4OBMA

Crystal structure of a putative transcription regulator (eubsir_01389) from eubacterium siraeum dsm 15702 at 2.15 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
258
structure length
258
Chain Sequence
KDATVNVSQNQTAIFTPDSTYDFSVLMTLSADNDKTPDKYMTITYIAKNNTFVLMPYLPNAVIDGGNTIKQICEQSGEAEVAKLLSSKTGLSINKYIRFTKSTLTELFDMVGNTTLTVPSEIKYENKKDNTVTIIKKGTQIFTAEQMYAYLTLPDYGVKDELYPCKLNATVISSFIDQNFIGTSSKTLDEYINFIINFTNTNIEQSDYDAKVKAIVYTLSQNKSSVTDFYIPYGDKSGDDYIIDDNSWNSAKKALGTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (EUBSIR_01389) from Eubacterium siraeum DSM 15702 at 2.15 A resolution
rcsb
source organism Eubacterium siraeum
molecule tags Transcription regulator
molecule keywords Uncharacterized protein
total genus 77
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2014-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.150 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4obmA00
3OKZA 3OWQA 4DE9A 2XXPA 4DE8A 3TELA 2XXQA 3NROA 3MEJA 3TEPA 3QFIA 3TFLA 4OBMA 3NXHA 3PE5A
chains in the Genus database with same CATH superfamily
2PUBA 1PERL 2PUAA 3CROL 3A9XA 3BS3A 1SQ8A 1CJGA 4Q2JA 2LYSA 2AXVA 2LLVA 4JQDA 1PRUA 1DWKA 1R69A 1BDHA 4OB4A 4DE9A 1DULA 4YG7B 4IWRA 2OR1L 3F6WA 3GN5A 1HF0A 4O8BA 3L1PA 3D1NI 2HINA 1AU7A 4FBIA 2LYRA 2AXUA 4JCXA 3O9XA 2PXLA 4X4BA 3R09A 1ZPQA 2IVGA 1OCTC 1QP7A 5DTRA 1JWLA 1QQBA 4X4GA 2HCNA 2PXBA 2PE5A 2IVQA 4X4EA 2JCGA 3QQ6A 1VPWA 2L49A 4Z5DA 3G5GA 4ER7A 2XXQA 3KXAA 3KJXA 1POUA 2PUDA 3FYMA 4IA8A 4ER5A 1ZAYA 4Y42A 1ZZ6A 4ER6A 3VK0A 1GT0C 2OFYA 4GQMA 5DRYA 1QPZA 1QP0A 3OQNA 2BNNA 5K98B 3A9ZA 4I8TA 3PXPA 4ER3A 2D5VA 2V3CC 2PUGA 1Y9QA 3BD1A 3RZZA 2KEJA 3NXHA 3PE5A 1QZXA 3GBFA 3S8QA 2WIUB 2B5AA 3LISA 4X4IA 3QYXA 2PUEA 1WH8A 1NW3A 1YSEA 1ZZ7A 2PXDA 4ER0A 2BNMA 3TFLA 1QP4A 1R63A 2L1PA 3ZPXA 1UTXA 4X4FA 1ZS4A 2PXEA 2IVBA 1ZUGA 2LLWA 1X2LA 3ME5A 3TEPA 2LYKA 3OWQA 4FN3A 1HQ1A 4Z5HA 3QWGA 1MFQC 4EK9A 4X4DA 2EBYA 3ZKCA 1RPEL 2XXAA 4EKIA 3U3WA 2LNMA 3DNVB 4Z5CA 3GZDC 3SX0A 1RIOA 2L8NA 3KZ3A 3OMTA 2XIUA 2ODRD 1X57A 2XI8A 4IVZA 2ICPA 3ZHMA 3VWSA 4Z59A 2GRMA 2CROA 2EWTA 4YG4A 4J1XA 5GAGi 1QB2A 4F8DA 3SCFA 1ZZ8A 3GUUA 1LLIA 5JUWA 1DW9A 2H8RA 1PRVA 1RZRD 5DTQA 3CLCA 1S7EA 2IV1A 1Y7YA 1B0NA 1NERA 2EF8A 3NDBB 2O38A 2LYQA 3LQXA 1WIZA 2FFHA 3DM5A 1IC8A 1ZZBA 2GZUA 3EUSA 2JVLA 3F51A 2HCSA 3IVPA 3G0TA 2KPJA 3TRBA 3NZLA 2GRLA 1RZRA 2R63A 5A7LA 2PXQA 3A9YA 4JCYA 2PXVA 4GHJA 4I6RA 2PIJA 1LQCA 4X4CA 5DRTA 1ZZ9A 2PPXA 4PU7A 2LYPA 2M4HA 3MLFA 3NROA 3SCHA 2MQKA 3SCGA 5DSXA 2XXPA 4WVLA 2LYLA 4OBMA 4X4HA 3BDNA 3QOXA 1BDIA 1UXDA 3GZDA 1RZSA 2LYJA 2BNOA 2PXKA 1QQAA 3G7DA 1EFAA 2IUOA 2R1JL 3JXCL 4MCTA 3OQOA 4Z58A 2PXUA 4YARA 1UXCA 2VEOA 1XWRA 3JXDL 1OSLA 4EKGA 2FJRA 2PUFA 2AWIA 1NEQA 1LMB3 2O4AA 1JFTA 1ADRA 2AW6A 3GZCA 3JXBC 3QF3A 1LCCA 2WUSR 4PU8A 3FMYA 1L1MA 2PXTA 3KL4A 2JQEA 1PRAA 2ICTA 3F52A 4YG1A 1PNRA 2XSDC 2YBDA 1CQTA 3OQMA 4MCXA 2J7WA 4HRAA 3OP9A 2IU7A 2AUWA 5DT2A 2J7UA 1ZVVA 4I6UA 3M9LA 2PUCA 2KEKA 2XCJA 2CSFA 2PXPA 3TELA 3CECA 4PU3C 2MEZA 3H5TA 1E3OC 3UWPA 5GAHi 2XJ3A 2A6CA 4YBAA 3SR4A 2KEIA 4DE8A 2AXZA 5DTMA 4J1WA 1WH6A 2KZ8A 4EQZA 1JH9A 3OKZA 2HSGA 2HFZA 3MEJA 3QFIA 3HZIB 3LFPA 3B7HA 4EZIA 3ZHIA 1ZZCA 1WETA 2LCVA 2MXDA 1JFSA 2PXFA 3QOWA 2BJCA 1O4XA 3R1FA 1U2ZA 3UFDA 4NDWA 4PU4C 4I6TA 3FYAA 1LCDA 2O49A 3GN5B
chains in the Genus database with same CATH topology
3QOXA 3GZDC 5DRTA 3SX0A 2J7WA 2LLWA 4HRAA 5JUWA 3GZCA 3GZDA 2MXDA 3A9XA 3ME5A 3TEPA 3SR4A 2HCSA 3A9ZA 5DT2A 3OWQA 2J7UA 4ER7A 3G0TA 4Q2JA 4DE8A 4ER3A 2XXQA 1NW3A 3M9LA 2LLVA 3NZLA 3QOWA 5DTQA 2ODRD 2M4HA 4ER0A 2VEOA 1U2ZA 5DTMA 4ER5A 3R09A 4DE9A 3VWSA 3TELA 4EK9A 3NROA 3TFLA 4EQZA 4EZIA 3A9YA 4EKGA 3NXHA 5DTRA 2L1PA 3PE5A 3ZPXA 3OKZA 5DSXA 2HCNA 4ER6A 2YBDA 2XXPA 4EKIA 3UWPA 2HFZA 3MEJA 3QFIA 4WVLA 2LNMA 4OBMA 5DRYA 3GUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKZ A;  3OWQ A;  4DE9 A;  2XXP A;  4DE8 A;  3TEL A;  2XXQ A;  3NRO A;  3MEJ A;  3TEP A;  3QFI A;  3TFL A;  4OBM A;  3NXH A;  3PE5 A; 
#chains in the Genus database with same CATH topology
 2PUB A;  1PER L;  2PUA A;  3CRO L;  3A9X A;  3BS3 A;  1SQ8 A;  1CJG A;  4Q2J A;  2LYS A;  2AXV A;  2LLV A;  4JQD A;  1PRU A;  1DWK A;  1R69 A;  1BDH A;  4OB4 A;  4DE9 A;  1DUL A;  4YG7 B;  4IWR A;  2OR1 L;  3F6W A;  3GN5 A;  1HF0 A;  4O8B A;  3L1P A;  3D1N I;  2HIN A;  1AU7 A;  4FBI A;  2LYR A;  2AXU A;  4JCX A;  3O9X A;  2PXL A;  4X4B A;  3R09 A;  1ZPQ A;  2IVG A;  1OCT C;  1QP7 A;  5DTR A;  1JWL A;  1QQB A;  4X4G A;  2HCN A;  2PXB A;  2PE5 A;  2IVQ A;  4X4E A;  2JCG A;  3QQ6 A;  1VPW A;  2L49 A;  4Z5D A;  3G5G A;  4ER7 A;  2XXQ A;  3KXA A;  3KJX A;  1POU A;  2PUD A;  3FYM A;  4IA8 A;  4ER5 A;  1ZAY A;  4Y42 A;  1ZZ6 A;  4ER6 A;  3VK0 A;  1GT0 C;  2OFY A;  4GQM A;  5DRY A;  1QPZ A;  1QP0 A;  3OQN A;  2BNN A;  5K98 B;  3A9Z A;  4I8T A;  3PXP A;  4ER3 A;  2D5V A;  2V3C C;  2PUG A;  1Y9Q A;  3BD1 A;  3RZZ A;  2KEJ A;  3NXH A;  3PE5 A;  1QZX A;  3GBF A;  3S8Q A;  2WIU B;  2B5A A;  3LIS A;  4X4I A;  3QYX A;  2PUE A;  1WH8 A;  1NW3 A;  1YSE A;  1ZZ7 A;  2PXD A;  4ER0 A;  2BNM A;  3TFL A;  1QP4 A;  1R63 A;  2L1P A;  3ZPX A;  1UTX A;  4X4F A;  1ZS4 A;  2PXE A;  2IVB A;  1ZUG A;  2LLW A;  1X2L A;  3ME5 A;  3TEP A;  2LYK A;  3OWQ A;  4FN3 A;  1HQ1 A;  4Z5H A;  3QWG A;  1MFQ C;  4EK9 A;  4X4D A;  2EBY A;  3ZKC A;  1RPE L;  2XXA A;  4EKI A;  3U3W A;  2LNM A;  3DNV B;  4Z5C A;  3GZD C;  3SX0 A;  1RIO A;  2L8N A;  3KZ3 A;  3OMT A;  2XIU A;  2ODR D;  1X57 A;  2XI8 A;  4IVZ A;  2ICP A;  3ZHM A;  3VWS A;  4Z59 A;  2GRM A;  2CRO A;  2EWT A;  4YG4 A;  4J1X A;  5GAG i;  1QB2 A;  4F8D A;  3SCF A;  1ZZ8 A;  3GUU A;  1LLI A;  5JUW A;  1DW9 A;  2H8R A;  1PRV A;  1RZR D;  5DTQ A;  3CLC A;  1S7E A;  2IV1 A;  1Y7Y A;  1B0N A;  1NER A;  2EF8 A;  3NDB B;  2O38 A;  2LYQ A;  3LQX A;  1WIZ A;  2FFH A;  3DM5 A;  1IC8 A;  1ZZB A;  2GZU A;  3EUS A;  2JVL A;  3F51 A;  2HCS A;  3IVP A;  3G0T A;  2KPJ A;  3TRB A;  3NZL A;  2GRL A;  1RZR A;  2R63 A;  5A7L A;  2PXQ A;  3A9Y A;  4JCY A;  2PXV A;  4GHJ A;  4I6R A;  2PIJ A;  1LQC A;  4X4C A;  5DRT A;  1ZZ9 A;  2PPX A;  4PU7 A;  2LYP A;  2M4H A;  3MLF A;  3NRO A;  3SCH A;  2MQK A;  3SCG A;  5DSX A;  2XXP A;  4WVL A;  2LYL A;  4OBM A;  4X4H A;  3BDN A;  3QOX A;  1BDI A;  1UXD A;  3GZD A;  1RZS A;  2LYJ A;  2BNO A;  2PXK A;  1QQA A;  3G7D A;  1EFA A;  2IUO A;  2R1J L;  3JXC L;  4MCT A;  3OQO A;  4Z58 A;  2PXU A;  4YAR A;  1UXC A;  2VEO A;  1XWR A;  3JXD L;  1OSL A;  4EKG A;  2FJR A;  2PUF A;  2AWI A;  1NEQ A;  1LMB 3;  2O4A A;  1JFT A;  1ADR A;  2AW6 A;  3GZC A;  3JXB C;  3QF3 A;  1LCC A;  2WUS R;  4PU8 A;  3FMY A;  1L1M A;  2PXT A;  3KL4 A;  2JQE A;  1PRA A;  2ICT A;  3F52 A;  4YG1 A;  1PNR A;  2XSD C;  2YBD A;  1CQT A;  3OQM A;  4MCX A;  2J7W A;  4HRA A;  3OP9 A;  2IU7 A;  2AUW A;  5DT2 A;  2J7U A;  1ZVV A;  4I6U A;  3M9L A;  2PUC A;  2KEK A;  2XCJ A;  2CSF A;  2PXP A;  3TEL A;  3CEC A;  4PU3 C;  2MEZ A;  3H5T A;  1E3O C;  3UWP A;  5GAH i;  2XJ3 A;  2A6C A;  4YBA A;  3SR4 A;  2KEI A;  4DE8 A;  2AXZ A;  5DTM A;  4J1W A;  1WH6 A;  2KZ8 A;  4EQZ A;  1JH9 A;  3OKZ A;  2HSG A;  2HFZ A;  3MEJ A;  3QFI A;  3HZI B;  3LFP A;  3B7H A;  4EZI A;  3ZHI A;  1ZZC A;  1WET A;  2LCV A;  2MXD A;  1JFS A;  2PXF A;  3QOW A;  2BJC A;  1O4X A;  3R1F A;  1U2Z A;  3UFD A;  4NDW A;  4PU4 C;  4I6T A;  3FYA A;  1LCD A;  2O49 A;  3GN5 B; 
#chains in the Genus database with same CATH homology
 3QOX A;  3GZD C;  5DRT A;  3SX0 A;  2J7W A;  2LLW A;  4HRA A;  5JUW A;  3GZC A;  3GZD A;  2MXD A;  3A9X A;  3ME5 A;  3TEP A;  3SR4 A;  2HCS A;  3A9Z A;  5DT2 A;  3OWQ A;  2J7U A;  4ER7 A;  3G0T A;  4Q2J A;  4DE8 A;  4ER3 A;  2XXQ A;  1NW3 A;  3M9L A;  2LLV A;  3NZL A;  3QOW A;  5DTQ A;  2ODR D;  2M4H A;  4ER0 A;  2VEO A;  1U2Z A;  5DTM A;  4ER5 A;  3R09 A;  4DE9 A;  3VWS A;  3TEL A;  4EK9 A;  3NRO A;  3TFL A;  4EQZ A;  4EZI A;  3A9Y A;  4EKG A;  3NXH A;  5DTR A;  2L1P A;  3PE5 A;  3ZPX A;  3OKZ A;  5DSX A;  2HCN A;  4ER6 A;  2YBD A;  2XXP A;  4EKI A;  3UWP A;  2HFZ A;  3MEJ A;  3QFI A;  4WVL A;  2LNM A;  4OBM A;  5DRY A;  3GUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...