4OBBA

The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
b'NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGNGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein from Anabaena variabilis ATCC 29413 in complex with (3S)-3-methyl-2-oxopentanoic acid.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 132
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4obbA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4obbA01
1YK0A 1QKKA 3IDOA 4RSMA 5FWYA 5BRAA 4E7OA 4G86A 1APBA 3EJWA 3GA5A 3MYYA 4Q6WA 1MB0A 2M98A 5B3JC 1U8TA 1D1QA 1ZITA 2E4WA 3BREA 4QYWA 4YLEA 4F8JA 2PLNA 3BILA 3LUDA 3ROFA 4OBBA 2A9OA 2HQOA 1SXGA 2IKSA 5GOTA 1VRVA 2FEPA 2NZVG 5JNSA 5TPWB 1Z13A 5T3YA 4NCBA 3HV2A 3OM1A 3FFXA 5EWLB 1JFTA 3RVJA 2H0AA 2FVYA 2MSLA 5GQSA 1GCAA 4MAAA 2QSJA 1QP0A 2DRIA 2KYRA 3W9SA 1EWVA 4YV7A 2IPMA 4E7PA 4DADA 3DZDA 2J48A 3HUTA 1BAPA 5DLEA 5FWYB 2PUCA 3I5AA 3QX9A 1XWWA 5EWJA 3C3WA 1B00A 3OO0A 4KRFA 1AB6A 1ABEA 4GPAA 4KVFA 1ZDMA 3HDGA 5JNTA 3NNDA 2WB4A 1TLFA 3O2JA 1U0SY 1M5UA 3I45A 3N0RA 4W5TA 2R48A 5ABPA 5I4CA 4XLTA 1ZH2A 1KMIY 4RXTA 1DC7A 1M2EA 1OXBB 4ZMRA 2LP4Y 2QV0A 4EVSA 4EYGA 1ZAYA 3N75A 4TN5A 3ILHA 1EHCA 3KHTA 1QPZA 5DKFA 2MYUA 4G0MA 3URMA 1LJUA 1L5YA 2PL1A 3KKEA 3UKJA 5BRJA 5C5CA 5BQ3A 4F06A 4ZMSA 1U04A 4MS3A 4F3TA 2FN8A 2QVCA 5EWJB 1P2FA 2BGGA 2PUDA 2IPNA 4MR7A 3FFTA 1D2AA 5IX8A 4MGEA 5EWMA 3DGFC 3OQOA 1SRRA 1DCMA 3C3KA 1E6MA 3EDCA 4L85A 4PE5B 1QQAA 4KK3A 1RNLA 3HDVA 3LMKA 2WY2D 1JDPA 1VKRA 2OENG 4W5QA 1PUXA 3N53A 1E6LA 3H5TA 4IMIB 2IOYA 4TMYA 1K68A 2R25B 2E4XA 5HQJA 4EYQA 4W5NA 5IEJA 2A9QA 4PEVA 3KTOA 3GBVA 2PKXA 3O2SB 3JPWA 4MS3B 5C5EA 2PUGA 3T6KA 4MR7B 4JASB 3SY8A 2B4AA 1DG9A 5EWMB 1CHNA 3TD9A 2HQRA 2I6FA 4MLCA 8ABPA 1VPWA 4RK6A 3IP5A 1DP4A 1JFVA 1SD5A 2QU7A 5TQ0A 4MRMA 3Q7RA 3OMWA 5DGCA 3RQIA 1GLGA 1A04A 3D02A 1YMUA 1BDHA 2VUIB 3T8YA 1ABFA 1DCFA 4RY9A 2PE5A 4G97A 3NHMA 1DCKA 1PEAA 4Z9BA 2A9PA 4GNRA 2CHEA 2MSKA 3BBLA 1P6UA 2FKAA 4Z4IA 1KRXA 2FTKE 3KSMA 1RXEA 2E4YA 3MA0A 4NV3A 1CYEA 3H5OA 4KV7A 1JX6A 3JS5A 1QO0A 4MLDA 4Z4GA 3VNAA 2JK1A 3RVSA 2GX6A 3CLKA 1FQWA 3F6CA 5TQ0B 4XARA 4MRMB 1D1PA 2FQYA 2WRZA 1FFSA 1D5WA 4Y9TA 5KC9A 1JBEA 1RPJA 3CZ5A 3QK7A 2QW1A 3CU5A 3FMVA 3Q41A 4MS4B 2IPLA 3H1EA 3GT7A 3KCNA 3LUGA 5KQGA 4KPYA 4G0XA 2YHAA 4OG2A 4JB0A 1NXWA 1QO0D 2M1ZA 3FDFA 5TQJA 2Q5CA 4N41A 2LIVA 3H75A 4M88A 4F12A 4RK5A 1FFWA 2E4UA 2FMIA 3RVLA 1W9HA 5F64A 1C4WA 3LKVA 5CHYA 3GL9A 3GWGA 5IUKC 2WWVD 1DZ3A 4EVQA 1Y1LA 2LPMA 2HJ9A 3G1WA 2GWRA 2GI4A 2VUHB 1Z2EA 2PUBA 1ZHHA 1NXTA 2CWDA 4TLMB 2L2QA 2OQRA 4JB2A 3TX6A 3QLTA 4Z4CA 5JS2A 1E2BA 3RVOA 5TQ2A 4ZJPA 3NNSA 4NQRA 1PHRA 1JH9A 3HSYA 3C3MA 5JNUA 4Z4FA 4RXMA 1P8AA 2TMYA 4FE4A 1Z25A 2WJWA 2IDMA 2L19A 1KRWA 1JYFA 1JHZA 3O74A 4KK4A 2NUBA 3NHZA 4UHJA 4MPTA 1EWTA 3CG0A 1YTUA 2PJUA 4RS3A 3H1GA 4LE1A 2PUAA 3N6VA 1UDRA 1USGA 1USIA 3Q15C 4G0YA 4EYKA 1HEYA 4LE2A 3QLVC 1LJLA 4HYEA 4IILA 4RK7A 4JP1A 2FLKA 3IPCA 1NY5A 1YVUA 1FSPA 1QMPA 3K9CA 4MQFA 5TQ2B 3EAFA 3MM4A 4Z9AA 3JY6A 1TVMA 2AYXA 4MS1A 2ZWMA 3UK0A 2RJOA 2V0NA 2JBAA 5JS1A 2RGYA 4TLLB 3DLBA 3A10A 3EQ2A 2E4ZA 3CG4A 3B2NA 1GUBA 3M6MD 1W25A 4RK1A 2FXIA 5FWXA 1JFSA 2F8TA 1U2PA 1M5TA 1QNLA 2GKGA 2FMKA 4CBVA 4LE0A 3F73A 2GBPA 4XASA 3M9WA 3LUKA 4LDZA 4WWHA 4KFCA 4MQFB 5JNRA 5B3JA 1MAVA 1LK0A 2HSGA 4XFKA 2JRLA 4NCAA 3OM0A 4MS1B 2FMHA 1XHFA 3HCWA 3JVDA 3OLXA 4QYMA 2QR3A 2JVJA 1I3CA 4YCSA 3CRNA 4EVRA 2JBAB 3LTEA 3JPYA 2W42A 1PNTA 3RVMA 4N47A 4OTZA 5IEBA 1BA2A 3HVRA 1TM2A 1BDJA 1ZGZA 3LFTA 3QLUC 1JF8A 4L4UA 4OATA 2PMCA 1Z2DA 1JYEA 2O20A 3A3KA 4XXHA 4N0QA 1C0EA 3H6GA 3Q7SA 5FBKA 5FWXB 1NATA 4OLAA 1A0OA 3KG2A 4RKQA 1SXHA 5HM6A 3CS3A 2P4UA 2FLWA 4G0QA 4RU1A 1ZN2A 3KLNA 5PNTA 3E61A 4MS4A 3Q7TA 4YWHA 1NXOA 5T7BA 2ZAYA 1RZRA 3TB6A 3EGCA 4IGAA 3VNBA 4LZLA 1ISRA 3T38A 1QQBA 3CKMA 4EYOA 1JWLA 4FB4A 2FEKA 3EODA 1DBQA 4DN6A 2L18A 4RY0A 4LRQA 3SM9A 2FQWA 3OO1A 3QEMB 2ID7A 4PYRA 5CNKA 1CEYA 5IUJC 5KI6A 2A9RA 3HUUA 5D2CA 3A0RB 1R8JA 3K4HA 1EAYA 4RY8A 2B1JA 5BR1A 2AYZA 3DGEC 4RXUA 1RZRD 1F51E 4Z4HA 4LDAA 4O5AA 3EQZA 3MF4A 3RVPA 1U2QA 3H5IA 4FE7A 5DCLA 1MIHA 3DBIA 4YP9A 1H9CA 1MVOA 2YHBA 4OLBA 1Z26A 1ZESA 5DTEA 1Z17A 3LUJA 2MYTA 5HKOA 3LOPA 2IYNA 4KMRA 2X7XA 4Z99A 4EGSA 1YK1A 3HS3A 3HZHA 3TMYA 1DJMA 4RDCA 1Z18A 1YIOA 1A2OA 4YS6A 3MIZA 4KZKA 4D6XA 4ETIA 3OLZA 3KYIB 3QELA 3A0UA 2FEWB 1PEYA 1AB5A 3OMXA 1YS6A 3JTEA 3H6HA 4IF4A 3KLOA 3N8IA 5KQMA 1T34A 4KQ9A 3QLUA 3FGZA 1Z12A 4KNYA 3ROTA 2PAFA 2FW0A 6ABPA 2XDYA 4RK0A 1WETA 1FFGA 2P9HA 2PUEA 1NXVA 2CD7A 3CHYA 2IPAB 3R0JA 4Z4EA 4JA2A 3CNBA 1ZY2A 3QELB 3N0WA 3M9XA 1P6QA 2JVKA 4P98A 1ISSA 3F7NA 3RVNA 2QXYA 1L5ZA 4P1ZA 4EUKA 5TPZA 3DLHA 5KQLA 4IMJB 4ETNA 3QEKA 3OLYA 1ZH4A 2E4VA 1Z15A 3H1FA 1DRKA 3UUGA 2LUOA 1NXPA 3D8UA 3LKBA 3TO5A 3H5VA 3G85A 2HPHA 1J56A 3GRCA 1NXXA 3H5WA 3GYBA 1TJYA 4B09A 4KQCA 4YGXB 4YRZA 4RK4A 3MQ4A 5E3JA 4D74A 1OXKB 3CTPA 3C6QA 2VYCA 5TPZD 4KREA 1DBPA 4G0ZA 2FSPA 2RDMA 5CNMA 3HK2A 3OLVA 3L49A 1F4VA 3KS9A 4G0OA 4MR9A 4Q6BA 3IP9A 2MYNA 3OQMA 4HNQA 1VLZA 4RWEA 4HNSA 2FQXA 3L6UA 1LBHA 2FMFA 3HO1A 2R47A 2F8SA 1EFAA 3CFYA 1DRJA 3BRQA 3O2QB 3I42A 5JNWA 4RKRA 4XAQA 3O1IC 4WUTA 3HEBA 4PICA 2CHFA 3BRSA 3RH0A 2NT3A 4RZSA 3I09A 4H3HB 5TE9A 4HNRA 3NNNA 3C97A 2ID9A 4H3KB 2QVGA 4JAVC 5IBQA 4JOQA 1JL3A 1URPA 3QEMA 4G0PA 1EWKA 4F11A 4ML3A 4EY3A 1M2FA 3S99A 4MR9B 4N03A 4ZPJA 1TMYA 3O1HB 2R4QA 1S8NA 1MB3A 3RVQA 2MYPA 2N9UA 3KYJB 3IPAA 4RV5A 1JDNA 4MQEA 2WJAA 4O1IA 4W5OA 2LBPA 5ED4A 1XHEA 3MMNA 2JVIA 4LX8A 1KGSA 4MYRA 4H60A 1DC8A 5HSGA 1JLKA 1YMVA 2NT4A 5CNJA 2VK2A 3QLVA 4W5RA 5KQPA 4N0PA 3HM9A 5FBHA 1LBIA 1DBWA 1RXIA 1GCGA 4UHKA 4D6YA 5JNVA 1NTRA 5KWSA 4MR8A 4O1HA 4YO7A 3E3MA 3LUAA 1QP4A 4WT7A 4QICA 2JB9A 2PUFA 1USKA 2L17A 5IC5A 2HQBA 3SNKA 1GUDA 4QPJC 4WZZA 1NXSA 2FN9A 3LUFA 5IUNC 2JCGA 3QX8A 3OQNA 4MQEB 4N76A 5CNIA 3T95A 3OLWA 7ABPA 2PL9A 2MSWA 3GV0A 3RVKA 3GBPA 4S05A 1K66A 1BVHA 2H3HA 3IP6A 3N0XA 4WXMA 5IULC 2WMYA 3ILYA 3O75A 4S04A 4PZ0A 6CHYA 1BDIA 2RJNA 1E6KA 4ETMA 3EULA 5KC8A 1D4ZA 4MR8B 3SG0A 3P9YA 3LUHA 1IIBA 4IRXA 3KJXA 1SXIA 3CZCA 1PNRA 1Z16A 5TPWA 2QZJA 3O21A 4DQDA 3HJFA 3F6PA 5EWLA 1YS7A 1ZVVA 3JVIA 3O1JC 4Q7EA 4ZYLA 3IP7A 3H5LA 3LUCA 3NBMA 4WXEA 4YR7A 3SAJA 1QP7A 3FFWA 4Z0NA 2NZUG 4NICA 3RVRA 3HXMA 3SQNA 3Q9SA 1ZGGA 9ABPA
chains in the Genus database with same CATH superfamily
3CX6A 2YWHA 4RKFA 4S1NA 1DIRA 2Y1KA 3QFHA 1WW2A 1R50A 3QE2A 3I9MA 2G8NA 521PA 1KQFA 3NDBB 3IX7A 1XU9A 2BN4A 2RH5A 3VYVA 1T9DA 4HXYA 2I7CA 4RPKA 1WDMA 2ZPTX 2PYDA 5CG2A 1DAGA 1UIMA 4ED9A 3M1LA 5BUSA 1ULUA 5IFLA 5GJCA 3CPEA 1FPMA 2BR3A 4FQ7A 3UPUA 3LJKA 2QOEA 2H0AA 2ZI9A 5GQSA 3ICCA 3K16A 3Q8KA 1K6XA 1HDZA 1UPTA 5JZVA 1M9NA 2IF2A 5KAMA 4EY7A 2IPMA 2JGDA 2Y93A 1GQFA 1ZINA 3PYLA 4AVYA 4E3ZA 2J6HA 1NBMD 4PRLA 3DM5A 3RTGA 1NJ1A 2AR7A 3GD5A 1LDBA 4AXXA 3ZHSA 2B5OA 3GRRA 4KRFA 4L5YA 3PWSA 2GM3A 2COEA 1R16A 2AFIE 3VGPA 4KIUA 3K6SB 3R8CA 2P9TA 4ICIA 2VPXA 5BORA 4RTSA 2CD9A 5CEEA 5CVJA 4UM9D 4QOGA 3STTA 4ZIRB 4P81A 1W4BA 2WMDA 1ADCA 1YR6A 2J3KA 4KVZA 2O1SA 4X71A 1C1DA 3ZWNA 1TVEA 3H8WA 5ALIA 1VB5A 3EVAA 4JT4A 5B3LA 2AHRA 1ISGA 2VDQB 2GA9A 5LQDA 2GB4A 2MYUA 4NSNA 5LZ9A 1KC1A 3M4JA 1LPOA 3GP5A 3HXPA 3JQAD 3O0DA 3EXHC 4RY2A 4BTVA 1FNSA 1HLDA 2ZB2A 3KKEA 4GG1A 3T1OA 3UKJA 4IHJA 1J9EA 3OICA 4OMFG 2QZ9A 2J32A 1CY7A 1P2FA 2Q5JA 3HU1A 3INGA 3G5UA 5TV2A 5HX7A 3WWDA 1AMNA 3WDMA 3EXIA 4XB2A 3TE6A 2XTNA 2Y1XA 2FDXA 5CW2A 4DJAA 3A3OA 2VRNA 1DCMA 1Z5ZA 1F8GA 3EDCA 1IXZA 2HJHA 3ZC3A 3AVUA 1X2EA 3KZCA 1B4DA 4PXSA 1G42A 2G36A 3ZUPA 2D3TA 1P2SA 2YW2A 3LMKA 4WESB 1BG6A 1NBWB 4ZCPA 2QUBA 1UXOA 1N36B 1OYOA 2CC2A 2BL4A 1TQ6A 4G5RA 4ZOEA 4RW0A 1R0SA 5A5GA 2GOYA 3EXAA 3A36A 4RACA 1X80A 3E1GA 4MV6A 5TS2A 4D8VA 7REQB 5L7WA 4Z0HO 2IOHA 1IK6A 1H94A 3PSAA 4UC0A 1X70A 4JUDX 3QNWA 3DMPA 5TS3A 1P7VA 1OHHD 4AKTA 3OJEA 4UTVA 4CTMA 1PGOA 1IMJA 3CUVA 4POOA 1UMBA 4RWZA 1DINA 3BF8A 3AHGA 4KVGA 3PC8A 5EMJA 2Q6TA 1MNAA 3LCVB 1DP4A 1SD5A 3HKBB 3VPGA 3S3TA 1ZWLA 4WBNB 1CV2A 1F14A 1V71A 2HD4A 2O2XA 4TZTA 3AU8A 3AJ8A 3U7RA 1PFGA 4EHJA 4AI6A 5JTUA 2QX6A 3AU9A 2LE0A 4ADSG 3JAMA 2YRFA 3EQ9A 2W6JD 4NDZA 4BNHA 3F71A 2B82A 3F9CA 2IE0A 3FUUA 3MS7A 2OXFA 1JU3A 2Z3WA 5DSTA 1CXZA 4HH0A 4Z4IA 1KRXA 1I6KA 5CMLA 2D06A 2FTKE 5ECWA 1RXEA 4G3XA 1F06A 4LPSA 1Q0UA 4ROTA 4FZ5A 2GVZC 4IS3A 4NV1A 3E9YA 4EJSA 5KJ1A 4O0LA 1Y8AA 4CODB 3IOYA 3CLKA 2C8LA 3UYKA 3ZDQA 1T3GA 3B51X 3CEAA 2JCSA 1U2ZA 1Z0JA 2ODEA 2C7PA 1Z06A 3D6FA 2YQZA 5HRAA 1HYGA 3BWBA 2BMFA 3I6YA 1LBTA 3D8TA 3EBPA 5BY2A 5MDHA 1MH1A 4R1MA 3GT3A 1FDTA 4QKQA 2PWYA 4OQMA 3OE7A 1RMYA 5EXPA 4OIFA 3PXGA 5HP4A 3U4AA 3GT7A 2N42A 1IHYA 5HUQA 1J0AA 2YW9A 3P96A 5DHTA 3BMQA 3DE7X 2XLBA 4JB0A 5ALLA 3FDFA 2OGUA 2IYUA 3ENVA 4RELA 2IZ5A 2ZS9A 1FFWA 1M33A 1Q0PA 2A0YA 2ORYA 4JOCA 5K3FB 1NI4A 3H3FA 1C4WA 1DDOA 2DWUA 2GTHA 3WYAA 5L9AA 1IB0A 2ECOA 2JGJA 3F3SA 1XCLA 2ZIWB 4IICA 4F8EA 1XDSA 5KU7A 1UZMA 2BKUA 3GARA 3VX3A 1M2KA 4LWZA 1XPUA 1QE5A 5JRDS 1CQXA 5I7SA 3K1ZA 4MA5A 4ENWA 5C4GB 3OOWA 3OKFA 3ZGNA 1DJLA 3ETJA 5C34B 2BVNA 4LHVA 4PZCA 2DLDA 3AFMA 2YV2A 3N87A 1PGJA 4YONB 4ZVQA 3WGIA 2WP8J 5IZCC 3DMTC 1M3SA 2I2DA 3ED5A 1M1XB 2AMFA 4PS1A 4S3MA 3ZQUA 3FGPA 2CLFB 2FW7A 3K8ZA 3B70A 3MB5A 1DBIA 1ZD5A 2Q5EA 1VE5A 3QVKA 4D0RA 5JJ5A 2VP9A 3FMPB 1HKHA 1SIOA 4J7XA 3A2LA 3T7DA 4ND8A 5ITZA 3BKWA 4ODIA 3TQTA 2O14A 3B6MA 5C7OO 4O4JA 4EMBA 4F84A 1OWLA 3ICQB 3H1GA 1EE2A 4I5GA 5CB8A 1O4VA 4D5EA 2CL7X 2FPWA 2ZSUA 3FSRA 2GO1A 2ZUVA 3IKMB 3KPVA 3N5KA 1KPIA 4FR0A 4TLBA 4DUGD 3WFJA 4M53A 1PQ4A 4O4LA 2HIHA 1P9LA 1GL9B 1Q0SA 2DPHA 1UBMS 1SCNE 1SIWA 1ZGCA 3SHTA 1TA0A 1FSPA 1YQTA 3EUAA 1BA3A 2JRCA 4FONA 2NZ8A 3IKLA 1UKVY 1ACLA 2AT1A 3EZFA 1DQYA 2BEUB 3NYWA 3R5TA 4KXUA 1H1LA 1L2TA 3F49S 2QN7A 4X1YB 4KO1S 4X44A 4BATA 5LD2B 1T9CA 3LPAA 3VZQA 5KHOC 2A59A 3SF8B 5LLDA 1AHNA 1S8FA 2F9MA 2JCBA 1W0KA 5JZSA 1RP1A 2Z3VA 5GJVC 2O7QA 3PQ8A 1GNTA 4LJ9A 5B3AA 1YGPA 3RCBA 5IRCD 3DLBA 1QH1A 4WCFC 2N3ZA 3B2NA 1LTHR 3KSBC 3M6MD 1H4TA 1P7YA 1XLTC 5BR7A 4DA4A 1KQNA 5FWXA 5K4HA 3ROXA 1DJPA 5ES3A 2CN1A 5C7YA 4Q3OA 2OL4A 1XHLA 1E4EB 1U11A 3RAJA 1EDBA 3TEMA 3WICA 2EX0A 1L4KA 2I7XA 3KIPA 3P5BA 3M9WA 1FBTA 1A50B 4JJ8A 5EHXA 3AEKA 4NBUA 1HQCA 3DE2X 4MQFB 4X54A 3P9RA 3V8QA 5HQTA 4XFKA 3ZGZA 4MVJP 4IDGA 4C3ZA 2RHRA 2QLNA 1EXDA 3ODGA 2FSVA 2QR3A 3BE6A 3HXLA 2QSUA 3BMOA 4UHDA 1M6EX 2ZR7A 3WIBA 4B48A 1MKYA 2EIXA 4C6RA 2JZCA 1PN3A 5BV0A 3AB8A 3CUYA 1RYZA 1B16A 2NTEA 3FZNA 3D8BA 3HP1A 2P4HX 1N78A 4RQUA 1ZGZA 1JDTA 1N34B 3ZEIA 3KSAC 2FF7A 5JTTA 4OSPA 4F9TA 1JYEA 1USVA 1JKXA 2A9VA 4HATA 2C9CA 4KGVA 4L5BA 5EA2A 3JD2A 5AVJA 2ZI6A 1K8YB 1JKFA 3B38A 5IZCA 3IOEA 1U3VA 2ASEA 2I1QA 4TTQA 3W5HA 4P7KA 2COUA 1E1CA 4URFA 4AU1A 4E5KA 2ODTX 2JHPA 2PD3A 2B37A 3THXB 2VQEB 3GLGA 5CM9C 2GFIA 4TKZA 1UPCA 4DZRA 3Q5DA 4BNXA 3N2LA 4GR4A 2DM6A 1OLUB 4ZCRA 2I91A 2UZ4A 3Q85A 4UDNA 4TV8B 1YFJA 1EVIA 4DMCA 3SC4A 1TO1E 2CMFA 2UZIR 4WLFA 1I3KA 5EZSA 3CUUA 4JXZA 4CMGA 1BE1A 1LDYA 1C7QA 4PQYA 1PYDA 4FU0A 4B6QA 2HF2A 4EFMA 3NALA 1EKXA 1NRJB 1O7JA 2J1LA 5KOIA 1GZVA 1XKLA 5DYWA 2AYZA 4BLQA 1Z4IA 1IHPA 4JYCA 4XWOA 1T24A 5IK2D 5JIBA 1IAQA 2X41A 1G16A 1VJDA 3MF4A 1KYWA 4JI8B 4DUYB 4PLPA 2V74B 5JPCA 3FCXA 3R7AA 4GGOA 1CZOA 1Q91A 3U40A 4JX8A 2CUZA 1JT2A 4WCFA 2PQMA 3W3ZB 2ZJ8A 4CIVA 2G9ZA 4ZOQI 3GUHA 3WGUA 3PWZA 4FMCB 4YRGA 1KH3A 1CUXA 3KZMA 3AIKA 5HKOA 3TLXA 1D9XA 3WYFA 1XQXA 2GFQA 4XQEA 2RAVA 1KDOA 1I7PA 1QG0A 4GHWA 2EGHA 1DC3A 4Q02A 4Z3OA 4NC9A 3PLNA 1Q7GA 2Z9CA 2BZ1A 1U2RA 3C70A 5EERA 3IS3A 1KK2A 5EMLA 4EQZA 2QN6A 1QTQA 2Q5OA 2BCEA 1CETA 3A0UA 4NCJA 4FIZA 5I4BA 3F3MA 3KL2A 4Y7DA 1ZIDA 1H5UA 4EUNA 5FFNA 3ZHXA 4EA8A 2KBFA 1MHTA 3CE6A 2ZP1A 3FVVA 2O9JA 2YNMD 4K9KA 4G0UA 5LQMA 4CMJA 5PGMA 3SS7X 1H4SA 5JARA 4FHDA 4FXOA 4IG9A 3QPUA 1L5HB 1G5FA 3GHHA 3N7AA 1E5TA 4BBZA 3VOAA 2PAFA 3JATA 2JCVA 2HPVA 4ETWA 4EOGA 5J4LA 2J3HA 1BRTA 1NUQA 1G20E 3UTCA 1FU8A 4G41A 3K6KA 1L3BA 4TKVA 1UFQA 3H2BA 4R2LA 1JHQA 3E8MA 5J3JA 4NFHA 2JIZA 3PPYA 4ZGBA 1A9SA 1GUYA 1JA0A 3N0WA 4L15A 1Z6XA 4ZTUB 1XFDA 3LZ6A 4TL7A 1ISSA 4GVLA 4CKCA 4DVGA 3D4NA 4GXRA 2QRGA 4B8YA 1RPNA 4FEAA 3EVTA 2CFRA 4MV5A 3C41J 4GWKA 2GBLC 3WYCA 3JYOA 1HDGO 4QPCA 2HZBA 2NVWA 4IG4A 4U7JA 2LR0A 3NWEA 4DXAA 2QRQA 3FNRA 3I1IA 3I92A 4ZYYA 1EFRA 4P3OA 4C06A 3T5MA 3KJGA 1U2SA 3GN1A 2JAXA 1DXYA 1X2BA 3NX4A 4NPCA 1ZI9A 5AM5A 3IMCA 1KI9A 1PLLA 1S1CA 3E9ZA 1OX4B 4I1IA 1PZGA 1P1HA 4U3JA 3RS9A 3LHIA 2LXNA 3A26A 2QNIA 2I34A 4DWJA 3CVXA 2ODNA 5FEUA 1F4VA 2HSZA 4PX5A 3V48A 3ELYA 2YTZA 1DUIA 2CUKA 4O4HA 2F8SA 4N3GA 1E3LA 2XMBA 1DV1A 5JBNA 1N7JA 2ZUBA 3PIRA 2WQZA 4ABYA 3E3OA 1THZA 2AKAB 1O95C 2QM7A 1VKJA 3JQ9C 1IPHA 1SC1A 2E7ZA 1OX5A 4QL3A 4UHFA 1COZA 3K0HA 1JR3E 1X15A 3H2KA 3JQGA 4H3HB 3N2GA 3ZWOA 1G21B 5LXTA 2OV8A 3CUSA 1U81A 2IF0A 1B41A 1AA6A 4REMA 5DLDA 1L7AA 1KI3A 4YXWA 3W9UA 2EEPA 3NT4A 3NUGA 1JL3A 1URPA 3WZ2A 3VAYA 1SOUA 4KHZA 3GRFA 3ZWXA 4BDTA 1B8UA 2Q1YA 5B7QA 5H4GA 3RNOA 1QK3A 3D4IA 3VR3A 3DW1X 3LM8A 4H7FA 4BFXA 3SHVA 2HBZA 3L46A 1IQUA 4IIVA 1T29A 1PG0A 2WVGA 3DONA 4RDHA 2IUYA 4FYIA 2EQAA 5HDBB 4JELA 2UVQA 1H3NA 1JJ7A 4WLEA 2XNDD 2NVUB 5HUHA 3N5CA 2NU6A 1B6TA 1SVWA 3QFCA 4S1OA 2QAGC 3PX3A 2OSBA 4Z1MD 3A1TA 3IVCA 3B53X 4RNDB 2QZZA 1U0TA 3TW4A 1EVZA 5JHHB 3VQTA 1IEWA 2YJ3A 4TMFA 3FUXA 4KRGA 2WJVA 1AK2A 2EG9A 2ZAIA 5BSGA 5IN4A 2H3EA 4CLRA 1ODSA 4Z0TA 2JGEA 1N2CB 2ZE7A 3ZE2B 1VKHA 4RSRA 1RWQA 3E2PA 3T3MB 3UCXA 3PIIA 4AKSA 3EMBA 5AVQA 3BH0A 2VJOA 5LP6B 4B7UA 1U9IC 1POWA 3KOXA 4N76A 3D6NB 1MUUA 1SBYA 1LD3A 1UMDA 1KMHB 3QWIA 3ZK7A 4P4SB 4AB1A 4BOYA 1NVUQ 2R1VB 4RMHA 5JQGB 1IN7A 1PVVA 2IOQA 4CKBB 3MSCA 3HQ4O 3ZUGA 4F3CA 5KWJA 1MJNA 4L8GA 5IULC 1DC6A 2RHWA 3ILYA 1OA1A 4U2BA 4DZTA 2FW1A 3OFKA 2X6QA 2Y1GA 5CFPA 4UQLA 2V4MA 2FPKA 1GSOA 4E51A 2K7ZA 4E2YA 1FZQA 1PJCA 4LMRA 4QUEA 3ZNOA 1QAQA 4UCFA 2OZEA 3BWEA 2WFZA 4C2BA 4DC9A 5IJ9A 3C3BA 4EYSA 3CEJA 5IVKA 3PZRA 3FRJA 2OA0A 1ZOOA 1EZ1A 4YRJA 1JJBA 5JAPA 2X0RA 4X91A 3RLFA 3UMYA 3N1UA 2H1CA 1V3QE 1WXHA 2QJTA 3OTWA 4P36A 4YR7A 1PBTA 5TGZA 1R4NB 4EW1A 3DE1X 1F38A 3SQNA 2E9SA 3BTOA 2BCGY 2FMUA 1RQRA 3IYLW 2V1UA 4KC0A 3MYYA 1ABBA 4DRXB 1FIUA 1Y89A 1PI3A 3PX2A 3UXYA 4ASUD 1E1QA 1L5OA 1SUIA 2IE8A 4BNGA 1KY3A 1ZJ5A 1JH8A 5JS6A 2IEAA 2ZBGA 4NFSA 4UBMA 3EEYA 4GSYA 2OBNA 3BXPA 3AK4A 5J1SB 2WKSA 4B3FX 2WIBA 2FXVA 2V6IA 4I36A 4EG3A 3EHDA 2FFBA 1H5QA 1S2IA 4IIEA 5LBUA 4XQ0A 2ZTMA 3DVAB 3NBQA 3MAJA 2GKSA 4US0R 4BZWA 4EPXA 3B3JA 4YV7A 2ZT7A 1VLLA 5AQ1A 3WMXA 3N2EA 1JEDA 1ZIOA 2R7LA 4ALLA 5M2QA 4ZALA 2NSLA 1QHNA 5LYJF 3OO0A 4UMVA 4FCWA 1B26A 1ZW6A 3E9CA 2WB4A 1F60A 1Z7GA 5SY6A 1ETHA 3I45A 4UVIA 1DHTA 2PA0A 3KWMA 2EDAA 4BNFA 3T1QA 5JD5A 1Y9DA 2VHYA 3P9PA 4LHYA 2BEVA 4RXTA 5TMEA 1MO6A 3X2FA 4Q9LA 4DJFC 2PKQP 4ZMRA 2VQSA 2BFAA 5IVIA 4X1KA 1ZL0A 2II6A 2IYWA 2YFQA 1RADA 3N75A 3ZE7A 3F9RA 2EL7A 3DDCA 1KQOA 1N1EA 1BE8A 4U6NA 3O83A 3G0BA 2ZKLA 3ORYA 4GMGA 4NQZA 4UEQA 1BJRE 1L5YA 4WGFA 3WA6A 4P0TA 4HGRA 3N39C 2E2WA 1WCXA 4GE0A 1W5SA 5EJAA 2DWQA 2QQ5A 2HO5A 2N47A 3QVUA 2PNJA 1X0VA 1ZAKA 2IYZA 5DTIA 5GVSA 5C51B 3ADOA 2XXAB 4HRYA 3NYQA 4HRXA 3UCFA 3P32A 4BLRA 4UOZA 3MTGA 5FTLA 4CEJB 1LV8A 4RM3A 4N6NA 4EQ6A 4HS9A 1OTXA 1SJ9A 1GGKA 2Q41A 3JASA 3NRCA 4R8VA 3T15A 2J30A 3ANNA 1KMNA 5AJXA 5ENZA 1NMZA 4HEHA 4KN5A 1W1WA 5F2KA 3PJRA 1U3UA 1N9ZA 1QG2A 3E7FA 4W5QA 1YV9A 3A6GA 4EMTA 1K68A 2PMBA 2E4XA 4QOEA 3JZDA 3D6TB 3MBIA 3LV8A 4KCGA 3JAWA 3STXA 4M6WB 5IJAA 5LL6P 3M3PA 4ECEA 4H08A 3AEUB 3IE0A 7ADHA 2WV9A 5A71A 3CNLA 3FD8A 4GFDA 2GCPA 4FMDF 1Q1BA 3VSEA 4YDHB 3GLFA 5CPFA 5C80A 1H0HA 3UWSA 2MDTA 4DV2B 2VJMA 1FP4A 2XE8A 4R0NA 4XCVA 2B4YA 3MWLA 4D44A 3N76A 1HL3A 1EZZA 3AY6A 2RMKA 3GFGA 1YR3A 1ISPA 1U0FA 3DXYA 2HCTA 2AOTA 4KXNA 1I32A 3EAGA 2Q1SA 5BVGA 5HGJA 3VJRA 3ZGXA 2WSLA 1ZGJA 4RVNA 4Q9IA 2WZQA 2BEWB 3KVRA 2Z8XA 2ZI3A 4OP1A 4QJBA 4MEJA 5BSVA 4JR0A 2CHEA 2BKAA 1MENA 2R6GA 4OJTA 4LY9A 4EK9A 4A9AA 2J7PA 1E18A 2KJQA 4NV3A 3GLVA 3LVFO 5ARDA 1Y4ZA 1V45E 1GZ3A 1NF3A 1X14A 2A4MA 3QI2A 4P58A 1CY0A 3A31A 2WUEA 4E08A 4H0CA 2HPZA 2K2WA 1U0LA 5ALSA 5HRCA 3LYUA 3QPVA 1MB9A 4QRHA 2A8YA 4WFKA 1WD7A 4J8PA 3Q72A 4P22A 4HTFB 4TXJA 4PIMA 4ZEWA 3AR5A 2C5LA 1UBRS 2GM4A 2OCYC 4P0PB 5AK0A 5FUBA 2NNLD 2FPSA 3CU5A 5B2EA 4DCMA 2CHUA 4V1CB 3DDOA 1OVGA 4N39A 3M6WA 3RHSA 2ZYRA 4XWKA 1EXVA 4U2DA 1C8KA 4ER3A 3WQRA 2RHCA 4BNUA 3P9KA 1FQOA 5ECYA 4YT8A 2LIVA 3I2KA 3T5PA 1E2NA 3JVUA 2HWXA 3L0BA 3OCYA 4WLNA 4D4MA 1V43A 4DB4A 3S5JA 1C3JA 4QOFA 2V5VA 4HWRA 4A1OA 4GW3A 4ILEA 3IUNA 4IZIA 4WXHA 3AXTA 3TMKA 1QANA 2WTBA 3LY7A 1Y1LA 2LPMA 1EJ6A 4N0MA 4Q4HA 2ZJ3A 3A32A 4PXYA 2FN4A 4ZOBA 2V03A 4IIJF 4Z7NB 3DOUA 5CFLA 2P4EA 5ICSA 1S7GA 1PT7A 1I9CA 1R5BA 3E2IA 4D45A 1C1YA 4NKRA 5SYMA 2BFWA 1DTEA 3J80A 4DV3B 2ECPA 1U80A 3DEKA 4J1NA 3FBWA 2QIOA 2A5JA 3PGKA 3OWHA 2JJ1A 3C3MA 1TE2A 3PHGA 2OHFA 1NIPA 2A1IA 2R6DA 2ZR8A 1ZU5A 4FE4A 4ME6A 1BW9B 3OPVA 5EEGA 3MXOA 5HKKD 1KVTA 1TFUA 3QPDA 1F8UA 2H52A 1L6RA 3WP1B 5JCPA 4L2IB 1B8OA 2D2VA 2RH8A 2AR9A 4CIDA 4EF4A 5ALXA 4Y2YA 5EXSA 1T8WA 4DMHA 1QVRA 3GJ7A 4MW2A 4PAWA 3RAPR 3FB1A 3AY7A 4WASA 2PX4A 1R8XA 3H16A 2I62A 3CNNA 5B1IA 3U1TA 3NRBA 1I5OA 2G9RA 3R7BA 2ZJ0A 1JJIA 4R0MA 3SICE 5BSFA 3FYTA 3LTNC 1PTJC 2ICAA 3T7RA 5B12A 1WQ4A 1WRBA 1W73A 5LDDC 4NBNA 3JY6A 3EFOA 2ZDGA 3PU6A 3UCEA 1NQVA 3DMYA 3GDHA 3P1JA 4MS1A 4ZWNA 3L7BA 3D1JA 3LF2A 1A9ZA 2I4LA 3E0XA 5ALMA 1TC2A 2GDZA 1UP6A 2A5FA 2JBAA 2ZAGA 4CZ2A 2IS6A 1T35A 3A6ZA 3K4PA 4LOLA 3TW6A 1PT6A 2BMEA 2Z98A 2X42A 5GZ6A 4PHCA 2HMVA 4LF4B 3MW8A 4TMTA 5BQ5A 1TJ3A 3ZWQA 1CYDA 3KEFA 1QE3A 13PKA 1TCBA 4J29A 3HKDB 4F56A 1I2ZA 1EZ4A 5JSZA 1WXIA 3FMGA 1P39A 2AJTA 3OD5A 4OAPA 4PHHA 1CK4A 4CM3A 2XNHA 5K0GA 1O6BA 1GXSB 2HAEA 2I66A 4LDZA 4WK0B 3Q88A 2HRDA 2GTPA 1LK0A 1UK6A 3PXBA 5SYNA 3OM0A 1E0KA 3OLXA 4B6GA 3B3FA 2WQ7A 1B0PA 2OD7A 4BKPA 2JVJA 4XOUA 3QXCA 4YQEA 4GRIA 1G59A 1RM5A 1R0RE 1SWVA 3NTOA 4FDTA 1ZZGA 3DEHA 4UTZA 3ZWDA 5IYZB 2HR1A 3NEAA 3QIAA 4Q34A 2PBRA 2XVZA 1JF8A 2BFDB 2PRSA 4NHOA 4NF2A 4MCJA 1WB9A 2YN2A 4LZNA 2Q2QA 1FTSA 3Q7SA 4LXIA 1H8ED 1YHNA 3U0VA 5AVSA 5CIQA 2BHNA 3NDJA 2P4UA 3CKKA 5CXSA 4QPNA 2GK4A 5DYIA 3Q6IA 3SVLA 4YWHA 3FLAA 2EYQA 5BNFA 2YVQA 4WOJA 3B1VA 3TM5A 3HL0A 4N4AA 3U3MA 4OHZA 1F2UA 1LUAA 5BW5A 9LDTA 4D25A 1JFFA 3GGCA 2FH5B 5EIFA 1AUOA 3F78A 4KBFA 4GLJA 5JZOA 1A69A 3CW2A 1SBTA 221PA 4HWSA 2RI0A 2WILA 3EGVA 4RM2A 1C4XA 1JDJA 2NACA 5CDUA 1EM8B 2IXTA 1UZLA 1PTJA 4A0GA 3TLYA 1SPBS 5L6LB 2FCAA 1TEHA 1QHHA 3C6BA 3HUUA 5G4LA 3GIWA 4XIJA 4LJ4A 3TRIA 2PS0A 2H0QA 4A23A 1SC9A 3WKCA 4F6LA 4B87A 3K35A 4PN3A 1L3CA 1CNEA 4YB8A 5BN3A 5EYPA 4EO7A 2Y71A 4NS1A 2JLUA 1ZM3A 3GLTA 3DBRB 5AK5A 3E58A 4DMMA 2Q99A 1JT9A 5IDXA 4TUYF 4X20B 5DTRA 2IYNA 3KJQA 5F51A 3U9SA 2F3SA 4R2MA 5DCYA 3BK7A 1QG6A 5J2TF 1DQSA 1N8SA 4EUSA 2EGGA 1XZHA 3EMVA 2H17A 3HYNA 3NIBA 3QKSA 4PQRA 1V2HE 3MIZA 3SEAA 5HPYB 2EV9A 1WV1A 2GCGA 3HY4A 3DEFA 4JUBA 5CDFE 3KYIB 3WRVA 3GR6A 1DAIA 5EZYA 3WBFA 3UWKA 1CRQA 3OU7A 3WLRA 1FS6A 3OJWA 4E5UA 2Z1DA 2B8WA 4UXIA 5AVZA 4OX9B 3V6LA 5I9LA 1F9AA 2MT9A 3K9LA 2ZIAA 1I14A 4UTXA 4WLOA 1VMAA 3CH7A 4BVFA 5IJZA 5LA6F 5FX2A 3PPXA 5JXGA 3DL4A 1BN6A 1D2GA 1ZO8A 3QW2A 1T9KA 2I03A 2HEIA 1TW3A 3OKPA 3T1VA 3WNVA 1YB5A 4NECA 4AYXA 3O82A 3B9QA 1YZVA 2QHXA 3KOMA 4R05A 1FVXA 1OOEA 1YMQA 2QN3A 5CCXA 3BSYA 2FFJA 1E1RA 1UUFA 3I1JA 4JA2A 5D85A 3ND5A 4FZ3A 4HLNA 2CV0A 3ACDA 4LFCB 1ZIYA 5FHQA 1P4SA 2INGX 3H2SA 1J39A 1WLYA 3AB7A 3NBXX 2WHEA 5CLLA 2ZBUA 3C3PA 3EZGA 4IDHA 5DRYA 4C0BA 5KQLA 1XP5A 2ONYA 3A04A 2APJA 4N3BA 1T9BA 4XJSA 2XKAA 3DR5A 3PI7A 4ZODA 3VTKA 4EKGA 2AVNA 2Z8ZA 3LO5A 4F1JA 3B2EA 5K0SA 2LUOA 1NDUA 1U8FO 1GV1A 5C7LO 5CJJA 1E3IA 2XUHA 4RCVA 2NXWA 1RJ9B 1UDAA 1WMBA 1YU6A 3NP7A 4M49A 2F9FA 4RAQA 1Z0UA 4MICA 1W48A 3NJ4A 4GDMA 1K88A 4MDYA 1WDWB 1T3HA 3BSFA 5JMWA 4BNDB 3NHRA 4YEDA 1OLOA 5B37A 1YACA 4B3MB 1LWOA 2LVBA 2IS1A 2OPBA 5TC4A 3CTPA 1Y6ZA 1IM2A 3A6FA 2YX1A 3IO3A 4LUCA 4DILA 2ZWPA 5JANA 1W8DA 5JAUA 2YV3A 1MIOA 2QTTA 3IO5A 4F5YA 1JWAB 4MR9A 2OO3A 1U0OC 2FN3A 1DLIA 2BDTA 3QQPA 5E4FA 2I6XA 4KG7A 4PYQA 3L6UA 1W0JD 5D5PA 3WV5A 1CBUA 2FF5A 2VG8A 4YFYA 2QRVB 2G4CA 2GBGA 3GJYA 5BMVF 3FNHA 3ROMA 4NVRA 4Q48A 1WCYA 1GGMA 3QNMA 4Y1RB 2OKCA 5I01A 3V1UA 1FS4A 1RRKA 1U5AA 1C7IA 3GUUA 4BNKA 1I36A 1X7XA 4IKEA 5A5DA 4IYRA 3ZDAA 4HNRA 1PW5A 1OFHA 3KKKA 4WKOA 5KPDA 4YAUA 3N3BC 4GYJA 4ZVSA 1YD7A 1XLUA 2YS7A 4GX2A 1OLXA 3KEMA 3AKEA 2NU9A 5G0TA 4MRAA 1KZ4A 2MJLA 1SAYA 2JDIA 2C9OA 4AF7A 1EBBA 2A0KA 5A2QA 1XXHA 2ZT5A 4F71A 4AM8A 1W85A 3PCRB 1GD1O 2A5LA 3QIVA 3P97A 2GEUA 1R4MB 1N6OA 5KNBA 4ONEA 4C0WA 3DHYA 4WEOA 2FMTA 1X1SA 4LS3A 2PRIA 4QBIA 1MT3A 3HJBA 1QKJA 4GM4A 3OWXA 5M3BA 1MVLA 3WIEA 2QZ4A 4ENVA 3BGSA 3G23A 4BZXA 1BEZA 3FI0A 1EGAA 2FDRA 4DNOA 1YR2A 5CNJA 4DCVA 1I01A 1SXPA 2IUUA 2NXNA 4B4WA 3EA0A 3ANSA 1RCFA 1UL1X 1YBFA 3VR2D 1P19A 3FDJA 4MR8A 2PEYA 1X7DA 5LFAA 1MAUA 4Y1FA 4U39A 1Z6QA 3NWOA 1K5PA 5CEFA 5IAOA 4RFLA 4XR9A 1RPTA 3Q1KA 2Y3IA 1TB4A 1JHMA 1Y4UA 1TO2E 3LUFA 1S4MA 3TPFA 3WLPA 4EL5A 4Q03A 5BW6B 1T9HA 1N0IA 3BMNB 5GONA 4P7GA 1M2VA 1N1MA 1UOOA 3TH5A 3ENQA 1E64A 1FFDA 2ZDQA 4MCIA 3JQRA 4HXEB 4N5NA 1TCUA 3SSOA 1M6HA 3PCTA 3FTQA 2Q1WA 5CA1F 4PG4A 4CDRA 4IRMA 1DDIA 4REQA 1P5JA 2MSCB 3PKZA 3TQCA 3EVDA 3PGJA 5LNK1 3VSCA 2R3SA 4Q9JA 2ZI5A 3NUZA 3VNQA 2DE0X 3OIYA 4RTOA 3DMFA 4XM1A 5FL7D 4LDQA 5H16A 1XYGA 4IRXA 3BK2A 4MVJG 4OQQA 3I8XA 3OQIA 4H4CA 5HK9A 1Y9JA 2ZUTA 3HWWA 4P2GA 3PC3A 3FKJA 4DQDA 3RYTC 3CX8A 2VJBA 2ZRCA 2WINI 5KJCA 2XCIA 3DKVA 4H7KA 5F3WB 1LW7A 2PJZA 4WXEA 5IM5A 2D1FA 3ND8A 4PINA 4AX4A 3SAJA 2ZAMA 1NR1A 1V5IA 2CLCX 5DGHA 2AI1A 1FX0B 3HRKA 3HP4A 3JX9A 1QQTA 2ZTLA 4G86A 4NZMA 3C43A 3H4IA 3LH5A 5EP1A 4BEBA 3RKUA 1ID8A 5BSEA 2HGZA 2C4HA 4QYWA 3TKYA 3UB4A 3HDHA 4C0KA 2B69A 4QYXA 1XC7A 2HSWA 1OJLA 4A6XA 2VHEA 1IVYA 4B35A 4MB2A 2JKZA 4BNWA 5GOTA 2NUTB 4MI6A 2QJWA 4EFKA 1XVAA 1QUEA 5FPKA 4I1SA 4GF5A 3DLTA 2EXXA 1U9ZA 2GAIA 4EHKA 2CNWD 2DAPA 1HDCA 4MGIR 1FSFA 2P62A 5JVDB 3C4JA 1RYHA 2DKNA 4URVR 1UPBA 2QN8A 1RIIA 3IDFA 3JALB 4GX0A 1BN7A 2QTHA 4V0SA 3A3NA 2BTEA 2JJ2D 3IH5A 1IHOA 2J48A 5DLEA 3HB9A 4L4YA 4AZ3A 4YDSA 1DX9A 1X86B 2JGRA 3C3WA 3EH2A 5E9QA 3RODA 3V4PB 4EB3A 1AB6A 2IPOA 5CJPA 4O29A 5ALFA 2GZAA 4EIWA 5JNTA 1ZN9A 4EG6A 2FJPA 1M6VA 1H2AS 2C03A 3CN9A 3DBOB 3EZ2A 3KR2A 4Q3AA 3T35A 4AO6A 5KTNA 4XLTA 2DUMA 2IYQA 4YJHA 3FNBA 2XDAA 4PG7A 4WSOA 4C29A 1DC7A 2B7CA 2OZVA 2CLEB 4QDKA 1XCJA 3NRJA 2WVJA 1HKUA 2KPOA 4ON9A 4XM2A 5KNDH 3RUEA 1TYEB 2HHHB 2YWFA 3S70A 1JECA 1MDBA 5D5QA 2LDXA 2PQ0A 3KVYA 3OH8A 4Y6RA 4HPJB 2Q3MA 4HMOA 4W7HA 4G63A 5DKFA 1QU3A 3HFRA 4DHEA 3F6YA 3OZCA 5B1HA 1KJJA 2JGDB 4MWOA 3T7IA 4C21A 2VJCA 5C5CA 2QRPA 5DV9A 1NBIA 1L1RA 3WZLA 2FN8A 2ZRAA 4YT4A 1Z8HA 3A7DA 2I78A 4QEKA 1TYBE 1K0FA 3A4TA 1DB3A 4P38A 3WGGA 4IVRA 4QYIB 1WHTB 2EZTA 2QRNA 3MJFA 3V7NA 1EHIA 1JLMA 1T4BA 2PBLA 1VHJA 4OQPA 3ZV4A 4I9NA 5AP9A 1RNLA 3VUEA 2QUHA 4BO3A 1YQWA 1C1DB 3HXTA 1D2MA 2XB8A 4F5ZA 2IU0A 3U4IA 5E0KB 1GNVA 3BK1A 1VLQA 2A35A 1C8BA 2H2IA 3N53A 4XLZA 5FI5A 1Z5GA 4OI1A 2IOYA 5CEJA 1OH8A 4XVRA 5EUBA 1C3EA 3BZWA 1IY1A 3WYEA 4WEQA 2Q3LA 2GASA 1VI5A 2QSYA 4CV0A 1I7QB 1RFGE 1IPEA 1Y1KE 3KQHA 1W4CA 2PFGA 2YBEA 3LX6A 4M86A 3A6PC 3G8DA 1NBEA 4C3OB 2EEZA 2CJFA 2B1QA 2RGUA 3O3CA 1O6CA 1LLDA 4RTLA 2I5PO 2HQRA 2QTFA 3O38A 4L8WB 5C37A 1B23P 2W2KA 2XYQA 3BTSA 2HREA 4RK6A 2QX7A 2G1UA 3GB9A 2XDQA 3IKVA 5EKXA 5A62A 3JZFA 5KU1A 1KPGA 2CL6X 3IHWA 4DQXA 1K8RA 1CUAA 2LKCA 3MS4A 2OCDA 3A9VA 1AIPA 1QV6A 3L05A 2VUIB 3LQ1A 4IXWA 2AC4A 2BFPA 1YDFA 2Q0SA 4ITVA 3RVDA 2G77B 1X80B 1X92A 2FEAA 1UFKA 2OCAA 4FHCA 3GRYA 1WUIS 4EZEA 5HCIA 3ZWBA 4UMDA 4IIXA 5THKA 2OXIA 5E6SA 2D54A 4ZREA 3A1WA 3KSMA 3I61A 2VO1A 2HA4A 3A2KA 1JX6A 3BHMA 3GLUA 3O6VA 3ORSA 4JVNA 3B13B 1UMBB 4B1FA 3T4XA 1RHQA 4F2DA 3GJ8A 1XNGA 2O8NA 5HF6A 5A6SB 3RVSA 5DI3A 5M04A 4OMUA 2WYOA 3H42B 4D3ZA 5IAAA 2XA2A 4ZAXA 1C81A 3DQZA 1FFSA 4ZAGA 3RS0A 2FW6A 4E31A 2G71A 2Q5IA 1D0SA 2JJYA 4DQVA 3I58A 1W4ZA 3PXDA 1SELA 1LFAA 4KFSA 4RORA 3X2EA 1DIOB 1O94D 1TYCA 1OBOA 1YBMA 3DFIA 2WSYB 3BJMA 4X85A 4EGQA 2PZGA 3GFBA 5JWRA 1GAWA 3TINA 2UUAB 2GM9A 3L04A 1NXWA 3EZ9A 2FB9A 2M1ZA 3BGDA 3OPXA 4MARA 3D7LA 3LU1A 3QE4A 4RDIA 3FDZB 3FHJA 3V8VA 4FGKA 2CJPA 2FMIA 4RPHA 1L4MA 1PGPA 1EG2A 2PV7A 1QONA 5AW3A 1E1KA 2IUSA 3TLEA 5IAKA 1NBAA 2DYKA 3AF1A 2CVHA 3AC0A 3DWFA 3IAAA 3EXHB 4HZUA 1EK0A 2Q4OA 5FUYA 2FCRA 4BB5A 4U0KA 3AESA 3HSKA 2BMJA 3A1FA 3C5CA 3X1XA 5BN5B 2ZUUA 1HG1A 1WY7A 4D3DA 2QE6A 4UEJA 1BMFA 3BMQB 3AHCA 4ZYZA 5JS2A 3RVOA 3IBFA 2YKGA 1VL2A 3AP3A 1GFZA 4HB4A 4F1WA 5FPYA 2JZOA 3CLSD 4LWOA 3IFSA 2RGDA 5I8PA 2QW0X 3WDLA 3KDPA 3WAJA 2DCUA 3KTAA 1AGYA 1DAKA 1O9HA 2WJWA 3H9GA 3PUYA 4X8MA 2WUDA 3KRTA 2AFIA 2J9FA 3GUVA 1MX3A 3R6DA 2CVQA 3T7EA 4D9IA 2VLIA 4QDZA 3B6ZA 1XJ0A 2EBFX 1R3UA 3GZNA 4D1YA 2CXSA 2RGCA 1ULSA 5LQKA 2PUAA 5JJKA 4HP8A 1UDRA 1USIA 1S0UA 2IP1A 2P78A 1J00A 2O19A 3E18A 1USUA 4AJ1A 3UF0A 4HQRA 2BFFB 4KE7A 3LZCA 3CCFA 2Q50A 3WKEA 2PX0A 2QV7A 4X64B 2O07A 4PHTA 2VPIA 4HLQB 2D74A 1UP7A 3KDSE 4LYGA 1V8BA 3BHJA 4XIFA 1XXLA 1EB8A 1TVMA 3EPRA 3E4DA 3VH2A 4PF1A 1X39A 1LGYA 2QU8A 2ZWMA 4K9LA 4RFSA 5ERYA 1U1IA 1I5EA 3R5SA 4ZT4A 4QRDA 4LRYA 5GJWC 3GFPA 4KU4A 4ND8B 4R0VA 4A6DA 2V9ZA 4EDFA 2G5TA 3VBEA 5AESA 2XMDA 1XBTA 3I04A 4M55A 4O4JB 1Y6RA 4W9MC 3CUEF 1R6TA 2IV2X 2X0JA 3TOVA 2C2OA 1KGDA 1SBIA 3F5SA 3IQEA 4A6PA 2WNSA 3RREA 2A67A 2X1VA 3TQOA 3I2JA 4QLOA 4BGVA 4OA8A 3IKJA 3O8NA 4O4LB 4A8JA 2ZYUX 3FIJA 1KYTA 2GEVA 2JS7A 2G3YA 2GXQA 2X14A 1N8KA 4E12A 2WICA 4Y7CA 3EVFA 1MX9A 1JQ5A 3KOOA 3P9IA 3WGQA 1I7DA 1RYBA 3MD9A 3V4RA 1L5KA 3UMGA 3EC2A 3S4YA 3WQSB 3VZCA 5DM0A 1PUJA 1H1LB 3GPCA 2REBA 3SF0A 1P0IA 2FMHA 2IHUA 4G1UC 1SFRA 4D9BA 5K3OA 2QQ0A 3A1VA 1I3CA 4MEAA 3RRJA 1Z73A 1P6XA 4C4AA 5K3CA 4FMCF 2JAPA 4JP8A 3DZCA 3REOA 1KIAA 4EHIA 5FOQA 1QH1B 5IEBA 1OTYA 1RFLA 4KAXA 3NVMB 3QLUC 4BZZA 2NOAA 1ZGAA 5FWXB 1CB7A 1U31A 2PSEA 4TVOA 3T0FA 3VOBA 4GM1A 3HFJA 4R40A 1YH3A 3KG2A 4NOKA 4J4TA 3CCCA 3WXBA 3H9BA 2VHVA 4G0QA 1T15A 5B1SA 1NQAO 2PGAA 3AEKB 3K20A 2ES4A 2CJXA 3S28A 2HRQA 3AKZA 3DDWA 2QUJA 3OJFA 4JJIA 3RGGA 5FBVB 2ACKA 1H69A 1TZCA 1UBGA 3Q7QA 5EIEA 3KKLA 4DGQA 1HE3A 3BMOB 3DTVA 3G68A 3FGNA 4RZIA 1B3BA 3T3NA 3UW3A 1EX1A 5K5EA 3NORA 2CJWA 2OORA 4QPZA 3SBEA 4YV0A 1KOLA 4IV0A 5KX5F 4IZHA 3FLMA 2B7BA 1OD6A 2O2SA 2IDZA 3HJNA 4MDHA 4MVXA 4P4LA 3U17A 1R8JA 2WUGA 4KOAA 1Z7EA 3RFXA 3S2EA 1U3WA 4ENUA 5BQPA 5FLKA 1V7PC 1WXGA 3LP8A 4NBVA 1E1CB 3UK1A 3V4FA 4LTMA 3FZEA 4XGQA 4FWIB 5IDQA 3GLGB 3P4UA 6REQB 3THOA 3HBAA 4BMOB 3RVPA 1KJWA 2VWHA 1XRJA 3L6DA 4TN1A 2YHBA 1LRLA 4YP0A 2OUKA 4AJIA 4LMPA 3ABRB 3F7MA 1ZQ9A 4BMSA 3ZJTA 5F7OA 4YMIA 1BROA 4MQ4A 2JEYA 1G8MA 4P80A 4I55A 1C9DB 1T3LA 4TWRA 3CB4A 4JI1B 4ZCIA 1Y0BA 2GZSA 3L8DA 2E6UX 5CM2Z 3CWZA 4H7EA 2I2AA 2XCUA 4KZKA 3Q3IA 1NVMB 1KRHA 4C04A 2YJGA 4GKBA 1KO4A 1II9A 2O0KA 4ZTZB 3EK2A 1KAQA 1IG0A 4PBSA 1G4UR 4JXXA 1Q77A 1JEOA 1A5AB 1NZJA 4AN1A 1T5IA 1CS0A 4YQYA 4LY6A 3FCOA 5EOVA 1I3OA 1YDHA 4R2XA 4B2PA 4IFTA 3UZUA 4CTKA 1BVRA 1V41E 4Q7KA 4WCFB 2J07A 1O96A 4G4JA 4TL8A 3RG8A 4XCQA 3QLUA 2G1JA 1C9JA 3IIEA 3BB3A 2Z2XA 3N74A 1GKIA 3O3OB 4MOWA 5DX1A 3GLIE 4JLUA 2QRLA 3OZUA 1ONSA 1PV1A 1N2HA 3SE0A 2DOKA 1CVRA 4FOTA 1I33A 1E96A 2W7TA 2ZUDA 5L7YA 4OPMA 1NXVA 1RABA 3BF7A 1OW3B 1E3TA 1UBUS 5D6OA 5HDQA 4Z4EA 1VRCA 1ARZA 1J8DA 5DLPA 2OD9A 2RHJA 4KLRA 1P6QA 2IXEA 1ECCA 2Y68A 3HU3A 3O90A 4LHZA 1O58A 3E5NA 4RMNA 4S2EA 4UU8A 4ZGWA 1JEYA 1JS1X 3DLHA 2C9BA 1TOAA 4IMJB 4JT8A 4URUR 1OI7A 4QGAA 3ZDEA 3V00A 3WGMA 5HA5A 721PA 2ZUFA 2J87A 7YASA 1B8NA 2MOKA 3A11A 2IU3A 2VPYA 4NDAA 4RZ3A 5KB3A 4A91A 5LWQA 3P94A 3TDMA 2KB0A 2X8BA 2ZBPA 5IT5A 1QZZA 4MIYA 4BASA 3OTGA 1K7YA 3EIWA 3ETCA 4TKMA 3RS3A 2Z08A 5BNZA 2ZZKA 2Z5VA 3E7PA 4TKVB 5AW7A 3I9JA 4TWAA 2GYWA 4GRAA 4CM5A 1LCIA 3HO6A 4YRIA 3FTEA 2WYUA 5TPZD 3COVA 4HRVA 3KVOA 4CKCB 3VYWA 4PQEA 3WTCA 2X8LA 4WQMA 1XNHA 2R2GA 3O7MA 2GEKA 5CGZA 1V5WA 3D0RA 3DMGA 4MGYR 4RYDA 3U4GA 4X65B 4NBLA 3ZJVA 5LP6F 1MQSA 4MA0A 5AXAA 1DX4A 3V8BA 3L6RA 4FFSA 1P17A 2AZXA 3LBHA 3QX7A 4TSRA 5IG2A 1G5QA 2YQ4A 2B92A 2ZYHA 4GBED 4N3AA 5C8YA 3UK7A 4ZAYA 3BRSA 4HUQA 3K53A 4G6ZA 4KQWA 4K6HA 4QQNA 4YPFA 3MTJA 3KYBA 1VHDA 3KHKA 3SYRA 2XF8A 1DMRA 4C0LA 4DOMA 3KUKA 1RXCA 2XT6A 3EIHA 2FRDC 1Q16A 4FLEA 4GNKA 2E89A 4R84A 3G5MA 4LCEA 4JI4B 1L8LA 4MPJA 5LLTA 3N05A 4KQJA 2J3LA 4U3JB 2P2YA 5T67A 5I6DA 4PZLA 4F11A 1BMDA 1OY1A 1P33A 3ABSB 4OB7A 2QAJA 4KUHA 3WGJA 5AHOA 3WS7A 1I1NA 2PFKA 2DHQA 2P6UA 4HWKA 5DHRA 4AMVA 2R4QA 4WJZA 1UOQA 3QHQA 1WF6A 2MYPA 4O4HB 3W5UA 4XD7D 3Q0TA 3NOQA 3ESAA 1G6Q1 3NR2A 3QTLA 3HB4X 3N3AC 5IJXA 2NO9A 5MN5A 1AKNA 2CYAA 3CUWA 3JQGB 2JFWA 2J5KA 2YR0A 4FKBA 3G0DA 3N2GB 4BO8A 1JLKA 1WV0A 3CWCA 1H2EA 2QD2A 3QLVA 1FE8A 4R8LA 5TIIA 4J2OA 3ICEA 1JIKA 4M4SA 4QQ8A 2YZGA 3FF4A 5JDIA 2HX1A 4JLWA 1FUEA 2CLOB 2Z9BA 4RJJA 4MB6A 4E5MA 3LUAA 1UBCA 4JQSA 4WT7A 3DFMA 3B36A 3IPYA 1G63A 2WF7A 4J0DA 4WJLA 4BFYA 4AKIA 4PFKA 5CB4F 1IOLA 1JG6A 2SKCA 2B20A 4IGFA 3ZU4A 4EHHA 5CG1A 4OX9Y 5B58T 3G0HA 4Y6PA 4M9UA 2LIPA 4BFCA 2PV0A 1RLMA 1K0UA 3GBPA 2IS2A 2FSGA 1ZCJA 2QMEA 3DD5A 1KFJB 3KD3A 1NVBA 1ADYA 4FS8A 3V9PA 4US2R 1KWGA 1PP4A 3OKCA 2VC2B 4D99A 2V97A 5K9ZA 1YUMA 1HMYA 4ETMA 3IELA 2A1UA 4CLRB 4IGEA 4JIGA 2CBGA 4ZHQA 1IIBA 4R2HA 2IUFA 5G1PA 3VC3A 1WKBA 3AVTA 1CJSA 3O21A 1HE8B 2DSTA 4KDFA 4MKXA 1RWPA 1VE6A 4JDPA 3I8SA 3ZZMA 5LQJA 2CK3A 2FWAA 2ZQYA 3PUJA 4IDOA 3SK0A 4RTRA 2FRDA 1UMDB 2ZJ5A 1Q19A 1MRZA 5FNVA 2OY0A 2PVPA 1AM4D 4NICA 5I7RA 4TVKA 1NN1A 1TGYA 2HT6A 4DR6B 2C2MA 3RBAA 5AHKA 5EPOA 5K3DA 5LBIA 1ZA1A 2X4LA 2AN5A 1H3FA 2Y92A 1G20A 2IIPA 2G7MC 3R0QA 4Q6WA 3WJ1A 2PSHA 2Z6AA 4HLDA 4E2FA 1QB7A 4ANFA 3T3HA 4R7GA 3BQNB 3VPSA 1SHJA 1X0XA 1ES9A 2BCJQ 5KKNB 1Z39A 4PZDA 3T94A 4NK5A 4I9FA 3DV9A 5FPSA 1UPXA 4CW7A 5HZMA 5IJ9B 2D1QA 2ZB7A 1BQ3A 1V7ZA 3HV2A 3VZSA 2ZUEA 3FSGD 4H9GA 2PS1A 3BDVA 4QBGB 3LOUA 3QPWA 4KYUA 3LW7A 4TV9F 2LDBA 4MI1A 4MCHA 4W9NA 1A77A 3RVJA 2R6ZA 2VRCA 1JB1A 1JJFA 2YYSA 2ZETA 4NZ9A 3UOAB 4DMFA 4KSBA 5IWCA 4KWCA 3FPFA 4A8TA 2C94A 2GEDA 1E62A 4WY8A 1VDMA 1C30A 2DQYA 3ZI0A 1MPXA 2J4CA 4BO9A 1U7XA 2H4FA 3NM6B 3GD7A 1KYIA 2M6RA 3RU9A 3K9BA 4HFJA 1B00A 1S96A 1H65A 3G8YA 3I0ZA 4URWR 1Y8RA 4KXVA 4NPHA 1LSOA 5P8WA 1FF9A 4J3JA 3CLRC 1E61A 1ZR2A 2Z2JA 2LWIA 4AZ0A 1X1QA 2N1BA 2CLHB 4GPIB 1UWLA 5ALQA 4KR2A 2OMEA 3FB4A 3L7NA 4PM4A 4AG3A 4EVSA 2DKOA 1IBLB 1KI6A 4YMSA 1TZMA 2OB2A 4J76A 5J2UF 1DEXA 2V3CC 1OTHA 2QAGB 2XUJA 2JH3A 1RKBA 1XDZA 2GPNA 4FMBB 1Q1AA 4LY3A 5GADl 3MQ2A 3EXG1 1L5MA 1H42A 2HY7A 1W5TA 4QAJA 2XB6A 4HVLA 3EDOA 1UBFA 1VCNA 4BMPB 1JR3A 4LTDA 2GZRA 4C5CA 2IPNA 2HB6A 4MR7A 2WK1A 3L8EA 4Z7OB 1VMIA 3EX7C 1D2AA 3VPCA 3UHJA 4H3SA 4DHWA 2ZRPA 3C3EA 4K88A 4QTYA 1LLQA 2QYHA 4JUCA 4K05A 2OWDA 1OAKA 2BEVB 1L5SA 2Q9AA 2YXEA 5H9WA 2JA1A 3GIDA 4X1KB 4HLUC 1VL1A 4WBSA 4XVQA 4AX8A 2ID4A 2WY2D 2EKLA 4UJ3A 1VKRA 3KZNA 3L7MA 2XYRA 4BLSA 2I8LA 4F91B 3DCJA 2B1GA 3QKWA 3ZXIA 2WNIA 3HN6A 1DBRA 5ENDA 1ADFA 1ECGA 2H1LA 3WGNA 4TRMA 4EPTA 4TYWA 1UMCA 1FW8A 2J45A 3RSHA 2Z8YA 2PKXA 5AO9A 1YDGA 2OV3A 3GGDA 2P9BA 3SI7A 1WKCA 5CAEA 2PUGA 3IULA 1JIVA 4FLFA 3AF4A 3H9EO 4KDCA 5UKDA 5L3ZA 3MG9A 1SA0A 3JWHA 1E6WA 1EE9A 4EQ6B 3G5LA 5H5JA 1R00A 1RWVA 3CLUC 5K2OA 2BTOA 2C5SA 2XCRB 2P0EA 2VPQA 4J90A 2J6BA 4MRMA 3Q7RA 1R4AA 2PX2A 1RYEA 4JJKA 4MVJM 1FU4A 1L7NA 1ONOA 2E5FA 2FEMA 2XX3A 3DCIA 3ZW9A 1WY5A 3GLQA 4UD6A 3O8CA 4TQ9A 4CKXA 3FHLA 4AJHA 4TSFA 1YF3A 2GZ2A 4EWLA 2G4VA 3I0NA 3Q7PA 3JAWB 4FDUA 3VNUA 5KSZA 4X97A 3E0QA 1FDSA 3W8NA 2ADFA 2NTVA 2WU0A 3QU9A 2QR2A 3ZHQA 4UPEA 5FJIA 3PQDA 2ISCA 4M2LA 3GLFB 4Y30A 2IIBA 5MF6A 1QO0A 4M1WA 2QSZA 2XOKA 3IMKA 1FP4B 1U4SA 1T5SA 1H2ZA 2PUJA 3NBKA 3R44A 5JZMA 5K6AA 2H92A 2XYPA 4J2TA 1Z5VA 2OM6A 4YYZA 4I2VA 4XJVA 2GSWA 3F96A 4LRTB 2AOTB 2F9LA 4ZVTA 4YN3A 3EYAA 4YAOA 4Q16A 3ZJUA 2XIJA 2AQHA 3MGBA 3B7WA 1A9XA 2GN6A 5FR1A 3L2OB 4DTCA 2QX8A 1D0VA 3I12A 3R8FA 3FPKA 2AFHE 1K2VN 2FPPA 3BERA 3H1EA 4QDJA 1SMKA 3EGDB 4X0EA 3VO9A 5JFTA 4P93A 3RIHA 5IM4F 4RIFA 3ZE1B 1Z83A 4F5WA 3KQLA 5JG7A 1M2GA 2REOA 2UVDA 2EF0A 5TQJA 1SN7A 2UZ0A 5F21A 2I99A 4Q4DA 3RVLA 3RRZA 4NMWA 3DP7A 1JEYB 4Q1AA 3TNJA 1LBEA 3HEAA 3MBOA 5E3IA 3OZ7A 4Y3UA 1KIFA 1F9EA 3KQVA 1SUCA 1T8TA 4YIHA 1LI7A 2J3DA 2VK4A 4UVGA 1FOEB 1GU0A 1L4UA 1V1RA 1JN0A 4NH4A 1P2UA 4UOQA 4ENQA 1OZAA 1S9HA 2VAWA 2XJ4A 3SEZA 4OMDA 3WY9A 2BI8A 3TX6A 5CK4A 4CIYA 2F59A 3NG1A 1E0SA 1VIVA 4QFDA 3QU5A 3F74A 3MERA 5IARA 3ZZNA 1CUSA 2FPLA 2OZLB 2Q0HA 2V55B 5DMHA 3ZY3A 1IXSB 1XDBA 1R0ZA 4R68A 3ZZ0A 2D1SA 4BNLA 4DG5A 1IY0A 4OLHA 1V7QA 4YCAA 3ETDA 2DWOA 2WSSD 2D2EA 1E1DA 1EWTA 1DEAA 1F8YA 3I04M 1W6RA 3IT1A 3QW4B 4L5JA 2PJUA 1YONA 3IDSA 1AZLA 5L3QA 4Q4HB 3AM1A 4OL9A 1N3IA 1VSBA 1HEYA 3L9WA 3EPLA 2OK7A 5AIBA 3U80A 4R71A 5BV2P 2JC3A 3IP3A 1WUTA 3QTTA 4RJLA 5E8RA 3OZXA 2UXBB 2DUUA 5KWVA 2ZSKA 3ZDYB 3H0CA 3O92A 4MKHA 1NW9B 3STYA 2AOXA 2XGOA 5M5BA 1UEJA 4F93B 3K15A 1XMXA 5D6NA 3BD9A 1V9SA 3GDWA 5FQOA 4AJNA 1V3UA 1PR3A 5IVHA 4RH1A 3H4MA 4EY6A 1T6ZA 3OOJA 1I4WA 1BWQA 1P7WA 1UINA 3G49A 1CF4A 3AVVA 2YFYA 3UWPA 2P5TB 5JUWA 4E2XA 3BG5A 1LWNA 2VSQA 2CLMB 1J33A 1ACMA 1RU3A 2W98A 1R0YA 4BO7A 1HRKA 2N75A 1W19A 1H0KA 1ZWKA 4O4IA 3AT1A 3E1KA 4I3HA 1GITA 1X19A 2IZ1A 2Z30A 3PJDA 1XTKA 3W7BA 4AS3A 4LBYA 1T5TA 3H9JA 2BGLA 2CLIB 3AYZB 3R3SA 1QHXA 4O2BF 1VKZA 3EFOB 4F4JA 4MS1B 1QF9A 4J7UA 1DX6A 3JVDA 1SHTX 4R83A 3JU3A 4HXGA 1V9CA 4IY1A 5DM70 3A1EA 4D8WA 4BMXA 2JBAB 1E7MA 4E1VA 4BCCA 3P9QA 4CM9D 1I5RA 1VJCA 5TDHA 4HJRA 3ZE6A 4FDLA 4YMLA 1X7YA 2W8ZA 2BFNA 4OTZA 3PFIA 4XWGA 4HX9A 4G1BA 5GTDA 1VHWA 1EAMA 2V7XA 3GCXA 3QXGA 3R40A 4QLAA 3QE9Y 4OF4A 5CFRA 1C0EA 3H6GA 5L7TA 1FPQA 1NJ8A 4Y2GA 4QJ3A 1HDRA 2IHTA 4AMBA 2IITA 4RA6A 2PMKA 4FGSA 1FYXA 1X87A 5BYJA 4L4ZA 3CNOA 4KXMA 5PNTA 4D02A 5MHTA 3AV0B 4ZC8A 1HTWA 2V6FA 3TI9A 2DTEA 3TB6A 4ZVKA 1JP7A 2H2FA 4WZAE 3AVOA 4EA7A 1L7XA 5JI2E 1RLTA 5JYBA 1FX1A 3TTWA 1NHGA 1YRLA 2QVBA 1QORA 1AQJA 4Z5XA 1J0EA 3IJRA 4LI3X 2JI6A 1ZU4A 2FP3A 4FP9A 4ESVA 4MP6A 1GTSA 4DM3A 1XALA 1ZMRA 2NYAA 1NYTA 4BJ5A 1OU4A 3A4YA 1PWHA 3OQJA 3AVYA 4MA4A 3FA2A 5KI6A 2OHOA 3IR6A 4NYIR 1XDWA 1TA9A 1A95A 2CDRA 1SWWA 3LAWA 3PSHA 4QQFA 1QQ5A 4ZRDA 4ZVUA 5BUQA 3W7AA 4TOIA 3ZV6A 3TSWA 2H59A 1WW3A 2VJPA 2HIGA 2ZLBA 3KPYA 4KDEA 4ZJUA 4F92B 1GZ7A 2ZW9A 3F67A 3N2ZB 3LDGA 1MVOA 5IWAB 1NV8A 1RXVA 1F2UB 5J47A 4OLBA 1I9GA 3BICA 4GOLD 1FJXA 1JDBC 2JANA 4N0EA 1JFFB 5BWBA 2RHDA 3AONB 4ROSA 2CV2A 1VCIA 1V4BA 2IYPA 1BH6A 2FP4B 2HU2A 5EE5B 1SQFA 1P29A 5KIAA 2PYIA 4OB6A 1MO4A 1YIOA 4JJGA 2IW1A 2ZCJA 4WDRA 3MTDA 5AOBA 5JQWA 3LGAA 1E32A 2J0QA 1QHHB 1HZZA 5FA5A 3VDRA 3PDJA 2VKTA 4K5QA 1KQGA 2FEWB 2GPBA 3RK0A 4RTJA 1OB2A 3PVSA 1G3QA 3A14A 1AGNA 1V4VA 4R1SA 5HIKA 5LKRA 2Q3FA 4PBRA 1DAEA 2Z1NA 3JTEA 5EYPB 5BN3B 3ESXA 4NCKA 4JV5B 2PSJA 3Q11A 1UBKS 3BVPA 1PJTA 1T34A 1AUPA 4KQ9A 3UAGA 4ND7A 5AUOB 4UE2A 1KZYC 1GUFA 2XDYA 4E4RA 1ZGHA 4LX0A 2RK6A 2XITA 5T4EA 4UNRA 3KE9A 4B3RB 4HNVA 3O94A 4H6XA 3OTHA 4N01A 4D43A 1UODA 3QKSB 4Q82A 1RRPA 1AC5A 1Q0LA 2WWWA 1PZEA 3KYCA 4NONA 3MCAA 1NE7A 2P5UA 5EZYB 1AQNA 1NZDA 4P98A 3AUSA 1UBEA 1F8FA 3RFVA 3GDOA 4E2WA 1L5ZA 2W70A 1JKJB 2EBUA 4GC9A 2ZIZA 1BWRA 1G8PA 1U94A 1T3TA 2GLXA 1NN5A 3BSWA 3EVGA 4Y2XA 3KKQA 2H54A 3IA2A 4NIMA 3RO7A 1DRKA 3EVNA 4INZA 5HKLA 2I8AA 3U3XA 4AN0A 1GG9A 2XZDA 4IQFA 2QLFA 1IBSA 1LPBB 5B5SA 1QCZA 4I1RA 4ZV7A 3OSZA 3G0OA 3WIVA 1XKXA 3PRHA 4CR7A 3GRCA 1NXXA 4X61A 4EG0A 1CY6A 1N1GA 1TJYA 1R6UA 3GYBA 4K03A 3UYLA 3WP0A 1JLRA 3I73A 4P5PA 1PJ2A 3VKFA 5IVPA 3NI2A 3UGTA 4EATA 1Y8QA 5CGQB 4KR9A 4LNUA 3OEHD 5FL3A 4BVBA 3K5IA 4DLBA 1QE0A 4UBOA 4ZI2A 3S81A 3HJTA 2YY7A 4NTZA 1E9EA 3QITA 4QWMA 3TYXA 4HYTA 2QDKA 2MSNA 4AWAA 2A5DA 3PA6A 1D2RA 5CU7A 1V48A 2ZYSA 3WNZA 1Z6TA 4WZ6A 3VU0A 1NXQA 1Q6ZA 1D1TA 5GM2A 2CLKB 5BUZA 2R6JA 3JQQA 1YJAA 1XZPA 2RGGA 4LVOA 5C4IA 1ONPA 2FQ1A 5TE9A 4FLMA 4R31A 3EPKA 4L6AA 4N65A 4W9RA 1GGNA 5DYGA 1VLMA 5IBQA 4H1TA 2QTMA 5D87A 1TGVA 4HPXB 4O02B 2FWNA 4M21A 3ZCTA 1DKPA 1T8PA 4MR9B 3OCZA 4BQIA 1NVWQ 1U28A 3IBYA 3TQQA 1I2MA 1NVEA 3ESBA 3ESYA 4O6VA 5TQVA 4LHWA 2CXQA 3KYJB 5DYNA 1UC4B 3KOYA 4NULA 3UN1A 4COOA 4MQEA 4DKJA 5JLJA 1V5EA 1MAHA 3FTFA 3NW9A 3QBDA 4GOND 2QJOA 4YRRA 4WOCA 1DC8A 5IP5A 3E5MA 5BT9A 1QO9A 1XWIA 3EMDA 1T43A 3LPLA 1FUIA 2ZB8A 3S1LA 4YY3B 3OD1A 5EKSA 4HVCA 5LMNB 1EFDN 4FHZA 1OLXB 3FSEA 2NU9B 3VKVA 2FLVA 4AUMA 1VXRA 2ZE6A 3T9FA 1K5HA 2RBEA 3R5HA 2GN4A 1YULA 2HJWA 4X9XA 1XXHB 5BSWA 1IB6A 4D8YA 1O03A 1W85B 3ZOKA 3UMCA 1Q14A 2ATXA 1NXSA 2EVWX 2WPNA 2IYXA 3I6ZA 2YZKA 2HSDA 2PUWA 4Z8XA 1KJ9A 4BRZA 1NL3A 5IUNC 4RVCA 3V80A 4WINA 1ZISA 1P2TA 3QEBZ 2XQVA 2MSWA 3I64A 3UC5A 4BUCA 1Z2AA 3OHPA 4G01B 3GV0A 1ILWA 1G2IA 1NNLA 4L6CA 3FWYA 4X6UA 5AKYA 3WR5A 4YUAA 2E5WA 4M9RA 2EFYA 3N0XA 5ER6A 3MPUA 1OLSA 2C3OA 3RUIA 3FZQA 1LVUA 3O75A 4JU8A 3VKHA 5FTKA 1R18A 2WF6A 1GLVA 3GO4A 3CXUA 5TF4A 4MUYA 2ILTA 4MWZA 3U3OA 5KC8A 3QMVA 4MR8B 5JXJA 5CDFA 3ZS8A 4EEKA 3P0EA 4CKWA 1KY4A 1CRLA 1WULS 3ICVA 1Q50A 1O0CA 3OUUA 3I83A 4OHXA 1KXJA 4BBAA 4ZMBA 5IHXA 1KL7A 1E2LA 1ZVVA 2F1KA 4FE3A 5GONB 4GR9A 1QCCA 5AW4A 4A36A 1VP9A 1M2VB 3LUCA 3MRSA 3DOHA 2DHRA 4HLCA 4WHMA 1VE3A 3K0EA 4DQ0A 1ONBA 2P1ZA 4M46A 4RF2A 4J0GA 4F2HA 1HNXB 3KE8A 1SHUX 3KZ1E 3EIQA 1E92A 4JC5A 5DEOA 1APBA 1M7GA 1L6IA 3L7CA 3GP3A 3M49A 1TAUA 2ZITA 3NIDB 5DU2A 4GE3A 2WOOA 3K70D 2I6UA 3HBLA 4GQAA 5I8WA 1XPRA 2C8VA 4F86A 5BSKA 1C9YA 2Q7XA 1ZVKA 1A88A 3OQIB 3PF8A 4FTWA 2JJQA 5EZ5A 4HT3B 5BSHA 4NCBA 3R7FA 4LXTA 2GERA 1R9NA 4L7QA 4Q9NA 5CFNA 1O0SA 2YVLA 1UJMA 1G6HA 3R7NA 3IAXA 2KLBA 2P6NA 3FJOA 2OSVA 4K6FA 2DRIA 1X94A 2BP7B 2OFWA 2WUVA 1U1EA 1U8EA 2FUEA 1PLKA 3CB2A 3P5SA 4U7WA 5LOVA 3Q9NA 4I4CA 3UV7A 3HUTA 3IDAA 4QAQA 3TJZA 3WFZA 1BZYA 4C6SA 1BS2A 1XWWA 5DN6A 3L7IA 3BDIA 3UT6A 2ECKA 1JG2A 3IILA 1M8JA 4D97A 3DCNA 4CF7A 2OFFA 4DCPA 4FOLA 4FOPA 1M74A 4NE7A 3W4KA 3ZZ1A 3FHTA 4B3SB 1D04A 1M8KA 2BONA 1NC1A 1P9OA 1P2DA 2NZXA 4B6FA 2DPMA 4INAA 5CDTA 2IBSA 1Y3IA 3ILHA 2Q6IA 1EESA 1QFXA 2I1WA 4JLBA 1RRMA 1U6JA 2LKDA 1RLJA 3DBHA 3E23A 3KWFA 5I7VA 4KMMA 3MCUA 4G09A 1RPAA 1GR1A 1ULHA 4X7MA 5E1DA 4ZT5A 7AT1A 4EEXA 1MEEA 1SZCA 4RTNA 2Z8YM 3L4JA 1FRQA 3DAHA 4MS3A 3ILVA 2PEZA 4AZ3B 2C04A 4LMAA 2GWHA 1JZSA 3ZS9A 4CKEA 2Q0XA 2R65A 1GPLA 1YL7A 3C3YA 1GPUA 5J2UA 1M6VB 1RJWA 2FUNB 1C9MA 1XO1A 1T0JB 1XRQA 2D3WA 4JJAA 2O7SA 1YOBA 5A6VA 5KREA 3RU2A 1TK9A 4YJHB 2O6HA 1MAWA 1WUYA 3G2NA 3L1IA 4J16A 3LY5A 4KO4S 5IKOA 1XDGA 2VT6A 4DA8A 4E6PA 5ALTA 1NN0A 2IP2A 1BDBA 2PH7A 3N59A 3HDVA 5C52B 4R5MA 1CUVA 2D0PB 3MYRA 3ORQA 3MJEA 3JWPA 4NE2A 1P2VA 4TMYA 2YOGA 3L7DA 4Y1EA 4FBGA 5AH0A 1BIFA 5HZHA 3F8WA 1YJQA 3DXXA 2G0NA 3FF1A 1DFGA 3LP6A 3TJMA 1DXHA 2VHZA 5G0VA 3D6UA 4C76A 2XXAA 1AXRA 2HUNA 3IIKA 1VZ3A 1SCUA 2Z2KA 4B3IA 5ENVA 4XM0A 1H2XA 3V1YA 2O2DA 1LB1B 4V3BA 5JRZA 1U3FA 1EDDA 2HK9A 3RWBA 4DJEC 1JSZA 5JD6A 1W88B 1Y37A 2YS6A 4PX9A 5TQ0A 4AYTA 5AVTA 2DY1A 3OMWA 2GPJA 3OI7A 3DKRA 2PZKA 4IHQA 4X3CA 3QVJA 4UBKA 4J0IA 4ZC1A 2VTDA 4XVCA 5AKZA 2I54A 5F1YA 4TYPA 2BJWA 3L5OA 4G1FA 4X8LA 2AEMA 1GDDA 3GGGA 3RUPA 3U4HA 3K0KA 4OO3A 2PIDA 1GKYA 1VG8A 4MVWA 4XYGA 3UFXA 4GVXA 1A9QA 1N25A 2HA3A 3COYA 4GMDA 4BVKA 1E9RA 4MTLA 3CRMA 2GEFA 4J0JA 4FCVA 4I6JA 4L57A 4AULA 2E1RA 2W2KB 3B8EA 3GNLA 1RBYA 4EY8A 1CDZA 3F6CA 3MT9A 1UIRA 4II7A 4RKEA 1KY2A 2QN2A 4D79A 2ZRMA 1ADBA 1O89A 4R7ZA 1Q3KA 5L3RA 1NFFA 2BW0A 2O1XA 4A82A 5B58C 4ZOLF 4MRPA 1U2GC 5K3EA 4UUOA 1IZZA 3Q41A 3SD7A 3UJ9A 4LF7B 4C0AC 5K4AA 2JIPA 3JTMA 4ITUA 1F1JA 1VG0B 4XJTA 4OG2A 5E6SB 2P41A 2Q5CA 2AOUA 2Y05A 5I7AA 1HLGA 1YA8A 1LDEA 2POQX 3GFVA 4HUJA 1BXKA 2WU8A 3PD1A 2Y27A 3EC7A 4J49A 1N92A 3ZY5A 1UFOA 3GWGA 2ZANA 3D3WA 1EG7A 1NUAA 3G6KA 4JLJA 4OGWA 2EL9A 1DHRA 1GKUB 1IFXA 2ALJA 2DFLA 2V1XA 3HCCA 5M29A 1LU9A 4O4JF 1NHWA 5A4AA 1JHOA 5KJFA 2W2PA 1Z3CA 4IGKA 2JI4A 3GUYA 3SKYA 3VPBA 1AGRA 4FW8A 4B2YA 2HWKA 1D8AA 5ILQA 3RUFA 1HUQA 2JGKA 4UPDA 4WK2B 4LJAA 5E6UA 1FYFA 3H04A 1MQ9A 5F2OA 3VAZA 3W2GA 3W9YA 2VYNA 4V0LA 2CL0X 5TMPA 3BTVA 2Y77A 1YZKA 2R96A 3Q2KA 1RMQA 2HUPA 3FPJA 4L3OA 5A3JA 5ARCA 4ZJPA 4HB0A 5IH7A 2ZM5A 3EC1A 3L01A 3U1BA 4X45A 3DOJA 3TFWA 1ZOLA 1NT4A 1SIUA 1U7PA 3ZE9A 5F4BA 1FLVA 3QPAA 1Q15A 5G0SA 5LQCA 1JYFA 1XCGB 4KIFA 3WAGA 3H86A 4DLPA 3VO8A 2C20A 3GVXA 1OWOA 3R3YA 5EGNA 2EFCB 4I6EA 4HZUB 2MCFA 2H48A 1NT2A 3QVGA 2JGMA 3AESB 1COWD 5A4DA 1XZIA 4KGDA 4ZI3A 2KM1A 2OHIA 1QDUA 5LJIA 4FC6A 4UU7A 4JP1A 4B9EA 5DFAA 3ILSA 3EHEA 4DLZA 4K86A 1Z75A 3QF7A 3IXMA 1XZLA 4JI5B 3RHZA 4Y2QA 2QL9A 3GPDG 2R5FA 4B2IA 1L1QA 5AVKA 1VA5A 4GDFA 2X5KO 1ZM7A 2W93A 2ZU0C 4LC9A 1SVOA 1UADA 2P69A 2D5BA 3KTAB 4GI1A 4EHFA 3B6EA 4QZVA 3UK0A 5L3SA 3TR6A 1MC5A 2AFIB 3M6UA 2J9FB 1N5OX 3P45A 1E4VA 4FD3A 2GHRA 4FSXA 1QZXA 3G2HA 3S2IA 5T8KA 4ID9A 4Y6SA 1NW5A 1A7JA 1MF7A 3X44A 4YJGA 3NVDA 2VZ8A 5LYYA 4OH1A 1LEHA 3ZX5A 3KB2A 4W7IA 5EP3A 1CJBA 3O4HA 3L6CA 3LY8A 1U2PA 2ONCA 3VYUB 3KOUA <