;  5D4S A;  2IAI A;  3UNG C;  1WHU A;  4BHB A;  9ANT A;  5FD6 A;  3LWF A;  1AOY A;  4KN4 X;  3S32 A;  2ECB A;  3V7S A;  2A6T A;  3DBR B;  2R3S A;  4D7M A;  2XAF A;  3OL3 A;  2F4M B;  5H6Q A;  4H4K C;  3GVA A;  3GZ5 A;  1FY7 A;  3GTO J;  3RKW A;  1YHQ I;  3M3Y J;  1ZG5 A;  5ILV A;  2LR8 A;  3KZI C;  5FRN A;  1RET A;  4DYR A;  3WTU C;  4G6Q A;  1S72 I;  3M7G A;  1X3W B;  2LLK A;  3NAU A;  2KZV A;  2LC2 A;  1UMQ A;  3IH2 A;  3SZP A;  2MSY A;  4BBR J;  3HRT A;  3OS0 A;  5TIS C;  1Z67 A;  1Y0N A;  1H89 C;  4A0Y A;  2DO7 A;  2XIG A;  2QEN A;  4KDP A;  2VT2 A;  2PMU A;  1U78 A;  2DA2 A;  1Z05 A;  3LSK A;  2RNG A;  2LP0 A;  1JKQ C;  3I9V 2;  2LY9 A;  4HDV A;  3W2W A;  2CRG A;  5JR3 A;  2X6X A;  1TT5 B;  2BGC A;  1A04 A;  2FJ1 A;  2FQ4 A;  4BE0 A;  5E79 C;  2A5W A;  2M45 A;  4E7S A;  4BE1 A;  4BH9 A;  1B72 A;  4UNO A;  2ELJ A;  2WWY A;  1HC8 A;  2CUJ A;  2ZC2 A;  1E3P A;  1BI0 A;  2COB A;  2VOP A;  2LBF A;  4OOI A;  1BR4 A;  3G3Z A;  2EFP A;  1V54 H;  3F8B A;  2HQ5 A;  1MSE C;  1T0F A;  4ZC3 A;  1SFE A;  2L0K A;  1IN6 A;  1YIT I;  2VOO A;  1LE8 A;  1IDY A;  2BBY A;  4BGD A;  3VYU B;  4D1Q A;  4KUM A;  3D1N I;  2LOO A;  1YI2 I;  3EYI A;  1AHD P;  3SHF A;  4I7H A;  4IOC F;  1W4M A;  2V79 A;  5K7F A;  3CUQ A;  2DMT A;  1OYI A;  4DNC A;  5L3F A;  2ACJ A;  2BVL A;  2QQ8 A;  2Y0S N;  4C2T A;  2OPT A;  3V4G A;  3OOP A;  2DI3 A;  2DA5 A;  4PZJ A;  1W5C C;  3CCE I;  2QA4 I;  4IQJ A;  1LB2 A;  1X2N A;  4BQA A;  5FKL A;  5E8G A;  3VYR B;  3BR1 A;  3BG9 A;  4BJT A;  4D9J A;  4ABZ A;  4ZTJ A;  3HRU A;  1HSJ A;  2JN6 A;  3QPS A;  3WE3 A;  5HOO A;  4IX7 A;  1L3L A;  4XKB A;  1FLI A;  2OCC H;  2LBF B;  4A5M A;  5KHD A;  1K61 A;  1D1B A;  2KIU A;  4DZJ A;  2ME6 A;  2HTJ A;  1IXS B;  2XRO A;  1KGS A;  1K79 A;  1LE8 B;  5DDG A;  5E20 A;  4FTH A;  4ZDP A;  1OFC X;  3J81 Z;  2XHK A;  3DPU A;  1F5T A;  5GTH C;  2QBY A;  1FYL A;  5EEH A;  4F52 A;  3CUQ B;  4WK8 F;  1A36 A;  1FP2 A;  5H20 A;  3HSE A;  2W48 A;  3VYT B;  3ZQL A;  1D0Y A;  4PJL A;  4QIW N;  1R4N B;  3I71 A;  5K7Z A;  4A3M J;  5D5X B;  3U9G A;  1H9G A;  1IGN A;  1X1C A;  3PNV A;  4X0G A;  4BXF A;  3LMM A;  3CCR I;  2RAE A;  1I3A A;  1VFC A;  1A31 A;  2ME0 A;  5EJC A;  3ERE D;  5L3B A;  1IO2 A;  4FHT A;  3SFZ A;  1UHM A;  4E7K A;  3BPX A;  2VQL A;  4PSX A;  1B6A A;  1MMN A;  3PL8 A;  2LSO A;  1AU7 A;  3VWB A;  2R7R A;  2YS9 A;  3DLL F;  1FT9 A;  1HDP A;  2DU9 A;  3RKQ A;  2QBY B;  2LVS A;  1W7P A;  1T8I A;  3ZQG A;  1B4A A;  4RAF A;  1STZ A;  3A1Y A;  5ILU A;  3L1P A;  1UAA A;  3DTE A;  1YW7 A;  3WU2 C;  2EIJ H;  2P5V A;  1X58 A;  4QWQ A;  1ZG1 A;  3PFI A;  4KIC A;  3GFI A;  1OCP A;  2FQ3 A;  4F7Z A;  2JUC A;  3L2C A;  4M71 A;  3LAJ A;  3L2U A;  1SC7 A;  2HGC A;  2DCE A;  2FBH A;  2H8W A;  2YPR A;  4L9T A;  1KU3 A;  1VND A;  1Y0U A;  2BE5 F;  4G7Z F;  3BC8 A;  3RJP A;  4XQF A;  3AKZ A;  5E18 F;  3K6G A;  2AQF A;  1D5Y A;  3K70 D;  3MZH A;  1NHA A;  1J0R A;  2XB0 X;  2HFH A;  4HX4 A;  2O6G E;  2BOL A;  4IL6 C;  2ID6 A;  3BZ6 A;  3D5S C;  2P7V B;  2PFB A;  3C7J A;  4PGH A;  5AON A;  3SDG A;  4FQG A;  2ESH A;  1W7P B;  5EG0 A;  3CMY A;  3CC4 I;  4RA2 A;  4YII A;  3BT9 A;  3IV5 A;  3U1D A;  2VJ5 A;  2RC4 A;  2ECC A;  3O3K A;  1FJL A;  4HF2 A;  1ZTR A;  2K02 A;  5K1Y A;  3R0J A;  1H8A C;  3IP4 B;  3G4S I;  3H0D A;  3DQV C;  3F8C A;  1GVD A;  3ECO A;  3LSM A;  1G3T A;  1YQA A;  2V4J C;  3LL7 A;  1FBQ A;  3Q3S A;  3HOU J;  2LNB A;  2R7W A;  1YO5 C;  1D8K A;  2FSW A;  3ZMV A;  1K6Y A;  1LFP A;  3L7W A;  3D5R C;  3M07 A;  2CH0 A;  2GAU A;  5LGN A;  4LFU A;  1GXP A;  4FT8 A;  1I39 A;  1Y1W J;  4ZTF A;  3LA2 A;  3K1P A;  2X6W A;  5D6F A;  2VUM J;  1LKX A;  5EG0 B;  2Y48 A;  3M9A A;  1YE9 A;  2XF6 A;  1O7L A;  4BYY A;  3RZD J;  2VQC A;  1ETY A;  3CDI A;  1J2X A;  5E1W A;  4C3H J;  2KPM A;  2RQP A;  2EFN A;  5LD2 C;  1DPU A;  1V3F A;  1WCM J;  2LDU A;  4CZC A;  2XPV A;  1S7E A;  1N25 A;  1E3O C;  1P9Q C;  1O7F A;  3L9F A;  5HVQ C;  3SDB A;  3FBI B;  1YRN A;  3GWZ A;  3GZN B;  2E1M B;  2VON A;  1QHG A;  3UR3 C;  2PJR A;  3FXO A;  2HZT A;  1JKR C;  3ONQ A;  5BOX A;  2P8T A;  5B66 C;  1K4T A;  4A3B J;  3HEF A;  2I10 A;  2FA5 A;  2O8K A;  4A3J J;  2CYY A;  2VXD A;  1J9I A;  2MLK A;  3K2Z A;  4UV8 A;  1NG7 A;  4HF1 A;  4XN3 A;  3AG2 H;  1ZRE A;  4Z2Y A;  1XS9 A;  3IAM 2;  2HKO A;  3KEO A;  1XCV A;  4D5C A;  3MEX A;  3FXL A;  4LMY A;  4HLY A;  1VQ4 I;  2F6C A;  4XOT A;  1I5Z A;  1VQK I;  4IOA F;  3GX4 X;  2XGC A;  2F2E A;  4AM3 A;  3HTS B;  3K1M A;  1HXD A;  5B1B H;  1YRN B;  5E3M A;  2CQX A;  4JK1 X;  3DEE A;  3CDL A;  3LA7 A;  4QLC U;  4L0Z B;  3NRV A;  4OIN F;  1Z3X A;  2E19 A;  3WTV C;  1Z6R A;  4CCO A;  1Z6T A;  1DU0 A;  4BU2 A;  3V42 A;  1P2F A;  2AHQ A;  2GWR A;  2PJR B;  2JA6 J;  3ASO H;  2DOA A;  4P9U A;  2BXZ A;  4A3G J;  1N77 A;  4LG0 B;  2IBD A;  2MGQ A;  3ZQF A;  2OCE A;  5D6E A;  4DYC A;  2JVG A;  3GYH X;  3D0S A;  2DT7 B;  3ZQC A;  1OLT A;  1VQ6 I;  5H2F C;  1Z3Y A;  3HJE A;  2DOD A;  1I50 J;  3BWG A;  1WPK A;  2K9N A;  1XDS A;  2LY1 A;  1MMD A;  2QKM B;  1IDZ A;  3DTI A;  4FX0 A;  1FBU A;  2EWN A;  4XNF A;  3ZMD A;  4BEH A;  2K7L A;  4PJN A;  2Y30 A;  3QU6 A;  3S1Q J;  4F93 B;  4IPA A;  5J4Y A;  2Q2E A;  4EJV A;  4HQM A;  4TV7 A;  4AWX B;  4A12 A;  3H9G A;  2QSH X;  2JA8 J;  3NQO A;  3L2V A;  4RGU A;  1EH8 A;  4P96 A;  2YR2 A;  4B48 A;  2MD0 A;  3UKG A;  4ZDL A;  4GXO A;  4XMY A;  3SXY A;  4ZZD A;  2EV0 A;  3MD2 A;  1VQM I;  5LRS A;  4KFC A;  4E7L A;  2G0E A;  1ZRC A;  3KCC A;  3E97 A;  3S3N A;  1BA5 A;  5E3L A;  4L0Y B;  1WSU A;  3KP5 A;  1FPQ A;  1SFX A;  2VBW A;  4HAM A;  3CJN A;  2QF7 A;  4MQV A;  2W85 A;  1S3J A;  1XMK A;  4XKW A;  1NK2 P;  3LSJ A;  3KYL A;  2NAZ A;  5IP9 J;  3IC7 A;  4LB5 A;  2Q0O A;  4KIG A;  4CYC A;  4KT6 A;  3TGN A;  3WU0 A;  3GME A;  3GXO A;  1YTY A;  2VKV A;  1IJW C;  4JP0 A;  2BHZ A;  4BEH B;  5CQG A;  1CGP A;  3CJQ B;  3AL0 C;  1S29 A;  4X6A J;  1T2K A;  1FMW A;  2QQ9 A;  2FBK A;  3LOC A;  4Y13 A;  2MAB A;  3DPL C;  5J47 A;  1OMI A;  5JLW A;  2ADU A;  2QUF A;  3PQK A;  1XSV A;  3G1M A;  2QKL B;  5EYR A;  4YFX F;  4L18 B;  2QQA A;  3ZRG A;  2CV2 A;  3P7N A;  3QPL A;  3V8K A;  4Y4R A;  2OZ6 A;  3EUH C;  2R5Y A;  2GLO A;  1WJA A;  3OY9 A;  1QZZ A;  1ON2 A;  3KP7 A;  3J7A Y;  1BN5 A;  3S2D J;  1LFU P;  2Y0S A;  1FOW A;  3GTJ J;  1EF4 A;  1XD7 A;  5J40 A;  1R1V A;  1QRY A;  4IRH A;  2KRH A;  3QOD A;  1JGG A;  2E2H J;  4UUS B;  3JRG A;  2LFB A;  3BTC A;  1HF0 A;  2WAF A;  3WG7 H;  1POG A;  3FWE A;  2B63 J;  3FK6 A;  3VB2 A;  2GIZ A;  2XAG A;  3LSG A;  1ETW A;  2Z5U A;  5IT9 K;  2I8D A;  4Y7N J;  1FWZ A;  3OYG A;  3OYE A;  2QSG X;  3CQZ J;  3V7C A;  2CV0 A;  4HA8 A;  1WJE A;  3GLX A;  3PSI A;  2FXA A;  4PFO A;  4PCQ A;  2NVQ J;  1VQP I;  5KVR A;  4PJM A;  1AWC A;  3QU3 A;  3B6A A;  1O3S A;  1MND A;  2RRE A;  3F8F A;  4BAC A;  1LVK A;  2GA2 A;  2F4O B;  5TRD A;  3H5N A;  1PP8 F;  2R5Y B;  1KYZ A;  4S05 A;  4KMU X;  3RYP A;  4GYG A;  3VYS B;  1XCB A;  2HQR A;  1X2M A;  1GVJ A;  3F72 A;  2LK2 A;  3TMO A;  1HA8 A;  2NXN B;  3JCU C;  4HSR A;  4D7N A;  2XRL A;  4NUB A;  3MWM A;  3KEY A;  2D1V A;  1IRG A;  2DOE A;  2H1L A;  3C2H A;  2PBI A;  3MMY B;  2ZXJ A;  4YEJ A;  1W0U A;  5J8F A;  2L9N A;  1BOA A;  1OYY A;  3TO7 A;  4EM2 A;  3BJO A;  2WC2 A;  2DDA A;  4EGZ A;  2EFQ A;  3M1C A;  2R7F A;  1TWC J;  3GFJ A;  1KA8 A;  3PFY A;  3SEQ A;  1FIP A;  2VBX A;  3QAH A;  3T1B A;  2V9V A;  3HDD A;  1JUS A;  2ISY A;  2HU9 A;  3CF2 A;  1DQU A;  3T8T A;  4BQN A;  2C6Y A;  3BR3 A;  2KZG A;  4V2G A;  4DJA A;  4I76 A;  2OV7 A;  1T98 A;  3BTI A;  3HXL A;  4MFE A;  3ZOB A;  2OU2 A;  2K27 A;  4GDF A;  1PUF A;  2KMU A;  4CSW A;  2FOW A;  1UHW A;  1AKH A;  3W2A A;  2HNH A;  3IHU A;  3OYF A;  1A5J A;  3E5U A;  2BY0 A;  4KJZ A;  2QLZ A;  1R1U A;  2DA1 A;  3ABU A;  4EMS A;  3QOP A;  2VN2 A;  2MC3 A;  3DKX A;  4NQW A;  2JUG A;  3EET A;  1F4K A;  4F91 B;  2E1O A;  1Z21 A;  3FIW A;  2W7N A;  2CG4 A;  2L54 A;  2VJJ A;  4Y3O A;  4E70 A;  1U8R A;  5HLI A;  4UUT A;  5E8I A;  5C3E J;  2KP6 A;  1EA3 A;  4M3B A;  1D3Y A;  1VQN I;  3CO6 C;  5EGO A;  2CS3 A;  4XID A;  3JRI A;  3JTH A;  2O5R A;  5FB2 A;  4E7I A;  1PUF B;  2STT A;  4Y17 A;  3EUK L;  3K9T A;  1SD4 A;  5C44 J;  1BI2 A;  1XG1 A;  2EB7 A;  2ELK A;  2XB5 A;  1IXR C;  2PG4 A;  3H3U A;  4M6X A;  1JKP C;  2OTJ I;  1WI3 A;  5IT3 A;  4LLN A;  3OSF A;  2HI3 A;  2JMW A;  1JHF A;  3MKL A;  3WHC A;  4GRI A;  1TT0 A;  2R7U A;  3T8R A;  2XSJ C;  2RV8 A;  1HCR A;  3JW4 A;  5EEG A;  2XAJ A;  3ZMU A;  1IV6 A;  4G8X A;  3RKX A;  1WVR A;  3IKV A;  2KQR A;  3DKY A;  2M0M A;  5HDN A;  3HGG A;  4Y15 A;  5GP9 A;  4AIK A;  5IPA A;  5FGM A;  2M8G X;  1R4M B;  4ESB A;  4N4N B;  1VI0 A;  2PMZ N;  4A93 J;  2V9K A;  4XRF A;  1VQO I;  2YSR A;  3FMQ A;  4XR6 A;  4IHS A;  2V1U A;  1CF7 A;  4XRS A;  2FML A;  2DQL A;  1VQ5 I;  5LGT A;  2W4S A;  2KL4 A;  1MGT A;  4HDU A;  2K5C A;  5E1X A;  1FYM A;  1T08 B;  3ZPL A;  3VOD A;  3F21 A;  1UZC A;  1RC9 A;  3FDY A;  2IW5 A;  5DM7 F;  2JA5 J;  2G7U A;  2K40 A;  2JRM A;  2HOT A;  1FTZ A;  1FMV A;  4IHY A;  3BR0 A;  1GV5 A;  3BR5 A;  3K4M A;  2IRF G;  1YS6 A;  4M6V A;  1GT0 C;  1B1B A;  5CVV A;  4E6K G;  1GUU A;  1FOX A;  3CES A;  3C3W A;  2VJI A;  2K9S A;  2JPC A;  3MQ0 A;  4M3F A;  4M74 A;  1UB9 A;  2GA1 A;  2L9V A;  3DF8 A;  5F6F A;  4B44 A;  4BBS J;  5M3M J;  3LQR A;  3VFZ A;  1ZKG A;  1LUJ B;  5FD5 A;  2XGX A;  2VC1 A;  5CVI A;  2YX4 A;  5CPR B;  2CGP A;  3P9C A;  4LIV A;  1R49 A;  2DBB A;  2VI6 A;  2XVC A;  3TO6 A;  2JJ7 A;  1B8I A;  2KJB A;  5DCM A;  4UV9 A;  1X1P A;  1CF7 B;  4HX7 A;  1TC3 C;  4LD5 A;  3HOV J;  3GFM A;  2MD5 A;  2P6S A;  2B7E A;  2EPF A;  3LA3 A;  4HEA 2;  4B8X A;  1X3U A;  3E5Q A;  3QYE A;  4BHC A;  5F04 A;  3J7Z I;  2FNP A;  5F27 A;  4G7O F;  3JTG A;  1D0X A;  2VT3 A;  4ASN A;  4RM3 A;  5BQT A;  3QPT A;  1ZLK A;  5DTD A;  1RUO A;  3WTW C;  4HZF A;  4DBR A;  1Y1V J;  2OQR A;  3QYB A;  1U2W A;  4G9Y A;  3HZJ A;  4FE4 A;  4YRV A;  5FLM J;  4BY7 J;  1VQ9 I;  2L9R A;  4OWR B;  3BZC A;  2LMD A;  4LJZ F;  1RIO H;  1WH7 A;  2JT1 A;  5JVT A;  2V26 A;  3ABM H;  5BNG A;  4A6D A;  2XPW A;  1O57 A;  3PUB A;  3K4B A;  5F64 A;  3S1M J;  2DPD A;  4GCV A;  5DCM B;  1QO0 D;  2X51 A;  4Y52 J;  3TOA A;  3CUQ C;  1MH3 A;  1P4W A;  3QPH A;  4NC7 A;  3CC7 I;  1X4P A;  5GTI C;  1ZEL A;  3FMR A;  2CO5 A;  5A2Q K;  3BCA A;  2ZJP F;  1XGN A;  2FEZ A;  2GOM A;  1ULY A;  2L7M P;  2I5U A;  1F36 A;  3F9K A;  5K7H A;  3JRC A;  4JYK A;  1I3Q J;  3CP8 A;  4I02 A;  3VEP A;  4HQE A;  4EJW A;  1U5T A;  4X1E A;  3KP6 A;  3KP3 A;  1OCC H;  2EBI A;  2N8G A;  2IGN A;  4GO1 A;  3TP3 A;  1FX7 A;  1ZHF A;  1U9O A;  5CYV A;  1FNN A;  1U0J A;  4II3 A;  4M9S A;  2F5F A;  4OMY A;  3PSF A;  2X1D A;  4XLN F;  3IRQ A;  4WXC A;  4RGX A;  2QSF X;  2Y0M A;  4U7D A;  4KIS A;  4FET A;  2W00 A;  1ZAR A;  3GUD A;  1B72 B;  3BCB A;  1B9N A;  1I1S A;  2FD5 A;  3E7L A;  3OV8 A;  2XGE A;  1D1A A;  3F0C A;  3HHG A;  5KAI C;  2L02 A;  3I4M J;  1IN8 A;  2LKX A;  1O4X A;  2K4J A;  1D0Z A;  3QWL A;  3M8F A;  4UVB A;  5E1Z B;  3I56 I;  1RES A;  3ZQ7 A;  1O3R A;  4PDK A;  4HX8 A;  4RLF A;  1KQ0 A;  3KYD B;  3ML6 A;  3OS2 A;  1MNM C;  1OR7 A;  4M6Y A;  3S14 J;  3ABT A;  3QP6 A;  4WWC A;  2H1K A;  1E17 A;  3JAM K;  4KNY A;  4I0B A;  1WGX A;  5FRM A;  3SEZ A;  1MSF C;  1IRF A;  2DTZ A;  5GAH J;  2W84 A;  1KQ9 A;  2YX7 A;  4EJU A;  1Y39 A;  5JHU A;  1J59 A;  5LFA A;  3ULQ B;  2DMN A;  5DM6 F;  4BQQ A;  2EFO A;  3T0Y A;  4ZYG A;  3HKZ N;  2ELH A;  1BR2 A;  2VE8 A;  3E6B A;  1NK3 P;  1BIA A;  3EDP A;  1BI3 A;  1BW5 A;  2WAQ N;  2VKH A;  2NOJ B;  3DP7 A;  2ZO4 A;  5IOY A;  3NWT A;  4XLF A;  2HDC A;  1QVU A;  2HDD A;  3J7A O;  2HXO A;  4EAT A;  3K4J A;  5GPA A;  1W7P D;  4I6Z A;  1HKT A;  3K4C A;  5GAE J;  2V1X A;  1J7K A;  4OMZ A;  5IP7 J;  1QHH D;  3NAR A;  1R1T A;  2EZH A;  2DA4 A;  3Q0W A;  5JFR A;  1RKW A;  2WB1 N;  3FHZ A;  1W36 C;  1W36 D;  1R71 A;  1O3Q A;  4L5I A;  3EYY A;  5DV5 A;  4A2U A;  2R7Z J;  2GXA A;  3PJR A;  3G6E I;  4UHT A;  4XK4 A;  4J01 A;  3OYM A;  4A0Z A;  1IN5 A;  2RNJ A;  1RNL A;  5KNL A;  2GZW A;  1PVE A;  3BDD A;  3HPH A;  1A35 A;  3S17 J;  1BOB A;  3ERM A;  1ENH A;  4HF0 A;  2M2E A;  1KQ8 A;  1W5T A;  5B5E C;  2E35 A;  1VQL I;  1SFK A;  4QSH A;  2FNA A;  2XAQ A;  4W1U A;  3S1N J;  3VOE A;  4WXH A;  4H0E A;  3K70 C;  3OIP A;  2M1B A;  2ZXH A;  5BPD A;  1JKO C;  4XOP A;  1D8J A;  3OYI A;  2KLO A;  2M34 A;  4CGZ A;  3TO9 A;  3JRD A;  1JUP A;  1ZYR F;  4A6E A;  1H9T A;  1MKM A;  4KIB A;  3V8L A;  1PDN C;  3S3M A;  5CVJ A;  4XL9 A;  5TGT A;  1K7A A;  2X9D A;  5ERI A;  2O3F A;  3WE2 A;  2MC4 A;  3WU1 B;  3HOT A;  1WJC A;  2E1M C;  2M4G A;  2P81 A;  3I58 A;  3BOQ A;  2CUZ A;  1SMY F;  1QA6 A;  4ETS A;  2IPQ X;  1R58 A;  2LKS A;  3M1E A;  5FFZ A;  2OD5 A;  3FF5 A;  4EM0 B;  1XPX A;  4KT5 C;  5L3C A;  2LF8 A;  3A01 A;  1F43 A;  1XMA A;  2JVH A;  2NNN A;  5DD4 A;  4XLA A;  2J5O A;  4EM1 A;  4YFK F;  2J5P A;  3I5U A;  3J7Y J;  4FCY A;  1QZY A;  5AIP A;  4ENJ A;  4M73 A;  2OBP A;  1MW7 A;  3CME I;  3ZGK A;  3ZMT A;  3W6J B;  1HOM A;  4ANJ A;  1WKM A;  3J80 K;  3CCM I;  1BIB A;  1TWF J;  2ZKZ A;  2ETH A;  1R23 A;  4C3I J;  2TCT A;  2NOG A;  1R6R A;  4RMN A;  4M9X A;  3HOW J;  2ZBK A;  4F92 B;  1X1A A;  3TP0 A;  2L4M A;  3G71 I;  1APL C;  4BY1 J;  3ZN1 A;  2DJN A;  2L7Z A;  5J1U A;  3F3X A;  2DTR A;  4AIJ A;  4E7J A;  3H5R A;  3C2B A;  1MH4 A;  3H35 A;  4CCK A;  2OTL I;  1RUN A;  1UHS A;  2M4K A;  3QYF A;  3I4P A;  3H0G J;  3A01 B;  2XAS A;  2MYS A;  4ZYH A;  3JRB A;  4UVC A;  2HEO A;  2HVR A;  4MTE A;  1I27 A;  1NH3 A;  2OQG A;  2CW7 A;  3LSP A;  5DUK A;  4MEX F;  4G7H F;  2DA6 A;  4R79 A;  4HBL A;  4PJ0 C;  2ZSH B;  3PO2 J;  2HWV A;  2R92 J;  1A6Q A;  2O9L A;  5EDN A;  2WAD A;  1IV8 A;  1X4O A;  1T56 A;  3H9J A;  4M9Z A;  5BPI A;  2E7W A;  2W25 A;  2A05 A;  2XSD C;  2WV1 A;  3MKW B;  5HLH A;  2ZFU A;  5IYC J;  4CHU A;  2PMZ A;  4IHV A;  2X4H A;  4P55 A;  3BTL A;  2M8E A;  3HBL A;  2P5K A;  3P9I A;  1XSX A;  2FMY A;  3CCJ I;  2KIM A;  6PAX A;  4AYB N;  3W3C A;  1R22 A;  1G6N A;  2MBF A;  3CF5 F;  4EJO A;  1IAW A;  5DUI A;  4MEY F;  3X2Q H;  4DBQ A;  1U3E M;  5ILS A;  5HS8 A;  5ED4 A;  1W5S A;  2PN6 A;  2FUG 2;  5DCF A;  3E6M A;  1SVL A;  2RVC A;  4CCL A;  3HRM A;  2CFX A;  4U7B A;  2K3P A;  2VQH A;  2HYG D;  1HST A;  4Q47 A;  1VTN C;  3GFL A;  3Q9V A;  3E0J B;  1NTC A;  3GTK J;  4OIR F;  2UXX A;  1SFU A;  3DV8 A;  1J75 A;  1ZGA A;  2CU7 A;  2WAE A;  2P5L C;  1ETX A;  2FX0 A;  3QRF F;  4JX4 A;  5B1A H;  1SAN A;  1OYW A;  2PI0 A;  1MD0 A;  2NVX J;  4KN7 X;  1MMS A;  1TLH B;  4XSZ F;  4U87 A;  2DFF A;  2VL8 A;  4BXU A;  3WTY C;  3HC7 A;  3ZN0 A;  5LBQ A;  2EJR A;  3O8G A;  3ZQH A;  2XDV A;  3HYI A;  2NS7 A;  3BPV A;  4O3M A;  2DFE A;  1JGS A;  2HPM A;  2GBY A;  2E1N A;  3H1C A;  1HKQ A;  2IA2 A;  2JA2 A;  5J3L A;  3A0H C;  3A02 A;  3C18 A;  4MNU A;  1WQ2 A;  1WWX A;  2QYO A;  2JA7 J;  4DQ2 A;  2Y9Y A;  5E3N A;  5EZG A;  1U9N A;  3ABK H;  4ITV A;  2DYS H;  3S3O A;  4XLE A;  1TNT A;  2WTE A;  4UB8 C;  3S8P A;  2W82 A;  3BLY A;  2KHM A;  4AID A;  2Z99 A;  1XSD A;  3FXQ A;  2HOA A;  3DTK A;  5FRO A;  1WFX A;  5K5R A;  2V1N A;  3K10 A;  2P6T A;  3CDH A;  4IHW A;  4CCN A;  2ZJR F;  1UST A;  3IWZ A;  4RAG A;  1SD6 A;  3R60 A;  2DMP A;  5LEJ A;  3TKY A;  1TL8 A;  4RGR A;  3F6V A;  2ZJ2 A;  1HW1 A;  2R7X A;  5F0C A;  1V5E A;  1LDJ A;  1BC8 C;  4O6J A;  1X3Z B;  3LST A;  2JSC A;  4I0A A;  2Q2E B;  2XKP A;  2MA3 A;  3FMS A;  4R8H A;  2O61 A;  1IUY A;  3LFK A;  2EIK H;  3RQI A;  1C0W A;  4PUS A;  3HUG A;  1T33 A;  3OWT A;  2UWM A;  4C3J J;  3Q0U A;  1XDU A;  4A3K J;  4G94 A;  2IS4 A;  1UEL B;  5D4R A;  3KP2 A;  5HNF A;  1ETQ A;  1JTX A;  2DN0 A;  2M5W A;  4WXD A;  1ZRF A;  2EV6 A;  3MVP A;  2IS2 A;  5IYD J;  1MJ9 A;  2UUZ A;  3DLA A;  3HIF A;  1MBH A;  1RR7 A;  1R5I D;  1R5G A;  2IA0 A;  3IH3 A;  4BAY A;  4CYC B;  1HLV A;  3NWS A;  1GDT A;  1DPR A;  1P4A A;  4L9N A;  2X1C A;  4EVI A;  2DXI A;  1IRZ A;  2M9H A;  5JLX A;  4ENM A;  5FJ8 J;  3TL4 X;  5LHH A;  1Y8Q B;  4OIP F;  1DGR M;  2RDP A;  3PUF A;  2BHY A;  4BE2 A;  2Z9O A;  3S15 J;  1BJA A;  5L3E A;  3LSH A;  3HUG B;  4II2 A;  5J6X A;  1S7O A;  1HW5 A;  1WJF A;  5KAF C;  2DDB A;  3V7R A;  2IGK A;  1D5V A;  2KIF A;  3O2P E;  4V19 K;  1U6G A;  2LG4 A;  2E2J J;  1YOV B;  1WJ5 A;  2M3A A;  5K5O A;  2UZK A;  1G3S A;  2DLL A;  4E4H A;  5HDK A;  1Z7L A;  4CH7 A;  1JI8 A;  2CQ7 A;  4HLX A;  1P6R A;  4BNC A;  3HKZ A;  1T38 A;  3CP2 A;  1BR1 A;  1IW7 F;  2AQE A;  2NS8 A;  2W1O A;  5ICC A;  4DOZ A;  2WAQ A;  1IRX A;  3ISP A;  2DAO A;  2K9Q A;  3BJA A;  2KRF A;  3HG9 A;  5LGU A;  2KIQ A;  4OIQ F;  2BY2 A;  2L4A A;  5HDG A;  3I55 I;  5J4V A;  4EJT A;  2A69 F;  2JSP A;  1I6H J;  1A6I A;  2NS0 A;  1MIJ A;  4MTD A;  2GQQ A;  4AUX A;  5F0H A;  3E5X A;  4R1H A;  2O03 A;  5GAG J;  1GXQ A;  1RI7 A;  2WB1 A;  2VAS A;  4DIQ A;  3B02 A;  1MBK A;  1QNT A;  3JRA A;  1YYV A;  1XMX A;  3WTX C;  2HDW A;  2KDZ A;  5ICE A;  2ZME A;  3OL4 A;  5HOD A;  1KU2 A;  1IN4 A;  1JE8 A;  1VQ7 I;  3FXK A;  3QOE A;  1FP1 D;  1TTY A;  3GTG J;  1DU6 A;  3G73 A;  3CC2 I;  3OSG A;  2EZL A;  1BI1 A;  4WX9 A;  4BUP A;  4AIH A;  3AFH A;  3ZQQ A;  4IRI A;  1SMT A;  4IRG A;  2EFW A;  2QWW A;  2D1H A;  1K4S A;  2JWT A;  3HOS A;  2X0L A;  2O8X A;  3BZK A;  2EIN H;  2FRH A;  1XGO A;  1BL0 A;  3PO3 J;  3CLO A;  2E5N A;  1ONV A;  2HOS A;  2ISZ A;  2EK5 A;  1R9T J;  2XV4 S;  3GF2 A;  2NVT J;  4D5F A;  1QZE A;  1T39 A;  3DU6 A;  2HR3 A;  4XSX F;  1GHC A;  2P7C B;  5IYB J;  1JUM A;  2Q1Z B;  1AKH B;  3N05 A;  2R7S A;  2HXI A;  3V8J A;  2LTP A;  3LQQ A;  4BXX J;  2JPB A;  2RQQ A;  1F9N A;  1Q1H A;  1SAU A;  1OCT C;  3K69 A;  4MLO A;  1G3Y A;  3ZQI A;  4DW6 A;  5F08 A;  1NG6 A;  2L01 A;  1HDD C;  2CV1 A;  4NQW B;  1QGP A;  2ZXW H;  3FKJ A;  1S8N A;  2FOK A;  3LFU A;  3DKW A;  2FU4 A;  2HQA A;  1TNS A;  5JI6 A;  3MKZ A;  2R93 J;  3I53 A;  1HQC A;  5EF6 A;  1MMG A;  1TQP A;  2NVY J;  3TQN A;  1JTY A;  2KJC A;  4BJ5 C;  1YLF A;  3CMM A;  5D5U B;  3H3V K;  5EGO B;  1RR8 C;  5F0F A;  2DMQ A;  1ETV A;  5FLX K;  2LYC A;  4A3D J;  1G4D A;  4KYW A;  4NC8 A;  2L7K A;  3A2K A;  1FTT A;  2EA4 A;  4P9F A;  2GIV A;  3OIO A;  1WRJ A;  2LKP A;  5KCM A;  4ZYE A;  5M3F J;  4A5N A;  3IH4 A;  2PQ8 A;  3BQZ A;  3R4K A;  1OQY A;  4Q48 A;  4N4O B;  3MFK A;  3I59 A;  1AA7 A;  3P5J A;  2H6B A;  1YJN I;  3SYT A;  2R5Z A;  1XX5 A;  4N0B A;  2ZSI B;  2XKO A;  4IJA A;  4IQ4 A;  2YUS A;  4HPQ A;  3HRS A;  3L2W A;  1BC7 C;  1TQI A;  1O3T A;  1ZGW A;  4P1W A;  5BMZ A;  1OKR A;  2OA4 A;  1IF1 A;  3FM3 A;  3H3Z A;  3BG6 A;  3GCM A;  2E5Z A;  4B4C A;  1FBS A;  2A6H F;  3U1K A;  3S93 A;  4Q4Z F;  1TWA J;  3OMY A;  2VJ4 A;  1FC3 A;  4AC0 A;  1OCZ H;  3F22 A;  3PNT A;  3CCY A;  1BM9 A;  3FK7 A;  2ZB9 A;  2VQG A;  2EH3 A;  3DEW A;  3I64 A;  3GBG A;  1FIA A;  3O8H A;  1FZP B;  5FLV A;  1WZ2 A;  2HQN A;  4MO7 A;  2F5V A;  2KT0 A;  4L9V A;  3COA C;  2LRE A;  2JTV A;  4AYB A;  2R7O A;  2CQK A;  2E7X A;  4FIS A;  5FO5 A;  2NRA C;  4HRI A;  1HW2 A;  3FIS A;  2R5Z B;  3HHH A;  1Y56 A;  4U0W A;  4CO8 A;  5J8C A;  2QZ8 A;  3M8J A;  1USS A;  2DQR A;  2LRD A;  1ZR4 A;  1K78 A;  3JSO A; 
#chains in the Genus database with same CATH homology
 4KIT B;  2JVG A;  2R7Q A;  3D5L A;  2DT7 B;  2CW8 A;  2R4G A;  5KNL A;  2WBM A;  3HPH A;  1OLT A;  1BOB A;  4F3Q A;  1Z3Y A;  1YX5 A;  4QPO A;  1SFK A;  2LY1 A;  3K70 C;  3OIP A;  1MMD A;  2QKM B;  1QU3 A;  3DTI A;  2ZXH A;  5HNH A;  4HNT A;  4JOM A;  4XOP A;  1T0F C;  4XNF A;  4BEH A;  1T95 A;  2KLO A;  3OYI A;  4PJN A;  1V5G A;  4B3X A;  4F93 B;  4AU7 A;  3I3L A;  3K4L A;  3VDX A;  2X1E A;  2VLA A;  3H9G A;  3S3M A;  4XL9 A;  3L2V A;  5TGT A;  3L2Q A;  2CFO A;  2MC4 A;  3HOT A;  3VSL A;  1WJC A;  2E1M C;  4B48 A;  2MD0 A;  2M4G A;  4ZDL A;  2CUZ A;  4JQF A;  1ERD A;  4XMY A;  5CKT A;  2WY7 Q;  3MD2 A;  5HLT A;  2K9L A;  1S9H A;  4E7L A;  3S3N A;  3EUA A;  4Y33 A;  4XLH A;  4XLC A;  4NNJ A;  2JVH A;  4E7Z A;  4XLA A;  3RQ4 A;  4XKW A;  1MW7 A;  3ZGK A;  4P5O A;  3KYL A;  4CA0 A;  4ANJ A;  4KT6 A;  4BEH B;  3KX2 A;  5CQG A;  2KDO A;  4PK4 A;  3CJQ B;  3AL0 C;  1R6R A;  4RMN A;  2E60 A;  2VIX A;  1FMW A;  3VSK A;  4ZJZ A;  2MAB A;  2Z2S B;  3DPL C;  4F92 B;  2VXZ A;  1X1A A;  1LDK B;  1OR7 C;  2QKL B;  3MKY B;  4C30 A;  3ZRG A;  2CV2 A;  4E7J A;  3H5R A;  4Y4R A;  1PJR A;  3EUH C;  3H35 A;  1WJA A;  4CCK A;  2WA0 A;  3RCO A;  3OY9 A;  4G6T B;  3OYD A;  1TZL A;  3CJR B;  3J7A Y;  2M4K A;  4ZYA A;  2Y0S A;  3QYF A;  2BW3 A;  3W2V A;  2V6E A;  3OYB A;  2MYS A;  2IS1 A;  2KRH A;  3QOD A;  1DGW Y;  3OYC A;  2X6Y A;  4BDZ A;  2HVR A;  2IGO A;  2WAF A;  2IGM A;  2ZXI A;  3OYN A;  2CW7 A;  2M7A A;  4R79 A;  3LSG A;  1WJB A;  3OYJ A;  2ZSH B;  2MFZ A;  2I8D A;  1PYV A;  4C2U A;  3OYG A;  3OYE A;  2K9M A;  2CV0 A;  2WAD A;  1KON A;  1WJE A;  1X4O A;  2L9S A;  3H9J A;  3PSI A;  4PFO A;  4CUG A;  4LIT A;  4PJM A;  4XON A;  1GLN A;  4HST A;  1MND A;  2RRE A;  3DPT A;  3MKW B;  4BAC A;  1LVK A;  2ZFU A;  4IZZ A;  3H5N A;  1DP3 A;  4J00 A;  2PMZ A;  3BG7 A;  2R7V A;  4BQO A;  3VYS B;  4BL0 B;  2XF5 A;  3SZG A;  3W3C A;  1HA8 A;  2BW3 B;  3TMO A;  3ZR8 X;  4C9Y A;  2IS6 A;  2M7B A;  2CMP A;  4HSR A;  4LIU A;  3G2B A;  4NUB A;  3KEY A;  4DBQ A;  3OOU A;  2FUG 2;  3C2H A;  3MMY B;  4YEJ A;  2L9N A;  4RLQ A;  4QPQ A;  4CCL A;  4U7B A;  2K3P A;  2VQH A;  3HL2 A;  3RPU D;  3ZXS A;  3UNG C;  3H9Q A;  3OYL A;  3S32 A;  3M1C A;  3E0J B;  2A6T A;  3PFY A;  3SEQ A;  3OL3 A;  4H4K C;  2HU9 A;  2WAE A;  3CF2 A;  1DQU A;  3FHN A;  4BQN A;  5FRN A;  4DJA A;  2HVQ A;  2OV7 A;  2GOX B;  4U87 A;  3HXL A;  2VL8 A;  1MMA A;  2KZV A;  3HC7 A;  2KMU A;  4CSW A;  2LC2 A;  2XDV A;  3W2A A;  2HNH A;  2Z1D A;  3OYF A;  2HPM A;  4KJZ A;  3OS0 A;  2JA2 A;  3DKX A;  2JUG A;  3LSK A;  2RNG A;  1X19 A;  3I9V 2;  4F91 B;  4ITV A;  3S3O A;  1Z21 A;  3W2W A;  4XLE A;  2W7N A;  3S8P A;  2X6X A;  2DT6 A;  2W82 A;  3BLY A;  4BJ6 C;  2VJJ A;  2KHM A;  4Y3O A;  4BE0 A;  3DTK A;  2A5W A;  5FRO A;  4E7S A;  4BE1 A;  1G8X A;  2ELJ A;  2KP6 A;  4XN0 A;  1WFX A;  2V1N A;  1EA3 A;  2CUJ A;  3K10 A;  4PSW A;  4CCN A;  2LBF A;  1BR4 A;  4PJJ A;  3HPG A;  2HVS A;  2CS3 A;  4ZC3 A;  2HPI A;  2O5R A;  2R7X A;  1V5E A;  4E7I A;  2Q2E B;  3U21 A;  3E1S A;  4BGD A;  1UG0 A;  3EUK L;  3VYU B;  4D1Q A;  2LOO A;  1WJD A;  4PUS A;  4PFP A;  2BVL A;  3K4N A;  4C2T A;  4HNU A;  4LG3 A;  2UWM A;  3OWT A;  2Z16 A;  4ZDO A;  2IS4 A;  4IQJ A;  2L2O A;  3VYR B;  1UEL B;  4BJT A;  4GRI A;  4XM3 A;  1TT0 A;  4D9J A;  5HNF A;  4ZTJ A;  2XAU A;  2R7U A;  2XSJ C;  5HOO A;  4IX7 A;  5JHF A;  1MNE A;  4XKB A;  2IS2 A;  2OC6 A;  2LBF B;  2UUZ A;  3DLA A;  3ZCO A;  2KQR A;  3DKY A;  2M0M A;  5KHD A;  1D1B A;  2UV1 A;  3NWS A;  3IAS 2;  2X1C A;  2DXI A;  1V5F A;  3TL4 X;  4ZDP A;  2HZD A;  2VB6 A;  2LH9 A;  1DGR M;  3DPU A;  4N4N B;  2BVM A;  4F52 A;  2V9K A;  3FBN B;  4BE2 A;  4XR6 A;  3LSH A;  3HUG B;  4II2 A;  4B43 A;  4F55 A;  4CCJ A;  1WJF A;  3VYT B;  1D0Y A;  4PJL A;  2IGK A;  2W4S A;  2KL4 A;  3DU5 A;  2K5C A;  2LG4 A;  3L2R A;  1WJ5 A;  2M3A A;  1X1C A;  3FDY A;  3PNV A;  4E4H A;  4X0G A;  1Z7L A;  4CH7 A;  4BXF A;  3LMM A;  3OYK A;  1JI8 A;  3OYA A;  1FMV A;  1X1D A;  1YX3 A;  2L5Q A;  3LSI A;  3HKZ A;  3K4M A;  3CP2 A;  1BR1 A;  2X85 A;  4E7K A;  4E6K G;  2AQE A;  3OYH A;  2W1O A;  2VQL A;  4DOZ A;  2WAQ A;  1IRX A;  4PSX A;  1MMN A;  3CES A;  3HG9 A;  1X1B A;  2VJI A;  3PL8 A;  4B44 A;  3VWB A;  2R7R A;  2OUM A;  1D1C A;  3OR2 C;  3DWL E;  3K4K A;  4XKV A;  5CPR B;  2JSP A;  4LIV A;  2VPL A;  3A1Y A;  1UAA A;  3DTE A;  2WB1 A;  2VAS A;  4DIQ A;  2DJI A;  1Y6I A;  2IXS A;  2LY2 A;  4HEA 2;  3QYE A;  3A4C A;  2HDW A;  4HG2 A;  3L2U A;  1D0X A;  3OL4 A;  2DCE A;  4RM3 A;  3QOE A;  1E0E A;  3IUO A;  3BC8 A;  4DBR A;  4XQF A;  3AKZ A;  3K6G A;  4BUP A;  2AQF A;  3QYB A;  3AFH A;  3K70 D;  3EPZ A;  3ZQQ A;  3RSN A;  4IKF A;  4YRV A;  4CCM A;  2VKD A;  2BOL A;  4OWR B;  3HOS A;  1N75 A;  3D5S C;  4RM2 A;  2V26 A;  2R7T A;  2E5N A;  3PUB A;  3K4B A;  2WY8 Q;  2X51 A;  2VJ5 A;  4OAZ A;  2XF7 A;  3DU6 A;  4NC7 A;  1X4P A;  1ZEL A;  3OR1 C;  3IP4 B;  3BCA A;  2GOM A;  3DQV C;  3LSM A;  3H0D A;  2Q1Z B;  2R7S A;  3N05 A;  2V4J C;  3LL7 A;  3F9K A;  3C2G A;  2R7W A;  3CP8 A;  4AVZ A;  1SAU A;  2RQQ A;  4BS9 A;  1N78 A;  4MLO A;  1K6Y A;  1LFP A;  2IGN A;  1NG6 A;  2CV1 A;  3D5R C;  4NQW B;  2CH0 A;  3FKJ A;  1U0J A;  4II3 A;  3LFU A;  4ZTF A;  3PSF A;  2HQA A;  2X1D A;  2X6W A;  3MKZ A;  4XOR A;  4KIS A;  4FET A;  2KRC A;  2W00 A;  1LKX A;  3BCB A;  2P0W A;  1MMG A;  1YE9 A;  2XF6 A;  4BJ5 C;  2VQC A;  3CMM A;  1D1A A;  1VZ0 A;  1G59 A;  2KPM A;  1D0Z A;  5LD2 C;  2LYC A;  4NC8 A;  2L7K A;  4CZC A;  3A2K A;  4RLF A;  1P9Q C;  3OS2 A;  5HVQ C;  3SDB A;  3FBI B;  5KCM A;  2E1M B;  4FAS D;  1QHG A;  4N4O B;  1AA7 A;  3UR3 C;  5FRM A;  1J09 A;  2PJR A;  3CZ6 A;  3SEZ A;  3SYT A;  3TBI A;  3ONQ A;  2ZSI B;  4DGW B;  5LFA A;  4IQ4 A;  4BQQ A;  4HPQ A;  2VXD A;  1BR2 A;  5CQE A;  3L2W A;  4E7H A;  2V7F A;  1NG7 A;  4XN3 A;  4P1W A;  2VKH A;  2NOJ B;  3NWT A;  4BDY A;  3IAM 2;  4XLF A;  2XC7 A;  4EAT A;  3K4J A;  3OIQ A;  3BG6 A;  3K4C A;  2F6C A;  2E5Z A;  4XOT A;  3RTR A;  3AL0 B;  3S93 A;  1QHH D;  3OMY A;  2VJ4 A;  3PNT A;  3DEE A;  4B47 A;  2VQG A;  3PNY A;  3H5A A;  3GBG A;  1Z3X A;  1W36 C;  1W36 D;  2F5V A;  4CCO A;  4OAY A;  4BU2 A;  3V42 A;  2LRE A;  4AYB A;  2F4I A;  2R7O A;  3OS1 A;  2PJR B;  3PJR A;  4HRI A;  2DOA A;  4XKC A;  1Y56 A;  4J01 A;  1N77 A;  3OYM A;  3M8J A;  2LRD A;  4YEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...