4OB7A

Crystal structure of esterase rppe mutant w187h
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
319
structure length
319
Chain Sequence
SGSPGVEQHTQAFLEALEQGGGKPLEQLSPKDARAVLTGAQASVKVDLSGIEVKERTIQANGQSIKLQVVRPANVKGELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSGAVAVYVDYTPSPESHYPTAINQAYAATQWVAEHGKEIGVDGKRLAVAGNSVGGNMAAVVALKAKEAGTPALRFQLLLHPVTDASFETASYKQFADGHFLTTGMMKWFWDNYTTDAKAREQIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGLLNPLSQVPAVKAAMRQAGTELKVHLQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Pseudomonas putida esterase reveal the functional role of residues 187 and 287 in substrate binding and chiral recognition
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold-3 domain protein
total genus 120
structure length 319
sequence length 319
ec nomenclature ec 3.1.1.-:
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ob7A00
4JH0A 2XUIA 5FXMA 5AOCA 2ACEA 2O2GA 4W1RA 5LKAA 5AK4A 3C43A 3D59A 4PSCA 3HABA 4IHAA 3DKKA 4H7HA 2OAGA 4OPMA 2JGIA 7YASA 3GZJA 5E4JA 3SWWA 1VJ5A 1FFEA 4LYDA 4CFSA 2JBWA 2PU5A 3RARA 4UPDA 4U2FA 1MAAA 4DTCA 2O2IA 3LIIA 1W76A 1LPNA 4ZV7A 2QR5A 2QT9A 1W6RA 3C70A 1B6GA 4QDTA 4GBGA 2QVBA 5ALQA 1P0MA 5FLKA 1YASA 2RIPA 3WL6A 2H1IA 1LZKA 1CUXA 2G4LA 5C8XA 3HYSA 1ZJ4A 3O4HA 4UHEA 1H23A 1VXRA 3PI6A 5LIPA 4GLBA 2CBGA 2DCMA 2CMFA 1WM1A 2ZYHA 2YH2A 1XFDA 5BOVA 3H2HA 1Y7HA 4A16A 2C0PA 2HA3A 3AJAA 4K5QA 3UMJA 2GYUA 5SYNA 2XUDA 4XWGA 4TPKA 1XLUA 5CT6A 1RP1A 4Q05A 5FV4A 1CUHA 2C7BA 3CN9A 3R3WA 2FX5A 3G0IA 5KBYA 3PF8A 5AKXA 3STYA 3QMMA 5DWDA 1H2YA 4QLAA 4BDTA 3G0GA 4N8EA 5BWCA 4K2AA 2WILA 3WYDA 4Y7DA 5KWJA 1VOTA 2ZYIA 1XZKA 3AINA 1XQXA 1P0QA 1XQVA 1ZIYA 5HZGA 2PVSA 4WFKA 3X3HA 2WIJA 5JZSA 2XE4A 5AKJA 3ESBA 1A8SA 4QDOA 2JGFA 1IVYA 3MVEA 4EY4A 2I3ZA 4X00A 4KEAA 3BL8A 5IVKA 5DYYA 1CUBA 1DT5A 1QIMA 4C4YA 5JANA 3R3ZA 2UZ0A 1DTEA 1LZLA 4QWMA 2FJ0A 4OSEA 3DL4A 5FPQA 3CCBA 4ETWA 4FFWA 1NX9A 2Z8ZA 1UWCA 3I6YA 3G02A 5JZ9A 2B4KA 5HKAA 1XQYA 2PL5A 4PF1A 2FUKA 1P0PA 2P8SA 4UFOA 2PSDA 4JYPA 3AIOA 5AK3A 1ZD4A 5EFZA 5DNWA 1EHYA 3JYHA 5AKHA 2I3DA 5ALNA 1FFBA 1ACJA 4KE8A 4BE4A 4I3FA 4RE6A 4C88A 1L7RA 2XDWA 5AI5A 1SCIA 3WL8A 1U8EA 4HXFB 1MPXA 2HA7A 4G5XA 1UZAA 3LP5A 1Q0ZA 3O4GA 1QIIA 1O6GA 4N8DA 3HXKA 5AM3A 5FPPA 5JAOA 3I6ZA 4K6GA 5AP9A 1HL7A 3TEJA 1BN7A 1W52X 4K6HA 3L1IA 1MU0A 3H2GA 3PICA 3OG9A 3UUEA 1RWQA 1SCKA 1XKLA 4CG1A 2VJBA 2RI6A 4Y2XA 4F0JA 5AI4A 2OCKA 3N2ZB 3K6KA 1YAHA 3FSGA 4B6GA 1LLFA 1P0IA 5EHXA 1CUIA 1DU4A 4U2GA 1HKHA 3C8DA 3TRDA 1USWA 5YASA 1ODSA 3W04A 4BC0A 5ALSA 1QIJA 3C87A 1ODCA 3FNBA 4H35A 1OXMA 4E14A 2Y2UA 3HRHA 1N5MA 3I2HA 2VA9A 2VQ6A 1YAJA 2CEKA 4Y2VA 4DMFA 5HFNA 2VAVA 3WA7A 1ORVA 3WL7A 4G9GA 5CRIA 3NWOA 3IVMA 2OCGA 1R1DA 5JAPA 1JU4A 3I6MA 2ECFA 4EA6A 4XVCA 2XUJA 4X90A 1GQRA 4N8SA 3KWFA 1DWPA 3FYTA 3GELA 4DM7A 3SX4A 1LPBB 1QTIA 3WWOA 1QIGA 3FVTA 1E66A 3KWJA 3T52A 1Q0RA 1F8UA 3K2IA 3NOXA 2XMRA 4G4IA 4X6UA 3ILSA 2C58A 3V9AA 5JAUA 2YASA 4GXNA 3STXA 2WU4A 1JMKC 5T4EA 1XRPA 1GKLA 5AKGA 3G0CA 2JGLA 3R3XA 5JARA 2JGJA 1Q83A 4XIIA 1XRMA 3HSSA 4N5IX 5LZ5A 2QOEA 2XQJA 4G8BA 3BWXA 4KE7A 3F8SA 4ZRDA 1E3QA 1CUUA 5ALWA 5AM1A 2G5TA 2BKLA 3QM1A 3LS2A 5JADA 1XZIA 5JYCA 3A2LA 1XQWA 3ICWA 2GBGA 1T4MA 1MX1A 4HRXA 3G8YA 3ED1A 4HAIA 1THGA 5EIAA 3STVA 4H0CA 2DQYA 3A70A 2RGUA 3FBWA 1JJBA 1QFSA 4GDMA 1ZI8A 4WFJA 4AB1A 3ZPXA 1H2ZA 5DYTA 4UBMA 4AN0A 2H9YA 1X2BA 3DLTA 2OGSA 2J3QA 3PF9A 3TGLA 2VTVA 2Z3ZA 2K2QB 5A7HA 4PW0A 5EGNA 3YASA 3JW8A 5I8PA 4P93A 5J3JA 5AKZA 3HJUA 3WWDA 4DNOA 3I2KA 4D9JA 4CCYB 2QZPA 2ES4A 2DSNA 1N8SA 1CR6A 5AJHA 3VVLA 1JT2A 1XZJA 1BEEA 2ACKA 4P08A 4OU5A 2VJCA 5CURA 5LZ4A 2VT7A 4Q3LA 1WCYA 5KREA 4K6KA 1MO2A 1TK3A 4X94A 1C4XA 3FAKA 1EDDA 4X3CA 4HXGA 3O9MA 1X70A 2QKYA 3E0XA 2HFJA 1MNQA 4OB7A 1JU3A 5ALEA 1MNAA 5AM5A 4E11A 1CUCA 1SC9A 2WM2A 3BIWA 3FLAA 1E8MA 4JUIA 3FLEA 3FSGD 3QMWA 4UHFA 2CZQA 1W75A 2W22A 1HBJA 4BCCA 1K8QA 4FKBA 3ANSA 1CUSA 3QITA 1JFRA 4X95A 4FFVA 4B9AA 2WIKA 4UUQA 2WUFA 2GBFA 3B3QA 5FOQA 2JGKA 2WHPB 3H17A 4QWWA 4PV7A 5LKRA 5DTJA 4L0CA 1OCEA 5AOAA 4EBBA 4DNQA 4H7KA 4J3JA 4J03A 1TCCA 5HKBA 3AZPA 4PNZA 2VATA 2O7RA 2XMZA 2V96A 5A7FA 1GPKA 2XUKA 5LP1A 5A6VA 5D3ZA 3RK4A 3V1LA 3STWA 3E3AA 1GPLA 3K9BA 4ZWNA 4ROTA 5CH5A 3H2IA 5JD6A 6YASA 1QGED 1J2EA 2QUBA 3G0DA 2WIGA 2GYVA 4X6YA 5C81A 3I2JA 1L7AA 1CQZA 2PSJA 4PSDA 5K3EA 3D4LA 2WTMA 4UBIA 4LYEA 1ZIXA 3EQ9A 3OM8A 4M0FA 3RKSA 4U2CA 5IH7A 3HC7A 1LGYA 4J0KA 4WJLA 2AJ8A 3CCCA 4H7EA 4OYLA 2JEYA 4ZREA 2HRRA 3I2IA 4C87A 3FYUB 1DX4A 4ITVA 4EHBA 4UBOA 4G8CA 2C4HA 4W1QA 2GBCA 3C8HA 1AZWA 4AZ0A 3VJLA 3DD5A 3FWHA 2H7YA 2DHCA 4P92A 1AKNA 1A7UA 1KEZA 5T4FA 5JALA 5EHNA 2GBIA 4LXIA 3WL5A 4BTVA 4DNFA 1ZD2P 1MJ5A 3LCRA 3WKBA 4UBKA 1GPNA 4MYSA 3TJMA 1TQHA 3GUUA 2BUAA 1R9NA 3D2CA 3H18A 3I1YA 4ZGBA 3I2GA 2AJBA 1A8UA 5HQ3A 4L9AA 5LLSA 3BF7A 1U65A 1JKMA 5LYYA 5ALFA 2OG1A 4RGYA 4EUSA 2GYWA 3MUOA 4Y9SA 1JMYA 3PUHA 2DQZA 1F0PA 5CXXA 2WG2A 3KSRA 5ALPA 1YCDA 4PQEA 1CUDA 4BAUA 2WFLB 4BAZA 3BJMA 5CH3A 5K3CA 3ZLUA 2V97A 1H2XA 4TVKA 4BB0A 3ESCA 3WZLA 4AXBA 2X5XA 4DGQA 3PE6A 4RNCA 5JASA 3WK9A 3C45A 2ZSIA 5AH0A 5ALHA 1DQZA 4XJVA 2VEOA 4X97A 2WG1A 1CUGA 3QMVA 3BF8A 4H7FA 1QIFA 4AMZA 4CIBA 3RLIA 2R11A 3DCNA 1EX9A 1GQSA 3D5EA 1K5PA 4IH1A 1TKRA 2HL6A 5ALLA 4BC1A 3PUIA 1G66A 3FYUC 1EDBA 1U4NA 3WJ1A 2WHRA 4JNCA 5HF8A 4KRYA 1QIHA 1YS2X 3VVMA 2PUHA 4PO3X 2HFKA 3CXUA 4Y2QA 2O7VA 3R40A 4IO0A 4KAFA 4DYHA 3KOOA 1XRRA 3A2MA 5F4ZA 5HF9A 1UOQA 2XMSA 3Q8WA 2X8BA 2HU8A 4FLEA 1WB4A 2RAUA 2WG0A 3AFIA 3ESAA 3IUNA 4UHCA 1EH5A 1AMNA 2BJHA 2VT6A 1JJFA 4X6XA 1K6EA 4WCVA 4XX1A 3DL7A 4Y2YA 2WJ6A 5JAHA 3NGMA 3NUZA 3E4DA 3VJMA 1G42A 1BE0A 2XQFA 2YXPX 1VE6A 1A88A 2HA6A 1K4YA 4BVKA 2OGZA 3IULA 1LPMA 4QLOA 2AJCA 1CPYA 1CUFA 3BDIA 1CVLA 1DWQA 4OYYA 2OPHA 4QDZA 1IMJA 4QEKA 5AK5A 4UBNA 3G0BA 2QMQA 1EB8A 1XRQA 3M83A 1PJAA 3VKFA 4OB8A 1B41A 5AM2A 3W9BA 3AILA 5ALMA 3C5VA 4BP9A 2OQIA 4KYVA 2AJLI 4HTAA 3DDUA 2I03A 5BV7A 3WK7A 2HADA 4KRXA 5A7GA 3AIKA 5E4YA 1ZJ5A 2EDCA 5EHZA 3R3VA 2DHEA 1H22A 1EK2A 3G9UA 5HF5A 1KU0A 3UUFA 3H0CA 2XUPA 3WK8A 3IIIA 4IQ4A 3FCYA 2PKYX 1J06A 5AHXA 5AKIA 1YSCA 3A6ZA 1UOOA 4QDUA 3HEAA 5IVHA 5LZ9A 1ODTC 1VKHA 2HA0A 2QXTA 5JD4A 1E8DA 1YB6A 4L3WA 1QFMA 3FCXA 5JZBA 4MXDA 4G1FA 5DJ5A 1IZ7A 2LIPA 1Y37A 2WUDA 2IIVA 2XQGA 3O4IA 1HLGA 4MWSA 1XKTA 2G5PA 1EXWA 3EIOA 1LBTA 1QO9A 5DLPA 3BIXA 3OOSA 5FRDA 4BRZA 4C01A 4UHHA 2HA4A 1DINA 2PSFA 4G9EA 3ESDA 4MWTA 2Z3WA 5EI5A 1TCAA 2J4CA 3WQHA 1PFQA 1QIEA 4YPVA 2XUOA 4J0HA 2OAEA 4BDSA 1VZ3A 4YASA 2Z5GA 1L7QA 4BBZA 3EBLA 2ROQA 3H2KA 3KD2A 4OU4A 1CUYA 1ZD5A 4JEIA 3ICVA 2XLBA 3WK6A 3W05A 4EY6A 1ACLA 4H7JA 3QH4A 1YS1X 2BCEA 4OCZA 4AO7A 1CRLA 2C0QA 3OC0A 4KAJA 1LPPA 1GKKA 4MYDA 2OCIA 2E3JA 2WFLA 4WFIA 3R41A 3D7RA 5E2IA 1FSSA 4HVTA 2GZRA 4NS4A 4EY5A 5LZ7A 4LXHA 3WWEA 2PM8A 3FOBA 2EEPA 4GHWA 3C6XA 4GECA 4Q3KA 2XB6A 4GW3A 1OILA 1VZ2A 1MAHA 1MTZA 4PSUA 5CXUA 5ALJA 1MN6A 5AM4A 1E5TA 5JIBA 4KE9A 1EVEA 3QYJA 3P2MA 4G8DA 2WSLA 4DMHA 4X92A 1W1IA 3HLKA 1WB5A 3O9VA 4CI9A 4DSZA 5ALDA 1CUZA 1TCBA 3D0KA 4EZIA 4M0EA 1CUWA 4LHEA 1QONA 2H7CA 1YA4A 4KE6A 1UFOA 3HI4A 2Z8XA 4C4XA 3FLBA 3WIBA 1R3DA 4UFPA 3F96A 4BRSA 1PV1A 1E8NA 3GROA 3U0VA 3HZOA 3F98A 4OB6A 5AO9A 4Q82A 2HM7A 4MJ3A 4WDQA 4B85A 4B0PA 4CG3A 5DYWA 4I19A 1GXSA 2X76A 5EIHA 1GZ7A 4Y2SA 3KDAA 3AUKA 4Z49A 2ZYRA 3WMRA 2WHQA 3AIMA 4FBLA 3F67A 5ESRA 2PBLA 1QLWA 1XZMA 2ZJ6A 4FMPA 4H77A 1HDEA 1LNSA 3VXKA 3C6YA 4J0JA 1ZGCA 2WUEA 3F97A 2XMBA 3WK4A 4MQLA 4WY8A 4DMCA 3SK0A 2HRQA 3IDAA 2VJAA 1TIBA 1XROA 5ALYA 4FNMA 5AKKA 2WHPA 2JF0A 5AIBA 4Q3OA 2CB9A 2XLCA 5AOBA 3RM3A 3LLCA 2BUCA 1EA5A 1XRLA 1WOMA 4CG2A 4B0OA 5FKJA 1RYYA 4BATA 4BCDA 4ZV9A 3BJRA 1XLWA 4C89A 1GGVA 1EB9A 2PSEA 2WJ4A 4MEAA 3E1GA 4UFNA 2IITA 4F21A 2OXEA 1CLEA 2J3DA 4QA9A 4U2EA 1J1IA 4NZZA 4FTWA 1UOPA 3WIOA 4V2IA 2HA2A 4O08A 5AK6A 1G5FA 2CKMA 4QZVA 4DNPA 5SYMA 3W9UA 2Q0XA 3WWPA 4H7IA 1YA8A 4J0GA 5I9IA 2JGEA 1CV2A 4YK7A 5CW2A 2JGMA 3OURA 1LPSA 3IUMA 3M82A 1BU8A 2WTNA 3V48A 1R88A 3H2JA 4DIUA 1AX9A 2FJPA 2HU7A 3WKDA 4DSAA 1UKBA 4KAAA 2RHTA 2QM0A 5HK9A 4A5SA 4AX4A 2QJRA 1CFJA 4Y2UA 3M3DA 1QIDA 4HZGA 4AN1A 1LPOA 4LKOA 3IUQA 3VJKA 1U2EA 2XQIA 3PDCA 2NW6A 5EHQA 3WYNA 2QUAA 4KJXA 4B82A 3G9ZA 5KWIA 4HS9A 5HCUA 2AJDA 1Z68A 1R50A 2PX6A 3OPMA 4DMKA 2HHAA 5ALOA 5C8VA 2O2HA 2WLSA 5IVDA 2V9ZA 2WKWA 5LZ8A 1J07A 1ZGBA 1ZI9A 1AURA 2IX9A 4FNGA 1WB6A 1XLVA 3DNMA 5H3HA 2DR0A 1ORWA 4ARAA 3MUNA 1CQWA 1FFAA 3CN7A 3M81A 2B20A 3O95A 3Q0TA 1AC5A 4W1PA 3DS8A 2QXUA 4B7ZA 5I7UA 3ZWQA 4EB0A 1XZGA 3L1JA 4MQMA 4UHBA 4UHDA 1CUAA 2GZSA 2G63A 2W6CX 2R8BA 1CUVA 2WIDA 4J0IA 5ALRA 1IUPA 3WI7A 1DWOA 4BTLA 3DJYA 3PFCA 2ZJ7A 1XZHA 4QNNA 4B84A 1UK8A 2HIHA 4B81A 4B9EA 4FOLA 5ALGA 1EI9A 4JYMA 1THTA 4Q1VA 2AXEA 1FJ2A 4X71A 2D0DA 5K3AA 3QBJA 4M0MA 3I2FA 4BZWA 3H1AA 5EIEA 5CMLA 3EF3A 1QIKA 2RONA 5C7YA 1F6WA 1ZOIA 1CEXA 4EY8A 4FHZA 1SCQA 4BVJA 4U2BA 4X91A 2BGNA 2ZVDA 2VAXA 4AQDA 4U2DA 5D3KA 3I28A 1EDEA 1E89A 1F0NA 4E46A 5CTAA 2WUGA 5HF6A 3DOIA 1EK1A 3ZLTA 2XMDA 2WJ3A 1K63A 1CUEA 3DYVA 1D07A 5AIAA 1UK7A 2J4FA 2DFPA 1BRTA 4KR0A 4CIAA 1FFCA 5HK8A 3GBSA 3STTA 1VLQA 4F5ZA 4Q34A 4GWLA 4X93A 1JI3A 1R9MA 1Q84A 3HACA 2BAGA 2BUBA 4J0CA 5LZ2A 1S8OA 5A2GA 4ZXFA 3WKEA 5K3FB 1NU8A 1XRNA 1QE3A 4OD0A 1VA4A 4H18A 3FVRA 2PU7A 3WA6A 4Y2RA 2WU3A 4W9RA 3W2TA 3EQ7A 4BYMA 2VJDA 1AGYA 1BN6A 2WQZA 4AO8A 1XZBA 2QS9A 3I1IA 2C5FA 4FBMA 3C5WP 2XMQA 2XT0A 3AZQA 5CH8A 4F60A 4P9NA 2WIFA 3WJ2A 3BDVA 4BZZA 1UK9A 1UK6A 2OGTA 1DQYA 5ALVA 3IUJA 1XZCA 3GFFA 4L72A 3ZI7A 2PSHA 3R3YA 4FLMA 3IBTA 4OUKX 3L1HA 3O0DA 1UXOA 2VF2A 4BVLA 1WHSA 1LPAB 1C7JA 1SFRA 3D2BA 1HPLA 2JIDA 1XZEA 3PFBA 4HRYA 1N5RA 5AI6A 4BE9A 5FDFA 4IH9A 2XMGA 2Y2VA 3V1NA 5ALTA 1TAHA 2HA5A 2ZJFA 5IVIA 5FUMA 3H1BA 2HU5A 4ARBA 2ZYSA 1WHTA 3EQ8A 1QOZA 4Y2PA 4BP8A 2XUGA 2D5LA 3QPCA 4YX9A 5A62A 5D7BA 4B80A 5K3DA 1ETHA 2HDWA 4WY5A 3MGAA 4AZ3A 5JATA 1UT6A 4ZI5A 2WFMA 5IKXA 5HQ3B 5T4HA 1CUJA 2QTBA 2PUJA 1XZAA 4WDRA 2BFNA 1BROA 2DHDA 1WPXA 2BGRA 4Y2JA 4H7DA 2Y1KA 4UBJA 3R0VA 3D2AA 3V1KA 3DKRA 3SC2A 1CIJA 1I6WA 4HXEB 1IZ8A 1DT3A 1XZLA 1YR2A 3G9XA 1QO7A 1GT6A 1ZI6A 4G4GA 4DLNA 3DYIA 4C4ZA 3H19A 5ISMA 3IURA 4I4CA 3WK5A 1IUOA 3B5EA 2XUQA 1LBSA 1BS9A 5DTIA 4NVRA 3ANTA 1YB7A 5JD5A 1X2EA 4UBLA 4X7BA 3DQZA 4LXGA 2XI4A 1MX9A 3F9CA 3O4JA 4LIPD 3G7NA 2XUAA 3KXPA 5T4BA 2B61A 2XUHA 4G4JA 2H7XA 4KACA 4S0XA 1A8QA 2CUTA 1AQLA 2XMCA 1KU6A 4J7AA 2ZSHA 5ALIA 1XZDA 1T2NA 2EDAA 1MT3A 4CCYA 4X85A 3R3UA 5AM0A 1EINA 3WKAA 1UKCA 3D3NA 2Y6UA 1VXOA 4QE3A 4GI1A 5E4TA 1MX5A 3H04A 4GEGA 4EY7A 3QPDA 4AO6A 2OQVA 2RHWA 4NMWA 1IUNA 3AZOA 5ALUA 3BE8A 3VISA 3WWCA 1VE7A 1QZ3A 1DX6A 3ZV7A 4IH4A 4INZA 1FFDA 4FDMA 5BWBA 4AMYA 2XQKA 4CCWA 5AI0A 3GA7A 5AKEA 4E15A 2V98A 1HQDA 2WFZA 3DEAA 3JWEA 1ISPA 5K3BA 1AUOA 1WPRA 3S2ZA 5ALXA 5AI9A 1XZFA 4BCBA 4W1SA 2QRUA 3U1TA 2OLEA 2QJWA 3T4UA 5FP0A 1TRHA 4A23A 2PPLA 4TGLA 2XUFA 5C8ZA 3OTQA 3BXPA 3C6ZA 1Y7IA 5HFAA 5K5EA 3WLAA 1QTRA 1H2WA 2CJPA 1W4LA 5CT5A 5DNUA 2B9VA 5CT9A 1BEZA 4C6HA 3B12A 1G4HA 1JJIA 1EVQA 2JEZA 3QPAA 5K3FA 3A2NA 1R4ZA 3C6BA 5AKYA 3QVMA 4RPCA 4RE5A 3IA2A 3FYUA 3LIPA 2I78A 3ZLVA 5AKLA 2Y6VA 4FLFA 4N5HX 2VSQA 3WZMA 4FWBA 5D6OA 2ONCA 5AICA 5DNVA 5CT8A 5CT4A 1M33A 1BCSA 1ZICA 4Y2TA 1O6FA 3QZUA 5ALKA 3G9TA 2OCLA 3IB3A 3V1MA 3VDXA 2C5GA 1VA5A 1N1MA 4B83A 5AI8A 3N0TA 2ORYA 1UKAA 1NU6A 5ALZA 1QJ4A 5CBKA 4W63A 1BCRA 3S8YA 4QDXA 1SOMA 1C7IA 5A71A 4BAGA 3W06A 3WKCA 3STUA 1ZD3A 4MEBA 3DOHA 4J0DA 2YYSA
chains in the Genus database with same CATH superfamily
1I0LA 4UKDA 5HM8A 2ACEA 3DVAB 1JB9A 1R4AA 3E9DA 2Z57A 2ZRNA 3LC2O 1KH1A 4K9RA 4OQLA 2HRZA 3U3KA 1ZGJA 2DJIA 3PUZA 1G8PA 3Q7TA 4R2IA 4YJ2B 4B4KA 1KFKB 1U1EA 1DRJA 1A8HA 4YCDA 2ONKA 1SZPA 1RW4A 4ZCTA 5D87A 3H0EA 4EB8A 1EXDA 2BGGA 3K5HA 2A33A 4PN3A 1NXWA 4URUR 1W0KD 1QYCA 2HNBA 3UJPA 2K2WA 2AFHE 3NKVA 5E7MA 3SXJA 4C14A 3U4IA 1RJFA 4G0ZA 4BUCA 4A6PA 4EGJA 4DLBA 3FUXA 4YCSA 2CXPA 1VJ5A 2VK2A 1FX0A 3SSMA 4M1TA 2JLXA 5TX7A 3CW2A 2HRBA 2P6MA 2WJGA 3NBYC 2QTMA 1DB3A 2PU5A 1Q7BA 3IQFA 2GXSA 4U2FA 3U7JA 1DFGA 3DO5A 3R7AA 2P5YA 3GLGE 3VPGA 5D5QA 1NBAA 4JV5B 3PEVA 2VLIA 1R4MA 1IY0A 2QR5A 1E1QD 4P3OA 2QT9A 3LZDA 4QYXA 3G79A 1B6GA 3C6QA 1QGAA 4ENWA 2FFQA 2HREA 4X8LA 5B1EA 4EHLA 1UDCA 5KYGA 3N05A 3MS4A 4QDTA 5TQVA 1H8EA 1U0JA 4D3ZA 4M8LA 4HEJA 3KVOA 5K0FA 3IKVA 4B6EA 1ZZEA 4MV4A 3LA6A 3WBFA 4QSHA 3S0JA 3PDIB 3GLSA 5FLKA 4EYOA 4F6RA 2FDCA 2D1YA 1YASA 3ZVNA 2DCUA 2XTJA 3DR3A 4OH1A 3FWNA 1OASA 2RIPA 3EWNA 4KZPA 7REQB 3WL6A 3DUWA 3AI7A 3LCJA 1U90A 3IIMA 3PSAA 4PZ9A 5CB4F 1JAHA 4PLGA 2IXFA 1D5CA 2G4LA 3INNA 5C8XA 1H2HA 5K0GA 3T7SA 2JLZA 2YS7A 2ZJ5A 1UQRA 3O4HA 1IOLA 3Q85A 4M9UA 4GP9A 5G0SA 4KQKA 4UHEA 5JSZB 4L4ZA 2GKGA 4FHFA 1T91A 4K3UA 5KKNB 5CVJA 2IS1A 3MS2A 3TI7A 4F91B 4PGGA 3ZJ5A 4CT5A 3P4YA 3NP7A 2EWVA 2DCMA 4QOSA 1U2DC 3RIEA 3T0GA 2CMFA 5TMEA 2QIOA 1NKVA 5FWDA 1R0WA 5JJKA 3QK7A 2E5LB 3VR5H 1A9OA 4PZEA 5BOVA 1J7KA 1EWTA 1CP2A 1G2PA 5IFLA 1W5AA 3E8MA 4OQPA 1TYCA 4A16A 5AVUA 3K09A 1YB1A 1JIVA 2HKIA 3GJSA 4Q7MB 4NBNA 5TGTA 2RGDA 3B1VA 1PUXA 3UMJA 4DYVA 2IELA 1S2IA 2ONYA 4ENTA 3EZYA 2GXAA 3A2KA 1Z16A 3CY6A 4PFQA 4BQSA 2H5JA 3G2HA 5CT6A 1C3OA 1RP1A 4MO9A 4Q05A 5FV4A 3ZJUA 4H16A 4YECA 2C7BA 3QYAA 2EJCA 3LQ2A 4QU5A 3WGGA 2HYIC 2FX5A 3B9PA 1CQIB 1RAGA 1KI8A 1AF4A 3G0IA 4PM4A 4RVNA 4X61A 1XHEA 2X4LA 4BWFB 4DN6A 2JIQA 2PTGA 1AK1A 4U7JA 1EFUA 3T3DA 1WD5A 3QFFA 1CRZA 1LF0A 1T4DA 1T5SA 2WMYA 3BIFA 5JMPA 2DUMA 3G0GA 3CNEA 3NIDB 1O2DA 4P3NA 5HFJA 1W5SA 5BUZA 4EKGA 1Z8FA 2VP2A 1RVV1 2OL4A 2PJUA 4K2AA 4UUOA 3WYDA 4Q7EA 1LFDB 3LRPA 1MAVA 1G291 4Q24A 2MSKA 2FZKA 1VOTA 2UXCB 3C4JA 4YN3A 2A9OA 5CHYA 5A9SA 4DRXA 4PCAA 1WBDA 4A0SA 4WNAA 3A1CA 1FYDA 4GQAA 2AFHA 4FGKA 1DP4A 3GGGA 1GLGA 1F8XA 3Q12A 4UNPA 5T5QA 1ISRA 4OHZA 3M4NA 5AW8A 5KYKA 1ORTA 2WIJA 4WCFB 5EFOA 1E1RD 4YR7A 4N0EA 1OHHD 5G4KA 1I51A 2XE4A 4EWLA 2J3MA 1O4WA 1QHGA 3JSXA 1RSZA 1OV4A 1UC8A 3ESBA 4R9VA 1A8SA 1MJGM 4X7PA 2NV0A 1UPBA 3LHIA 1Z0ZA 3LA8A 4V0OA 5IBQA 2KWIA 3MVEA 2KYRA 2I3ZA 3QGMA 3VBEA 4A9AA 1VMKA 2MMGA 5E38A 4BVAA 5JS6A 2JK1A 5K0SA 2G1AA 4MWEA 3NXSA 5JXGA 3SHQA 4HLNA 3E9ZA 1ZR4A 1K8YB 3HBLA 3NHBA 2G71A 3BL8A 1M2EA 4Q7KA 5EUBA 4KMOA 1WXWA 5DIFA 4B45A 1QIMA 1AUPA 2IK8A 4NU8X 5COBA 2X4DA 3RJZA 1OLSB 4RF5A 2H52A 3GR6A 4UEQA 4E2WA 4YJHB 2UZ0A 3I9LA 1TMYA 1DCTA 5D3QA 3SXUA 1KXZA 5ERYA 3WB2A 1XNRB 5FTMA 2V6FA 1JYEA 4OLJA 4OSEA 5FPQA 4F85A 1H6AA 1TMOA 4NHOA 4QEDA 3T8YA 4ETWA 4Z8XA 4LF5B 4IG9A 2XNHA 2Q5LA 2WJVA 3JASA 3SF0A 2NV6A 1C9NA 3DKVA 3IP9A 4FFWA 3M6FA 4Q16A 1NX9A 1KQFA 4CGZA 2HQOA 4TKZA 2WJAA 2HNKA 3OWXA 1V2HE 1T9KA 2FSUA 2AN5A 1NDUA 2OAP1 3UAOA 3NV7A 1QXSA 3HG7A 3ZVLA 2ZB3A 3RSCA 2JC3A 4XRRA 2PL5A 4PF1A 4A3SA 1LC3A 4JYPA 4CPDA 2BEWB 2YQZA 2J4DA 2PH3A 3AIOA 3BH7A 3RUAA 1ZD4A 5EFZA 3JYHA 1TTHA 1GTSA 3D3JA 1TVEA 3VMFA 4WACA 4GMKA 4RESA 3T3GA 3BGVA 1LVUA 1TJNA 4I55A 1DAFA 4MQEB 4UCWA 1S3IA 1Q11A 4YWHA 1EDOA 1JLHA 3RH0A 3CR7A 3CIFA 2XSZA 2CHUA 1L7RA 1VSQA 2QPLA 1GRRA 3ICCA 4N39A 2H65A 3MWDA 2X9LA 3CF2A 3QVWA 1HNNA 3OTWA 5AI5A 3KR9A 2ST1A 3TKLA 3ZDZB 1EAYA 3O8OA 2ZG6A 4LF6B 1U8EA 2QM8A 4D4IA 5FTJA 4ARIA 4IZHA 3G2LA 2NZ2A 3ZHRA 2B8JA 5LQRA 1T34A 2MTBA 1P9LA 3TQIA 3LYLA 2EFEB 3LP5A 4G5XA 4TMFA 1Q0ZA 3RTBA 3IAM1 1G20E 1WTCA 2CFOA 3E2PA 3RRXA 1ZGAA 4I9NA 3K6SB 1O6GA 1E6EA 5FPPA 1IAQA 3BD7A 3DL0A 4R2HA 3W3ZB 2IPXA 1BJTA 4URWR 3TMYA 2XYVA 4DLSA 1RCTE 1X1EA 3O5AA 1IXKA 3PUVA 1NW7A 3K3PA 4L6AA 1X77A 2I1LA 1FS6A 3G1TA 4Z9AA 1RIIA 4RUKA 5C3MA 3AX6A 3R09A 3GGPA 2A30A 4K6HA 3T5AA 3CWZA 1E64A 1TM3E 5E7IA 2FCRA 4MCJA 1V11B 3ENWA 2PGAA 5EXSA 3W3AD 1JVNA 2WJPA 3AEQA 5AK0A 1X15A 3OMXA 4NDZA 1Y1LA 3PICA 4P6VF 3RRZA 1RWQA 2RH5A 3KQPA 5A4KA 2PZ8A 3HKBB 2GZDA 4P35A 4L22A 1N33B 1VLMA 2FG7C 3OUUA 2ZJYA 4RS3A 5GVRA 1RDFA 4YUVA 3R8CA 4F0JA 3V7FA 3N2ZB 4PG8A 3THXA 3EAGA 4RV4A 4OO3A 1CZHA 3X44A 4XDZA 4XCVA 4G89A 1YAHA 3I4LA 2CUNA 1V47A 4OQFA 2DG2A 3UHFA 4O3FA 1USIA 5KYUA 4B6GA 3ZR4B 3BICA 2CK3A 5AW3A 1ZN2A 3OPXA 3C8DA 1TQ6A 2AOTB 3HJAA 1Q44A 4L7QA 2H2AA 5YASA 3TMKA 3U9LA 1UBTS 2YOFA 3KTAA 4A8PA 3GA0A 4PRZA 1JHAA 3W04A 1HE8B 4EY3A 4F93B 5ALSA 1QIJA 2QEQA 1CRPA 1RLOA 2JATA 5D86A 1OXMA 3CT4A 2R3SA 1BXGB 3CKLA 2PK3A 3UN1A 3L5KA 1D1QA 1EFAA 2HR1A 2X6RA 1OFVA 1V8FA 1FK8A 2E5FA 3LO8A 4UATA 3WMWA 4JWTA 3ZE9A 4MQBA 1L7NA 1V6AA 2CDNA 5LMCA 3I2HA 1NW3A 1E1QA 1U2TA 3M6IA 4GI3A 5EMNA 4BO4A 1YAJA 1M2GA 1T35A 2G06A 2GZ3A 4RK7A 4Y2VA 4HLUC 1YJCA 2XMPA 2XTNA 1ORVA 5H3LA 4O4LF 5HFNA 3ZQJA 1TTTA 3LWBA 3RNLA 1J5PA 2OUIA 3NWOA 3KELA 3KOUA 2ZCJA 3QBTA 3IJ5A 1EX6A 4AZTA 1R1DA 4I50A 4DCVA 2ZANA 2X0NA 2O3TA 1JU4A 4O4HB 2H51A 4KYUA 3HUUA 3SDZA 1OVGA 1ZG3A 3R5FA 2ECFA 3OECA 1WU8A 3SJZA 1SHJA 2ZKIA 3DW3X 4FM9A 4N8SA 2VQDA 2FW9A 3MBKA 3X1WA 2VDOB 5A6SB 1NP6A 3FSJX 3UY4A 4F96A 1XI2A 3PFKA 2Q5OA 2GF0A 4LPSA 3WQBA 3SX4A 3GLIE 4JS0A 4Q9AA 5B64A 3TW8B 4WVFA 2BHLA 1UT5A 2QLLA 3JD3A 1V1MA 4O1MA 5HXAA 2B2NA 3EGXA 3WWOA 4TYYA 4FYXA 2GBPA 1ZOOA 5AFSA 3ETGA 5JPIA 3KWJA 4ENRA 3TLGA 4PBTA 1FDUA 5G1OA 2OZKA 3LCUA 1D1PA 4D0NA 2BGTA 3HMKA 1GUFA 2I8AA 5DHRA 1Z5UA 1YGPA 5IH3A 1OLSA 3K2QA 3B38A 2EBUA 4J1QA 3TGPA 1REQA 2GN6A 4D97A 4X6UA 3V9AA 2C58A 1BC5A 3L6EA 2ZSDA 2LKCA 3PITA 3JS5A 4FEAA 4E5PA 2HJHA 1XRPA 1YIDA 1TRKA 2PEZA 3A3OA 4XQCA 5CDFE 5J4KA 5FTWA 3UWMA 1NIJA 3G0CA 1IHPA 5FUXA 3RVOA 4CEJA 1WXHA 2JGLA 3QQ5A 3B9RA 3MF4A 2ZATA 2P27A 1GZUA 4I6EA 1VHWA 3I2YX 5BSMA 1AGRA 4GRAA 4F5DA 1SIOA 3WZ2A 4MV0A 2I7CA 1HR0B 3I9KA 3KKPA 1I4EB 4EJSC 1UMKA 1Z7EA 4BNFA 5LUAA 1T13A 1KO1A 1XTBA 4YMHA 2QOEA 4XYEA 2RGNA 3QFHA 1DKOA 1A71A 1UZUA 2HMAA 2QJOA 4AT1A 1JHYA 3ZGYA 2F67A 1BKDR 1F17A 3LBIA 3F8SA 3P9XA 4JXZA 5B30A 2XKJE 4PTZA 1ZCBA 2I6GA 3IIKA 5AM1A 2O52A 2PQ0A 5DHTA 3OLVA 4R8RA 1WXGA 2BGIA 5DBIA 3K5PA 3QM1A 4F97A 5L3SB 1ENZA 4MEJA 1U9ZA 3CUTA 4Y0NA 1SZCA 3U4GA 2PS0A 3VSBA 2P3OA 3ZUGA 1H2FA 5JW6A 2RHMA 4FYVA 5FNVF 5LU8A 1XQWA 1U6KA 3OHPA 2R1UA 4N03A 4PZCA 3MTQA 3GD7A 1RNLA 3NCHA 1NUTA 4TLCA 2J9GA 3L7NA 4TMVA 1NFFA 4BLQA 3DMPA 1M67A 4FC6A 4LWZA 1VDMA 4KPEC 2I3BA 1E4YA 3IKTA 2O7SA 3JAKA 4TVSA 4ZA2A 4KQFA 2HYDA 4BFUA 5BN1A 3KOMA 2BDUA 1V5EA 2AG1A 4DQKA 3FBWA 1RC1A 3QOWA 2PE5A 2SKEA 2AC2A 4JX8A 1XNQB 2QQEA 4DQLA 1N6OA 2WZBA 4UQOA 1J09A 1ODIA 5IDYA 3W0LB 1JHQA 2VP3A 5C4IA 3VSEA 1C3VA 4LGCA 3BK1A 4WFJA 5I7HA 2XCUA 2WA1A 1OBFO 4KR6A 3H8VA 3R2JA 1GY8A 4IL5A 4DV6B 4F3TA 5L4SA 1VLZA 3IAHA 1OOEA 3L18A 4I1UA 4JOCA 3THXB 1JFVA 3W8NA 2FOLA 2OGSA 1KS9A 3DBHB 4LTDA 2CVFA 2J3QA 3H05A 1J1ZA 2JD1A 3MTDA 3EN0A 3TGLA 2G83A 4PG6A 5FFNA 5BW5A 5KHOC 2HGSA 1ML4A 2CLFB 4B6JA 5JQGA 1PZEA 2C2MA 1P4RA 2I4IA 1F3OA 3O73A 3A9CA 2ZDGA 4QHTA 4ZU1X 3SC2B 3CSUA 5A7HA 2QSYA 4HLQB 4DSOA 3H75A 4QASA 5K7SA 2C96A 1P8AA 1RBZA 4HI0E 4RLQA 1C0KA 4WA8A 4ETNA 2DFNA 3NYQA 3OI7A 3U80A 2VDJA 3KWLA 2VXOA 3OO0A 4MVWA 5C7IO 3LX5A 2H57A 2B98A 5DK4A 2OV3A 2ES4A 4TS1A 4YAIA 1AHPA 1E1CB 1DO2A 2C2ZA 4JKYA 4NEGA 4R9NA 1HFWA 5F73A 3VVLA 4HB2A 2X3FA 1HLFA 2P3QA 2X0RA 3C1UA 4RLHA 1C1XA 4CDMA 1MV5A 4DCOA 4BOYA 1XZJA 2O19A 1WUIS 4YV1A 3QVSA 4IIXA 1DHRA 2FRDC 3PDUA 4P08A 3T7TA 4AJ4A 1QV6A 1Y5LA 4LXTA 4ER6A 5LQNA 1JZTA 1Q92A 2VJCA 5CURA 4F2HA 4AIIA 4P53A 3EE6A 2IYRA 3F4KA 5GJVC 3KKEA 3ORYA 4L5CA 4GEKA 4N9WA 2OXTA 2P1RA 3QELA 1X9HA 1X1RA 3H3JA 1NMSA 2WW8A 3B7WA 3RIXA 1Y9DA 1GR0A 4X3CA 4JI8B 4MAAA 4DSTA 1LUAA 1LSOA 4HEHA 2IS6A 1GFIA 2F3RA 4HXGA 1X70A 2OTCA 4R1NA 3CBGA 4MDHA 1T0HB 3E0XA 1P9NA 4GGMX 1RWVA 3EPHA 1MNQA 1OWPA 2ISCA 3IQDB 2FGJA 4TWAA 1TB4A 2BFAA 3D3WB 1JU3A 2BR4A 5AM5A 3HYNA 4P4NA 4XRGA 2UVDA 3Q9LA 4RW0A 1I9CA 2WM2A 3FLAA 3FPAA 2PS3A 5AW9A 4W5QA 1OB5A 4IVRA 4ZANA 3K9GA 1U28A 2Z83A 1DRUA 3IV6A 4LRUA 3D0OA 3ZWVA 4L78A 1ZUWA 4IWYA 2PWZA 1NI4B 4R98A 3TXAA 4OI4A 2ZS9A 3VZCA 4NJMB 4HNRA 1ULAA 1LRKA 4LGVA 3SDBA 2VP6A 4RFSB 3ZI4A 5IUJC 1P4GA 3B85A 3ZX5A 3BTVA 1IDOA 5KOIA 2JJYA 3NUGA 4UHFA 1W75A 3RK1A 2W22A 1FDRA 1FW8A 2ZTSA 4NX2A 5L3RA 1ABBA 4FYPA 2QYHA 2PRYA 1JE1A 1NT4A 1ZEJA 2GN0A 1A1SA 3DE7X 4IW3B 4P5EA 3GLFA 1FA9A 1JFRA 5BQXA 4FILA 4HHEA 3CR8A 4MRSA 2IBTA 4K81B 5FIUA 1SKQA 4B9AA 2WIKA 4BXOB 3V1YA 3FE2A 1GWNA 3CLKA 2WUFA 3HSKA 1QVWA 3NEYA 4UUQA 5GONB 3U37A 4CTMA 4YMGA 2P6RA 2A0FA 3ZVRA 3TCNA 3ADCA 2J0EA 5FOQA 3FRHA 5IJAA 2WHPB 4QC2A 4EFLA 4KWTA 1OPXA 3MWYW 3Q5EA 4PV7A 3VTAA 4TYNA 1YRLA 3L9XA 3K96A 1OCEA 2W37A 3HU1A 4WGFA 3C1TA 3RU2A 2OM2A 3M1AA 2NVOA 2OXCA 5HCIA 1U4SA 2BR5A 3BEOA 2Q41A 4R1MA 3BFXA 3RAJA 5BSRA 3MILA 4Q9JA 4RTLA 4NNPA 4EBBA 1UPUA 3D4IA 2JIPA 4UQLA 5TQ0B 1SKYE 3KQVA 5ED4A 3I5YA 1H66A 2J7PD 2O6LA 2PMWB 3D6MA 4INOA 1RYFA 2XB9A 4URYR 3TRHA 4C20A 4F4UA 3LY7A 3MHPA 1EVJA 1QE5A 2EKPA 4H08A 5L4LA 1KSFX 3AZPA 3FFWA 3FAZA 1QFXA 1L1FA 1MG5A 2QMOA 4GKKB 4X63A 4IIFA 4IIHA 2V5AA 4KREA 1KK3A 1Q6YA 2AGVA 3AYZB 1JFSA 2XUKA 5KWEA 4OXKA 3THYA 1MCZA 2AC4A 3GXBA 2ZGVA 1E7QA 3NEAA 3TJZA 4ND2A 2CYAA 1F12A 2AQHA 1XTKA 1Q1ZA 4MO2A 4TL9A 2O06A 3STWA 3CZCA 1NNLA 4CMAA 3UMFA 1GPLA 3R7DA 1KOJA 4ROTA 1PHPA 1DXOA 1I3KA 4KPGA 5CH5A 5KZMB 3KB6A 1N6LA 5JD6A 5ULLA 2JIRA 2WYHA 1VLHA 3G0DA 3FBGA 3GLKA 4B3IA 3EJ6A 2X15A 3PEFA 4B1FA 1J23A 1RPAA 3GJ8A 3LPMA 3EY4A 1BX1A 4I4TB 2BVNA 3LT4A 2FUNB 4TKVB 4DSUA 1T1IA 4BQRA 2VHZA 4HFMA 4RH1A 1NVDA 2IPLA 4D2IA 3FFAA 1C9EA 2FW0A 4CLEA 3HADA 3ONFA 4PSDA 5K3EA 3AF6A 2J32A 5CNIA 4CM7A 3TVYA 2LXNA 2QW8A 5IYZF 4CM5A 3OM8A 3E2MA 3KEMA 4QVGA 4GPTA 4OJQA 3WNZA 4BNTA 2CNOA 1BWSA 2QVXX 1VIMA 3QTLA 1UPAA 4WA7A 5IH7A 1X42A 1C50A 2XAUA 5H59A 4DDKA 4HNTA 4KH1A 4HQNA 4B6PA 4WJLA 3AVVA 4P3YA 1TK9A 4ID9A 2VO1A 4C43A 1ESNA 4H7EA 4Q1BA 5E6RA 2XSZD 4UTXA 3TR5A 3SICE 2QRHA 3T1HB 2YMPA 1V16A 3SXPA 1HYBA 1M1YA 2O2JA 3FIJA 4B3HA 2QD1A 3EOZA 3VJRA 3TD9A 3DBVO 1YI8A 2HJVA 2FKAA 5IT0A 4EJSA 3R9WA 3FPLA 2F6RA 2WU8A 3IJEB 4MKHA 3I9JA 4TLEA 2XOKA 1J8YF 3CIOA 4WTOA 4MS4A 2VZ9A 5GV7A 4BFCA 2I5PO 3HR4A 1QH1A 2QDKA 4W1QA 4EHBA 3NWBA 2QUZA 3H1GA 3DMTA 2O9JA 1D4OA 1QWOA 1EZ4A 1RAFA 1ZGGA 1GP2A 2P78A 2PT5A 3DD5A 3DMHA 5JS8A 2R8PA 4MW1A 2ZRKA 1GAJA 4RPJA 2NWQA 2BLNA 2EL7A 3T9FA 3TN7A 1K5DA 4P92A 2BELA 5B1IA 1ZISA 1PWEA 2VH5R 5LP6F 1YHNA 3QXHA 4X20B 4BNNA 5E6SB 2BFFB 1UFRA 3O21A 1ZEMA 4H31A 4QPPA 2YJZA 4TM7A 3SQMA 3WL5A 4CQLA 3LL7A 3OPYB 1APBA 2F3PA 5BQ5A 1ZBDA 3AUFA 2DTXA 5DISB 4EFDA 5LD2B 1E7SA 4U00A 2YWCA 1DKPA 3EYWA 3E22B 4IDCA 1MFZA 3NYIA 3SHOA 3ZU5A 2OO3A 4LPKA 4CT0A 1FTNA 2PNJA 1O7JA 3COZA 3ZWYA 4HT3B 3P71T 4BJ3A 1GSIA 1M54A 2N3ZA 4JFRA 3WKBA 5A4FS 1SRRA 1ZJ6A 1ABFA 4MYSA 3HCWA 2X0FA 5J2TA 2ECOA 3EGCA 2UVPA 3MTGA 4PONA 5KVQA 3H42B 4EEZA 1QNLA 2HUPA 3HB5X 1RQGA 2R8YA 5B12A 3GUUA 2VPTA 4ITRC 4RSGA 3J7TA 1R9NA 1A27A 2A9FA 3D2CA 4HQLA 4UUPA 3IT3A 3KDSE 2Z4TA 1A2QA 4GYYA 4X5OA 2HW8A 3KIPA 3ND7A 3U60B 3FTCA 3DFFA 3JVEA 2OWDA 3G5MA 1IPEA 4LGMA 3K73O 1DAGA 1W581 3VNUA 3PUYA 2JB9A 3LDAA 4L9AA 1XA3A 1LV8A 3RUEA 3L8FA 3OJCA 4C7MA 4K28A 1U65A 4CM8A 7MDHA 2OG1A 5LQAA 3TR6A 3GJTA 4OUDB 4EUSA 2CCKA 4D02A 1KMIY 3AEXA 3NLLA 5KQMA 2I4OA 3FNEA 1JMYA 3M4ZA 1MZVA 4MQFA 5IBCA 3SNHA 1E6LA 5BW6B 3B70A 3PUHA 4FEYA 2DQZA 1LC0A 3DB2A 5CXXA 3JARA 2D0PB 1AXRA 1WDMA 1I2BA 1XL0A 2YZKA 4C4AA 5IC4A 4K8OA 2WG2A 2PFKA 1G4AE 3NTLA 5G4LA 1KAOA 1X1DA 2WJIA 4PQEA 1N7GA 1UMCB 3D8SA 1CUDA 2C57A 2OBMA 2OD7A 2X7XA 4P7BA 4N6GA 3VPFA 4BAUA 3RRJA 4OSOA 5KOHA 2O2YA 3AI2A 3HCDA 3U62A 1SBZA 3BJMA 2C00A 3S2FA 5JRZA 1RCFA 3TEMA 3NDBB 3KQTA 5JCJA 4JLPA 4NYIQ 5J2UA 2HXGA 4YUWA 5COQA 2QW1A 2P2LA 2V7PA 4FQ8A 4OP1A 4FYJA 4RACA 4XEHA 2V97A 3TLGB 3EGEA 5FR1A 4TVKA 2ODAA 1T5BA 3AR5A 4DGQA 5LBTA 3W6OA 1IXZA 2Z6UA 1K7SN 4JI1B 1E7RA 3L8MA 3G88A 4E6EA 4GYKA 2ZSIA 1F2UA 1Y3FE 2P7IA 2FN8A 5H82A 5ALHA 2XOEA 2GM3A 3OZSA 5ICFA 1AKEA 1EUCA 5LB2A 4TWZA 2VEOA 1ZCZA 4X97A 3QFSA 4A27A 3ZHUA 2REQB 2ZVQX 4YQYA 4ZOQI 2NZ8A 5B3AA 4AJLA 2XYQA 2BM8A 3SR3A 2OZLB 2ZPUA 3EEBA 3MJSA 2R11A 1DOHA 2LTAA 2O5RA 2BMFA 4KODA 5GJCA 2OCPA 1Q3HA 1IC6A 3NONA 3EZNA 2EWMA 3SQWA 5ALLA 3UCFA 4V0NA 3TZKA 3AY0A 4GMDA 3ZS8A 1YB4A 3KQMA 4B4UA 4RLFA 2EWWA 1EDBA 4GMFA 2G36A 1U4NA 2IOHA 3N28A 4ZOLF 4ENSA 3AW8A 1NPDA 4V3CA 5HQJA 3VR4D 2H3EA 3FHCB 2O8DB 4NNJA 4FT2A 4KRYA 4R01A 3ONNA 1V43A 3HBAA 4M7OA 4QBTA 5DB4A 2PUTA 3V3TA 4B43A 2BYTA 4IDEA 2ZVJA 1MW8X 1B3BA 3EZFA 4BZXA 2JPDA 2HK8A 1SAYA 4KIGA 1OKKD 1Z4PX 1IVNA 1U0EA 2AMVA 2X7JA 4R69A 4ARZB 4IJUA 4D43A 3R40A 1YACA 3BOSA 1PFKA 1XIVA 2GJKA 2ZULA 2WMNB 2BBWA 3UVEA 5EWJB 3DZJA 2V58A 4JBNA 2VZLA 1NP7A 1M1YB 3KOOA 3OIYA 5C2JB 4CG0A 8ATCA 1XRRA 2Z09A 5IN5A 3VR3A 4OQDA 3IPXA 3VR5D 4NNOA 1M1UA 1C41A 4CQNA 5HF9A 4RZQA 4WWHA 2X8BA 2HU8A 2VHYA 4YONB 5FOTA 2A9QA 2Q2OA 3QVGB 4WY2A 2C5LA 2I8LA 3RYIB 1AGXA 2X6TA 3UO8B 1WB4A 3AUJB 3ESAA 4B87A 1XTUA 3EZXA 5BURA 4XM0A 3DLBA 3BRQA 2PH7A 3F6RA 4UHCA 1EH5A 1SD2A 5IJ0A 1GCIA 2ZBGA 3IT0A 3LUHA 1JYFA 3I0ZA 2BJHA 3R7WB 5JBQA 3F7OA 5KYXB 3KQUA 4I81A 4X6XA 4BO7A 1H42A 4WOBA 5A4DA 4YCCA 3PQ8A 1GILA 1QV9A 2FE1A 5FHQA 3VO2A 3GIWA 4UMDA 5LVAA 4DKJA 3VNBA 2J85A 3BULA 1XD9A 2OESA 4HBZA 3M5PA 4KOAA 1YS7A 1KRHA 1NYRA 3ENZA 3H4TA 3NGMA 2VHXA 4FZ5A 3WYFA 2W6MA 1M7GA 2HQSA 4ZALA 2DVMA 3W79A 4I9GA 5GVSA 4LV5B 4AK9A 1QRDA 3MTIA 4JELA 1K8ZB 2R1TA 3E4DA 3O93A 4J1SA 3EEOA 2P9GA 3A25A 1BE0A 2DUNA 5JXWA 2OCXA 3PD7A 1LWOA 2WOJA 5EHGA 5K4HA 4MVJH 5I5EA 2BFCB 1OAAA 3IEXA 5F3DA 3TSOA 2VJLA 4EVSA 3F78A 4L73A 4EW3A 4ZCLA 4F86A 2NQTA 2G7ZA 1WKVA 2VN8A 3AHHA 2D3WA 4W5HA 5ARBA 4E12A 1DAIA 1Z63A 3EQZA 2UZ1B 4IICA 2OGZA 2ZQYA 1PVVA 4QYTA 5LN1A 1YHYA 1J22A 1LPMA 1XVIA 2X8AA 3IULA 4IQ0A 2IRWA 2YYAA 1RJGA 2F1KA 3UHOA 1IJBA 3EARA 3GGSA 3A6LA 5IX8A 1CUFA 3MPOA 4J2TA 3L9WA 5CG2A 1KDRA 3CXRA 4UVEA 1V45E 1J2TA 2HBQA 3MW8A 4XPZA 4TQUS 4ZCSA 1TTPB 2BP7A 7MHTA 1EVYA 4KR2A 4LZNA 1SQ5A 2Q9AA 4NPAA 1J2UA 1FVOA 1RZRA 1NN0A 2HMVA 5CYFA 3KSBC 2B4YA 1MP0A 1EX7A 1IOZA 1IMJA 3BMQA 3FSEA 2WFAA 3BJEA 4QEKA 2DQSA 1EXMA 3ZZTA 1QQBA 1ZCFA 3S27A 2ZVPX 3TQHA 2VK8A 1U3WA 2XYHA 3G2NA 3KM0A 5C3UA 5IMSA 1DUIA 1KEPA 3GK3A 3IVRA 1QPZA 4JJ8A 1XSEA 1H65A 4M8IA 3VH4A 1EHCA 2Z1NA 1Y3DE 2F9LA 1MH9A 2CF6A 2W4MA 5DBOA 4KAXA 2CVOA 1JFLA 4D9BA 3N7UA 3WB0A 5KVSA 3ZWXA 1U8FO 1QRUA 1EUCB 2D5IA 5CFZA 4BP9A 3WAJA 3GA5A 2PXHA 2LVBA 3N53A 1KOFA 4ISBA 4BVHA 3LY8A 4KQXA 3JWPA 3WS7A 1J97A 2JFYA 2ZRMA 4OATA 2I03A 1MEJA 5DXAA 3PGXA 3WK7A 1FDTA 1CS4C 1E2GA 2HADA 3Q10A 1PWYE 3FKSA 3WWYA 2XCQA 3E81A 5JJ5A 3MN1A 4ZQBA 1EFTA 1DARA 1T6ZA 5E0OA 1U8UA 2EG9A 3Q0EA 4NFYA 1UMDA 4KMSA 2EDCA 3DBRB 4ZCQA 1YRQA 1EFVB 2DHEA 3NWJA 1D4FA 1VQ1A 3V8VA 1VFPA 2PRZA 4PAQA 1SD5A 3P9YA 4PYLA 1E3IA 4R9SA 4I08A 1NW9B 2FZVA 3MWLA 4EKYA 3DTVB 3A6PC 2FOIA 3FR7A 4YFYA 4CMIB 1Z4LA 2HT6A 2BC9A 1P60A 3VNQA 4N0MA 2QT0A 3ACCA 3E84A 1PG5A 3I8SA 3WK8A 2P11A 2F48A 1DCKA 4AJHA 1JXMA 3IIIA 1Z2NX 1MR3F 2ZIXB 3RSSA 4DARA 3RC1A 1KFCB 2IGTA 3C7AA 3I04M 3V8NA 4PRKA 5AT1A 4CDNA 4F9TA 6NULA 2FUEA 3W5SA 1E9EA 1PT7A 5AKIA 5I01A 1UOOA 3EXG1 4QDUA 1QDEA 4L9RA 4YP0A 3NBFA 3QU7A 2AG0A 5LZ9A 2G40A 2J5KA 1VKHA 5TE9A 4A8JB 1R7RA 5CA1F 2P90A 1WF3A 1CJMA 2PV0A 4G56A 1SN7A 3W2EA 3LGAA 1W94A 5JO9A 4CN8A 4F2PA 4F5WA 4OX9B 2EU8A 2Y1FA 3BCHA 2VCYA 3Q8XB 1W30A 4L2IB 3FCXA 3SHVA 3AHJA 4QVIA 1V4VA 3DXZA 1PF7E 4I1YA 3H5OA 5ILQA 3SF8B 2OEPA 1BJRE 1DTWA 2JS7A 2TMDA 4G1FA 5F21A 2XCIA 3GLTA 2NUPA 1IZ7A 2LIPA 2UUPA 3IP8A 3SHFA 1NG9A 3D64A 2JFZA 1TKAA 2CHGA 4JYAB 3O4IA 2FHSA 4PG7A 4TV9A 4BNKA 2D3TA 2ZWPA 4MWSA 5GM2A 3NBZC 1JRLA 3KKNA 3JD1A 1SUEA 4C3OB 1ICEA 5EUQB 5DN9A 5DLPA 4MTLA 2VI5A 4WLNA 2GESA 3WL4A 3N76A 1O9GA 2DBQA 4DV0B 3BIXA 3OOSA 4EF4A 2D59A 2D5AA 5BVHB 2Q1WA 2GD0A 4ZJYA 1KI6B 3TGWA 1KFJB 4BV2A 3NHLA 3ZE7A 3AM4A 3K71B 2I29A 2PTHA 3BQMB 1GAWA 4PIPA 4V0LA 1G8YA 4G9EA 4YTEA 5IN4A 5IDWA 2Z3WA 4BKOA 1QVRA 2JHGA 4ASUD 4F9EA 3AB8A 1DZIA 1TCAA 3PG5A 2F17A 3KZOA 1AKQA 5CK4A 4DV7B 2PKRA 4LJ6A 4EB6B 1L4KA 3KETA 3ZV4A 1DKLA 1RLMA 3ILXA 4C0KA 3RVQA 4IS3A 4J4BA 2QA5A 2QVCA 3EVTA 2I3AA 4EQ6A 2Z9BA 2EFGA 4DZZA 1WKBA 4GU5A 1M2WA 4W82A 1FMLA 2R5WA 2OCYC 3CWQA 1IQPA 1OGYA 1M5UA 3RW9A 4LMBA 3SFZA 4YPVA 2IDJA 1CZUA 3KXLA 5FAXA 1TVMA 5CVTA 3GFGA 4OHCA 5TS2A 5E95A 4UOZA 5C51B 4E1VA 1MRZA 3HJTA 4URVR 2C3YA 4TTVA 5F64A 4XM2A 3SYLA 1VZ3A 4PAMA 4Z9YA 5FWXB 5LYJF 3QBDA 4CTJA 1F8GA 1SHZA 4W5JA 2II6A 3KL2A 1PQ4A 1XDBA 2JH3A 2HZBA 3EH2A 2V65A 1AV7A 1L7QA 4JLWA 4BBZA 1CY7A 1VP3A 1U3TA 3EBLA 1R8YA 3I5MA 3H2KA 4DG8A 4XVUA 4J16A 1CUYA 2Z2YA 2OBXA 1ZD5A 3KOYA 3ICVA 1Q7GA 1GL3A 4DWWA 4DS3A 2XLBA 2TS1A 4QULA 1U2GA 3U13A 5CVDA 3GLGA 2QL5A 1DKNA 1L1QA 3A1TA 4G0MA 4QRHA 3ZHBA 1YS1X 3T5CA 4X8OA 4OCZA 1W9MA 121PA 2VDNB 2XIJA 3BKXA 3SLRA 4NCKA 5GINE 5UKDA 4A5OA 2PPVA 3DOEA 4CNBA 1LPPA 3G6WA 3H5WA 5CYPA 5KSWB 3U3JA 1U0LA 2ZAOA 2E3JA 5FI3A 4PN7A 3GEPA 4ETMA 4WFIA 4TXJA 4DHWA 1UUFA 2I22A 5E2IA 1ONPA 5BW8A 5JPDA 3U6KA 1ZH0A 1V48A 4UU7A 4HH0A 3HHPA 3CBQA 5LZ7A 3VX4A 1QK4A 2PAFA 1YC2A 3PHCA 2WU1A 4OOFA 1XEAA 5FUWA 2FK7A 3IGFA 3F3KA 4L74A 4N3NA 5COAA 5KNBA 4GHWA 1WOYA 3FOBA 1FMCA 1OQAA 5IAKA 5MFPA 5FNZA 3VNAA 5I7WA 4LDRA 1OILA 4LHSA 1FYVA 1YWGO 3S5UA 1GFZA 4A1OA 1Z36A 4PSUA 1MLDA 4A03A 5ALJA 1HM5A 8GPBA 1E5TA 1FBTA 4FHCA 4YAEA 3ZBPA 2IEYA 3JALA 3HB4X 1J70A 3OY7A 3OZVA 5G1PA 1JQAA 1G9SA 1N2EA 3OE7D 3QYJA 1YMQA 2DPGA 4P33A 2CXTA 1YRYE 4RK0A 1K2VN 1KHHA 1KZ7B 1CRWG 2EZTA 2WSLA 4M1KA 4I8DA 4CM8B 3VA7A 3PTAA 4L16A 3AESA 4X92A 4Z54A 1FXWA 1WCV1 1I9GA 3IUPA 1N6RA 3R7LA 3C3EA 4M83A 3LBAA 4NCAA 3E9MA 4XSGA 1G8HA 2OORA 1K89A 3AY6A 3K1YA 4H3SA 5E3HA 1N2XA 2JBAA 5BQOA 2BI7A 3OKPA 2B1IA 4LHEA 4DM3A 2IT1A 1QONA 4KGVA 4YY3B 1I4OA 2CMKA 4KE6A 2YIDA 2CHVA 3RTEA 1E6UA 2ZTHA 1FNNA 3HL4A 1JEYB 5HSGA 1IEVA 2HSEA 3KJZA 4NTZA 4WZZA 3CVJA 3L7IA 2P9BA 2Z8XA 1H5QA 4JBIA 5EJ4A 2CNWD 2VDWA 4MYRA 4JBYA 3FLBA 5CU7A 5KPDA 1G1MA 1R3DA 2G1PA 4MW6A 2P4HX 3MA0A 3ASZA 3ZYCA 4C5BA 1QZUA 3CMMA 1E8NA 3FCAA 3R77A 5C4GB 3GROA 3NZEA 3L0PA 3HZOA 2ZI3A 3F98A 5JLAA 1X7YA 3IUEA 2ZI9A 3T0IA 3CLRC 4GE0A 1FTGA 2ZBRA 4OB6A 3EULA 2LDXA 4L8GA 5AO9A 4QG3A 4KK3A 1Y6GA 1D1SA 2MWMA 2HM7A 2NYVA 2AQKA 2RJ3A 4Y9DA 5DHQA 2HWXA 5EJIA 4Z53A 1QU2A 4TKUA 1KWKA 4MI9A 5CA0B 2SHKA 1UIRA 2RI0A 4FX2A 4IPTA 4MUGA 1YS4A 2CLHB 4NPHA 4MOWA 2D1RA 4LDJA 3HXLA 4WDQA 4B85A 3FKQA 1WPGA 4IDNA 5KOYA 4WNYA 3RT7A 4PLTA 4S0ZA 1HDCA 4FX5A 4QGAA 1GXSA 2Y77A 3MJCA 3O2QB 5H3CA 4B7ZA 3IOBA 4R40A 2H1CA 2QSZA 3J81A 3ABQB 1MVOA 4TL6A 3WLHA 3UH1A 1W85B 2WHQA 1P39A 2X2PA 1PGNA 3JQ6A 3WMRA 4Q02A 4FBLA 5ESWA 3F67A 2BKAA 4YREA 2VWPA 3SZOA 5KTTA 2IZ1A 1V1JA 1V2GA 2ZJ6A 3I9FA 2VK4A 3KJEA 3IJPA 3OT5A 3PJGA 4EYGA 1HDEA 2PN1A 4B2PA 2GAAA 5KNDA 1COZA 2I2WA 2PMFA 2VL7A 1ZGCA 2WUEA 3O74A 4IGKA 3HA3A 5EWLB 3A06A 3ZZ0A 1I7PA 4CQMB 1XR3A 2JLQA 4IDOA 2GO7A 3PUJA 1XPJA 2FX2A 3HFJA 3O8OB 1MGPA 3DO6A 2A6PA 3EPJA 5EIXA 2IXTA 2AF3C 3A3KA 3GMTA 2XAAA 2QHXA 3IDAA 3OJFA 5ALYA 1EUDA 1SBTA 3KEFA 5FNVB 3TNYA 4A4DA 4UTPA 2QRPA 4QTZA 2LE0A 5AIBA 4WVLA 4Q3OA 2CDAA 2OK8A 5KKAA 5BSUA 4RK1A 2CD9A 1TZCA 2ZCVA 4I55F 1XTIA 1WDLA 3P9ZA 4JC4A 4MUEA 3S29A 4CDGA 5I9SA 5HRAA 1JG4A 2XLCA 3I76A 3GPLA 5AOBA 1O77A 1OJ7A 4LN1A 3MTJA 1YJ5A 3BZUA 1SQGA 5JH7A 2WBLC 1XPUA 5HE8A 1KJIA 1P7ZA 3LLCA 5F7OA 2OHHA 3F6EX 3OA2A 4FU0A 4IIGA 2VQSA 4QODA 4MUYA 4YDHB 4CG2A 4C22A 3L8EA 4BB5A 1ZJJA 4RD2A 3TB4A 2FP3A 1OKKA 2FJUA 1RYYA 1GA1A 3LI2A 3QUTA 2JCXA 4Y6LA 3OE7A 1RRGA 4DC9A 3I9V1 3L92A 4PRLA 4UNSA 3SEAA 1DAEA 1XLWA 1R8JA 4JFAA 1EB9A 3OAAA 4BX0A 2IXBA 5E2BA 1J8MF 1DO8A 4FNAA 4Z6KA 1OGIA 1SB9A 3ZTTA 1W59A 1WAMA 4TL7A 3ZDQA 1I7QB 5DBEX 1QFYA 5D6NA 3IJRA 1MVNA 5K0EA 4MRMA 3AEYA 1G7RA 1JDPA 1BJKA 1Y8CA 2V3VA 3I04A 2EQ5A 1GUDA 3P4UA 4NV0A 4JUCA 1QS0A 4G37A 1J1IA 5TJHA 2VJPA 3LGSA 2HCFA 3KV3O 2NN3C 3K0AB 1D6NA 2L2QA 4R7GA 4BMSA 5IPFA 2AKEA 4E13A 5BN3B 2VSYA 2J9RA 2RGCA 3EA5A 4M1MA 4JLDA 3AM1A 4AY6A 3KVRA 3AKDA 4EVRA 4N49A 2QRVB 1GNVA 5DRYA 3TD6A 4DB2A 1MA0A 2A9JA 3UB4A 1G8AA 2YV3A 2BPOA 3MWJA 1RWPA 3PRJA 3HBNA 4X7RA 5AK6A 3USES 1Q5PA 3RBAA 4AIRA 2VJMA 1X87A 4ZVKA 1ZU4A 5IG2A 3S1LA 5SYMA 3PNMA 3TW0A 2X0KA 2IX3A 1MVLA 1NNI1 2I80A 1FMFA 2G09A 3JQ8B 4FE3A 4H7IA 4H6VA 2ZB7A 1I10A 2NYUA 2GCNA 1YRWA 2JGEA 1QF9A 3BMNB 2B78A 1H05A 1IRIA 1H2AS 3IB6A 3KHSA 4ESOA 2OMEA 1CV2A 6LDHA 3GJ7A 1OWLA 4QPNA 3OE1A 3IUSA 1E3SA 5GZ3A 1PL8A 4FE7A 3AR8A 4UAVA 1GPWB 3LCMA 3OURA 5CW2A 1JEYA 3KEQA 3IUMA 4L57A 3TM5A 4C0HA 4D9GA 3M9XA 3NWEA 5GONF 4BO3A 1KDPA 2V5VA 4LHVA 3V48A 2YZ7A 4S2EA 3N7AA 1ETUA 4YJGB 1ZGZA 3I01A 1LQUA 3PSHA 4GUAA 2AD1A 1KK0A 2AC7A 3AJRA 3UG6A 2KX7A 1PJRA 3II6X 1HRDA 4J4TA 1KAHA 2VQFB 2XBMA 1KMNA 5KQPA 4LJ4A 3MBIA 2HBZA 4CM1A 2HCTA 1COWD 4BFSA 3R9XA 2DY0A 1I36A 4R9UC 4HZGA 1FS4A 4MQUA 6REQB 1UBNA 3L0DA 2W2OA 1S2GA 1C9MA 2Q2NA 2RHHA 4IYRA 4RIHA 4AN1A 1J2RA 1N0HA 2FEWB 5KQLA 2QX7A 2EOAA 5KYWB 4MDFA 2F4NA 1LBIA 4NV1A 2AA3A 4P3PA 1TPZA 2XQIA 3FY4A 4ZVVA 5HKOA 3PDCA 3LM8A 1XKXA 2RCNA 1EGVB 4PLCA 1E96A 2Q99A 1A77A 3DEYX 3K7EA 2O14A 4EPYA 4QNRA 4C0LA 4YRPA 1RRVA 3OPYA 1LJ8A 4LMPA 4B82A 1OLOA 2E5WA 4QOJA 5KWIA 3E61A 3NOQA 3FD8A 4V02A 4HS9A 5K99A 4FYHA 1T8UA 4Z1MD 4FR2A 5HCUA 3VZRA 3OY2A 2AJDA 1PK9A 1AF7A 1JDJA 1CJCA 3E22A 3F4BA 1ADBA 4NWIA 3CX4A 3TAUA 4AJ1A 2H00A 5BUCA 1EFVA 2OENG 3IVCA 3PX3A 3TTXA 1R50A 4OK3A 3SBDA 1NLMA 4EMUA 5K8LA 2PX6A 4P7KA 5K4GA 1LBHA 3O3NB 5BYJA 2NAFA 1RAHA 3HQ4O 5TGZA 2VBIA 1JQ5A 4NH0A 5DE3A 3CISA 5L7TA 4BU1A 4HNVA 3G68A 2OFPA 5KCZA 4M22A 1KEWA 1Q3TA 2WKWA 2ZYWX 1UDAA 1W1WA 4ONEA 5LZ8A 4F3NA 3QWBA 5MGBA 2O23A 3PX2A 2Q5CA 1PGOA 2YIJA 2JI6A 1I7SB 1E3DA 1ZGBA 1ZI9A 3F46A 4P0QB 2W8BA 2IX9A 3L4JA 4YJDA 5F1OA 4FNGA 1I4TD 2YNMA 1WB6A 3DG9A 2VNSA 3GJXC 4RHTA 4R6WA 1ECLA 1W5BA 4CIDA 4M1SA 3Q1LA 5JH7B 1XAJA 4GRDA 4QDKA 1XLVA 3UC9A 2DB3A 2BJVA 3EXIB 1BXRA 2Y0PA 5H3HA 2DR0A 2WF9A 3KVYA 3SEQA 2B0CA 1XCMA 4Z4IA 1TZ2A 1UDBA 1WD7A 4H7PA 2J8ZA 1KI2A 3CN7A 4BFYA 4DDMA 2JFOA 3WO0A 2F1HA 4B6FA 2B20A 4NFHA 4JASB 4C6SA 2ZU0C 3CINA 2E87A 4JP5A 2FLVA 2A0UA 3PX7A 4DY6A 1MOSA 3EZ6A 3RRNA 1ULSA 5TQ2B 1Z74A 1AC5A 3NNSA 3U9SA 2QPOA 2FWRA 3DS8A 3WISA 1KR2A 2A3RA 3FUCA 3EXFA 3M6AA 3OD1A 4FPXA 4I4TF 4TXNA 5ESDA 3R5JA 2W93A 4KHZA 3KCQA 1CSEE 2WD7B 3KAPA 4OGGA 3WE7A 3UT5A 5EESA 1XZGA 4GKBA 2WMDA 3U48A 4MQMA 4UHBA 1FU8A 4RA9B 1O95A 2GZSA 3HUFA 1UJ2A 4RQBA 2WTBA 4F92B 3VH1A 2I71A 3TLZA 3I9NA 2VTDA 1PTKA 5THKA 4D79A 5JMOA 5L3QB 1DMSA 3Q5DA 4B3SB 1MO3A 2WF6A 3ZOZA 4QO7A 2YHIB 4V0ME 5EYPB 1T3TA 2WIDA 4J0IA 4GOOD 1HWYA 5SZHB 2LP4Y 2MINA 3PB3A 4CHGA 4J75A 1S89A 3DBOB 1QQ7A 2PLRA 1NBMA 4AJ2A 4J1NA 4LDQA 3GOQA 2FW6A 2H4YA 3DJYA 1Q12A 3FUWA 2X8WA 4XD2A 2V74B 5ECYA 1XD2A 2PIDA 3JATA 3AIIA 4RY0A 3DFMA 1Z5PA 1PT5A 3GIDA 4B81A 3BMNA 5HA5A 4B9EA 4Y3UA 3UPTA 1B2LA 1EI9A 4GYJA 3LC0A 4JSTA 5SY4A 1F48A 2RK6A 4G01B 1II9A 1K75A 3PC3A 3RS2A 5I8ZA 5F35A 4D3XA 4BZWA 2QRNA 3GPBA 1XDUA 2IXGA 3GEEA 3KUKA 4IX9A 4P1ZA 3FA2A 4ZP1A 5FORA 5FJJA 5K2MA 4BMOB 2XVAA 1KMMA 2ZT7A 4ECEA 3DE2X 3UK0A 2NACA 5F51A 4D9KA 2YINC 1TGVA 1V8ZA 1AGNA 1P7CA 2HDHA 4KH0A 2PGOA 1JIJA 1ZOIA 3CLTC 4UM9D 3DNFA 4FHZA 4BVJA 1Y3AA 4ZV4A 5KQGA 3PQ5A 4FP9A 4REOA 2XB4A 4UTZA 3U4QA 3AF4A 4F2DA 1E2FA 4NU6A 5JSYA 3AF3A 1C4KA 1TK2A 5LR6A 2YUTA 6REQA 1D7OA 4WKPA 1IY9A 2WM9B 2YN2A 3I28A 3NETA 2BTQA 1L7MA 2GEKA 1EDEA 2REXB 3O4VA 1FDWA 3DF7A 2JZCA 4NARA 5HF6A 3DOIA 1N6HA 4FJ0A 3EVAA 1T0UA 2YYZA 4RU1A 5EEHA 2RI1A 3G23A 1Y5MA 1AA6A 1K63A 4EGSA 5IWAB 4NBWA 3KXKA 3LE8A 4JR0A 1CUEA 2JAHA 3ETJA 2GARA 1W88A 4HX5A 3BM5A 4UULA 4TZ0A 2CXHA 4WKBA 4FFBB 3FZQA 1ZMBA 3EGVA 4Q9KA 5DCUA 4M89A 2JCYA 2Q0SA 3NNDA 4YO8A 4R84A 5JDIA 2YV2A 1QFJA 3PRHA 4GX1A 2BSQA 3KU1A 2C3OA 1XALA 3SDSA 4DJAA 4R3WA 3MAAC 3SX0A 2IC5A 2BV3A 4H1WA 4R1SA 4CIAA 3INYA 1L5KA 2VKQA 2VJOA 3BQNB 2QI9F 4IJ5A 4DT1B 1NXPA 5AHRA 4AJEA 4CIWA 3S7ZA 1BCSB 4ZYUA 2G67A 5AVJA 1M2NA 2JIZD 4V39A 5KNBD 2XE6A 3NM4A 4Y0VA 1VLQA 3QXCA 2AOTA 2D54A 3NW9A 4QXOA 1CK4A 4RJJA 4X93A 2NP7A 3GB9A 1TXGA 1M7BA 1Z6QA 2REBA 2AUTA 3IMEA 3N9IA 1LF5A 4I9HA 4OAPA 3HACA 1B76A 2C2HA 3JQ9A 5TRTA 3TZEA 3L2OB 3V2UA 5L6LB 1M1XB 3ZW9A 2AWNA 1P0FA 3HI6A 4DBLC 3DMGA 1P5ZB 4RVUA 3GUYA 1J99A 3JQFA 2VRCA 3UJ8A 4C0BA 3N5CA 5IABA 3OQHA 3WHKA 1I3CA 1M8JA 4J2OA 4BPRA 1CYEA 1PZFA 2Y0EA 3OLYA 3HO6A 4YMWA 4J0QA 4ZXFA 1AB6A 4TS3A 4YJ3A 3HDVA 4BBJA 4PG5A 4UVDA 1A2OA 3VZSA 1Y1KE 4J49A 4S3MA 1MORA 1S9DA 1XRNA 3M9WA 4DBVO 2GKOA 2V4ZA 2VXBA 4NQRA 1QE3A 4YP5A 4YRDA 4A2CA 4EG8A 3QE2A 1WS6A 3WR5A 4H18A 3ZBUA 1T8SA 4MIKA 4CF5A 4PINA 4P80A 5LMUB 3W2GA 3S40A 4JXJA 5EZSA 1NVAA 2ZBDA 3KXDA 3EW9A 3W2TA 2QY6A 1RAAA 3K8ZA 3EQ7A 3CUVA 1ISHA 5EPUA 2CNWA 1ZNWA 2VJDA 2GNPA 2UV8A 4YS6A 1AGYA 1AZTA 2NGRA 5B7PA 4B7CA 5LM3A 3N2LA 4MR9A 3NS7A 3IE2A 3Q9SA 3VKHA 1ILEA 3EGOA 2GHTA 2PS1A 1LDYA 4U6QA 5CDGA 1U8ZA 1EFCA 4KRFA 4FI3F 3EXHC 4RTOA 3KOWA 3OD5A 1TF2A 4FBMA 5F23A 2W2LD 4WK6A 3CG4A 5CH8A 4L1KA 2VYNA 5L3QA 1R6XA 1WY7A 3TE6A 4C76A 2W6JD 2ZPTX 4P9NA 1FU4A 3FXAA 4JIGA 1ECPA 5H83A 5KYXA 1KDTA 4LYAA 3AEKA 4Z9FA 2EFJA 2PXAA 2G0TA 1CNFA 1BMFA 1Y80A 3C8UA 4JENA 1E5VA 2C95A 1DQYA 1O1YA 2PBFA 2UKDA 2W6OA 2HUNA 1QFZA 2NU7B 3EFOB 4BP1A 1ZC4A 5A4JA 4MRAA 1M83A 1EVIA 2GNAA 2ORVA 5C1BA 3E03A 3NTUA 1UH5A 4E5KA 4O6VA 4YMTA 3EXHB 1DLJA 1S02A 3BREA 1KZ9A 4Q21A 5IM4A 4DZTA 1PDWA 1ZD9A 4XLZA 3GO4A 1SBQA 3MJFA 4O4IA 5KVAA 1VMEA 2J1LA 4OIFA 4XUDA 2AH5A 5EZ5A 1RI1A 3V7NA 4WN3A 3AFMA 2ODQA 2HEIA 1TO2E 5GV8A 3W6ZA 4CJXA 5KSYA 4Z4FA 2O8FA 5JI3E 4R0VA 3OCZA 4Q4AB 4W99A 4FOSA 1UXOA 4X6LA 3ZDAA 4BVLA 2FMUA 1E4EA 2UYGA 3MJHA 1RE0A 1C7JA 1SFRA 2OCBA 1N1EA 2ZWIA 3HZZA 4QSMA 5F52A 5ENVA 3RTCA 2QTAA 2O8EB 3GAMA 3PV0A 2NSJA 2OILA 3PL1A 3SEFA 3M33A 1XB2A 1X39A 4LOKA 5ESXA 4G41A 4J16C 1YDHA 1N5RA 2NM0A 3ILVA 4RGQA 5BUQA 2XZTA 5AI6A 1I7LA 3X1MA 3TIFA 1KPGA 1RRKA 3KZXA 3NAQA 4CIYA 3ZDCA 2E4AA 1Q1NA 2FGKA 2SBTA 3KKMA 3TQCA 2Y2VA 9ABPA 1QGDA 3TQQA 1F06A 4JGGA 3LVBA 4N7RA 3AVWA 2XJ4A 4X65B 1REQB 2Q8QA 2AE2A 3NVDA 2O3RA 3ROQA 5AJXA 1LX7A 1EBBA 5IVIA 3ZCQA 5FUMA 4GZLA 3ENKA 3B5JA 2Q27A 2EXXA 2R5NA 2G70A 2RCYA 2PLAA 3F3MA 3GDFA 3C7KA 3P32A 4Q19A 4DJEC 1TM4E 4K26A 5BSKA 1V1RA 1WHTA 1YQQA 5HPYB 1ZNYA 3CRNA 5KX5F 2VDPB 4D9HA 4DLTA 3LXXA 5KDOA 2HMYB 2Z08A 1YZ3A 2D06A 1R15A 2QTFA 2FFJA 2WD8A 3PKJA 3QPCA 4KBGA 5AXAA 1JYSA 4DUYB 1VYUA 4D44A 3CF4G 4YX9A 3GAZA 3BWDD 3N6RA 4D8VA 4W9MC 2WSMA 4RZHA 5CR9A 4B80A 1YKFA 4Q1AA 2HDWA 4AXBA 5JATA 3WIUA 4NRDA 4PZPA 5GPBA 3EUEA 1UT6A 4Q01A 1C81A 5TVGA 1XWFA 3CONA 3VR2D 4V0SA 4ND6A 3S3TA 3WLQA 4IAOA 2AFHB 1QZZA 1V37A 1CUJA 2PS9A 5IJZA 3L4BA 1W96A 2QTBA 1BMTA 3IDZA 3QWFA 4BO1A 4IKPA 2XGGA 2NU8A 4WDRA 3GRZA 5BYAA 3ZWAA 3D5QA 2L19A 2BDTA 4HDAA 3KPWA 3WRWA 4WJKB 1WR8A 4H7DA 4N82A 1A9RA 3EOAI 3MD0A 5ITZA 1Z6PA 2PKWA 2ZIFA 1GHTA 4WOKA 5FLEX 4EQZA 3RD5A 3UYLA 5F3WB 5DWQA 1O58A 2YRXA 3VVCA 2VAWA 2VHJA 1DJLA 2NADA 1L7VC 3SC2A 4D46A 5B3JC 5CB8A 1I6WA 3IAUA 1DDOA 4HXEB 1MTOA 2VLBA 5FL7A 1G5PA 2C54A 3ZCUA 3MWFA 1JFFA 5A4IS 1IZ8A 1KDZA 2NQ8A 2YZNA 4L5JA 1DT3A 1XZLA 2HAEA 3GH1A 2EARA 2H8GA 1U28C 3CZRA 4EA8A 5IJWA 5J40A 2ZOSA 4B7XA 3KZVA 4L8WB 1UM8A 5JWHA 1TJ5A 1UJ4A 4E0BA 2W5UA 3F8WA 4HNSA 2RGXA 4JJ6A 1E2JA 1MABB 2W00A 1CDZA 1AQJA 1QM5A 4G4GA 4TXHA 5JUWA 3RYHA 4JYBA 3RVDA 3AL2A 5DM0A 4DMRA 4QEZA 4U2KA 2DGDA 1E77A 3W1WA 3UMBA 5HJ2A 1VSVA 4KFSA 5EP2A 5ISMA 2VYCA 1NUSA 4ND5A 3BWEA 3OIVA 4PX9A 2FQQA 2BI8A 4DA7A 1KY5A 1RWKA 2XUQA 4H27A 1Z4MA 1Z0KA 4LZJA 1GA4A 3SM3A 3ANTA 4FGJA 2WIBA 1HOTA 4IEFB 4RPHA 4W7HA 5CW1A 3PEYA 1F8YA 4WL0A 4HYQA 3N70A 1CTQA 1UXJA 4U02A 3NB0A 1J5EB 2H63A 4RABA 2AI3A 2QQFA 1NM5A 2FUCA 2H3HA 4LXGA 3ZQ4A 2CHEA 2DKNA 2RHJA 4BJ1A 2Z5FA 4ZO4A 3TCKA 2EGUA 4ZT2A 1PJ4A 1ZHHA 4HAOA 1J90A 4OI0A 4BS9A 5E7JA 1HTTA 2X7HA 4IOJA 3KZKA 1DX9A 3G7NA 4RVFA 3E1SA 1FYFA 2XUAA 3DYBA 5DV9A 1N3BA 8AT1A 4BMZA 4PHGA 2XUHA 4CV0A 4PYRA 3JRWA 4WKCA 4PCLA 1LSJA 4A6XA 4CMEA 1XKQA 2DLNA 2YWFA 5JQGB 1NJ2A 3CO0S 3OIGA 1U7HA 4QL3A 4YAOA 1BMDA 4J7AA 2ZSHA 3JQAB 3BSYA 4OBWA 1EE1A 3A9SA 4II7A 4Y6OA 1YUBA 3TLKA 4KVGA 4L3VA 4CN9A 1MO5A 5BR8B 1OMOA 1KAMA 1X7XB 4O33A 3TUIC 4BO9A 2F62A 4XYGA 3RAGA 3CX6A 1JEEA 3IMGA 2ENWA 1VPLA 3ND6A 4N3BA 3TAXA 1X7HA 3D3NA 3GZTB 3IAAA 1YK0A 4QAJA 1VL6A 1GU7A 1VXOA 1EJBA 4I2NA 1VE5A 2EX4A 4QE3A 1Q21A 3TZQA 5L9AA 4EIWA 1T2DA 2ZJAA 3H04A 3JVUA 3QOFA 3ICEA 1O5TA 5E1OA 1FB5A 2XWQA 2OQVA 3OIFA 4I50F 5JYDA 1RI5A 3PPWA 1YZHA 4NYJR 1BDBA 3TKYA 1XDWA 2Q45A 4WAUA 4LSGA 4H2DA 3RS5A 4LA4A 1H94A 1FLAA 5ALUA 1JEJA 1ZW6A 1Y4SA 3VR3D 3VTZA 3DDWA 3IPRA 1VBFA 3D4NA 3WWCA 1VE7A 2FP4B 4REQA 1IQ0A 4KN8A 2NVBA 2BE9A 4B47A 1H2EA 1I3LA 3DT6A 2GJ8A 1A72A 2I7XA 2RC5A 3FKJA 3ZV7A 4ARUA 1Z07A 3V4LA 3T94A 2JARA 5ELXA 4BPBA 2RHCA 5D3MB 4DUPA 2Q0QA 4Y6SA 4EI9A 1ZITA 4LS3A 4DLZA 1T8WA 1IM5A 5AI0A 4C5AA 3RNOA 2EBHX 1Z3CA 2EJVA 4LC1A 1ZK3A 2WFZA 2C7PA 1B23P 1U8AA 4TX1A 2DTDA 2OBLA 3JWEA 1AUOA 1A5TA 1WPRA 4ES6A 4WN9B 2XXAB 3S2ZA 4KRGA 3HLYA 4MICA 1CQPA 3H6HA 1JF8A 1TOAA 2F43A 4ZMRA 4B4OA 4W8GA 3VH3A 2IQIA 4BCBA 2QRUA 4B74A 4Z1OA 4KDFA 2MJLA 1Q74A 1DXQA 1U2QA 1TRHA 1X14A 5EZYF 4HADA 2XBLA 3VKVA 5ITZB 1UBSB 2I2AA 3NHAA 1T0IA 3GLFB 1Q7TA 1XAGA 2OT3B 3MWKA 4JU9A 3Q6NA 2GGSA 3JALB 4M1WA 2DH6A 1B6SA 3FZEA 3B60A 1Y7IA 4ZD6A 2KSQA 5DSTA 5HFAA 5JFOA 3U17A 3B51X 5HUQA 4FBGA 3G8CA 4CLRB 3LQQA 3L7LA 3T3EA 4S24A 1DKQA 1VSTA 3OE5A 4O4JB 4F4DA 1V25A 3A6GA 5FWYB 1WW8A 4OMDA 4NCBA 2QE6A 2VRWA 2IYVA 4AICA 1Z5VA 2RFLA 4YPFA 1ENOA 3U4CA 1E5XA 1XMPA 2I99A 4DQVA 3MFYA 4KXNA 5DNUA 1XZQA 5CDSA 5CT9A 5IKEA 2IIPA 1PS9A 1B4DA 3CZ9A 1YUNA 3NGLA 1JJIA 1JNXX 2MIIA 1EVQA 2GCOA 2JEZA 1T6YA 1K97A 3INTA 4MR7B 1Y81A 1OA1A 5IAOA 3MTEA 2IV3A 5EJGA 2Q3MA 2ATIA 1XLTA 2F1IA 4YYZA