4OBIA

Crystal structure of a duf1312 family protein (ef3258) from enterococcus faecalis v583 at 1.73 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
TYQAVLKVDNKVIKVFDLKKDGPHYTYKYEAKDGDYNLIEVDGDRIRVKEANCADLVDVRRGWISKPGETPIACLPHNLFITVEASD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (EF3258) from Enterococcus faecalis V583 at 1.73 A resolution
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2014-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 4obiA00
1NPPA 1NPRA 1M1HA 4OBIA 4ESNA 1M1GA 3LD7A 2KPPA
chains in the Genus database with same CATH superfamily
1NPPA 1NPRA 1M1HA 4OBIA 4A0TA 4ESNA 2YQ2A 1M1GA 3LD7A 4A0UA 2KPPA
chains in the Genus database with same CATH topology
1NPPA 1NPRA 1M1HA 4OBIA 4ESNA 1M1GA 3LD7A 2KPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPP A;  1NPR A;  1M1H A;  4OBI A;  4ESN A;  1M1G A;  3LD7 A;  2KPP A; 
#chains in the Genus database with same CATH topology
 1NPP A;  1NPR A;  1M1H A;  4OBI A;  4A0T A;  4ESN A;  2YQ2 A;  1M1G A;  3LD7 A;  4A0U A;  2KPP A; 
#chains in the Genus database with same CATH homology
 1NPP A;  1NPR A;  1M1H A;  4OBI A;  4ESN A;  1M1G A;  3LD7 A;  2KPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...