4OBBA

The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGNGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein from Anabaena variabilis ATCC 29413 in complex with (3S)-3-methyl-2-oxopentanoic acid.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 132
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4obbA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4obbA01
2RJOA 3FFWA 3ILHA 3O2JA 3N53A 3P9YA 3I5AA 1WETA 1BVHA 4LE0A 4Q7EA 3I42A 3QK7A 4G0XA 3N75A 3A10A 4G0ZA 2N9UA 3JPWA 3LKVA 4DQDA 4MR9A 3URMA 1NXWA 4ZJPA 5BR1A 4TLLB 4OBBA 5JNRA 1OXBB 3FDFA 3MQ4A 3OQNA 3IP6A 2GX6A 5EWLA 2JVKA 3RH0A 1ISSA 2YHBA 3KYJB 5DGCA 5DTEA 5DKFA 2JCGA 2WRZA 1QP7A 4JAVC 4YCSA 3LUJA 2CHEA 1SXGA 1YS7A 4NCAA 3KKEA 2JRLA 3T38A 1SXIA 2A9OA 4MS1B 3HO1A 4YP9A 3KJXA 1YMUA 1GUDA 4MQEB 1NXSA 3OLZA 4RKRA 3LUCA 3JS5A 4G0PA 5ED4A 3KLOA 4RK5A 3H6GA 5TPWB 2M98A 3CZ5A 2GBPA 4PYRA 4XARA 1EWVA 4EGSA 3MM4A 3LOPA 1NY5A 1KRXA 5FWYB 3BILA 5BQ3A 2GWRA 2JK1A 5EWMB 3GL9A 1JFTA 4RXMA 6ABPA 1P2FA 4NV3A 1TJYA 2NZUG 6CHYA 2TMYA 4PE5B 2PUBA 5JNUA 4MYRA 2LUOA 4MLDA 3O74A 1XWWA 3GRCA 3KYIB 3RVPA 5GOTA 3L49A 4Q6BA 5CNJA 3RVLA 2PKXA 3SAJA 3QX9A 4MQEA 5CHYA 3O21A 3W9SA 3NBMA 3FFTA 3CLKA 2ID7A 4IILA 5TQJA 4RK4A 4WXMA 5BRAA 1KMIY 5TPWA 3QLUC 1T34A 4E7OA 1GLGA 1BAPA 1MB3A 2AYXA 2JVJA 3ILYA 1PUXA 4UHKA 2I6FA 4ZMSA 1M2FA 4XLTA 1JWLA 1D1QA 1FFWA 3E3MA 4WUTA 5FWYA 1U8TA 1SRRA 1AB6A 5EWMA 4YR7A 3I09A 1H9CA 2RJNA 5D2CA 5HM6A 3GYBA 4TN5A 1A04A 1JDNA 1RXEA 3N8IA 1DBWA 1EHCA 2HQRA 1LBIA 1Z16A 1E6KA 3C3KA 3D8UA 3I45A 3OLWA 1Y1LA 2RGYA 4MQFB 4P98A 3RVKA 4EY3A 2PUCA 1DC8A 1DG9A 3QELB 3KTOA 3QLVA 5TPZA 1APBA 3NNSA 4MS4A 1ABEA 1W9HA 2CD7A 3ROFA 1HEYA 3GBVA 3EQZA 3RVNA 4WWHA 5KQLA 4YLEA 1QP0A 2NT3A 2MSLA 1K66A 1FSPA 1ZITA 4N47A 2FQWA 4OLAA 4HNSA 4JASB 4RU1A 2WWVD 1VPWA 2FEPA 3CG0A 2XDYA 3MF4A 1S8NA 2ZWMA 3N0WA 1PHRA 1VLZA 1DC7A 1Z25A 1C0EA 2R25B 4PEVA 4Z4CA 5ABPA 4KK4A 2WMYA 2BGGA 4LZLA 3IP7A 4W5TA 4Z4EA 1NXPA 4MR9B 3GT7A 4ML3A 1PNTA 2FKAA 3D02A 3IP5A 1Z18A 4RK1A 4ZMRA 3OO0A 3QLVC 4G0OA 1M5TA 1NXXA 3OQMA 1QP4A 3HS3A 3CRNA 1P6QA 1Z26A 1LJUA 2WB4A 3G85A 2ID9A 3DGFC 3N0XA 4IF4A 4LE1A 4QICA 1DCKA 3LTEA 3HV2A 3O75A 4KREA 2O20A 4L4UA 4P1ZA 3CS3A 1DBPA 5KC9A 4YGXB 4G97A 1U2PA 3NHMA 1YK0A 1PEYA 4LDAA 2FLWA 4LDZA 2GI4A 3CZCA 4IRXA 4KFCA 3OM0A 4YWHA 3HM9A 1TMYA 3F73A 2B4AA 3OM1A 4S04A 4F06A 3FFXA 1ABFA 4EYKA 5CNMA 4RK0A 5CNIA 1L5ZA 1URPA 3H5WA 3Q9SA 2F8SA 1JHZA 1JLKA 2LPMA 3F6PA 1NXOA 1DCMA 5HKOA 3S99A 4EVRA 1LBHA 3L6UA 2F8TA 3H5LA 3JY6A 1BA2A 4Q6WA 4QYMA 4W5NA 3HJFA 3N0RA 1DBQA 2JB9A 5KQPA 1JYEA 4ETNA 4MS3A 3KSMA 3SQNA 1MIHA 1D5WA 3E61A 4G0MA 3M6MD 3LUAA 4H3HB 3OQOA 1W25A 1Z2EA 3ROTA 1YVUA 2HJ9A 8ABPA 4N0QA 2L17A 5I4CA 4MGEA 5PNTA 1CYEA 2PL9A 2PUAA 4F3TA 1GCAA 3EDCA 3QLUA 1MAVA 2FQYA 3EAFA 2E4XA 1EAYA 4JA2A 2QSJA 1LK0A 3H5TA 4EVSA 1YTUA 2HPHA 5TE9A 1QQBA 1QPZA 1QO0A 4QYWA 5CNKA 3K4HA 3KCNA 4XAQA 3Q7RA 4RXUA 2OENG 2PUFA 4KZKA 3SM9A 2FQXA 4Z4IA 2IKSA 2QW1A 4MR8A 2MYPA 3MIZA 4ETIA 2PUDA 2LBPA 2MYTA 4CBVA 2PUGA 4FE4A 2OQRA 1JFSA 1IIBA 4MLCA 4DN6A 1GUBA 1TM2A 4OTZA 4RDCA 4XFKA 4Y9TA 4HYEA 4MS4B 3BRQA 4L85A 5DLEA 3H1GA 4MAAA 5IBQA 2VYCA 3CG4A 2PJUA 1BDHA 3TO5A 1QNLA 1J56A 1USIA 2P9HA 3NHZA 4KVFA 1U2QA 4RK6A 1QO0D 4KPYA 1ZVVA 1YS6A 2AYZA 4H3KB 1I3CA 4NICA 1E2BA 1ZDMA 2M1ZA 1JX6A 2A9RA 3OLYA 5JNWA 4KRFA 4PICA 3LUGA 2QV0A 4LE2A 1QMPA 2VK2A 2IPLA 1Z15A 1VRVA 3OO1A 3C3WA 3OMXA 3VNBA 2JVIA 4PZ0A 3RVMA 5C5CA 1KGSA 4YO7A 5T7BA 1RNLA 1DJMA 2E4YA 2E4VA 3TB6A 3M9WA 3C3MA 3EGCA 1AB5A 5IC5A 3DLBA 4KQCA 4NCBA 1MVOA 2HQBA 2IYNA 3FMVA 2HQOA 1M5UA 3T95A 3M9XA 1YIOA 3HXMA 1CHNA 4LX8A 4W5OA 3FGZA 4H60A 4JP1A 1E6LA 5T3YA 5TQ2A 1M2EA 3GBPA 3T8YA 4Z4HA 1Z2DA 3EJWA 5B3JC 2IDMA 1SD5A 2B1JA 4RWEA 3Q7TA 4Z9BA 4Z0NA 2QZJA 4FB4A 1YMVA 1EWKA 2NUBA 4N0PA 3RVJA 3H6HA 4KMRA 4Z4FA 2E4UA 2H3HA 4ZPJA 3RVQA 4W5RA 3DZDA 5JS1A 3LUDA 5IX8A 3SG0A 3KHTA 1USKA 3GWGA 5KWSA 4YS6A 4RY0A 2IPMA 4HNQA 3RVRA 1OXKB 5BRJA 3LFTA 4D6XA 4HNRA 5HSGA 1XHEA 5TPZD 3HVRA 5HQJA 4EYGA 3CKMA 3QEKA 4EYQA 4S05A 2W42A 5IULC 1DRJA 2MYUA 3F6CA 4YRZA 3GV0A 4OATA 3H5IA 1ZAYA 1YK1A 3A0UA 2WJAA 3NNDA 1GCGA 5KI6A 5EWJA 2FXIA 1RXIA 4UHJA 3BBLA 4MS3B 4B09A 3DLHA 2HSGA 3O1IC 2JBAB 4YV7A 1ZH4A 4TMYA 2FN8A 4N03A 1ZH2A 2PMCA 4O1IA 3OMWA 5JS2A 1D4ZA 3EULA 2FN9A 4F11A 3HCWA 3HSYA 4KQ9A 3A3KA 1ZESA 4EYOA 5IUJC 1DP4A 4MR7A 4DADA 3KG2A 3CHYA 4WXEA 3H75A 1DZ3A 3UK0A 3UKJA 1RPJA 1EWTA 4RV5A 2E4ZA 3C6QA 2H0AA 4QPJC 5KQGA 3B2NA 2PL1A 4O1HA 1UDRA 2MSWA 3VNAA 5IEBA 2FVYA 3HZHA 2V0NA 3EODA 3JVIA 1Z17A 1FFGA 5KQMA 4RZSA 2JBAA 1FQWA 4MR8B 2MYNA 3LMKA 1Z13A 1FFSA 1L5YA 4FE7A 2IPAB 2VUIB 5F64A 5IUKC 1U04A 2FMFA 2QVCA 4F8JA 4RY8A 3CU5A 3SNKA 3O2SB 4WT7A 4E7PA 2FLKA 5JNSA 2E4WA 4OG2A 1ZGGA 3BRSA 1CEYA 3SY8A 1P6UA 1JDPA 2NZVG 9ABPA 4RKQA 4EVQA 1C4WA 1BDIA 3LUHA 3HEBA 1JL3A 2PAFA 2VUHB 4KK3A 5C5EA 1XHFA 4Z99A 2FTKE 1B00A 4EUKA 1D1PA 3HK2A 2KYRA 2PE5A 3JVDA 3QX8A 3DBIA 2YHAA 3IP9A 7ABPA 5IEJA 3CFYA 3GA5A 3H1FA 1LJLA 3G1WA 3LKBA 3OLVA 4LRQA 3F7NA 4RK7A 1P8AA 3KLNA 4XASA 2DRIA 4N76A 3EQ2A 4JB2A 5B3JA 1K68A 4RS3A 5TQ2B 4OLBA 3RVOA 4D6YA 1JFVA 2IOYA 1A0OA 1RZRA 3JTEA 1NXTA 4GNRA 2FEKA 3QEMB 1QQAA 4RY9A 4GPAA 2QXYA 2QU7A 1VKRA 3HUTA 5GQSA 2R4QA 1MB0A 1DRKA 1ISRA 2GKGA 4M88A 1JH9A 4MS1A 3UUGA 4XXHA 1ZN2A 3H5VA 3C97A 4D74A 2IPNA 5JNVA 3O1HB 1EFAA 1R8JA 2FSPA 2QR3A 1ZHHA 4G0QA 3HDGA 3Q41A 5FBHA 5E3JA 5TQ0B 2FMHA 4G86A 5EWJB 1NXVA 3IPAA 2A9PA 4IGAA 3IDOA 3T6KA 3DGEC 1RZRD 2LP4Y 1F51E 3CTPA 2WY2D 3NNNA 4JOQA 3Q7SA 4ETMA 4NQRA 5JNTA 2FW0A 5FWXB 1DCFA 3QEMA 1F4VA 1ZY2A 3O2QB 2FMKA 1A2OA 2PLNA 2R48A 4G0YA 1NTRA 4MR7B 1JF8A 1Z12A 1USGA 2FMIA 3LUFA 3Q15C 4ZYLA 3H5OA 4KV7A 5KC8A 4JB0A 1KRWA 2CWDA 2PUEA 5FBKA 3BREA 3LUKA 3RQIA 2WJWA 3OLXA 4MRMB 4N41A 1QKKA 1SXHA 4TLMB 3TMYA 3TX6A 4W5QA 5TQ0A 1TLFA 2X7XA 2FEWB 4Z9AA 2CHFA 3R0JA 5DCLA 4O5AA 2L2QA 3HUUA 1D2AA 3KS9A 4RXTA 4MPTA 1TVMA 2R47A 3QLTA 2Q5CA 3MA0A 2ZAYA 1BDJA 4IMJB 1JBEA 1E6MA 5FWXA 5IUNC 3O1JC 4KNYA 3HDVA 2P4UA 3RVSA 3TD9A 1NATA 4MQFA 2L18A 3IPCA 2L19A 2MSKA 4RSMA 4Z4GA 3QELA 2A9QA 3CNBA 3H1EA 1JYFA 5EWLB 4WZZA 2LIVA 3MYYA 2RDMA 2QVGA 3N6VA 2J48A 1ZGZA 3A0RB 4MRMA 3JPYA 2NT4A 3MMNA 1PNRA 4F12A 4IMIB 1U0SY 3K9CA 1PEAA
chains in the Genus database with same CATH superfamily
3CO0S 1V41E 3P0IA 2FPSA 1XF9A 3PV0A 5SY6A 4XTCS 5JC1A 3AW9A 4J1NA 3MLBA 4C06A 3K8OE 2QV7A 2DERA 1LDNA 2OG2A 3IOCA 5D7NA 4M37A 3N3BC 4HN2A 2D1QA 4NS1A 1NBWB 4DRXA 2ZUEA 1TVKB 4GG1A 4OQXA 4ZT4A 5KSOA 2BBOA 4GL2A 4ND8B 4Y6GB 1VJTA 1AGXA 3IESA 2CGEA 2IOFK 5EI5A 3SXUB 1QVVA 3H13A 3QNMA 2P2NA 3EXIB 3MQ4A 4B87A 5EE9A 4B6PA 4XR4A 2CFTA 5L3SA 1SULA 4X91A 4CLOA 2ZIGA 4C3VA 2HLPA 2XBMA 2FP3A 5LP6C 1MRSA 1MX5A 1N6LA 2FN4A 2OSBA 3FGOA 3LPDA 5D8DA 3STXA 3C98A 2IYEA 1TCUA 5B36A 3OHMA 4WJLA 2IYZA 1AKVA 3AQ4A 2V8OA 4CE6A 5JWOA 3PTAA 2FHPA 3EOAI 3KVRA 5CLHA 3MWJA 3T38A 1V1RB 1ZA2A 4H16A 1A4XA 1GKKA 2FZ5A 5EJAA 4TM8A 1UWVA 2RHLA 2WPDD 3AKDA 4Q3KA 1D0SA 3RI3A 2G1UA 4JWKA 4E4YA 2JLCA 2OCPA 2VYND 4RY2A 5JLAA 1U1CA 1FTYA 2CLHB 2IA5A 1GPLA 1SHKA 2GILA 4NBUA 4LBVA 1GUYA 4PCUA 1YBVA 2P8JA 2DQ4A 5JVDF 4RZHA 5CDFA 3IUQA 4OSPA 2ZKLA 3AESA 5JADA 2QUAA 2C9MA 2ZUUA 1C3VA 2J7PD 3T35A 4ZYWA 1UZNA 2WICA 2IEYA 4E2XA 1P5ZB 2QY9A 3ZJ4A 1Y9ZA 1ZJZA 4NV3A 1J24A 4MULA 4GQIA 4TTSA 2O59A 2Z43A 3DDHA 4PE5B 5FUQA 2B94A 1SA0A 5JWRA 2PKRA 3EZYA 3K9WA 4RKYA 3DEJA 3ONVA 2PKWA 1M1UA 3KZKA 2W6PA 5E0KB 1JHUA 4I1RA 1V48A 2YN4A 3T9EA 4EPTA 2B5WA 4ARAA 4LJ9A 3O21A 4K6HA 5AT1A 3ZW8A 2AW3A 1XNJA 4RAOA 4FYMA 421PA 9GPBA 3ZHVA 4XR9A 4QBTA 2JFZA 3SF8B 2W98A 4NJMB 1KMIY 3ZJ5A 1S3FA 4IDNA 2XHZA 3FR8A 3BGIA 1D5CA 2AYXA 2W22A 3PJFA 4UHKA 2I6FA 4HXFB 1D1QA 2VNKA 5ETJA 5CFPA 1U8TA 1J09A 2FWRA 4QU9A 2GFQA 3HTXA 5E6RB 1CUUA 4NYMQ 1I7SB 2VT7A 4E5SA 3TLEA 1PK8A 4JOCA 3IRUA 5BXYA 3P71T 2P5SA 2JFFA 3BMNB 1YJ5A 1EGHA 4PU0A 4TN5A 4BX8A 4IXTA 1EHCA 4X84A 1TEVA 2GN4A 3ASYA 3OIUA 2IP4A 3PC8A 5AUPB 4CKWA 3ZD6A 1U65A 4IIVA 2FG7C 4XLZA 4NY1A 2UYHA 4DPLA 5JZ9A 1DG9A 1XTTA 4C0KA 3N8GA 3QU4A 5TPZA 3ROMA 3SSMA 2IS6A 2XAUA 2IK8A 5EJGA 3T3MB 1AH2A 3F96A 1T3GA 2QPAA 2WQZA 2UVPA 3UOAB 3KB8A 1QIIA 1HEIA 4TMVA 3WYAA 1M2OB 1SOVA 1QP0A 2RI6A 3MAAC 2D5LA 3EB9A 3KDPA 1E9DA 3Q10A 3Q0EA 1XSEA 4GLLA 4NPHA 5A4KA 1IEVA 2HV9A 1TD1A 1MG0A 1E77A 2VHYA 2VR1A 1VPWA 4CTNA 1KEKA 3SS8A 4CT5A 2AVDA 4TV9B 2ZWMA 4GIBA 1RYMA 1ORVA 3N0WA 3PX7A 3RW9A 2OBFA 1JT9A 5KKCA 1E9AA 1ZR2A 5FAXA 4RC9A 3UBMA 3B1KA 1UPBA 3IBFA 5LBIA 2ZYAA 5G0UA 2Z95A 4II3A 4AMUA 2R96A 8MHTA 5T4EA 3UWKA 1POXA 3H4IA 3HMKA 1ESNA 3KKZA 3PEVA 2R4TA 1J8DA 1FRQA 3PC8C 3IP5A 4P3NA 2SNIE 2UZ3A 4KN9S 5ARBA 4P4SB 5AOVA 1XI2A 4WRRA 4YQZA 5JANA 3K9BA 1PX2A 2DY1A 2XAAA 5G4LA 2EEZA 5IFKA 1G8HA 1Z0FA 1P7YA 2AJLI 3KE8A 4GGMX 4Q1DA 1WHSB 2PVSA 1JAXA 1IATA 3IMCA 4JLNA 3A1CA 2OKGA 4MRVA 2O0LA 2XSZA 2HEGA 3W2GA 2GM4A 1F8FA 4D9JA 2Q50A 4DUGA 4G97A 1ZGBA 3I4CA 1X94A 4F1KA 4LDAA 4OXXA 2ZCVA 1MAAA 1UXJA 1HDZA 2FPXA 3IPYA 3JQRA 3T5DA 4GLJA 4CQMB 1X77A 1X74A 2GF0A 2P2YA 2W6NA 1P6XA 2C2ZA 5JHGB 1VBFA 4BE9A 3T12A 1T2NA 1J0BA 2JGKA 2ZWIA 2EJVA 2PMBA 3EY9A 2JEZA 1LBHA 1Q83A 4JBLA 1XLWA 3EPRA 3GRRA 4WBNF 4NBTA 1V1MB 3DEHA 4S0XA 4Z3OA 3DWGA 4DFDA 3P5SA 4G9BA 1XU9A 3JALA 1T6YA 1UKYA 4CKZA 4R4JA 5L3ZA 1JH8A 2YRFA 1TM7E 5AVJA 3V1KA 5CD9A 1PN3A 2R6DA 4KQ1A 5BV1A 1O87A 5LA6F 1R0SA 4D5EA 2W5UA 1Y81A 4MVJG 5DRTA 3VA7A 4HMPA 2GAJA 3DBLB 1SCNE 2QENA 1T4BA 4L78A 4RADA 3QU7A 1RE1A 4JY7A 3WLKX 3RYIA 2ZQYA 5GGYA 3TLCA 4F0JA 1X13A 2IGTA 3EWAA 2OXIA 1LD3A 5DH9A 4ZYYA 5CFRA 5LQJA 4G0WA 4NU8X 1PDWA 3T99A 3GPLA 4NESA 5AM4A 1SWWA 3G3EA 3GNSA 3MMPA 4WUVA 4PYNA 4J49A 2HPHA 4OYLA 1XEXA 1A9XA 1G9TA 1SUIA 5AHWA 4DSTA 3CGWA 5A5VA 4FN4A 5HE9A 3D6AA 5HJEA 5LXTB 1X2EA 3EGDA 4PLCA 1FDSA 3LLVA 4PHHA 1U3FA 3HR8A 4TZ0A 1UH5A 5GZ3A 3HKCB 4MR8A 3HLKA 3RHFA 5KJ6A 1NVAA 3KB1A 3A8TA 4OUDA 3ANXA 4FE4A 4IJWA 3TKLA 4WFJA 3P96A 4Z1MD 2RH5A 1JFSA 3FM9A 2AFHE 1DEKA 2IPXA 4ZI2A 1KAQA 1LTQA 3OPYA 5IBQA 3QWFA 3K2IA 1GVNB 5J5AA 4LPSA 2WU0A 2CYBA 3CG4A 5A4MS 2CNOA 3KR2A 4URUR 1LQUA 3L84A 3NHZA 1S1CA 5IF3A 3BCHA 1R88A 1M2NA 5T57A 2ZJ1A 3DHWC 1GG2A 3G0GA 4XUGB 2A1IA 5AP9A 1C9NA 1QVRA 3VC1A 1XMQB 4KBYA 3PLAE 1YXMA 4KLZA 1ZDMA 1QPGA 2B30A 1SVWA 2G28A 4Q9NA 4WFKA 3Q2KA 3S40A 1ZD5A 2G5GX 1D6SA 1YACA 4ZAZA 4X6YA 3HCFA 1Y63A 3KRTA 3PEEA 3EF3A 3H16A 1G60A 1L5WA 2GARA 4MMZB 3AVXA 4UBLA 5CVJA 3P2JA 3TIXB 1W76A 1L5MA 3EIFA 3KKOA 2GLTA 3NQ41 3QHPA 3IQIX 4AMYA 4EI2A 1OBVA 2I4IA 3FPHA 3VYUB 2NV6A 3C6ZA 2JHAA 4OAPA 5BV0A 2IZOA 4LBZA 3V34A 4DA8A 4CEHA 3JAMA 5DZSA 4IDDA 3H2JA 4WCFB 1ODKA 3ZDBA 1JQAA 4M83A 4OBXA 1VA5A 2H1SA 1EP2B 4G36A 3OHSX 1ZA1A 5IVKA 1QRSA 2NVOA 1X86B 2VNSA 2NUBA 4NWIA 2XCIA 1PWYE 3GH3A 4TTRA 3PU6A 5J1TB 1K6XA 2AKYA 3WHPA 4ENPA 5I51A 1HK7A 2BBSA 3CVOA 2OFOA 5FV7A 5YASA 5F35A 2O1WA 2V74B 3KHTA 1B41A 1GTJ1 2QN9A 3DFZA 5CA1B 1QHSA 3QPVA 5B58C 5HOEA 1SELA 3O26A 4I5GA 3II6X 2LKCA 3AB3A 4JKYA 4HNRA 3VJLA 2DTDA 4JVNA 4PVCA 5HQJA 4RL6A 4AXBA 1P1BA 2MYUA 3KE9A 4H18A 5TEWA 4YMGA 2R751 3GV0A 4MB6A 3H18A 2BZ0A 2NVUA 2XMSA 3SCZA 3EF0A 3OT4A 3FWHA 2H16A 3UY4A 4HTFB 4P0QB 3TOZA 1OWNA 2OAP1 2QUBA 3DH0A 3DLHA 3HWSA 2ZB8A 3AIIA 2GM9A 2QTGA 2UZ1A 4EF4A 5HUQA 4H7KA 2ARKA 4O1IA 1EG2A 4ZDJA 4D56A 3M4YA 4Y9DA 1QRTA 3FDZB 2JG3A 1FSSA 1M2VB 2ZU6A 3BWEA 4UCXA 4V1CI 4TYYA 2Z1DA 5CITA 4IDGA 2BRUA 1X8JA 4RZ3A 1SCQA 1BXRB 3N2GB 4BGVA 2ZUWA 3HNPA 4KLCA 2IF0A 4AZ0A 3PRJA 1VP9A 2BFDB 2QLNA 1OZFA 2LD4A 2UUPA 4Q48A 3W8FA 2EKDA 1RKUA 4H7PA 5E0OA 4KWTA 3EEIA 4FBMA 4GZMA 4MUBA 1PQPA 4Y2GA 1JHXA 5B3AA 3ZXUB 5E9QA 1Y1TA 1KMHB 2PRZA 2ZYGA 2GFIA 4XUDA 2C88A 3RHSA 4RZSA 3KAPA 3L8DA 4JDUA 4Y3UA 2MYNA 5CHEA 1Z13A 4LQCA 3VTFA 1QVWA 1IXRC 4BUCA 4JVLA 3UCFA 3VO1A 5D7BA 3UANA 1E3MA 4X1OA 1QC5B 4MP8A 1EJ2A 2PIAA 5HF8A 5J5VA 3MJEA 4D3FA 1CP2A 4IXWA 2CHUA 2PWAA 3EEYA 4IG4A 3ITKA 3TKAA 2FZKA 1UEIA 4KX5A 1OY1A 3I0ZA 3LBIA 4UU7A 1DXYA 1V4NA 1T91A 2CSUA 2IXAA 3EOBI 3R2JA 4GI7A 4UBKA 5DW0A 1RHJA 1K4MA 2ANBA 2BRUC 2ORVA 3IVCA 3M89A 4UULA 4DLXA 5CDYA 2IBTA 2NXNA 4K1LA 1CQWA 1E1CA 1PKXA 3ABSB 2QRVA 3OP1A 4XSGA 5DHAA 3UJ3X 1XL1A 3W8DA 4D0GA 1MUUA 2PS0A 2ZIZA 1E7SA 2DWCA 1JG2A 2CVHA 3SIWA 2OWEA 1NYRA 5ENVA 3R5FA 4EKNB 4ENUA 4N4AA 3QX8A 1DBRA 2W2OA 3IP9A 3L6EA 4NCNA 4DE5A 1NVFA 2VHCA 2FN3A 3FY4A 2C7OA 4MUXA 3SD7A 3PCXA 5TDHA 4D45A 5BNTA 2QPLA 1DZIA 1E7WA 1H4TA 2BMFA 5HTOA 4EJFA 1I2DA 1C9EA 1S2NA 4RHYA 4LRQA 5FRDA 1VFNA 1YDEA 2HKIA 4I4LA 4GMDA 3C24A 3NHPA 3KLNA 1MO3A 4AMZA 4BMYA 1C3OB 1R4NB 1Y4ZA 1JAIA 1GITA 5FL7D 4MMXB 4JLVA 4U3JA 1V8FA 3HCEA 5CXSA 2W4MA 4MVCA 1CZNA 2C4VA 1NNUA 1NE7A 1GCIA 1WSWA 1JILA 1FP4A 5CAEB 1QGUB 3UIEA 2C9ZA 4I1YA 3HRHA 1AJEA 1XKQA 4N65A 1DIGA 1TM5E 3BF8A 3CUEF 2JEYA 3S28A 3K9GA 4EFLA 1QQAA 4HUJA 2CNDA 5ELXA 3V3TA 1OD6A 4HPWA 3Q7QA 1I36A 1XCLA 4YJ2F 3T54A 1GRNA 2Y1LA 4G81A 3SZUA 3WDMA 3UUGA 4J4TA 5EJ9A 5AW1A 5DM70 5JISA 3PQDA 1KXJA 3KSBC 3UPDA 3WZLA 1QCZA 1R8JA 4JYMA 4YY3B 1WM1A 2EBFX 4R1PA 2JIBA 5E3JA 2GPSA 1I2CA 2FMHA 2IEDA 3W5AA 2FMXA 5CCXA 4YUWA 1UADA 1Z2OX 1E1RA 2VTBA 5AKEA 3P9QA 2YHIA 3UOWA 3ZLBA 2BGMA 1R18A 2ZP1A 3FYTA 2QT9A 1RPTA 4WCDA 1T0HB 4YJFB 3IX7A 4DR6B 4K0RA 2AUTA 3L06A 3QLEA 1C7IA 3O8DA 3RJTA 3T1QA 2ZIXA 3AF0A 2PGDA 4MR7B 4DCTA 2BEUA 3W4IA 3IVMA 1Y4AE 2FZCA 5G40A 4CEIA 4JSTA 3KT0A 5K05A 3L0YA 4GPD1 1O97D 2NQTA 3D7NA 4RTKA 1Q91A 3ETGA 5C52B 3PPIA 4MWCA 1U98A 3LM8A 2XNCA 3TN7A 4ZN6A 2IOHA 3BXEA 4UXJA 3R9XA 3KT6A 4M1KA 1G7TA 2L2QA 1WW8A 1UPAA 3FWKA 2BDEA 3DOIA 4OJNA 4WLUA 4GD3Q 4EJMA 1IOWA 5I47A 1FFHA 1ZWKA 3W8NA 1IB0A 1Z47A 1DXOA 5KOJB 3K1TA 4P83A 4IMJB 2Y3IA 1JTVA 1VMAA 4NOMA 1BKDR 3O1JC 4JLJA 4KDFA 1IVNA 1XYYA 4XYGA 4YI5A 1A8IA 1ZP6A 2QTCA 2HHJA 3K73O 4HEA6 4MQFA 4PAMA 4H17A 5CGZA 3TD9A 1TCVA 2ZTHA 2L19A 2MSKA 3AP1A 5AESA 2HF9A 2FX5A 4NCKA 2AK3A 4RLHA 3SZOA 3MOGA 1B26A 5C51B 4ZEMA 3MGKA 1FVFA 3ICCA 3L0CA 1J0CA 3AIKA 4K8OA 4C0QC 1M6VB 2I78A 1IQUA 3KEMA 3P1JA 1DIOB 2VF7A 3MMNA 3R3SA 2QLJA 3PYXA 1P72A 4ZT5A 3DBRA 3BDVA 1QOQB 1K7CA 1H2YA 1GG9A 1R0CA 2W2NA 2Z9CA 1NW6A 3L1KA 3QYPA 1AE1A 2RJOA 1OWMA 3HXTA 5H02A 2VAXA 3DE1X 3GUZA 4P3XA 3FFWA 4YREA 3WLTA 4EYSA 3GLGA 3ZOZA 1J2UA 1TT5B 2WWTA 3NYQA 4NG4A 1EUZA 2AJTA 4DUPA 1A9RA 1ZMBA 2EKBA 4EVIA 3T1HB 1RCUA 5T4BA 3CBGA 5AW3A 5L40A 2ZYDA 3Q98A 2IU4A 5G0WA 3F5DA 3BFXA 4Z3KA 1A97A 2WLTA 4O2RA 3AF3A 3TM5A 1IXZA 3D6TB 5BR1A 1VIYA 3Q7IA 4P8RA 1EX7A 1O1YA 5FYDA 2OY0A 1X6VA 4G01B 5L8VA 4PCLA 4A23A 5JNRA 1DAIA 1I1OA 3GCZA 4LCJA 2ZBQA 3PQ5A 4FINA 4TTTS 3W0LB 3HJRA 2B34A 2WI8A 4I1SA 4PYIA 5DX1A 2ZI4A 4QGBA 5CRIA 5DGCA 4PZUA 1MOSA 2ZRLA 2GPJA 1U0LA 4GYWA 3IAAA 5KNBA 1V8ZA 4QDZA 2F17A 1RJ9B 3OY2A 2G9UA 2RAUA 4TMWA 4YCAA 3WK7A 4CMIB 2A9OA 5TMPA 1Z0JA 3CZQA 3NH6A 2OORA 2VA8A 4OI2A 1F60A 1EG7A 3KJXA 4R8VA 2ZLBA 5KYYB 4BEBA 1JHRA 3C41J 1JHAA 1H8HD 2ZUVA 2PFKA 4MHSA 5F76A 3UK2A 3IQWA 5K3CA 3AMVA 3V80A 1W4AA 1YAJA 3A6FA 3LUCA 4IPTA 3VR1A 4H3VA 5T6MA 1GXSA 1TC2A 3TPFA 3UUFA 3DEAA 4RPIA 3C8DA 4B6EA 1SK8A 3DOOA 3BIJA 1M8GA 4D41A 1VGRA 1DOAA 3C43A 1NY5A 1AF7A 1DQNA 2OXTA 1KORA 1TJ3A 3DLAA 5BQ3A 4KO2S 1TCCA 2JKZA 2O7VA 2CF6A 2LKDA 3CH6A 5I8ZA 1FSGA 3MT0A 6CHYA 1DV2A 4JOSA 4CDGA 3EPJA 4GXTA 4MYRA 1UBUS 4AU1A 5KQSA 1ZH6A 2NO1A 4NMMA 5KTKA 1F5NA 2YMPA 2AXPA 2IY8A 2P1ZA 4L95C 2E49A 2I7VA 1NC1A 2Q6VA 2V7EA 1Z0SA 3AJRA 3KXKA 4RGQA 3VR5A 5IRCD 2OORC 2D06A 4ZU3A 2IZ0A 2VBGA 4HDMA 1IUKA 5EPUA 3WRXA 5LYJF 1FTGA 4TT8A 3FHJA 2AF3C 2VK8A 4PRZA 1JMKC 4JJ4A 4RD0A 4YO8A 2AR0A 3D8TA 4KG7A 4I50A 2QMQA 4C0XA 1A4UA 2C8VA 3HXPA 5C31A 4XLTA 5EHNA 4XD2A 3PFGA 1G63A 1S9HA 3JWPA 4R9RA 3C7CB 2AIRA 1GPMA 2W2KB 4XYBA 3SYLA 3TSYA 2FCAA 5JBNA 4PX3A 4A82A 2Z8XA 4ZO9A 3V2IA 4LYDA 4NP6A 1MX9A 1NNSA 4PZYA 1LI4A 5D1HA 4RMJA 5F51A 1E62A 2PZLA 3QVUA 4WNYA 3KTOA 3LX5A 3CYFA 5E4FA 3PXAA 3W05A 1ABEA 1BMDA 1DKLA 1W9HA 3N2ZB 2J5KA 1AS0A 2HD4A 3GGPA 4A0GA 1MDBA 3R0XA 4FGWA 3ZDZB 4PQEA 1UXOA 4KN5A 5HP4A 4G0UA 2PGXA 3PPYA 2GCOB 2WYHA 4NF2A 1HKHA 3NOVA 1P2UA 4X7BA 4EOGA 4DSOA 3PFIA 1ZUWA 3OICA 4MJLA 3WRXC 4QNMA 3P32A 4Q9IA 4BCCA 3VOTA 1ISMA 1YVPA 5COBA 2HNBA 3T5TA 4BMXA 2O4CA 3RS9A 4P9NA 4GYYA 3TS1A 3QEBZ 5IYZA 2A5JA 4G67A 3IC5A 1XKXA 1SUWA 4FCCA 4DNOA 5KAPA 4EM6A 5BR8B 2ZRDA 4YLGA 5IS2A 3T4PA 3BT7A 2JI8A 4BECA 5AUQA 3HWWA 1KAGA 1LLUA 4E70A 4OHOA 1AGPA 1NXQA 1P3JA 2VATA 3DPIA 1NVMB 3QG5A 4HB2A 3UO8B 2K7FA 4G9EA 1UEXC 1VJDA 3KQMA 1GGJA 1Q15A 5AI4A 1NXXA 2QZ9A 3BEOA 4B46A 2EQAA 3KTFA 3LRTA 3X1WA 1N0WA 2Y1KA 3D43A 2GKOA 1NI4B 2RHTA 2RHJA 4BNKA 4DQKA 4NOKA 4OIMA 4OYHA 2AJBA 1BEZA 2XPCA 2PSHA 2XY4A 3K15A 4CR7A 3AJ9A 2HDWA 3QVGA 3MELA 3GN1A 3ESYA 3QQPA 5TF4A 1FRVA 4BS9A 4DIMA 4E5PA 3O95A 5JJ5A 1GZSA 4O2AB 2IV3A 1E89A 1ZRNA 1F0PA 5CNMA 5KYXA 4CEJB 2FOLA 1JHZA 1FS4A 2GJAA 3DUFB 4WKPA 1UMDB 4NU0A 4QBFA 4JLDA 1EXMA 3OEEA 1ORDA 2F8TA 2IU6A 3W06A 1ISGA 5M29A 3UWMA 1DBQA 1FC0A 2CW5A 2YRXA 4NZYA 1KJYA 2XADA 4LZOA 1DG3A 2RK4A 5LMCA 2QSUA 1QHYA 2IVZA 4DUGD 1W25A 1Z2EA 5AUOB 1XCPA 3F46A 1WZIA 3FTNA 2YZNA 4NL4H 5BMOA 2D8AA 4EKEA 3O4VA 3ISVA 2N0SA 3BAZA 3VOBA 3L6OO 1T24A 4UNPA 4JGGA 1TEZA 1VL1A 5HKBA 4XWAA 5K0SA 2J8ZA 4DLYA 3G6KA 3WYCA 1C30A 2V7TA 2C59A 2YV5A 3QBJA 1M0EA 2EX4A 3UBTA 2HY7A 4OQ4A 1MAVA 2PBLA 3ED1A 3EAFA 1XQVA 3PF9A 4JA2A 2C8JA 3DCYA 3ZU3A 3DMGA 3IPRA 5CIQA 1O6BA 1H05A 2QROA 4Z0PA 3W79A 2AKEA 3O4IA 1FS5A 2WEKA 4OHRA 3TE6A 5KYWA 1QPZA 4IGKA 2PLRA 2XQFA 1NW8A 5FBQB 4I08A 1I2AA 1FL9A 2IYUA 2JFWA 3KXIA 3A4YA 1Y7TA 2IKSA 1NYQA 2J3QA 4O4HF 4KXXA 4QAQA 4WY5A 1GKIA 2H11A 2VPYA 3A6GA 3I92A 3KVYA 4E5DA 2E5LB 4EBFA 5DGHA 3P0JA 2FZGA 3SF0A 3F67A 3O3CA 5CX1A 1WDTA 5U9CA 1JJVA 4MUMA 1ML3A 4P4GA 4RJIA 3DDNA 2DT5A 2DCUA 1RI1A 3ECAA 2QZPA 4P0TA 1QFZA 5GJWC 3WQHA 1ABBA 1LV8A 3QKSB 4FMCF 3DT9A 3UFXB 2A2ZA 1U4SA 3DOJA 2ZXEA 1OHHD 4YACA 4K5QA 4L5BA 2F9FA 3V7YA 2J3HA 1N9GB 2A59A 4H3KB 3KWLA 4HAXA 4C0HA 1ZWLA 4EW2A 4U5QA 4PV7A 3C48A 2JANA 4LWZA 3RCBA 1XBTA 1H2ZA 4LE2A 3AVPA 2BHRA 1QMPA 2FX3A 1KYWA 2BI4A 3IEXA 4IFBA 4OAOA 3A3YA 1R6DA 3EFOA 1J07A 1NR5A 1Q11A 1XNHA 1IOZA 3G68A 4S1PA 2YFYA 2HU7A 3KX2A 1BS1A 3FR7A 3OZRA 3IHTA 3KPUA 4YO7A 2PS9A 4KX3A 5FUWA 3W2TA 1CWUA 4ARIA 4OJYA 5EJ6A 4K9MA 3RSZA 4FOSA 1KAOA 3QE0A 4GI3A 4WNAA 3SI7A 2X6TA 4Q4HA 1WHTB 5HRCA 2JFVA 1J8FA 4OXYA 4TSRA 5TXGA 2I71A 5IDYA 2I6TA 3ZE1B 1E6LA 3H3FA 2OFXA 2XRFA 1FUIA 2ZJOA 4ZA2A 4AO6A 2AEMA 3FOBA 5ALXA 2EFDB 5A4FS 4CF6A 3ZKAA 3AUTA 2HBQA 3MHPA 3W6PA 4AUNA 4RWEA 2P68A 3E53A 1WSBA 2VDQB 4DMGA 5C8YA 4CIAA 3PFKA 4X8MA 3ESAA 2AB0A 2ZDGA 3GRKA 5IM5A 4P38A 4YMIA 1NF2A 1XAIA 2PBZA 5FI3A 3DZHA 3L1UA 1JSCA 1MXFA 2VOEA 4QYXA 2Q46A 4IP0A 4LQDA 5G1OA 4OHZA 4DJ5X 1AHPA 2ZTUA 3VV3A 2A33A 4DREA 2X8LA 1ZD3A 3RVRA 1I3OA 1OXKB 5DWDA 1IG3A 1C14A 1OPRA 4BX3A 4P4NA 2KPOA 1FXUA 4MTCA 3QEKA 1G8KA 4N0DA 4OV6B 4MGIR 5DP1A 5H4HA 2Q9BA 3IAUA 3DAYA 4NFSA 5IULC 5C53B 2NYVA 4D8TA 4UTPA 3IBCA 4E2ZA 1EDOA 1ZFNA 2E6UX 5EMHA 1GCGA 3MAJA 1RXIA 5T8KA 2JGAA 3CLSD 4P2GA 1R6AA 2FN8A 1RI2A 4PM4A 2NTVA 3ASUA 2Q5EA 4G4GA 1DMRA 5JS2A 4QUKA 5CDFE 1CPYA 1OU0A 1UK8A 1E1LA 1CQIB 1J2YA 1ZYUA 2QTTA 1RADA 2QVBA 3BYZA 3LC2O 4ZRNA 3FKSA 1K3FA 5EZ6B 3TZBA 4BV3A 5J4LA 3LYLA 5A5GA 5HDQA 4AY5A 4ESHA 1E2LA 3NS7A 2YJ3A 4EO4A 3CHYA 2BLLA 1ZVMA 3H75A 1P29A 1YDWA 2P9YA 2RKOA 3HVKA 2LTAA 5IBRA 5AK4A 4YRGA 4FU0A 1PQWA 4LV8B 1CEQA 3AR6A 3JQ7B 3N7UA 3CPEA 1DCTA 3B2NA 3NH9A 3IT1A 2HV8A 3ZBTA 3B1JA 3ORHA 1F9EA 3VNAA 2O07A 1N6RA 3NUGA 4W8OA 1RQGA 1TYBE 5JC8A 1FFGA 4XOUA 1GNLA 3VOAA 3S2FA 4FDTA 4YUXA 1KDTA 2FZVA 4LHZA 3U6BA 5SYMA 4RHXA 1U99A 1L9KA 3A6KA 5T8KC 4BMVA 1XMXA 4B82A 1ZPDA 1A5AB 4D4IA 3IMGA 4W9RA 4RH1A 4DXAA 3BHJA 1BJRE 1JEYB 1JHYA 1EUDA 3NM6B 1U7TA 3GMTA 4TSFD 4OJTA 1ADJA 3V9PA 1CRPA 5KU1A 2HZBA 1A77A 3W1EA 1EDZA 5CDTA 3U4AA 3VZQA 4BO4A 4BKPA 1I1QB 2CZQA 2WD8A 3LX4A 3ZIUA 1KH3A 2C2YA 2WHEA 4UCFA 4P7BA 1GYRA 3F5MA 3KQYA 3BRWD 3Q8XB 1XMJA 9ABPA 2XTAA 4TLDA 1K9VF 2FGKA 3NORA 4A9AA 1L5HB 3LUHA 4QSMA 4C6TA 2VUHB 1K7YA 4M0UA 2IPOA 1DAFA 3FLAA 2FTKE 4P7JA 3DNMA 4RX1A 3TQTA 3LO5A 4MCAA 3VO2A 3X2EA 4DANA 1M72A 2BEWA 1NMYA 3IKMB 3LXMA 2JIOA 3RD5A 2P5YA 1ADCA 1F8XA 4UNRA 4AROA 3IEUA 3FSJX 4R1UA 2AYYA 2IQIA 2WKPA 4KODA 1K0FA 1U90A 4YJ3F 4RZUA 4MVXA 5IVDA 2C8KA 2RAFA 2RGNA 2O2CA 3FUWA 3OCXA 1ZSNA 1NI3A 1G1AA 3UMCA 3DONA 5I01A 4RMIA 2EG5A 2AS0A 3SXUA 3NAGA 1JFFB 3WX0A 3F47A 1G18A 4RA9A 1M1YB 3JYPA 1FQOA 1JKFA 2WSIA 2LGJA 1ECFA 3KYDA 3KZXA 3B52X 3L4KA 1XTBA 1QQ6A 3BX1A 2TS1A 4MRAA 1QIMA 2D2VA 1K06A 3P4XA 1XPUA 1HDCA 1TO6A 3KM0A 3HVIA 2FEKA 2I2FA 1JVSA 4IJ5A 5BSWA 1GTRA 1TQ2A 4E21A 1W36D 1Q0HA 1O89A 2BFNA 3D4IA 2XXAA 2WU8A 1V1RA 4K9OA 5ALYA 1PAUA 1OZ0A 5AOBA 3CIOA 3WWZA 4EFKA 5BW4A 3GRYA 2NWQA 1B73A 5JVDA 3WYGA 1C0IA 3TBFA 3QA3E 3EXG2 4K3VA 4Q37A 2BGTA 2CE7A 2W8BB 2FHSA 4HNAA 4NJOA 2JIPA 1G5RA 1WCWA 3BWVA 3DBVO 4UBMA 2QR3A 1T1RA 3A6HA 1CU1A 3OPYI 3HDYA 4EKGA 4KAFA 1U28A 4C3UA 1NJ1A 2RGNC 3NI2A 4K6OA 5LQSA 3UYLA 4BWFB 1AUOA 3V2GA 3IPAA 4PHCA 1KSGA 3NC4A 4AJ9A 4H1HA 3EC2A 3NCTA 4ZRMA 4PAGA 4L27A 4QOGA 4ZCLA 1PFQA 3VO9A 4ETMA 1LDMA 2M6LA 1H2EA 5HVNA 5TGZA 3GDWA 1GPYA 1GR0A 1MX1A 3H2BA 5FWAA 3GDFA 1QQ7A 1W46A 4ADSG 4CKBA 5KJEA 2D2EA 2Z5LA 5BQ5A 1SVMA 4PLGA 1NP3A 2FMIA 2RJ3A 3E2PA 4C9BA 4CVNA 2ADMA 1DEOA 2VPZA 4XGNA 3ZNQA 1IHDA 3TNYA 3GT3A 3TIFA 4U8HA 2O8BA 2QPTA 5EXPA 1P1CA 2XTZA 3R75A 2HSJA 3CKKA 4RACA 3TX6A 3RUAA 3SF8A 4YWJA 3RBAA 3FVVA 2X7XA 2XYPA 1EB9A 5IJ9A 1U28C 1YB6A 2ZJBA 3PF8A 4A03A 2ONZA 3U9LA 3CT6A 4BQRA 4F93B 4CM4A 2PA3A 1IZZA 5BW5A 4TS9A 4C29A 2WJYA 3MRTA 5H4GA 2PKYX 1EK5A 2VJPA 3BMNA 3JVVA 1RSZA 2GD0A 4IHAA 5EOVA 1E3TA 4TTQA 1X8KA 2FF7A 2L18A 3BFPA 3K0AA 4C4AA 5K09A 2G9ZA 3TTYA 4Z4GA 2RK6A 3E22B 2VF5X 4YRIA 4PG7A 3H1EA 3NBZC 4N3NA 3QVMA 5H59A 3GLIA 2OE2A 4UHHA 3Q4GA 4KBFA 1ESEA 4Q9AA 4U7FA 1JQEA 5IW8A 1JU9A 2HIMA 2ZT6A 4K6MA 5LMNB 1O96B 4JDPA 1MC5A 2XUDA 16PKA 1DAMA 2IRWA 1WD5A 2Y0PA 1FUEA 4F2HA 3LBAA 3WMWA 4KQWA 2OG1A 3K9CA 2B69A 1RD4A 2NU9B 1FA9A 4BATA 2GRAA 1L3BA 4TV9A 2DR3A 4P54A 2OM2A 4NMLA 4KQIA 2D2FA 1JG4A 3GT0A 4MUIA 4O3FA 5THKA 2X0DA 5KOYA 1AZWA 4Y1FA 3VSCA 1IQRA 1D6JA 3EXG1 1K88A 3JPWA 4FTWA 1T3TA 2O19A 2H2GA 3D54D 4B44A 4EEKA 4FMBB 4NCIA 1MORA 3ENVA 3M0EA 3NATA 1XR3A 3P0RA 1GIAA 1QORA 1N36B 2RK3A 5AHKA 3WIOA 1WZEA 3PXGA 1K9SA 1PS8A 1YGYA 1VPDA 3ZE9A 4L4RA 5GP1A 1J8YF 1HUQA 1XEWX 4WA7A 4TSKA 4M0EA 4DMKA 2O3SA 4X3PA 3WLLA 4RLSA 4PS1A 1EQAA 2Z58A 2TRSB 4A10A 2I7DA 3AM1A 4BRUA 4D43A 5ALWA 5ESRA 3O90A 3THYB 4XX0B 4KYVA 3MWGA 5FNVB 3PQ6A 4FSXA 3KHSA 4QO8A 1YMUA 1Q7GA 3V4LA 1KFEB 1EVLA 4WBNA 3ADKA 2PLAA 4OAQA 4TLCA 3SM3A 1T36A 3IPXA 4CQMA 2J0SA 4X1IB 1P5RA 3V4RA 4FJ1A 1PTKA 1P2DA 2BSXA 3H6GA 5FOXA 1XK7A 2R7MA 3JRWA 4KR0A 4PYRA 4MYSA 2WSYB 4B3TB 4INOA 3ADCA 3UAVA 4PC2A 5FWYB 1QTQA 2ZW9A 3MS7A 4MW5A 1QJ4A 2BFPA 2DJIA 3AVQA 2GWRA 1QIHA 1RW4A 1SGWA 5KNBD 3CUSA 5EWMB 4H7EA 3MOSA 3GHHA 4KQEA 3WRYC 1WABA 2C5FA 2W48A 4CLHA 1RQPA 4Y1EA 4J4BA 1NHWA 3AGPA 2ZRHA 3NRCA 4NAVA 5SZKB 2LUOA 2OLJA 3QVXA 4BZWA 3DE0X 1OXVA 3EVBA 4NABA 2IS4A 3OF3A 3DBLA 5KQGA 3NIGB 1TMOA 4FHZA 4M1QA 5B3LA 3WOVA 1L8XA 2MCFA 3KZMA 1P2BA 3J7AC 2IX3A 2RCNA 3O4RA 4KSYA 4HNGA 3BWCA 2I8LA 5ESWA 4PSDA 3H8JA 3LWBA 2RC5A 4UASA 2LZ0A 4V0KA 3ZVKA 4J0IA 1C50A 2X5JO 4OQMA 3U4GA 2QLTA 1D8TA 2G6BA 3OIFA 4DG5A 5LXTA 5AM0A 1P7VA 2VJNA 3AHGA 1IRXA 3CV3A 5DHQA 5REQB 2RJNA 1BWSA 2ZR8A 3RBVA 3OTOB 3O0TA 4GLFA 1UC9A 2HQRA 1LBIA 2AC4A 1E6KA 2FW7A 4DTIA 1XMVA 4X97A 4NE9A 5ELMA 3VR5D 3AEUA 3FJ1A 3EVTA 3ULKA 1MDFA 3ZTYA 4C05A 5I9NA 4KPEC 2W6IA 5D01A 3TFOA 1DDGA 1S9DA 3Q3GE 4C0LA 3LVBA 4JIGA 1V8OA 2F1RA 2OP0A 1BX3A 3OZAA 4BX2A 2NT3A 5CT4A 1Y8AA 2DLNA 4JVOA 1K92A 1V96A 3SBDA 2WJ3A 1E59A 2WWVD 3ZGNA 3HN2A 2AMJA 3U3OA 4KV9A 1UQTA 2YZGA 3FAKA 5EMJA 4S24A 3LG2A 5TJ9A 1YRLA 3ZN2A 4KHPB 1IWPB 2H51A 2B25A 3GMDA 3MINA 3N76A 3WAJA 5GJBA 1SKAA 4L72A 2BGRA 2K5UA 1GOTA 2N46A 3D5EA 1QAMA 2W2XA 3TL6A 3UN1A 2I33A 2B35A 1Q20A 3G2QA 3MBKA 3EPLA 1P1FA 2HEIA 2B8TA 3IP7A 4LZLA 3FSRA 3WLRA 3GT7A 4XWGA 4F1WA 3MGAA 1KJWA 1C9YA 3C5EA 3TZLA 1FRZA 4DEXA 4XZ3A 3H42B 2V5UA 2BZSA 4L0CA 4E13A 4GOKA 3KT8A 1EP1B 2DWQA 3ILVA 3OUTA 3MJSA 2WWWA 4QARA 3SC2A 5JTUA 1JJIA 4WCFA 2D7DA 4MVYA 1USVA 1BWQA 4B84A 2H57A 2WB4A 3VZSA 3B6KA 4ZVOA 4ESVA 2C94A 6GPBA 4J16A 3ANMA 1DUSA 3BH7A 4E14A 1IVSA 1DBPA 3QX7A 4KQKA 1PR6A 3BFJA 3EVZA 1YK0A 1CE8B 3H9GA 3ONEA 2YWFA 1MGOA 3DQQA 3PDIB 1AV7A 4IRXA 4WK0B 2VXYA 2O8DB 2F7SA 2B8WA 5HKKA 2B4QA 3PUKA 3W1WA 4S04A 1FMJA 2F62A 1P17A 2OBNA 4D9CA 2B7CA 2W00A 4RJTA 4RTNA 4UUNA 3WB1A 5IM4F 3RSSA 5JG7A 2UUCB 1DRWA 2ACKA 3LW8A 5H82A 3ZGXA 3L7MA 5FFNA 4HTFA 3R6DA 1EM6A 3DM9B 2AL7A 4EY7A 6ADHA 4DBLC 3F5FA 2XTJA 1MIHA 2I8CA 5AWFC 4DLLA 5A2QA 3IOBA 4WCFC 3M8KA 3T41A 4BNGA 3RS0A 1CJMA 3AXSA 4BC0A 2QYTA 5FTJA 4J16C 1ZXBA 3FPKA 3EASA 4JVMA 4Q47A 4U9HS 1I2ZA 5AXCA 4HNUA 2AEJA 1YU6A 4WOBA 2DGDA 5CLGA 3DTVB 1JS1X 3RUDA 3I9NA 1M8FA 1S0UA 2PYIA 3HWX1 4EB6A 1P0PA 1BXRA 4M9UA 4RESA 3N2GA 5K03A 2WD7B 4HWOA 3TG2A 3FNQA 1GQQA 3H5TA 4PZDA 4B9AA 4DJJA 3SGLA 2JHCA 4NS4A 1QO0A 2XBUA 3QF7A 3K0CA 2VF2A 4LFAB 1NNI1 3TGPA 4OB8A 5LBUA 3ZYZA 3OESA 4S2EA 1KMHA 1QB8A 2PQ0A 4DRZA 4Z4IA 2FQXA 2MSDB 2ORED 3U56A 3L43A 3PENA 2ZVJA 1G9XA 3TUIC 4MWEA 4KB5A 1VJGA 2MSNA 3B36A 3OKPA 1SAYA 1PJ4A 3L40A 4KIJA 5HZGA 4YIKA 1H6DA 1MHTA 3FXAA 3TRIA 4EW3A 1KOFA 4DY6A 3PGVA 3DVRX 3IILA 4HGPA 3AFIA 3TKYA 3ZWMA 2NU7B 1IVYA 2VDJA 1PYOA 1RYFA 1T4MA 3CM0A 3WA7A 1WDMA 1YS6A 4NFLA 4EO9A 1ATZA 4P93A 2PSDA 1Q2XA 4FMDF 5ALOA 5SICE 4E3WA 1E2BA 3E2MA 4C4TA 3F7TA 1T2CA 4CHGA 5E7IA 3MC1A 1QCDA 1Z15A 2IPLA 2Q9CA 3L1VA 4MI1A 4W5RA 2I91A 3IMEA 4WX2B 5H16A 3K0CC 1KGSA 3EK2A 5LDHA 1US8B 5ALUA 2V98A 3UH0A 2XUGA 1EXDA 4J9VA 5LMUB 2C4HA 5K0LA 3WGHA 1AB5A 1LTHR 3QM1A 5HZHA 1JKXA 3ICQB 1OVMA 2DP4E 1Z0ZA 4O0MA 3FMVA 4Q4LA 4W5JA 1YQTA 2X2EA 4YAGA 1J2TA 2VQFB 2GEKA 3FCAA 4PAWA 2OMEA 1C3OA 2YN0A 1MRNA 4ZO7A 2QG9A 2BV3A 4YJ2A 1F0YA 1AK2A 1IONA 2Z2XA 3BA1A 2FEMA 3GJQA 4MGKR 3AB7A 3Q72A 3QF4B 3JATA 4PHTA 2NG1A 3OF2A 5BNIA 1XZMA 1QGUA 5DYWA 2G9NA 1DI0A 3D6UA 2X9NA 1DIHA 3Q5GA 4YC7A 3MGGA 3AEZA 4X8OA 1QH1B 1YZNA 2HFKA 3DZKA 2H92A 3OLCX 2BLNA 4N5IX 3RFVA 4KJXA 2D0IA 2FPKA 2HO5A 3LRPA 2ZRCA 1USKA 2YQZA 3PGMA 4LX0A 3G0HA 5FF9A 1U0RA 3IIEA 5JXWA 4HXYA 2GXUA 3B89A 1XD2B 3IV9A 3E0QA 1HE2A 2GPTA 4S05A 2ZM6B 5LYYA 2W42A 3DBHA 4GPEA 1DRJA 1CR4A 4E09A 4KAAA 1BVUA 2C9DA 3A0UA 3DS8A 1HH4A 2R5WA 5BVHA 4HR7A 5CB0A 2J59A 1W59A 1A4RA 1KVRA 1P3Y1 4KE9A 3VYRB 2GJ9A 1MA0A 3BBLA 1L1EA 4NOLA 2UYOA 2XJ9A 3B5IA 3CR7A 5JMOA 2J5BA 1I1NA 1S7GA 4IQFA 3QYAA 3ME5A 2PGNA 3QWBA 4PZZA 4YA6A 3UMGA 3V4OA 3Q2OA 2C2WA 2C57A 4EW6A 3ANNA 1YR6A 3HXKA 4QLBA 3WHIA 4C1NA 5JAIA 1NW9B 4MR7A 3GLFA 3DE5X 1Q50A 3GGCA 4L9SA 2H0RA 2DWOA 1PGOA 1X7YA 2VJMA 3A9UA 4L76A 3WL6A 4E6EA 1CBUA 1CC1S 5DF1A 3WIDA 2C9YA 4QPJC 4AI6A 1QQ5A 4B6SA 1ISIA 2XV1A 3B8HA 1A2QA 1WBDA 2YASA 4LVOA 4AQDA 1UDRA 5LLSA 5CK5A 4F3NA 1PGJA 4OB6A 5AW5A 3HP4A 1P9OA 1HQKA 3MWLA 1EFVB 3JVIA 5EMMA 5L3VA 1XTSA 3PDCA 4DLZA 1DUVG 1OMOA 3KTDA 1N34B 1H3FA 3DAGA 4UAVA 4WXRA 2IXDA 3GPDG 4TVBA 2PMEA 3FKSD 4QLAA 4M53A 4NBWA 3B82A 1YJCA 3GDOA 4U39A 3R7AA 5C1DA 1PR4A 1XNQB 3RS7A 4EP1A 2F3RA 1CUWA 5F64A 1ULTA 3GLRA 4L4SA 4B73A 1W96A 1U04A 2WF8A 3HNOA 4GS5A 4N8DA 5BWBA 1N5JA 3GEEA 2GJKA 1U9IA 1V26A 4S1TA 4CETA 1Z7WA 2OUKA 3R7LA 1ZJ4A 3PGLA 2WB2A 3OUZA 1UEJA 5JNSA 1OZHA 4B3RB 2JLWA 4LFBB 2FG6C 4MAMA 1JDPA 4K28A 1M6VA 3CINA 4PW0A 3F6RA 3HKDB 3NHJA 2VF8A 1WPRA 3L04A 3QVJA 5I9LA 5IDQA 2X8WA 5I5EA 2FWPA 1P5JA 2E55A 3G7SA 4EUKA 1Z4PX 2EKLA 1CY7A 4LWPA 3QJGA 4JXXA 3M33A 1KAEA 1OLOA 2YHAA 3VDRA 4M0MA 1DQPA 3IR5A 1ZNQO 3W2EA 2FDXA 3F7OA 1CULC 1GHTA 4YHBA 1QUEA 4PG5A 3MHTA 1EFCA 3DKKA 1ZM7A 3OPMA 1AURA 4JLMA 4PTZA 5IARA 3VZBA 5KVVA 3AERA 3OPQA 1THMA 3QP9A 1W4BA 5FO0A 1RJFA 1UZAA 4GMFA 1V47A 1H9AA 1DKNA 3CCCA 1RLUA 1ZNXA 4PLTA 2FPMA 1U9IC 2I8AA 4E03A 4IEEA 4XGKA 2QWXA 1Q3KA 4NX2A 4F2GA 2OZLB 4ZVPA 1ARZA 3L4EA 4QPPA 1Z82A 4QBHA 3M6UA 4GYKA 4O25A 3EFEA 4DLAA 4M9QA 1YE3A 4K86A 4UUMA 1WKVA 3PC6A 1EVYA 2D1YA 4PFKA 3LY5A 4Y9UA 5IK2A 4JXZA 2AMVA 1GILA 1CY6A 4R6XA 4X20B 1E2FA 1KRHA 1UOQA 4JR2A 4RYLA 5FP0A 3VSAA 5AVYA 2AJCA 2IH5A 5FCDA 3CE9A 3IEVA 5AM5A 3RIYA 1AS3A 3W2IA 1WCIA 4P82A 5KYYA 5GGXA 3JD3A 3P2EA 5FUXA 2CD9A 1P0MA 5EIBD 2HCFA 4Y6LA 2DJ5A 5MN5A 4MP3A 1EFAA 3FRJA 1T4GA 1G17A 4G0QA 1RRCA 1UAAA 3RGGA 2EBUA 5CVTA 5B7QA 3ER6A 1YZYA 1XO1A 1IHXA 1MC8A 2VT2A 5EWJB 1TI7A 5K45A 3G02A 1CIVA 1L1QA 3CF6R 4IHJF 5TRTA 2GASA 3RIHA 4DM7A 3AWIA 5D00A 4D57A 1TUGA 4EQ6B 2HHHB 1E2IA 4Q7MB 2G0AA 1ODTC 4GMKA 2ZRGA 1TIBA 2W6JA 1O9BA 1RLJA 5LYJA 4WZAB 2AKAB 3CRMA 1P9NA 2FKNA 3P9XA 2ONJA 4RE5A 1Z62A 4AJHA 6REQB 3AGQA 5FADA 1PFUA 1ECJA 4KMOA 1NN3A 2C5AA 1USGA 1UXKA 2PO5A 1Q5PA 2R1UA 2O23A 3EEFA 1YR9A 5AI8A 2XNHA 1NL3A 5DNEA 4DGSA 4LPKA 5JYDA 2AG8A 3JQGA 5D3QA 2II6A 2OAGA 3KOOA 5C8ZA 3L41A 2A0WA 5DX0A 4E3ZA 5EKUA 3IAM1 3BREA 3V8EA 2QTAA 4MQMA 4LOJA 4W82A 2XYGA 3CGGA 3QOFA 2I29A 1F1BA 4U7WA 1B6TA 4M0KA 3A28A 5CG2A 3CWZA 5DCLA 1S3SA 4DCOA 3BJEA 4PC3A 3ZWWA 5BOSB 3NGMA 3GAZA 1E2NA 2V6GA 3TGWA 1JPJA 2HF8A 3TIVA 3AK4A 3DAHA 4TPKA 1QH8B 1QIDA 2AHOA 1CV2A 3MA0A 4Z2YA 1H94A 4EHHA 2ACEA 1MIOA 1NWCA 1VIDA 1G16A 2WU1A 4DUZB 1JFRA 4DG9A 4HLDA 2XHEA 2EKQA 1HDEA 1A8PA 5H3HA 1K5GA 1WOMA 1ISFA 3HN6A 2QP4A 3PXXA 3JD0A 2YC4C 3JAKB 3N0TA 1IUNA 3INNA 5DYGA 1N2GA 2AQ8A 2WV7A 2GZSA 3PDHA 5T6BA 4DJFC 4CR8A 1ETUA 4R8LA 5EJEA 4HX9A 2YWDA 4BQEA 3NXKA 1NKTA 1VIMA 1WQ3A 1BE6A 2WHXA 1WZUA 4P3YA 1QWOA 4IMIB 1Y8QB 5JH7F 3FW1A 3ZI0A 5HE8A 2X42A 1M54A 4DYVA 3LCVB 2APJA 1H23A 4UM9B 1J0DA 4ENVA 2RE8A 1D4AA 4MYCA 1EVQA 2VZ9A 4JI4B 3CH5A 4TTIA 1NW5A 1YL5A 3NP9A 3GROA 3ITDA 4JMLA 4LSGA 4LE0A 1J33A 1E4EA 2HMTA 5EUMA 1KZGB 3FLEA 5ESXA 3RRZA 4XWOA 1Q0TA 1Y37A 5TF0A 3V8RA 4L1KA 3OKFA 1KI9A 3H1PA 4CM7A 3TAHA 1T3ZA 1E20A 3LQ4A 5C9ZA 4R5MA 5EJMA 1ACMA 3T3DA 3FDFA 1U3VA 3L4SO 3LF2A 1GGHA 2O5VA 3O9MA 4WVFA 3CKLA 5TMBA 4NATA 3VAAA 4XRRA 1AKQA 2OOKA 1QQTA 2VT3A 4LDJA 4MWOA 3CPHA 5TSDA 3N2NA 2P3SA 3TW0A 1NI4A 2W9XA 2HF2A 2HFJA 3FHOA 1OI7A 3KKEA 4DW8A 4LHSA 1TXGA 4Y2YA 1R2QA 3L8MA 2JJQA 1Y5IA 2EWMA 5GZ6A 3ZWNA 1AKEA 1R4AA 4LGVA 3U7GA 1KK0A 3OWOA 1YRAA 4MQEB 3B70A 3R20A 5LQMA 3U7QB 3A4NA 2B3TA 3JS5A 2DPXA 1V1JA 2EWWA 4CEJA 2QTNA 1V3TA 3GRVA 2GSDA 1YIAA 4GSYA 1QHNA 1P73A 3V7UA 4RIIA 8GPBA 1XFDA 3TAUA 3E7XA 2QQ5A 5F2OA 2AW5A 3HL4A 3T7IA 1LK7A 5AO9A 2DFNA 3UHPA 4E5UA 2OD2A 3F71A 1CB7A 3MERA 5CB4B 3RT7A 1RXVA 3W6ZA 1MO5A 1K5PA 3O94A 5FD8A 4QZVA 1P2FA 3RYCB 1CY4A 2DHRA 3ZBUA 5AVOA 5JQGB 3FFBA 5BO5A 1NZDA 4EATA 1BVYF 3PDWA 3O83A 3AUXA 4HSGA 5EUQB 1EI9A 4TT3A 4RKWA 1II0A 1OUMA 2QM8A 3BJMA 1C0KA 3KJFA 1S6YA 5ILQA 1RM0A 1JN0A 1ZRSA 3V3KA 1Y89A 1VM6A 2Q07A 2Q6IA 4R8RA 5A9SB 1IAQA 1IN4A 1ZUIA 4BNNA 1JT2A 1DADA 3R77A 3CVWA 4I2NA 1K8RA 2FH5B 3UMMA 3E3OA 1AUPA 3GEDA 1MB3A 2NUAA 3NVMB 2YXPX 3UJHA 2ZQ5A 3UAZA 5KO2A 4WUTA 1GRVA 1GR1A 3BB4A 2OHXA 4CDNA 4INJA 3RRYA 2G4VA 1LY1A 4AJPA 1D0IA 4D8XA 4B0PA 3A1FA 4I55F 5D2CA 3FD8A 3M9LA 4WADA 2WVJA 4JH0A 1M8KA 1YFZA 4PQFA 5AH0A 1UC5B 3AIOA 3WDSA 5JI3E 4P98A 5FPSA 3I9KA 4XWKA 1B15A 5DVZA 1NT2A 3V1YA 1UOPA 3GVHA 2G04A 4UD2A 3ROKA 1F6BA 1SUEA 1T29A 1E0SA 1U2EA 2O2JA 4JJGA 2JEOA 3PSHA 1MQ8B 1B0UA 4M86A 4Q3LA 4QTUB 4Y0AA 1TK3A 2AJ8A 5F4BA 1HSOA 3RVNA 3UFXA 2QJFA 5FUYA 2HUPA 4Y2VA 1U8EA 3TUJC 1EA7A 1ZITA 1SCKA 3NIFB 1K7EB 1K97A 1T13A 1N9GA 1MMFB 3RANA 1T3SA 2Y6VA 1P1HA 3MWEA 3D4PA 4CLEA 4W1RA 4NBVA 1REQB 2B21A 1S3GA 2AOTB 1G4AE 1CFJA 1UKZA 2CXHA 4GBGA 13PKA 1ZLXA 1FFBA 1WQ1R 5K4AA 4E12A 1PHRA 2IYXA 5E4JA 1C5KA 4AK9A 1A7UA 3VAZA 3ZXSA 3HY3A 4LJ6A 2YW2A 4CKXA 4V03A 3WE7A 4DIKA 4AS1A 2Q3LA 4HWKA 2Q8PA 3ZR4B 3VQTA 3COYA 1U1DA 2CL0X 3DCNA 4W5TA 5DGTA 2W6ID 2GLUA 5CVUA 5CFNA 4DUYB 2EZUA 4L75A 2GZMA 5FAKA 4ER6A 2FKAA 4NPAA 4BGDA 3LQ1A 2JGJA 3U3MA 4M1ZA 3LDAA 5I6DA 1LI7A 2PYDA 4BQOA 5BQFA 1M5TA 1AKWA 3KYBA 1GV1A 1ZK4A 3H2GA 4PZPA 5CD1A 2V6MA 5TQVA 3U7EB 1AD2A 5H7XA 2ZUCA 4BY9E 2FUCA 1IBCA 1SOUA 1RHUA 1F2UB 4BN0A 4K9RA 1UM9B 5FOVA 3UJAA 2GHRA 3R3VA 5JFOA 2P4EA 4FFBB 1EXWA 5BN3A 1JSZA 4YWHA 1FJ2A 4UDXX 3T52A 2VL7A 1A5SB 2B4AA 4R98A 3TSWA 4Y8VA 1T8UA 3A7EA 1ABFA 2X14A 3IVXA 3NM4A 4QNRA 4EYKA 2QUHA 1E8NA 1L5ZA 2EP5A 2FQ1A 1P4HA 2H48A 3GDHA 4AX4A 4XB2A 2AOXA 3F6PA 2RI1A 3PNKA 2VSOA 3EGEA 4B7XA 1ORRA 1LNSA 3D3WB 1LS6A 4QYMA 4KBGA 3HA3A 3DHVA 5JD4A 4C7OB 3R7NA 3PKIA 1D5WA 3BF7A 2JGIA 4M1YA 1NURA 4CM8A 1L0BA 4X64B 2E1PA 4G24A 3ZZUA 1YFKA 2GXAA 1N2HA 4BTLA 1XQYA 3LBNA 4ZVKA 4ZAYA 3OTQA 4C04A 2Y1EA 5HKKD 1BU5A 5KZMB 1S8OA 4M6WB 1EWRA 2ILTA 3K4QA 1Z7BA 2WR8A 1AHIA 4B80A 4JNKA 3EPPA 1MH9A 5L6MB 4I1IA 2DR2A 3W04A 1N5MA 3AJEA 2PSEA 4BMPB 4ZCRA 3FMIA 3NHFA 3ZI4A 3GNLA 4N48A 2K2WA 1T26A 3LH5A 4EVSA 1YTUA 1P80A 3QVVA 4LYAA 1R6VA 3MGCA 2QRLA 5THQA 1RLIA 2FSGA 5FBWB 2X23A 2LWIA 1TTQB 2NU6B 4DJAA 5KTSA 1G2PA 5AHRA 1XFAA 3CRW1 3VUFA 1SBIA 5ALFA 1C3LA 4YRPA 4LF5B 4AJNA 2X7JA 1NPDA 4A73A 4QG3A 2ECOA 3AHDA 2OV1A 4KMSA 3MIZA 5FPQA 4ACBA 4ETIA 2ZJ2A 1TVEA 2LBPA 4V0QA 2P2DA 4LNAA 4OHPA 3S70A 1B8VA 4LOAA 5BQXA 2Q0SA 3ABOB 3F4LA 2V1XA 4LZPA 2IV7A 5C7OO 1PGPA 2BDTA 1JHVA 3K0KA 4YPOA 1JEYA 4BO8A 3ZWOA 2AFRA 4L85A 4ZZ2A 4MAAA 2NUTA 3QIVA 1RYYA 2OXEA 4UUAA 2QAGB 5CYPA 5G53C 2PJUA 2JJ2A 1G3RA 5ALKA 1P33A 1FLVA 3CEJA 3GFBA 2XKBA 3JVEA 1YQEA 1U2QA 3C6YA 2GTPA 1ZM2A 3O6VA 3PGA1 3ZWQA 1OFIA 3TE7A 1QO0D 5DYIA 1WUIS 2FXVA 3FWPA 2AZ4A 4B7CA 1U0FA 3Q3IA 1E7RA 1VYTA 2QRUA 1BVRA 1RM4A 4YJ3A 5ANRB 3C5WP 1OU4A 3FYSA 2C82A 4PNHA 3SEQA 5GVSA 1ISJA 5DTIA 1L5HA 3GLIE 2EBHX 1QYVA 1GQRA 4BEJA 4GE3A 4D9MA 1CS0B 2ECFA 5EA2A 5EXSA 2VAVA 3SP1A 2E4VA 2Z6VA 1A9SA 3C3MA 4TKZA 3L8YA 4R54A 3ACDA 4H15A 4OM8A 2WWXA 4ZYTA 2HQOA 5J2UF 4YXWD 1HSZA 4A0HA 2SCUB 1YIOA 4AS2A 4GC9A 3EIOA 5AJHA 3WV5A 2LXNA 1L7RA 4G0NA 1VPEA 3KVNA 3RVDA 1MJHA 1M2EA 4RL4A 1MW9X 1XDUA 3I30X 4J7AA 1A9TA 4N9QA 3RU3A 3TTXA 1ZU4A 7ADHA 4Y6PA 1KY5A 1DOHA 1BS2A 2A1UB 4QGSA 4A16A 4D9KA 4QEKA 2E4UA 3RVQA 2R68A 1NIPA 3WGTA 5ALSA 4QHYA 4RCYA 4KAJA 4DA6A 1IEQA 1TQDA 1P1IA 1WXFA 2DUNA 9LDTA 4BXOB 5C7IO 2O7RA 2IPMA 3LBFA 5E6SB 3DOHA 3I2IA 4TL6A 2D1TA 2JAUA 1ZBDA 4RZQA 1IN8A 1N7JA 4BLSA 1Z83A 1MB4A 1J99A 2JLSA 4OMUA 3B6EA 1YZVA 2XKAA 3OEYA 1KIMA 2XWBF 4OATA 4WXYB 2WNIA 2YJTD 1IHUA 2A5DA 2WJAA 4LNUA 2XECA 4QUIA 1UPFA 4R1NA 4REQB 4BJHB 1YKSA 4BDSA 2D5CA 2RHBA 2C7RA 4LF8B 2VJYA 1IK4A 2AI1A 2OCYC 3LECA 3FG9A 3ICOA 1ZH2A 1EJ0A 3VH3A 1I9CA 2GD6A 2WF9A 5FH9A 1KYQA 2CYCA 3UGTA 4AZ3B 4TN1A 3S3TA 3JYQA 1WY7A 5FUVA 2OILA 2I87A 2OR3A 2QUJA 4N54A 1LV7A 3JQDA 1FDUA 4BP8A 4UJ5A 1EFRD 2O8EA 4PO8A 2WWHA 3A9CA 3SHVA 1KDOA 3THSA 3A9SA 3W6UA 1J9ZA 3ZOKA 3W3AH 1XN4A 1G38A 2WIFA 3WFZA 2ZZNA 4GGPA 1T25A 5HQ3B 2OO5A 2YJ5A 1SVLA 5IEBA 1GTG1 2X1LA 4FZ3A 5CYGA 1FQJA 2E5WA 2H9IA 3HBLA 4MV5A 4W1SA 3ABRB 2YDXA 3BJRA 1ZGCA 1PWHA 2XNDA 1QHGA 2A58A 4EENA 1T6XA 3PUXA 5LFAA 5L7TA 1ZIDA 1ILWA 2Z2IA 1HURA 3U80A 1W44A 2F6RA 4MPPA 4ISCA 4WSOA 4YJGA 3AUUA 2CEAA 2FEOA 1L7AA 2DFLA 3DPUA 3EIWA 4DDWA 1ISHA 2A78A 2DKNA 3FCCA 1TA4A 3GLHE 1DSSG 3VSEA 1KXZA 2EZ4A 4KR9A 3N70A 3FZEA 3T15A 2IWRA 1E2GA 3VPCA 2RCYA 5LQCA 2AEEA 1CEYA 5LU9A 4DC0A 1QDEA 5E1OA 1FOEB 3MSXA 3ZV4A 2Q5OA 4FN5A 4B3IA 1UFVA 4C88A 1O96A 2ZPAA 1C4WA 3S81A 2CVZA 2KMLA 1RI5A 3EUWA 1I3NA 5K2MA 1DX4A 2BGKA 2RGGA 2G07A 3BWDD 4KVZA 1BXKA 1O54A 3GU3A 3TZHA 2OO5C 4AW9A 5A6VA 2XZTA 1J8VA 2R6AA 1T10A 3E9DA 2V0CA 4AWBA 3G6WA 2HMSA 3P2IA 4J1SA 1FJGB 3HO8A 3L9XA 1Q2UA 3G1WA 4XDGA 3OX4A 2OHIA 4QVGA 1XKLA 3VR4A 1WLSA 3GX1A 5LPNA 1RWWA 4F9TA 1GPH1 1EAMA 1K68A 1E61A 3ILXA 3OSUA 10MHA 1Q0SA 3D3NA 3ZS9A 4D6YA 5KS2A 1B8NA 1U9CA 2J3EA 1QYCA 3LY7A 1W4CA 1A0OA 4L8VA 3BC1A 5DASA 1JE1A 3QPBA 3VM6A 2B61A 1TW2A 4MCIA 3FAZA 1UFKA 1I0ZA 1EBUA 3EVGA 1EEHA 4BN5A 1C4OA 5J4KA 5HMLA 2R8RA 1ZCJA 2V4ZA 3SC4A 5ITWA 1AG9A 1U7ZA 5L3QB 3I2JA 4CF4A 2DR0A 2GKGA 5FNVA 3THYA 5SYAA 2R8BA 4R3UC 3OCZA 5C37A 2IPNA 1IHYA 4N9WA 1GQOA 1WF3A 1QVAA 2X3UA 4GSLA 4IX1A 4RZ2A 4TUYB 1BKYA 3CF0A 3O03A 4MGHA 1KK1A 2P7IA 4WE3A 4X1IA 4LFCB 2PZBA 3W8EA 4IIDA 1DRVA 1Z4NA 2J6IA 3FPBA 5A6SB 3TTVA 1PZGA 4HJRA 3RFCA 2XNKA 1YC5A 2HDHA 4D6PA 4MHTA 3VR3A 4YYEA 1GARA 2DVMA 1P0FA 2AFHB 2VH1A 2XCLA 1KPIA 4JOQA 5A1JA 5IK2D 5CCBA 3L05A 4ZOBA 3DFMA 2C96A 3RTBA 4NYMR 5EXEA 5BP7A 3S29A 4EHKA 4EGCB 3F4BA 4LJRA 4IM7A 5CB8A 2OLKA 4PONA 1JF8A 1Z12A 4ZCMA 3E8SA 4B85A 1CRWG 2VCYA 4TTVA 1JR3A 2IOQA 3A11A 2BR5A 5ITZB 2GJ4A 4X9XA 3OJLA 4UTVA 1S2OA 1FUKA 1QKKA 4FOPA 5B7PA 3AV0B 3OURA 3W5IA 3PT9A 3RFXA 1Q14A 1ZO8A 4I8XA 2V03A 2QBYB 1ZOIA 3R0JA 3SPXA 4D92A 2BL4A 3HUUA 2ZPUA 3GO4A 2A94A 2KX7A 5JEDA 1YD7A 3R7WA 2HLHA 2R47A 1X38A 3KQSA 2I4OA 3RYFB 4ROTA 1PU2A 3Q7EA 1U11A 4URXR 2R8OA 5REQA 3BXHA 1K6EA 4B2PA 2CBXA 1QDUA 4KDEA 4MINA 1NM5A 2P0EA 4HDNA 4NAUA 3ZZMA 4RTLA 3SDSA 4OQFA 1E66A 3RSFA 1DDOA 2BFEA 1V25A 1YVDA 3L1JA 4L8LA 2GRUA 1TE2A 3JYHA 4MI3A 2EJUA 4RVOA 4DAOA 2Q5QA 2WQ7A 1W87A 2DECA 3FN4A 5EWLB 1Y7IA 3EARA 5BSVA 4YMWA 4Z2AA 4GFDA 3UG6A 3AL2A 2RGBA 2FW9A 1XCMA 2JFOA 2ZIUB 2VHXA 5IHXA 3N86A 4M9RA 3UMRA 4XTRA 3VU9B 1ZIXA 4MVJF 3LFHA 5TT0A 4BAUA 3K0HA 3MS4A 3U0BA 1DEHA 2Z56A 3JX9A 1E3EA 2JRCA 2R62A 1Z29A 3F6EX 3BRCA 4R6WA 4BKOA 3C6KA 2QN7A 4QKQA 4ZODA 1TIKA 3QX3A 1WETA 2C5GA 3KLBA 1PJ8A 4KH0A 2PYZA 3HKBB 4MWZA 2QGNA 4PO9A 4Q7EA 3SJZA 3QEOA 5BVGB 1J0AA 3N75A 3KPJA 1ZM3A 2Y4NA 4IJKA 5A7FA 5CMLA 5BSEA 4E33A 3HU2A 3OOJA 1XLTC 1R16A 3EVDA 5IAEA 1WSAA 1ZK0A 1VCHA 4B2IA 1JJFA 1O5TA 1VLQA 1CUAA 2N1MA 4K2HA 1RI3A 3GEPA 4L74A 3C2QA 2VUSA 3CWQA 3GP5A 3GLQA 4DNFA 1Z6QA 1C9JA 2B8JA 1QHEA 2B8EA 2VPPA 3U0VA 2GN6A 2JIQA 1N7HA 3IXLA 3MN1A 4DDHA 1SXIA 2DLDA 4W4TA 3UM9A 3T1TA 4Q4JB 3ELWA 4E4RA 1YWGO 3PDIA 3DC2A 1Z4MA 1OXTA 1YMQA 1CVLA 1E0DA 1PJRA 2H52A 4FOOA 1HQDA 1UP6A 1RJEA 4KKVA 4GO1A 1JR6A 3KSZO 4ZHSA 3L7YA 3NCHA 3B48A 5D3MB 4AZTA 2YVLA 2JLYA 3U3KA 4YCBA 3O73A 3P4YA 4CR6A 3EUAA 4A1FA 4QTTB 4DCGA 4DL9A 1X1BA 2UUOA 1N8SA 3BE6A 5FOUA 5K3FB 3U4CA 1A82A 1GA6A 1UBLS 4FK8A 4CL3A 3EPHA 1ZLYA 1H2FA 2CDBA 3KC2A 5DSXA 4E0BA 3SKXA 3OZTA 5F5NA 1CP3A 4LGMA 4R2XA 3N2KB 4XVUA 1Q1QA 2VSFA 4Y2JA 3WTCA 4QJ3A 2AV6A 5D3ZA 4EG6A 4YMHA 3RVPA 3HADA 4L2IB 1P4JA 3PC2A 5CNJA 4BEVA 4JLKA 4LY0A 3DTVA 4TXLA 2OGWA 4UMDA 1N33B 3LKZA 2QYSA 1G66A 4MROA 1KDPA 3GUYA 4V0NA 4CKEA 4G1CA 3GLFE 5FEUA 3BDAA 1I7QB 2NM0A 3SS7X 4D9FA 1XXHA 4MEJA 3K92A 2Q1TA 1EU1A 4D0SA 3C5CA 3TFQA 1W88B 4IDOA 1N2BA 4TTAA 3A6DA 5DM1A 4F46A 2D0PB 1G8SA 4JT9A 1L1RA 1QTNA 1WXXA 2WYUA 3BK2A 1JDNA 3GVIA 1WTCA 1J39A 1RPNA 3F97A 2CKMA 5AKLA 5JLJA 1ULUA 3VVBA 4TYWA 2MT9A 4D42A 3OLWA 2RGYA 1DC6A 2XF2A 3H5AA 3RIMA 5GM1A 5T5QA 4BQQA 5IANA 3NTRA 4PX9A 1A71A 2J0UA 1C8KA 2B9VA 2R1ZA 4IS3A 3UFBA 5B58T 5KTRA 3SE7A 1HEYA 1YR1A 2Y9PB 1Y3HA 3JQ8A 1KA9H 3GLGB 1U94A 2IHUA 3D6VA 4PIVA 5JDIA 3USES 2JI7A 1E0KA 3OD5A 2Z09A 2VJLA 1GAEO 4FJ2A 5G3ZA 2QX9A 1MA3A 2E48A 2XGJA 1W2GA 2XTNA 3SSAA 2J41A 4R05A 1ACJA 1OIWA 1D1SA 2DSNA 2QD5A 3C45A 5EZYB 3SYRA 4KU4A 2PK3A 2ATXA 4LJ4A 3DL4A 1J9GA 3ETJA 4JS0A 4Z4CA 1R5OA 2E37A 5DCYA 2ILVA 3BD7A 5KMGA 3RT1A 4NFYA 2FK8A 3A14A 2PAAA 2NZ8A 3H19A 4M0PA 1XROA 2IT1A 3PDJA 2VBIA 4FONA 3NDJA 4J90A 5ALLA 1JMVA 3ZHUA 4CODB 3WG9A 3RSHA 1E2JA 1QV7A 1TUIA 1P2TA 2I3DA 2HWXA 2VP2A 5JEEA 5JAZA 4BZZA 1Z18A 1D7AA 1PJLA 1RKQA 2F1JA 3D4LA 3S5JA 3T9FA 1IFXA 4TYNA 4B4DA 5DNCA 3HJGA 5IKPA 4B3GA 1OX4B 4LMPA 1OLXA 2WUWE 1X1DA 2PTGA 4J03A 3L8ZA 4G5QA 5DBFA 3QF4A 5J9FA 2AG1A 4OHWA 4YN3A 1R0XA 1ZM9A 2WSBA 3BXOA 4AULA 4HL6A 3PNOA 5JDIC 3TLBA 2X0JA 1A5BB 3E1SA 2IHBA 1Y34E 2YWJA 4ERXA 5C8XA 5LCXA 1FBNA 4J2TA 2GZ3A 1HE8B 1P18A 2XE6A 2XWJI 4LDZA 5JSFA 2OV2A 2AXQA 1JDBC 1JZTA 4RPLA 1HNWB 2YIDA 3E9ZA 4Y98A 1K7FB 4IV8A 5FWYA 1J42A 1ECGA 4N6NA 3AINA 2R5FA 4RK0A 1U7HA 1XD2A 1JLKA 2BM1A 2IP2A 5FA8A 5IAJA 5KHAA 5FTMA 3AVWA 4JJEA 3UAYA 2RARA 5HKOA 2ACWA 3GAAA 4M9XA 3LYAA 4DVJA 1Z5WA 2ZR7A 3EMBA 4GDMA 3IKTA 5ECDA 2C97A 3PNMA 3VJMA 3GJRA 4OP1A 1FDOA 3W4JA 3Q3EA 3L8EA 4FI3F 2EGGA 1IN5A 2QL5A 3ZTTA 3F1LA 3D4OA 1X15A 1WNFA 3CB4A 1UJ5A 3PJDA 4QGGA 2IYOA 1HLDA 4FEYA 5G02A 6LDHA 3E3LA 2WTUA 1N1GA 3PUVA 1V35A 4RETA 4F5WA 1AKMA 2HSZA 2C2OA 2X5NA 3CIFA 3KEQA 4JKIA 4BZQA 3ZQJA 1Z5VA 4UNSA 1Z4QA 2P2ZA 3S2YA 3ND6A 2B5OA 5KPDA 1NRIA 1OCEA 2VYFA 4TKLA 1YS1X 2OPHA 3TRJA 4ARBA 4TRNA 2X13A 2XVYA 4KXNA 1IBKB 3FFAA 5C1IA 1TL7C 5K6AA 2C3OA 4KUEA 4O4LF 1ZAKA 1EFHA 4BO1A 4LC1A 1YJ8A 1EFVA 5DNUA 3NJ4A 2KE5A 5K3SA 2CFIA 3NOXA 4EKIA 1UWCA 1FU8A 2A84A 2HJRA 3WK5A 4L7QA 4KN6A 3UYKA 1I4OA 4R3NA 1YBMA 1GGFA 5LN1A 2OK8A 4OTZA 2PUVA 4CU2A 1PZMA 3PQCA 2H1FA 4MUGA 3I04M 4EHBA 1CF4A 5FDFA 1XU7A 4TWZA 2R8YA 3H17A 3H4TA 3P9NA 3BGSA 5IAKA 1AX9A 1JW9B 1I5EA 4KWHA 4RCZA 3TPCA 5IC6A 2FW6A 2VJBA 5CPBA 1V5EA 4G9GA 4OXQA 1BD4A 5FO1A 2AYZA 4M7RA 5AM3A 3CLHA 4NEHB 3OLYA 1JX6A 1L5LA 1DE0A 3KV3O 3NHAA 1LXCA 4FGKA 3Q8KA 1VRVA 3EGXB 3OO1A 5AJUA 3TDKA 4E94A 4C78A 1JPUA 4GI1A 2PVPA 3OTHA 1R8XA 1JA0A 4I1OA 2DHEA 4MRNA 3VYSB 5C4IA 2G36A 1UXIA 2CJWB 3ANY