4OBSA

Crystal structure of human alpha-l-iduronidase in the p212121 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
594
Chain Sequence
b'APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLAAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Crystal structure of human alpha-L-iduronidase in the P212121 form
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 194
structure length 594
sequence length 613
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2014-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4obsA03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4obsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4obsA02
1FGVL 4QCIB 3MKKA 3QI9C 3PNWA 3EGSB 5DI8B 2OZ4A 1HEZB 2BDNL 3HA0A 3TO4C 3SDCD 4TVPH 3HKFA 4B9ZA 3NDYA 1KR1A 5IHUL 3BYTA 5ITBL 5GJTH 5BS0A 1HOCA 4PJCF 3PWUB 1II4E 4XUYA 4QRTB 3OX8A 4B0MM 2DQGH 4XP6L 2DD8H 3MRCA 3MJ8A 1MFCL 1U3ZA 3QWOA 1A3LL 4O2EA 1AO7D 1MCKA 4AIXA 2ITCB 4UILH 5FA4A 1GPOL 4BH7B 2MQ0A 4DOHB 1VBRA 2AXFB 2R0KH 2JCCB 2QSCH 3QR3A 2XVKA 1D9KA 4NQUA 5SX4H 3HNVL 2WWKO 3RIAF 1FBIL 2J7LA 3INUH 4WUUA 3W82A 1FN4B 2G3JA 5T1MA 2BRQA 4ODVL 3D0VA 2BVTA 2EYSB 4J3XA 4F8TA 5EOCH 2PKDA 1GOWA 4WSJA 2R0WL 3MLPA 1I3GH 3BAWA 3MA7A 2V7NA 4HV8B 4PJBB 4RX4A 1QACA 2FHBA 4Z78A 3OF6D 3VA2C 2CK2A 2R4RH 2GJPA 4P7QA 3FTGA 3A47A 1EGJH 4P99A 3HC0A 3DETC 1RZJL 4DVRL 1GGBH 1EGJA 1HKFA 1OM0A 3FW6A 5DA0B 2P48B 4I48A 4WEUD 5J6GA 4D9LH 3HE7C 3SE8H 4EIGB 1UM4H 3C5SA 4LSQL 1DANT 4Z0BL 4R9HA 3JWDH 1A6TB 2BVYA 2RFXB 3FT4B 2FGWL 1MAJA 4NCC2 4NO0D 3ZKQD 4GW4A 1CBGA 1W2PA 4BM7A 4U5IA 2CXGA 4UAOB 3WNOA 4H20H 3BKCL 5JHLL 1YDPA 2LTQB 1RU9L 1DZBA 5TGBB 3DIFA 4R97B 3V6FA 4KQ4H 3VGAC 1JZ5A 3MA9L 1FC2D 1TMCB 1H9VA 4ORGA 1JPFA 4ZTPH 5EUKA 4X7EC 3L5WB 4XTRC 3ZT6A 1FH5L 3FT2B 4PJ8D 4O4YH 4NJAH 2WZHA 1HL8A 3I6KB 3UO1L 4M5YL 1HHKA 1R3IH 3OXRB 4WTZA 1UENA 1MWAL 5I73C 1MCPL 2HLAB 3PDOB 3VRIA 4QRQB 2PYFB 3V8CA 3GUTB 5KSUB 1IZKA 3O3EB 4FXLA 1SM3L 4NQCD 5A2BA 2KL6A 3PGCB 4RFOH 4F7MA 4N8VA 3D18B 1KN4H 4JO2H 1R85A 4MNGE 3VFNA 5I17B 1F11A 4LLYA 1IBGH 4LCCA 1FZJA 1MY7A 5B4MC 2C8NA 4GW1A 4KDTA 1AGEA 4M48H 5JIPA 3ECBA 4HZ8A 4PCTA 3HJEA 1MHPH 3GSNA 4ZS7H 3SDDC 5CZXD 3WFBH 4P5MB 4TOYL 3PQYD 1XSIA 1LO2H 1Q38A 1T7WA 3DECA 4Q9BA 3UBXA 4WJ5A 4X6BA 4ATLA 4HGMA 3QUXD 4W88A 3VXSD 1MJ7H 2WHJA 1OPGL 4WF7A 1C5DA 4KUCF 1EHAA 2E9WA 2CIKA 4WUKL 5FOBA 4BS0A 1ED3B 1BQUA 2TAAA 3WLWD 5D7IF 5IB2A 5TE7H 1A4KA 2R0ZL 2Q8AH 3TN0C 4GAYB 4F7PA 4G6ML 3VM7A 5F6HJ 3BAKA 1IKFL 1D7FA 4WTZG 2J8GA 1FNLA 2RBLA 4NZDA 5F44A 5EUOF 1UWQA 5F1IB 1OP5H 4M6OL 3OQ3B 1QVBA 3D69A 4N1HB 1CG9A 1OGAE 1S5IH 3CU1A 3OJVC 4WCYH 5CEZH 3CGTA 1EHXA 4GAGH 4P2QA 2OYKA 1RJYA 3W53A 2H2PC 5FAAA 1K8IA 4N8VG 5DRZA 5ALBH 4UBDC 1NLBL 5BO1L 1JGVH 4W5ZA 2FHFA 2CO7B 4A2MA 1R24A 5D7LE 1AGDB 2BCKB 5H35A 5LYRA 5CIPH 3FQNB 4KJWD 5CIPA 1DLFH 4XVTH 2QHAA 4RMSA 4N9GB 2O26U 1E28B 1VGEL 3LEYH 3GIZH 1N5YL 1HSBA 2F8VA 4XBEL 1GOQA 3W9EA 3L2LA 1QFWI 5AZEL 3L1OH 5HY9A 3UBXG 4JANA 3ESUF 1GVIA 3CU7A 3PWNB 3SE3C 5E2VH 3MUGA 1F02I 3TBTA 5MENB 1YN7A 4EI5C 4CKVX 4Y5XC 2O5XH 2D0FA 2EDJA 4FXGB 1UCBL 4GFTB 5KW9H 1CT8B 3MX0A 5K9JH 3ZLQC 5I15L 4XPBL 1FVEB 1I8LC 5FO9B 3KHOA 4OCYL 5C07D 3X13B 1L0PA 1VFMA 1UH2A 3ET9F 4QRSA 4KK5C 4FLOA 1G7QA 2P42B 3U0TA 3QEHB 4ELKA 4N0RA 3GSUB 3U0WH 4HPOL 5I1KL 4L8BB 2YRLA 2G41A 1NFIB 1JGUH 2ARJQ 3MRNB 5DEZA 1JWUA 1U8JB 3QI9B 4MZ3A 3FHAA 4Y4KB 2P4AB 1RP9A 4M7LL 1YZZA 3TO4B 2V17H 4G8GD 3AMLA 4PJGE 4YHZL 1M7IA 1TZGH 4JFTA 2P8LB 4MD5A 4PGBA 4PRID 5IVZB 4KKLD 1EV2E 2FWOA 4MNJA 5TQ0H 3CPLA 5ICXA 5KSBA 1E0OB 3LMJH 1YEGL 3RPMA 4NQXB 1D5ZB 1EEYB 2H32A 2V7HA 5C0BB 1MQPA 4NBYB 3U83A 2NZ9D 1BQHB 2XOTA 3LS4H 1LE5B 4QCIA 2NXZB 2Z1SA 3SY0B 4HKBA 3SE4A 3AZRA 1ACYH 4XNYL 1HEZA 4OLXH 3KPPB 3QGVA 2EDBA 4XZUB 3RZCD 2WMPA 4PG9B 2IAMD 4JKWA 4NQVA 4LEXL 4CRPA 3ZYIA 2WSPA 1E4MM 4GRLC 5IFJB 3TBYA 3M17B 5EB9A 3HZKA 1YEDB 2DQDL 1TVNA 3RHWF 3GNMH 3O6FB 2CD0A 3WD3A 5HI3C 2ATPB 3BZEB 2R1YB 3I6LD 1QLRB 1LO0H 4HLZH 2AXFA 2JCCA 3A67L 1RZKH 4QXTA 4Z7VB 1GC1L 3EYVB 1FV1B 3KPRD 2D7TL 1OP3H 5EBMB 1OAKL 1FN4A 1PZ3A 3HE7B 1T0NB 2J5LC 2H8PB 4LGSB 2EYSA 5CJBA 1RK1A 5FGCB 3HI5L 1XH3A 4EI6B 3RUGA 1WFTA 3QUKB 5DLMH 1IT0A 2XFRA 1I1RA 1GRWA 1P53A 1DFBL 5T1LD 1OLZA 5C09D 1RJZB 3U57A 4QNPE 1K2DB 5E2UL 3QFJB 3VG9B 3WNLA 4FTVB 3I6GA 3VGAB 3DRQB 4JG1H 2B0SH 3IVKB 4OZGF 1GGCH 1SR0A 4F9LC 4QLJA 1RJCA 3ZE0E 3W26A 1CU4H 3BPOC 1MJUL 1DEDA 3O0RL 3O45A 2RFXA 3FT4A 1D2KA 4YXKH 1OT1A 4L8CB 1F4YL 1I3RB 3G6DH 4CD4A 1IQWL 4KRPD 3DMMD 5I73B 5JMOC 4JFDB 1BM3L 3EMQA 4K3DH 1DQJB 4XAKE 1JXKA 3DUHA 3RWDA 4P4RA 1M7DB 4RAUA 4U2ZA 3SCMD 3TTSA 5HGGS 2YL8A 3D3VB 3KL5A 3BIKB 4HLZG 4MJIB 2HFGH 4Y4HC 1CN4A 4PJFB 1FAIH 3W5MA 3OAZK 1U8NB 1EH9A 2MNUA 4WHTB 5DJYA 3OXRA 3VG0L 4IRJD 1BBDH 3QQ9D 3AZTA 4MQTB 3BXWA 2HLAA 5DJAB 1UYQA 1XF4B 5KSUA 3WJJC 3VIHA 1OAUL 4FFWC 3O3EA 4Q2ZB 4CMMB 5L0QC 4QLKA 4XHJD 4ZUVB 3D18A 2J8OA 1I1CA 2XJ7A 2D2OA 4JZJC 1BZ7B 5E9DD 5EOTB 3UZVB 43CAA 2YDQA 2YD6A 1X7QB 1DBBH 5IFAH 5JIKA 3WLBA 2ILLA 2HT4C 2VDML 5DMGD 2CO6B 1BX2A 4P5MA 4POUB 3X14B 3BZ4B 2VDLL 2HJLB 4KQ3L 2AGJL 3DSFL 1DR9A 4UOQA 3GKWL 3QZWB 4KC3B 3ZZ1A 3E2HC 1GONA 1MIMH 1G0CA 1YEJH 4AG4L 1T04B 3U2SB 4D6DA 4R4FL 1KXQE 2Y36H 4YHYC 5BRPA 5LWYL 4CJ0A 4K3EL 5EO1B 1OTUD 3QEQB 3UZEA 3LPOA 3ZHLA 1ED3A 3D3AA 1CF8H 4RMUA 4OZHB 5D5MB 2BOBA 2X7LB 3RVTC 2ZUTA 1O6IA 1YYML 4ZFOB 1CICD 5A2IH 4UTBH 5F1IA 4Z8FL 4LKXB 1E4IA 1KGCD 3VIKA 5E2WH 4OGAC 1ZEAH 2FYYA 5F7YC 1E4XH 2CLVB 5E6ZA 2QQNH 4LSTH 5CGYC 2GKIA 4JHWL 3BJ91 1YQ2A 4ZXLA 5GS2D 2BCKA 4Y5XB 3QRFM 3WSQL 3EUUA 5ANMA 2NLJB 3MBED 4PD4K 4PCSA 2YUZA 4N9GA 4UFJA 3HZYB 1V6WA 4RBPH 4J27A 3RZWA 4GKNB 1GZPB 5T1DH 4DKEH 5GS3A 5KTEH 2D3VA 3IJHB 1T1WA 2VQUA 1SYVA 2BVPB 3DBXA 4LCUB 3PWNA 3KLSA 4JIEA 2NY7H 1FYHB 2X05A 5MENA 4WEBH 2I5YL 2CDEB 5ACMA 2GUYA 3EYFA 1IC1A 4FXGA 3G5YA 5D9OA 5DWUH 2DQJL 2DQUH 2NYYD 3PWVA 2XPGB 3HB3D 5D1ZA 5MP6H 2I9LB 3BC9A 2J8FA 3HMXL 4Y2DB 1FZMA 4P9MH 1FVEA 5FO9A 2XRAH 1CLXA 3TVMD 3L3GB 2WC4A 1H3VA 8FABB 1TQBB 2FX9L 4LVHB 1US3A 4YXLL 5JLZB 3GSUA 2B1HL 3B6SA 1CL7L 1NFIA 2UVEA 3MRNA 4NWTL 4W8LA 4GXVL 5CEXB 3LKPB 5FYJH 1SVCP 1B9ZA 3EBAA 1NAML 4JPIA 4NI3A 1U8JA 4UDUA 4D3CH 1LE9B 3SCUA 4Y4KA 4JHAH 4FQ2L 3BFOA 3EZJB 5A6LA 2JALA 3ZDYE 1TJHH 1NCTA 4YDKL 1WBXB 2P8LA 3W0WB 4PBWD 4FQXD 1NGWB 1RZIB 2R1WB 2ERJC 5I75C 1OF2B 1QLEL 3VD7A 4NQXA 4LKCB 3VD9A 3DRTA 1I9EA 3UERA 1EEYA 2AXGA 3RM9A 3ARUA 4LHUB 2BVOA 5C0BA 4YZFE 2OTUB 1KPVA 1NANI 1PY9A 1BQHA 4ONHB 4Q6IC 1LE5A 3SY0A 3U4BL 4UFHA 4YHKL 2JB5L 4KROC 4AMKL 3KPPA 1LO4H 5JNYA 2PC8A 2CNCA 1YUHB 3DOSA 4JQVA 4WVRA 4PG9A 4PMYA 5FGBC 4GKZA 1KPUA 2EJ1A 2IANB 5IFJA 4XX6A 3R4DA 3P9MA 2ICCA 3RDTD 1YPZA 3M17A 1JPST 3QIUB 1CTOA 4N9OB 1TNMA 1YEDA 4QWWD 2P45B 3O6FA 2OJZH 2R1YA 4P3WA 2VLKB 1QLRA 5A2CA 5CUSL 2ZIDA 5D1XB 5EPMA 5E6IA 1P4BH 2HT3C 3EYVA 3F6IA 3LIZH 4TTDC 3NFNB 3GKZA 5KVMC 1D6VH 5IW1A 4DUVA 1FV1A 3ARXA 4X6FB 1CLYH 4X80L 5EBMA 1LDPL 1TVBB 1T0NA 4AD3A 3SOBL 3ZT7A 2H8PA 1OGAD 2Y8KA 3THCA 4RQQB 4X0KB 4P5TB 4CBPA 3O6ML 1W0WB 4BK4A 5CMAB 2ZXDA 3FOMA 1MQKH 3VWKA 1PDKA 2DI9A 1ISVA 1RJZA 3BWUC 1F4HA 3BI9X 5E5MB 5D7LD 3QPXH 1E4WH 5HHPB 1I1FB 3DRQA 1OIFA 5DGQA 3HR5B 3IVKA 2X89A 4U1GC 1QI3A 4QDMA 2M26A 1BQHG 4MNMA 1UHVA 1E6JL 5FUOH 1MCBA 4Y4HB 5EIQA 5IVXB 5H94B 3EZ8A 3WQVA 5JPMB 2R56H 1XIWD 3MLZH 5A3IC 1DQJA 2XVGA 5J1SC 2CEQA 5IBLC 2EQDA 3N85H 4WU5B 4UFKA 1MCOL 1QP1A 1KNOB 3WO4B 4HT1L 3VW3L 3D3VA 5SWQA 3IB4A 3ELAT 2EDNA 3AS1A 2N7AA 1QBML 4PMRA 5A95A 4FXKB 4ZOBA 2Q86A 2DYPB 1MUJB 5A2FA 5IIEB 2YA2A 1X6NA 4BQ4A 4RA3A 1ZVSA 4UT9L 4WHTA 4EN3A 5E09A 3JVGA 3BZFA 4EKXA 1HQ4B 5LA1A 4HP5A 4DCQB 1NBVH 4KDWA 5FYKU 3SDYL 4GXPA 2H26B 3UMTA 3BRGC 4PJCB 1NCCL 1BD2D 1K4DA 4CMMA 1FP9A 4ZUVA 3E2HB 3TJEH 3N04A 4LLMA 1EPFA 2QKIA 4HBQA 4ZUTA 3B9EA 5JDJA 2G3IA 2R2EB 5EOTA 1V0MA 5JOPD 3GGWB 3TT1H 3STLB 3EJYC 1X7QA 4JQXC 5HJ3B 3CXHK 3EYSH 1AD9B 4FQIL 4HKZA 4P59H 4M7KL 4R3SB 3CUJA 2V2TB 4LNRB 3QUYB 5F9JB 2ZWLT 3X14A 3UTOA 3BZ4A 2NY1C 1KOAA 4MQSB 1NGQL 1UC6A 4JR9H 1HX0A 5TD4A 1F58H 2P49B 3QZWA 3UC0H 1I9IH 2DSZA 3MYZA 1DANU 1PJ9A 5DJ6A 1MCCA 3U2SA 3QJFB 3LKRB 3WCYA 1WCGA 2J1KA 4DWSC 3GMLA 3NIYA 3MSGA 4B7LA 5EO1A 3PL6B 4OCXH 1C92A 1A1MB 2G60H 5C0RH 5I1CL 1KJ2L 4OZHA 4O51B 5D5MA 3TWCL 2X7LA 5DQDH 3BRFA 2PB1A 1DBAH 4DN3L 2J8UE 1EAJA 5DMIH 4ZFOA 4PUDA 3RY6C 2OL3L 3O6LH 1P2CB 1HINH 1LO3H 1B3YA 3VIIA 1KYOK 2PW1B 4LLDB 2HMID 4B9YA 2IF7A 3IAQA 2DSVA 4HJ0C 4KHTH 5AZ2H 3R1GH 3S4SB 1ZU8A 3UJIH 5LGJB 3NJ3A 3PZQA 3WMBA 2AEIT 3WKML 3MV8B 4CN4A 3E6HB 5IB5B 3WJLA 4U1SB 2XTKA 4O9HL 3W81A 4JO1H 4EXKA 1H0IA 3L4TA 5DRNB 4GKNA 3QZWG 1LEGB 2BVPA 4PJ7E 4LCUA 3TCLB 3EFDH 1Y0LA 5KBNC 3OKDA 5SV3A 5C0CE 4PJXE 4OLUH 5ACZB 3VMPA 1GOKA 1R3LB 2GSJA 4HPYL 1BG4A 1VADB 1BP3B 2YZ1A 3IDGB 2I9LA 4XAKD 1SYTA 4XPHL 2YL6A 4HWBL 4NFDA 3VM5A 2VH5L 4Y2DA 1NEZB 1A1NB 3GIVB 2D3NA 5HBBA 2PYEA 1KGXA 3KWXA 8FABA 3MOAL 4YFLI 3GH4A 3QT2A 3VXRA 4NHUA 5JLZA 5GHWH 3O9WC 5GIRB 1A0QH 1XGYH 2HRPL 1TJIL 3C6LD 3LKPA 1MFEL 4HJJH 2OXGA 3H7LA 3OBAA 1U8OB 1LE9A 2Q3AA 4JFXB 3VTRA 2C26A 5E5UB 3A4XA 1GHFH 4XMLH 4WO4C 4KROB 4UTAH 1FDLL 3D25B 5BS0E 3CFEB 1E4KA 2D0HA 4AIZB 1FPTL 3ARFC 5TE4H 1C91A 1WBXA 3W0WA 1Q72H 5D7IB 3C09B 1NGWA 3QO0A 2EZ0C 4N8CH 1WK0A 5EU3B 3G04A 4B5EA 3QCTH 4JLRA 2R29H 3WKNA 1OF2A 2Y7QA 3SUSA 4LRNL 5EUOB 2FEEI 4LKCA 2I9TA 1SVZA 2B4CC 1QVOA 1FQ9C 3SGKA 2B20A 3BISA 2FD6L 3WD2A 4WUUE 1KC5L 2EH8H 3QP3A 2JJUA 4XCCH 2WQRA 2C1PB 4JPVL 3SBWC 1YUHA 1CGUA 2XKNA 1TPXC 3IJYB 4M8VA 2D20A 1RUML 2Z8WC 4Y16C 3QIWC 5HBFA 2IANA 3STZA 2CITA 3U7YH 5A8MA 2DBLL 4JDTH 4PP2B 4S1DC 3WF2A 3QIUA 4MQ7B 5J11B 2GITB 1CCZA 4PGEB 3WS3B 3G6JF 1QA9B 3O9NA 2WBJB 2VLKA 2QHRL 5D1XA 4OQTA 1JD7A 2ZX5A 4RAHA 2YPKB 1J12A 5IB1B 3NFNA 4ZQKA 4X6FA 3MRIB 2GJXB 4W85A 1TVBA 15C8L 2F54A 3GHBH 3H2WA 4X6DA 4X0KA 4KVCH 4KRLB 4P5TA 4NF7A 4RFEB 1MJJA 1WTGT 5BJTB 1P7QD 1W0WA 5CMAA 3PZTA 2GW5A 3HRPA 1RK0A 2GJZB 1SEBA 4BKLA 1QFPA 3CVIH 1RZGB 3MJGX 1IL1B 4UV4H 3ARDA 5E5MA 4WW1A 4X4XB 1I1FA 4PJHF 2BNJA 3HR5A 1HYSC 3BIAX 2IBBA 1HH9B 3LPPA 4LHUG 3MRGB 5D2LF 2JF7A 1CLZL 3ARGB 1TJGH 3RP1A 5ITFB 5TDNA 1IAII 2R69L 3MBXH 5DRXA 3FQTB 4KUZH 3HS0B 4WY7H 4OIFA 4DZ8B 2DEPA 3EHBD 1YEEH 4MNQA 4OD1L 1GGYA 1BFVH 5JPMA 2P8MB 1XGTA 1OSPL 3D9AH 3H3BC 5I5RA 2E27L 4UOW0 3TBSB 4NQDE 2XTJC 5GS0C 4K71B 5DK0A 1TDQA 3F7YB 4O02L 4MSWB 5FDYA 2GK0B 1BVZA 1EX0A 2BFVL 1ITCA 3NDZA 1BGGA 3MCKB 1I7TB 3QQ3A 1ZLWH 1MUJA 1JNLL 1WE5A 5IIEA 4CW1A 2IG2H 5IXEA 1LP9F 4RGOH 3VRLE 1IGCL 2ZCKH 1X5JA 1PG7L 2WB5A 1JPTH 2X4UA 4DCQA 2R4SL 1FSKC 2IPKB 1KEGL 2ZICA 3V2AR 5ABFA 2VZUA 2XWDA 3QFDB 1N0XH 3QXWA 2V2XB 2FBOJ 3VI4E 3HC3H 3AHTA 1XYFA 5FM4A 1NC2B 1NSNH 5CSBA 3WXWL 3POHA 2R2EA 3NPZB 4AH2A 3A6BL 3RKDC 2AAAA 1U8PA 3STLA 4PMDA 3WIIL 4QRPB 5HJ3A 1AD9A 4N42A 1QI0A 3CUPA 5HHVL 1FVCA 3TA3B 3DHMA 3BGMB 3BOVA 4IRSC 3QUYA 1BWWA 2HP4A 3QNYB 1TZHB 2XFFA 5DYOB 1WITA 1C12A 4PYGA 4OUOA 4JFVA 4NUGL 4P2QE 1ORQB 3Q2CA 3QJFA 3MZGB 3BMVA 2EDLA 3RKPA 2NY4B 4EBQH 1EUTA 3CUIA 5GGRB 4L8SB 5K33A 4ERSH 2NW3B 3GH5A 4NQEB 4OZGB 4L3EB 2Z91B 3Q6GL 4GBXC 4O51A 1JBJA 4M02A 1A4JB 3BPCB 1D5XB 3A4AA 2KZ1B 1CDUA 2PXYD 4YE4L 4NM4H 4H26B 2VC2H 1E55A 1GOMA 3VDBA 1OY3B 4KZDH 4HA3A 5BVJA 3AS2A 3W28A 3ALPA 1P2CA 3NIDE 2QPUA 1FNSH 1BZQK 4WWKA 2CRMA 4HIEA 2PW1A 4G6AD 3CVHL 2G75B 3ALXA 5LGJA 5ESVB 4UZGA 5FGRA 4JN1L 3MV8A 4A3YA 1N64L 1Z0NA 3C8KB 2OZ4L 3FQXA 3FZUC 2XY2A 1J8HB 3PP4H 1JN6B 5IB3A 4YUEL 3AHZA 5A2AA 4OLYL 4KFZC 3QRGH 1T0MB 4TVPL 4D1IA 3BPLB 4UQ9A 5DRNA 5GJTL 3BAIA 1NCDH 3O6KH 4BFIB 4R4BB 5EWIH 5TDOB 4W8BA 1CEOA 3UTTA 3WFLA 2DQGL 2A9MH 4XPTH 5D7JD 2J4GA 4IOFD 4XB7A 4MCZB 2Z8RA 1Q6EA 1M71B 3PHQB 5ACZA 5E03A 3P77A 2N7BA 4IM4A 2AQ2A 2W59A 1GYAA 1UWEH 3U4EA 3IDGA 5IK3B 4WO4B 2RGLA 4KPHL 5JXAH 1LL4A 4HULB 1CQKA 1FZOB 4TULH 1A1NA 3FO1B 1WAWA 4UT7H 2VZSA 5DMJB 3GIVA 5EOCL 1IEAA 3X11B 5E0QA 3V7AE 1DUZB 1MHHB 2A9NH 3KDMA 1MF2H 4GUPA 1TCMA 2R4RL 2ZUNA 3V0VB 4LBEB 2KKQA 1EGJL 1ZS8B 5HHQB 3O6AA 1U8OA 3S4SG 1HKIA 4JFXA 3CBWA 1I3VA 2F53A 3DVFA 4OCLC 3A3HA 1MCIA 3CFEA 3SE8L 1F3DJ 3K4ZA 1UQSB 4Y16B 2VLRA 4AIZA 1WZAA 1I4FB 2GQHA 5D7IA 2YWYA 1VJSA 2XN9B 1FO0B 1O7VA 3EDFA 2YMXH 1AC6A 1N0LA 1KQYA 1UD3A 3CXDH 4W93A 1TZ7A 5DFAA 5EZLB 4ZUUA 4K55A 2A3HA 4KQ4L 2Y9RT 3L6FB 3X3FH 1MAML 4AEIH 4POZD 3P4MA 5DVNA 1HNFA 1CD1B 1GSMA 4WLCA 1PZUB 1E3ZA 3IJYA 3RUGE 4O4YL 1ZBKA 1YEHH 2QQKH 1R3KA 3PP3K 1J0HA 2IJ0C 4Q7DA 2J7GA 3B5HA 1BSIA 1R3IL 1T22B 4WNQB 1HN1A 3MACL 1C16B 1MVFA 3VI3F 2GITA 3WS3A 1CD9B 2ICEA 5FOJA 5IF0A 1AR1D 4M82A 4BH8B 1QA9A 2IGFH 2WBJA 4P46D 4K7PL 4KAQH 3OKOB 2YL9A 3F5JA 1KELH 1BOGB 1H0DB 3B9VA 4RFOL 3SN6N 3Q1SH 3MRIA 5EB8A 5E4EB 3BP4B 5A6SA 3AXXA 1IBGL 4R96B 5F8QC 1H5BB 1U95A 5TJWK 1BGXH 1UVQB 4RFEA 4U5KA 4MXVF 3GSNL 1MHPL 2AEPH 1QEWB 2GJZA 2UY3A 4V1DB 1H49A 3VGDA 5FM8A 2XFYA 1IL1A 4DN4H 3WE6B 4GSDL 1I3UA 1P7HL 2R9HD 2AI0H 4HMDA 4X4XA 1KENL 3RAJH 25C8L 3WD5L 3VGFA 5H8DA 2QJDA 1HH9A 3K2UL 1N5AB 4YDVA 3MRGA 2LFGA 3ARGA 5A6MA 3SDCC 4PTMA 1HF6A 1JNHA 4WDIA 5TE6H 1O5DT 1OM3H 2ZG1A 3FQTA 3L9RB 2A77L 1KBGH 3HS0A 3EFFB 4NN6C 2ZCLL 4DZ8A 3H9SB 2P8MA 4WI3A 5GRUH 1OAYH 4AIOA 1HKLL 1H5VA 5C0CD 3TBSA 2HVMA 3QHOA 2HFEA 3A6OA 3N0PB 3BCFA 5BCAA 1G7LB 2AV7B 2MCPL 3QH3B 1HQRB 1JIBA 2UUDK 5CEZL 2EO7A 4JKPH 1VFAB 3QHFL 4KVNL 4MSWA 1OTTC 2GK0A 4U6VL 4G8FB 1WZ1H 5KVGH 4NZCA 3OZ9H 5I6XC 2O92A 3I3DA 1I7TA 3SUUA 5ALBL 2HLFD 1GZJA 5I2IB 3T2NH 5J6HB 3IDIA 1VERA 4IRSB 1BQCA 5HGAA 2IPKA 2VRAA 2YBTA 1E9LA 3C60B 3K81A 3LVEA 1CYGA 1QTYT 3LEYL 4P2OB 4XWOD 2DMBA 1QNOA 3L1OL 1DWJM 5BS0D 4TVPD 5FKAB 5A2LH 4TUKL 4W5UA 3DROB 2DM4A 4ONFH 4F79A 1SJEB 5KOMC 3R8BB 3OR6A 3PWLA 4JGUA 2WVSA 1HCFX 3QHMA 4PYSA 1K85A 3F4VA 3TA3A 5F7MC 4XI5C 3BGMA 2OSLB 4AL8L 3H9YA 3VNZA 3UG5A 3QNYA 3RWGA 1D9KD 1TZHA 3QQ4B 4YFLF 1E70M 3I75A 5KW9L 2R15A 3PGDB 4NKDB 1BVLA 2HTKD 3SGDH 1HJXA 5K9JL 4WUUD 4FP8L 3UJTH 4HOXA 5GGSY 1KBKA 3PV7A 5D2NA 5DJ8B 1X5HA 3VRJB 4PJ8C 5FDWB 3V5HB 2JEQA 2XWJB 4L8SA 4RX4D 1G5AA 1XYZA 4NQEA 3CNKA 2VDRH 3FQWA 5ANME 4AZBA 1G9NC 1S3KL 1Z9LA 3HE6B 1QFHA 3N50A 3ULVF 4DEPB 1D5XA 1Z9SA 4D0CB 4H26A 2W60B 3NCJL 2V17L 5IQ7L 1H3PH 4P8UA 5E00A 3T0DA 2YN5A 4D8PB 4S1SH 3QXTA 3K46A 1LJYA 1A7BA 4MAZA 2G75A 3CUHA 4QCFA 3LMJL 3HC4H 4XH2B 2WMKA 2O9RA 1BEYL 1UWXK 4V2CB 3GMRA 4TXEA 5LBSH 5ESVA 1T83C 1IGIH 3ZDZF 3PTKA 3C8KA 4KGLA 2Z35A 5CZXC 5BZWB 3EJZD 1J8HA 1ZSDA 2NCMA 3G08B 4OLXL 5CJOH 5TFSH 1T0MA 1C7TA 3WNMA 3LRHA 3WFCL 1DVFB 4F7TB 4PMUA 1AGFA 3QUXC 4R4BA 5TDOA 2VAJA 2GAZB 5GGTH 2XGBA 2DQXA 2D1ZA 1MQ8A 5I3DA 1E72M 5A2JH 1EQPA 5HPMA 4YDIH 4UQAA 3PHQA 1AIFA 4Z7QF 4PRWA 1MCWW 3WLWC 1EEQA 4L4VA 4MD4B 4HIHB 4YDLC 4MGXA 2J2ZA 4NQDD 4W6WB 3RBGA 1FZOA 3C08H 5FM5M 4HZLA 2AJZA 4XHQA 5DLML 4L8DB 1DUZA 1MHHA 1B30A 1UD5A 2GDUA 4JFWA 3V0VA 1P4LA 4LBEA 1CDGA 2APWA 2B7DT 3G5ZA 2ZUSA 2QQLH 1ZS8A 2OMBA 5DHVA 1O0VA 4WK9A 1Z9OA 4KJWC 4JAMB 3BQUA 5INCB 4M4PA 3TZVA 4LF3B 1CXKA 5SWSB 3O4LB 4HQQL 1GNXA 2Y2WA 1UQSA 2NTFB 5DD5H 4XXCC 1I4FA 4N0YH 3K3QA 1FO0H 1MCJA 1YPZE 3T0EB 4YXKL 2EDQA 3RA7L 2X6MA 1BOYA 3G6DL 1JZ8A 4OV5B 3BKYH 4ONOA 4P23C 4K3DL 1ZWIB 3MRMA 5EZLA 4YHNB 1DBJH 3L6FA 3OKLB 4J7RA 2O61B 4RIRA 5DD0H 1UXWB 2F8QA 3FO9B 1GGTA 4YBHA 4GKLA 3CDCA 5DT1H 2HFGL 4P2QD 2UY5A 2AV1A 4QTIH 1FAIL 1CFQB 4ATWA 1KCLA 1T20B 4OI9A 4OLVH 1T22A 4XXDB 3MGTB 2W9EH 3L3OA 3FO0L 3CZLA 3EYPA 4XBGA 2CGRH 5FCZA 1AXTH 2CR3A 2WWMD 4PV9B 3PN8A 2H1PH 3L3KB 1QW8A 3OKOA 3AHVA 1UR2A 3UROR 1BOGA 5I1GH 5DUBB 2GCYB 3BP4A 4MXQD 2UY2A 5B21A 2VRQA 3FCTB 1QLFB 1UVQA 4KKLC 1ZKAA 1RUAH 5IFAL 5CD3B 3K8MA 2MPAL 3U30C 1AO7B 4V1DA 5GS0H 3SCTA 3WE6A 4MAYA 3GBNH 4TNWK 2CCRA 4ZFMA 5DSCB 1TENA 4XPFL 4M93C 4HC1H 1MIML 3FOLA 1YEJL 4YQXL 5I6XB 3RZCC 3TGXA 3DV6A 5CP3H 3UP1A 3EYUL 1V3KA 3BSHA 4JJHA 4U1KB 3LZFL 1CF8L 1ZT1B 4OGZA 3ECQA 2C0HA 4GKOA 3V7MA 2JJTA 2OWWA 1ZLUK 1ITBB 1FC1A 5ID0A 2YUXA 1R7OA 5IMOB 5T33L 1G7LA 2AV7A 5BXTA 3QH3A 3QDMA 1VFAA 5IW6B 4G8FA 1HK6A 5E2WL 3P0YH 4NQSB 1ZEAL 2Z8VC 3N18A 2WUCH 4NC1E 3RU8L 1E4XL 1C8PA 1L7IH 5C6WH 4OLZH 4OCRH 1CFSB 3KE0A 2AJSH 1R3JB 1UJ3B 2VKXA 3F7QA 7CGTA 2A74A 1P7KA 4LSVH 2VNCA 1B4JH 5C2BH 5A94A 4BZ1H 3C60A 3N1MC 1JRHL 4FFVC 3F58H 2BV9A 3WD4A 1QI5A 2MKWA 1KFAH 4P2RB 4P2OA 3UTQB 3RILA 1F6LL 4OD2B 3OPZL 5DURD 1EJOH 3G6JB 5FKAA 3GMQB 5DO8A 3DROA 4PJ8B 3AIWA 1MNUH 1SJEA 1UWGH 5GGSA 3RNQA 2NY7L 1H2JA 1BPLB 3ZJKA 3QEGL 3JV6B 4RAVB 1NBYB 4OLWH 4QHMA 2OSLA 4KRPC 1BQSA 3ZE0F 3QWQB 1SY6A 3I50L 1A9BB 5BRZE 2DQUL 3QQ4A 4RMWA 3AC0A 4HFWB 3P4LA 3PGDA 2DQIH 1XCXA 4NQCB 3VMOA 1S9KC 3SCMC 4XRCB 1KULA 4IDLA 3DXAA 3NCBB 3UG3A 3DX8B 3MJ7B 5DJ8A 1G6RB 3G6AB 1B0GB 3VRJA 2ESVB 3IKKA 2IPTL 4LGXA 3V5HA 2VZVA 3AM8A 3PE9A 2QPSA 4WGVB 2UZYB 4PJHB 1ERNA 3ARED 3WF3A 2YOCA 1W91A 1S8DA 4HS8H 2V9TA 3QQ9C 4D0CA 1UD2A 5I8CB 2W60A 3PQYB 4FHBD 3VGHA 4JHAL 4I1NB 4N1CA 1L9MA 2LVCA 4XHJC 4WU7B 4Y5YA 4AD5A 3QUXB 5AWNH 3VXSB 4GAFB 4OTXH 3VXPA 3OXSB 1QPKA 1RMFH 1PIFA 3WMCA 4JHBA 4KMTL 3WBEA 1IEBA 2XA8H 3JWNC 4YDLB 2FECL 3TIEB 4DKAA 3G08A 4K8RH 1LO4L 1LP9B 1NAKH 4FG6D 1A9EB 3QJHB 1NJ9B 2PYEE 4TUOB 1DVFA 3EO0B 1MXGA 1NWRA 3GBLA 3FRUB 1OGGA 3VXRE 2B2XH 5KN5B 2G5RA 3UYOD 1KXHA 1BJ8A 1KEMH 4OF7A 4GXUM 5E70A 1OSEA 1TA3B 1ROWA 1T21B 1KJ3L 1P4BL 2VUYA 1RHFA 3ILQC 3LIZL 4HIHA 4XMKL 5B3JF 4W7VA 1JMXA 1CICC 1G6VK 1EDTA 4QLLA 4G3YL 3W0WE 5L8JB 1ZHKB 3RY4A 1EO8L 4L8DA 5C7XL 3DO7B 1C8YA 1MQKL 4QGYA 2I07B 2Z31C 3B3IB 1ECEA 4XNXL 3KYOA 3BH8B 3CH8A 4P57B 3OLGA 1ZANH 2Z9TA 2P1YA 4MB3A 4UQDA 3RVVC 3QPXL 2WBWB 1E4WL 2GJ6B 5DMKA 1NMCB 3H3PL 2ZUUA 3MBEC 2V9QA 4N0UB 1P1ZB 4JAMA 5DA4A 3T0XA 4ZDHB 4LF3A 3ZKXB 3O4LA 2IANE 2C4XA 5FUOL 3AIEA 2R0LL 3VXTA 1QFUL 2BC4B 4HUNB 4LSUL 5C07B 3TTQA 2ZX8A 1SJVA 3T0EA 2ICWB 3ZSSA 4JE4B 3BVNB 2P46B 3NACH 2VMFA 2X2YA 3BKJL 3EO9H 1CGXA 5IHZA 4OV5A 2GFBB 2R56L 4IMKA 5GRVL 1E27B 5J89A 1MQRA 3S37X 3M8OL 2X42A 1MPAH 3N85L 4YHNA 4S0TD 3OKLA 2O61A 3U46A 3HB3C 3WUWB 2F54E 4PJ5E 3FO9A 1TIUA 4QOKB 4X6DE 4G8GB 1GC1C 1KCSH 4JN2B 2DIJA 3ARBD 3ZJ6A 3ZE2E 4F58H 2X4OB 2I26N 3M07A 3TVMC 3O2VL 4PRIB 1CFQA 1U6AL 1RPQA 2V6HA 5HPOA 2VDQH 3MGTA 4HEPG 1YECH 2EECA 3TH4T 3S96A 3HHRB 4YFEA 3WH9A 2FIRT 1EFQA 5HSFA 4NDMB 5JW3H 4FMFA 5DUBA 3TJEL 4XGZB 3CDGB 4V2XA 4WFEE 4M6AA 3HMWH 2WHMA 1F3JB 1EDGA 2IAMB 2LU4A 1WC7B 5DQ9B 3W2DL 4MNQE 3C8HA 3I02B 4U4BA 4FQXC 2DT2A 1FLTX 3B9KA 1W8NA 4P59L 1TTFA 1AO7A 1JAEA 3UXFA 9CGTA 1YNTA 2DQFB 3DUUB 5D1ZD 3CMOL 5DSCA 3UC0L 1I9IL 1WLHA 4NKIL 3KPRB 1NBZB 2VERN 2DKUA 1EO7A 4X5WB 5AAMA 5GGVH 2K3TA 2YA1A 2AJYH 1FYTA 4YZFF 3RPIA 1ETZA 3T0WA 4C59B 1A7PL 4HKXA 3P73B 3BP7B 4OCXL 3RDTC 2E7HA 4P49A 2HISA 3ZKMD 3IU4H 3L3HA 1EHNA 3R06A 3OF6A 1HYRC 5T1LB 4ZFOL 5DQDL 4JZNB 1DBAL 2AAVA 4HUWA 1C08A 4CVWA 5I8OL 5HYQA 4PRAB 3SDXB 1LO3L 4RGNE 5K9OB 5IW6A 3CX5J 4XVUD 5F70A 1JNNH 1QPPA 3IJ9A 3BN3B 4APQB 4MA8L 4D94A 5AZ2L 3Q5TA 1CFSA 3BSZL 4WI6A 3UJIL 1UJ3A 1RIHH 4YEEA 3BD4A 3DO3A 3DMMB 5E2TH 3T1FB 1U8MB 2AJXH 4WGWB 5C0BD 4JDZB 2Q20A 1DEEB 2X5PA 1MI5B 1VIWA 2YD9A 3NZ8B 3B2UD 4BSWB 4PN2A 3SCMB 4P2RA 3UTQA 5IJVB 4QF1A 4OD2A 4Y19B 4KKCC 5C0ND 3GBMH 2XV6B 1Q6DA 3OR7B 3GMQA 3BLPX 1INDL 2HTLD 2XWEA 4WHYH 5EH1A 5HHNA 1MW1A 3BD3A 4HFUH 4ZENA 3JTTB 2I25N 4UQ3A 1G9NH 3WDHA 1URLA 4RAVA 4EAMA 4XNUL 3O4OC 5CBAA 4IRJB 2XACC 1XIWC 4JFQB 1JF1A 1WZKA 1A9BA 5E6ID 5EA0L 3MLXH 5EZJB 4HWEH 1WISA 2X1PA 4UNTA 3ARSA 3MCLH 4NQCA 3SDDA 1F4XH 5HVGB 4OCMC 3VD3A 1CR9L 4YHMH 1G6RH 3MJ7A 5E9DB 3DI2B 3G6AA 1B0GA 3EAKA 4JPWH 4BSVB 2ESVA 5HYEA 2NY3D 5TPWL 2JB6A 1NWSA 3QHZH 3QIBA 4PJHA 4X9YA 4X9IA 1RULL 3VWKD 3MV8E 2E4TA 1A0QL 3S37H 1XGYL 3GMPB 4EDWH 5D2LA 4RWYH 4XCNB 1U58A 5L2KA 2X0YA 4V28A 4KI5F 3C5JB 3RWIB 2J7DA 4UTAL 1ESWA 2X89D 3GSQA 3BDYL 5EBLA 1P9MC 1BJMA 4XWGH 1WAAA 3V6ZB 4WU7A 1BFNA 1UD6A 2AXJA 3BP6B 2DTSA 5TE4L 3UTTE 1XSJA 1Q72L 3TBVB 43C9B 3VXSA 3WH7A 2PWGA 4N8CL 2WLZA 5GJSL 1KIPB 2R29L 5I9QC 2FIKB 3WL9B 2L7UA 4S1RH 1X3DA 4KJPD 2DT1A 3R0MA 2Q8XA 4G9DB 2X4QB 4WHYG 1I8MA 3NVQA 3ZMRA 2EH8L 1QBLH 3TIEA 5T3XE 3MV7A 5HDRA 2JJSC 4JB9H 4U1NA 4DUWA 1IZJA 1LP9A 4TUOA 3ISWA 1KGWA 2AJUL 5I1LB 1H4PA 4JDTL 4PRNB 5E0FA 4M7ZC 4EN3D 5JZ7C 5FYJU 5JW4M 4D6GA 4LIQE 4OQTL 3ZDXE 2OM5A 4LPUA 1TA3A 1T21A 4HZAA 5BW7C 3UTZB 2PF0A 3MLSH 4PLKD 2EPNA 2F53E 1PSKH 3T2OA 1PG7W 1BLNA 3LN9A 2VLRE 1U91B 1JD9A 3QQNA 5D7IE 5M94B 4QYOB 5BQ7A 5ITBH 4A2LA 3DO7A 2HMIC 3GSOA 2J8UF 5IFPA 1CLCA 1U2HA 4XP6H 5FUCE 5GZOD 3B3IA 1MFCH 2OI9C 3BH8A 4P57A 5FK9A 4QY8B 5KVFH 1GPOH 1JPGB 2GJ6A 1JWMB 4TNWF 1P1ZA 2PBOA 2VDOH 2A6DB 4IOIB 4LVOB 1FBIH 1I7UB 4U1MA 3MBXL 2F8OA 2BC4A 3M1BB 4ODVH 2QV2A 3VD5A 1CGWA 4WY7L 5F89A 3PABB 4U6YB 3BVNA 2Q8BL 1LG1A 1BFVL 1G1CA 2R0WH 3D9AL 1N82A 3N9GH 1FNAA 4OJFL 3SQOL 1S7WB 3E8UL 3CFJB 2X4TB 2BSED 4K23H 5BRZD 3AB0B 5L88L 1VKXB 1RZJH 5EU7C 4DVRH 2J62A 1CK0H 4QOKA 4RISL 4U0QB 3V5KB 4PJXF 1FNEB 2HT2D 3S5LB 2X4OA 4LMQE 1JGDB 2P24B 4PRBB 3L3DB 2WXDM 4Z5RA 4LSQH 4MNGB 3V8OA 4RGOL 2MQCA 1M53A 3V4VL 4Q9QH 2Q6WA 3MRRA 1JPTL 1T5WB 3ORJA 3P9LB 4YR6A 4Q9RL 2IBGA 3BKCH 2ZPKH 3C6LC 5JHLH 5E9AA 4AD1A 1N0XL 2NY5C 4H5SB 1RU9H 4ENED 4NDMA 3U9PL 1BAGA 1UR8A 2E8YA 3CDGA 4XGZA 1UD4A 5HVFB 2D3LA 1RP8A 3H9HB 3FY1A 1F3JA 1U8HA 5DQ9A 4CU6A 1WC7A 2D22A 3QNZB 4C57C 3BAYA 1FH5H 3I02A 3JUGA 5FCSH 3N11A 4PEEA 2MOVA 3RDTB 5DVLA 2EDRA 3UO1H 1F8TL 1HSAB 1VFFA 3KG5A 3VINA 3B5TA 4AZ8A 4Q22A 1CVSC 1MCPH 3IU3B 5IHSA 5JBFA 3A6CH 1VRXA 1S5HB 3EMCA 2DQFA 1XGQB 4QRUB 4Z7OE 1CDHA 4M00A 2BVEA 4LASH 2OYLA 1SM3H 3KPRA 1NBZA 4Y2DD 1OWQA 3ME0A 1QSFB 4PTUB 4X5WA 2W91A 1YN6A 4NUJB 2PYED 3LPGA 1OGAB 2Q7YB 2ZXAA 3MQIA 2VITB 3WUWG 2VJXA 3E0GA 4TVUA 2VXQL 3VXRD 3KHQA 3BP7A 3N1QC 4OZIA 2A6KB 4FNLH 2J7BA 1AXSB 1OTSD 1IC5L 2ADFL 4JZNA 5C0EB 2DKMA 5MI0C 3QEUB 3ZE1E 5D7LB 1VFOA 3EOTL 3G6MA 4KZDL 1A7QL 3NSMA 1DWIM 3MNZB 4LDOB 1D5MB 3VXNB 4GQRA 2GSIB 4PSPA 1DQQB 2KQNA 3W0WD 4PSRA 4ODTL 4LSDA 1L7TH 1TG7A 3CPUA 4APQA 5JOEA 1OSZA 4D6EA 1XH0A 1KJVB 3KPNB 3LKSB 5KJRH 1BVNP 1HKJA 4WUKH 4N5ED 3DMMA 3T1FA 3IDNA 2BSSB 4QGTA 1A21A 1DEEA 5JW5A 1MI5A 3PP4L 1IKFH 3HLAB 4OOUA 3QRGL 2WYSA 3BXNA 1OB1A 1I1AB 4M6OH 5IJVA 4Y19A 5D2NE 4QT5B 3OR7A 2CDGB 5JA8B 1VCAA 2IAND 2DSUA 2VZ3A 3S98A 1F4AA 4JM2C 3QIUD 4NQEE 2O9PA 4FFYL 4IMLB 3RNKB 5BO1H 1LMKA 4G9FE 3MS8A 3RJXA 3QNXB 1GZQB 2IC2A 4OOZA 1KLGB 4UIKL 1UWEL 3MLTB 5D96B 3TBWB 3O41B 1KTDB 5EZJA 5T3XL 5DO2C 5EN2B 5A6BA 4F37F 5JXAL 4TULL 5IWLA 1VGEH 1HNGA 1OP9A 2F54D 4XBEH 1MJ8H 1VAHA 5AZEH 4BSVA 2C9AA 2IFFH 5ELIA 2A9NL 1RURH 3WQ5A 2XFXB 4GMSL 4PD4J 1IT9L 4H41A 2YPLA 3GMPA 4U0RB 4PLOB 3SO3B 3SDAC 3CFCL 3ARDD 1J8HE 1ITXA 4KK8D 2P43B 1MCEA 1OWWA 3C5JA 4NO5B 3RWIA 3GJEB 5EU6E 5LXGH 3KZSA 1UCBH 1JGLH 3WS6A 4MB1A 3GMOB 4PY8I 3T65A 5I15H 1DBKH 4OCYH 3HRZB 4NNXA 3KPQA 4HUUB 4CGTA 3T8XB 2C4FU 4MNQD 2FIKA 5CJXC 4NO2B 3WL9A 2IPUG 4D72A 3EOAA 3RBSA 5I1KH 4L4VE 4IJ3B 1OARL 1UFUA 3ZO0A 3E3QC 1A6WH 3BRDA 2K7QA 1UM5L 4FQCH 3FN0L 4M7LH 3NMEA 5GRJH 2PW2B 2J88L 4YHZH 5ICYB 3LOWA 2EIEA 3BPNC 3QCUL 4MNKA 2P7TA 4D6IA 5CKGA 2OI9B 5GS2H 4WFFE 2EIZB 1YEGH 5F7FA 5F7DB 4UZSA 1CDJA 4EE9A 3UTZA 4NN7C 2DQTL 2E9BA 3LDBC 3V6OC 1KELL 5CHNA 4XT1C 2VCAA 2NXYD 1NGYA 1RIUL 3Q1SL 5DJ2A 2WC3A 3BDBA 1CL7I 1NOUA 4YHPA 2Y23A 4QYOA 4X6EB 4RGND 4E8DA 3VWJC 1XH1A 4LEXH 1BGXL 4WRLA 1JTOA 1V08A 1MELA 2BSTB 4I5BB 3Q5OA 2WUBL 5IROC 5LKNA 4JAWA 1TZIA 3IRPX 1BQLL 1CPUA 3SKJL 4ZUSB 2QF8A 1W3JA 2ED8A 3NIDF 1HCVA 3QUYD 4UDTA 1ISXA 1IQDB 1JPGA 1VPOL 3RAJL 5I18L 2G4FA 1BFSA 1JWMA 2G8ZA 3K1KC 5JBDA 1GC1H 1VJZA 2GUOB 5K9KA 1N4XL 1U3HB 4IOIA 5GRYA 4AY0A 2D7TH 1I7UA 5I1HH 5TE6L 2IQAB 4W81A 4Y8AA 5J0BA 4JFFE 4U6YA 3HI5H 2J3SA 2VWEE 1GVYA 4PY7A 5D7JC 2H9GA 3MRPB 3TEUA 4IOFC 1QI2A 5GRUL 5FV1L 1DFBH 3DX9A 3C2AH 4PJEE 5D6CB 5J9PA 4R7DA 1S7WA 2XG4A 3C6LB 2VRJA 4I2XA 3CFJA 2X4TA 4TVSa 3BJLA 2VLLA 5EIVA 4C54A 3S97C 1JDDA 3FB7B 1WZ1L 3NIGE 1MCHA 3V5KA 1IGTA 1NFDE 4WWKD 3T0VA 2BOCB 4MJ4A 1JGDA 4MNGA 1MJUH 4LEOA 3O0RH 4HGKC 2IUZA 3K2MC 4V1DE 3ULSB 2W1NA 1CWYA 4FQJH 1F4YH 1FVDB 4FZEL 4X99B 2OLHA 1T5WA 2OR9L 3BGFB 1IQWH 2Z4QB 1N3NA 3LEVL 3MV8D 3PG2A 2A3BA 2O9TA 2VDPL 4H5SA 3HPJB 1FE8H 4GMTH 2OTPA 2ZUVA 5HD8D 2NY2D 3OGSA 4I0PD 3QNZA 1JV5B 3UTTD 3T0AA 1S9WB 1A6UL 4U33A 5B8CB 3WDRA 1MREL 4JQIL 4ZD3H 3VG0H 3GJFK 2DL9A 1MSPA 5KS9A 3P4OB 3QDME 4BUGA 1MCRA 3W11C 1IRAY 1OAUH 3PZUA 4C7GA 2FHCA 4POZC 5T3XD 1TR1A 3GZAA 3MROA 1J0KA 4MJ6A 1FIEA 1M1SA 1QSFA 2J77A 1BLIA 1BFOA 1DQTA 3H9ZA 1AGCB 2RCSL 4DWHA 2ARJB 2NY6D 4O58H 3ROLB 4C7DA 3RWEA 5LG1A 2APBA 2EPKX 2V2WB 4GXUN 5IJKA 3IDMB 2HKFH 2VDMH 2JK5B 5C0EA 3RUGF 1KB9K 4HS3B 4P46C 3QEUA 3WUBA 5IBTL 2VDLH 4NC2B 3U48A 1B2WH 2G9HB 2GFTA 4Q7NA 2F53D 1AP2B 1D5MA 4KY1L 2AGJH 3DSFH 5T1KB 3LH2L 3GKWH 3MUJA 2GSIA 2VLRD 2AK4E 5A43C 4N0FB 4G43B 3ZM8A 1RZFL 4C55A 4GO8A 1FJ1A 4N90E 3KL3A 1KJVA 1W72B 1N2RA 3MR9B 1S7SB 5DJXB 1DP0A 4K3EH 5LBSL 1HJWA 3WENA 1IGIL 1DLHA 1QR4A 3O3DA 4OFIA 3MFFB 1GGIL 4NT6B 4I0KA 3CFBB 2R1XA 3V4PH 5JR1L 4RE3A 3TYFA 2E7LA 1UWTA 4AIUA 2QV4A 2VE6B 1K8DB 1YYMH 1I1AA 3DXAE 1FHGA 2R2BB 4Z8FH 1WFNA 4MDIB 1N26A 2DJSA 4QT5A 1CDCA 3WXVH 2CDGA 5GGTL 4UFMA 2XPKA 3GB7A 4TPRH 3AGVA 4JL1A 3KXFB 2FZ3A 2IADA 5AYBA 4IMLA 2Q87A 3RNKA 3TONA 4YDIL 1MHCB 2H41A 4CVUA 1MFUA 1NCWL 4AZ6A 1FP5A 5INDA 4JHWH 2GK1A 1KLGA 3TBWA 4JQXA 2DH3A 3O41A 1KTDA 3WSQH 1KYOJ 5EN2A 4MHHG 1I7RA 4P5KB 1ZLSL 3SGJA 5IEKB 3QUMA 4R0LC 3EDJA 3MNVB 4M81A 3VIMA 2BS9A 1CXFA 3U36A 1KG0B 3W9DA 1SBBA 1AR2A 4G42B 4OZ4B 3KYNA 3VFPA 2EPOA 4PGJA 2QQLL 1OGSA 3U4AA 2I5YH 1UR0A 2DM7A 1RFDL 5D1QA 1KIRA 3EDEA 4J3TA 4NO5A 3GJEA 2DQJH 3AFLA 4IM8A 2EYTB 1IGYB 3S88H 1XZ0A 3LMYA 2HWZL 2OQJA 5E7FA 2R2HB 5HGHA 3RY6A 5F3BB 1JFHA 2FEDD 3TO2B 3UX9B 4HUUA 5AD0A 3DUSB 4BQ6A 1ZA6A 3ZR5A 4NO2A 2YD7A 1U8QA 1AI1L 2B1HH 4JCLA 4HG4K 2EO1A 3DYMA 5CAYB 4NWTH 1XT5A 4GXVH 1U30A 1P6FA 5GZND 4PJIA 2PXYB 1D9KC 1NAMH 5K9QG 1VACB 4F66A 4FQ2H 5E94A 5ICYA 3EYOB 3LD8B 4TOQA 1TQCC 1GHSA 1G7JB 4YDKH 1I85C 1E71M 4QKXB 2FSEA 2CGRL 1UH3A 2JEPA 1AXTL 1QLEH 5DC0A 3E6FB 5JXEC 4W4OA 2EIZA 5F7DA 3VXMA 2H1PL 2R23B 4CMHC 2ZSVB 3P9WB 1I8IB 5I1GL 1XGUA 3BW9B 3MRQB 4OB5L 3U4BH 5AAWA 5D4QA 4YHKH 2J4WH 3T0EE 4X6EA 1WWBX 4XC1L 4FA8A 4GIAA 1UR4A 2H3NA 2BSTA 4I5BA 5D7JB 4L9LB 1RUAL 2PCPB 1X5LA 2DTMH 1XGPB 1LEKA 4ZUSA 5C0GB 4F7CB 5A6KA 3K8KA 1FFNB 4GO6B 5CUSH 2MWCA 3O9WA 3BWAA 5DFWH 1U3HA 1HIZA 5FA3B 3UDWC 1HHHB 3OAYH 4KRNA 2IQAA 2P5WE 3Q3GA 4JO3L 1R7AA 3SOBH 3X12A 4PV8A 4JVPA 3D39A 2X4SA 3C5ZC 3O6MH 5L8LB 2DWDB 2F58L 4TUJB 5K93A 4NQED 4CKQA 5F96L 2AERT 2XQYK 5D6CA 5FKPA 3MXWL 4G9FD 1LWRA 4B3LA 1MRDL 3S6CA 4ODUA 5F7NC 1RAMA 2WIIB 1FHLA 4I18B 3B8YA 4DKDC 4JVWA 4F9PA 2BOCA 3P0VL 5DJDB 4P3CH 1BJ1H 5HVHC 2BY3A 4KDTC 4X8JB 2AJSL 1CIDA 2K7PA 1EVTC 3IT8D 2ZOKB 4Q9CA 1FAKT 2V38A 3GK8L 2GY7B 3DURB 1JZ6A 2Z4QA 5HYSA 1ORSB 1RHHB 4DKFL 3NN8B 2CLZA 2GTZB 3LN4A 1V7MH 4I3SH 1J8HD 4TNVF 4KJYA 3VUPA 1DWFM 4N68A 4URTB 3RI5F 4MPKA 3FL7A 4YBLB 5EU6D 1MCOH 4IDJL 2WINB 1EA9C 4HT1H 2EDDA 3F5KA 1FYTE 1MIEL 2B1AH 1T1YB 4JFPB 5JOFB 2XXCB 5D9PA 1UWGL 3VNYA 1S9WA 2XZAH 2ZOLA 3S3PA 3MUZ1 5B8CA 2MCG1 1IAIM 1SY6L 4UT9H 4UFIA 3ULUE 2YUWA 1YY9C 2C1OB 3RWHB 3PBGA 4P46B 4GG8B 3P4OA 4L4VD 1QFOA 1YPZF 3SDYH 3SEPA 4GW5B 3CFDB 3ZR6A 1S9YA 3S34H 1G7HA 5HDLA 1NCCH 2J8UB 2FX8H 5EOQL 1R87A 2VXSL 4DFHA 3G5VB 3L5HA 2PN5A 1P5UA 2ZX7A 2UYLB 3WDQA 3JUZA 1MLBB 3W6MA 1IAMA 1AGCA 4W7WA 3LB6D 2ARJA 3ROLA 1JP5A 1W2VA 3UESA 2FJHB 5I6SA 4H8WL 5JW4N 4HS8L 4FQIH 3HG1E 2JK5A 2NZIA 3OG6B 4WFFD 5C0JB 1EEUA 1ZXQA 2WCAA 2ZUYA 4P2RE 2G9HA 1NGQH 3BQUD 2XHYA 3TZVD 3SUTA 5LVEA 3UPRB 5T1KA 3P11L 3MV9A 3S9DB 1T3FB 1LQ0A 1QRNA 4NKOB 2JTDA 2PR4L 4J3SA 4DVBB 2X70B 1KCUH 4OTXL 4AZGA 1W72H 4G43A 2E7BA 1CFVH 4NN5C 4QTHB 1W72A 4YHLH 2E0PA 4PJ7B 3MR9A 4HWZB 3WHXA 1CFNB 3VFRB 4DGVH 4AD2A 2FO4A 4E5XB 2VT0A 4QCEA 3MFFA 2NNAA 5IMKB 4NT6A 1SYSB 5C0CB 5I1CH 3DARA 4W8AA 4PJXB 3QAZC 3U0PA 1KIUA 3BN9C 1YNLH 2BVDA 1K8DA 4K8RL 3UJJH 4PTTB 1W2KT 4J3VA 2R2BA 4MDIA 2NPLX 2ESVE 1WEJH 3VMNA 3FB8B 2B2XL 3PDGA 5F1KC 4OKVA 1NCBL 3KXFA 4PJHE 3R8QA 1KEML 4JFFD 2BXYA 2C7UB 4Y7MA 1MHCA 3CVHB 1N6QL 1CGVA 5D2LE 1ZLVH 5L2KE 1R0AL 1OD0A 5CILL 2VRKA 3WKMH 1FCCA 4M6ML 4R4ND 1WAAE 1PBYA 4CU7A 5IEKA 1JNJA 3E1F1 1VB9A 5BS0B 2XZCL 3V4UL 3QXAB 5BV7L 3GNRA 4HIJA 1KG0A 3OX8B 1MCNA 4G42A 2ADJA 4AC1X 3MRCB 1FGNH 4ESKA 1CXHA 4OZ4A 3SCWA 2Y1VA 3QWOB 4O2EB 2XNAA 4V1DD 5FHBL 1ZANL 4CD6A 4ODSL 4EZMA 3CCHA 3VILA 4MAYD 3MV7E 1PG7X 3I85A 4HPYH 3PV6A 1D9KB 5EU5A 3SGEI 2RHEA 3W24A 2QSTA 4KTYA 5E99L 2YZ8A 3SE4C 4WUUB 4HWBH 1V6YA 5E0CA 3D0VB 2R2HA 5F3BA 4WI9A 3TO2A 2VVSA 3NACL 3DUSA 3EO9L 1CE1L 1FORL 3MOAH 1A2YA 1WTLA 5KSAD 5C86A 1IEHA 5E8OB 1E6RA 2BY1A 3MA7B 4Z78B 5SWZA 5CPTA 2DLEA 3VVGA 4CN1A 1S9XA 1KJMA 1TJIH 2HRPH 2OP4L 5IT2H 1MFEH 4Y4FB 1KCKA 4CD8A 2PXYA 5E8DH 3OGCA 3QDMD 1G84A 1VACA 1T1XB 1ZE3C 5J6GB 4PG2A 4F58L 1NGPL 3EYOA 2XVPA 4XB3A 2VL4A 4OGYH 5SX4I 3C5SB 2APFA 2VDQL 2VIRA 2B5IB 4QHKI 5HHOE 3EIFA 3QOMA 2W66A 3PTQA 3HPLB 4LRNH 3E6FA 2GJ6E 2F5BL 2DDQL 2DQHL 2DIBA 1YDPB 4LLUB 4YIQB 2NTSP 2ZSVA 4BYHA 4OSUL 3DIFB 3V6FB 1I8IA 5JW3L 3UTSE 4JO4L 3GHEL 1KC5H 5C0DB 1P84K 3BW9A 3MRQA 3HMWL 2P44B 3PWJA 2B8OT 1E6ZA 1J05B 3ARYA 5HI5D 1RUMH 1ZK9A 4C56B 4RZCB 4N90D 1HHKB 4HUKB 3MRBB 4UAOC 3OJ2C 4J8RB 4KKBD 3HFML 3VFUA 4F7CA 4GZJA 3O2WL 2LTQC 1Q6CA 2QHRH 4YHGA 2V5YA 4R97C 4QOKE 1UZ6F 4JKKA 4NQDB 3CIQA 3IS0X 4F7MB 3A0OA 3UAJD 5BXFB 1HHHA 4FG6C 5L2JA 3DXAD 2VN4A 3VFNB 15C8H 1F11B 4X5XB 4LCCB 4ONGL 3GMMA 2B39A 4Q0XL 4OV6F 5ADPL 2J12B 1AGEB 2PTTA 3ECBB 2DWDA 4HLJA 1HWGB 5DUMH 3ULUL 3O2DH 2X10A 3GSNB 3O2DA 2HYMA 1JZ7A 1EHLH 4KDVA 1DE4B 3TNNB 4OI8A 4H1LB 1KB5A 5FF6A 4FABH 3WIHH 4WJ5B 2WIIA 4MS8D 3CSYB 3PHOA 3WIHA 1CLZH 5M7QA 4GG6E 3IFOB 2R69H 2X9WA 2VR4A 5JUEH 4ZEPA 2ITDA 4MLIA 3ZQ9A 4X8JA 4MYWB 4OD1H 5E2TL 4BF7A 1OSPH 3DURA 3IETA 5IB2B 2YBUA 2E27H 3CZEA 1RHHA 5ABGA 2ZUMA 2VXUL 1N6VA 3V52L 4Z7WE 1PPIA 2WINA 4O02H 1DVFD 3UBXI 3MLWL 2BFVH 1T1YA 3IDJB 4JFPA 1LLOA 4D6HA 4P2QB 1RJYB 1KXVA 4HFUL 4OZIE 2UWFA 4JFZH 1JNLH 3TA9A 3MZTA 1IGCH 4MMXC 1UADC 3OKNB 4Q6YA 2JKXA 3RWHA 1PG7H 5H35B 4NHCH 4CCEA 1KEGH 4HWEL 4GW5A 3F7PC 1OP5K 4LCYB 4YHML 1VESA 3QDJE 3G5VA 1HSBB 3EDDA 2ZUWA 4BQ2A 2UYLA 3WXWH 1MLBA 3DHPA 4HCRA 4G5ZH 1OINA 1K5NA 2EXWC 3A6BH 3MUGB 5M17A 4KMQA 2FJHA 4EDWL 1MI5E 2X40A 1AQMA 5HHVH 5J06A 2IWGA 3QDGE 2WANA 3ZE2F 5C0JA 3QAZB 1JUFA 4ZO6A 5J1AA 4K7PX 3WELA 4PJDF 2LU3A 4XWGL 5DVOA 1HP5A 1T3FA 4NKOA 5ABFB 2EDTA 5KANG 4DVBA 2X1WL 3L5IA 4QRSB 3T0ED 3L3IB 1G7QB 5I77A 2HKHL 1U0QA 4OF6A 5ID1B 3HNSL 3CMJA 4E5XA 3KPOB 3Q6GH 4S1QH 5C0CA 1QBLL 4YPJA 4MXVE 1JWUB 1T4KB 4JB9L 5D1ZC 1U2CA 4U1HB 4PTTA 1AGBA 1Q9OA 5HHME 1LG2A 1PZ2A 1P4IH 2EIBA 3TT3L 4ISVA 1JWSB 2X41A 4PGBB 2P5WD 3CVHH 2FWOB 3I3BA 3KPSB 1DJSA 1OAXL 2YPLE 2C7UA 4HD9A 5ICXB 2OXHA 2XQBL 5KSVA 4R2GB 2V3GA 4XPAL 3ZKMC 4X7SL 5SV4A 5CGTA 2DSKA 1K9FA 2H32B 1CGTA 3MLSL 1N64H 1EOKA 2OZ4H 3LHPH 3AZSA 4OBSA 4HKBB 4Y4KC 1GQJA 4YUEH 2QSQA 3ZTNL 2LE9A 4OLYH 4M1CD 4ZG1A 5DURB 2ATKB 4NQVB 4XVUC 3QXAA 1J0YA 4MVBD 3TBYB 4ZAKB 3B9KD 3WH5A 3U9UA 5C6PB 5DK2B 3HZKB 1P5VA 2MANA 1J1PH 4G6KH 1XR8B 5KVFL 3RIFF 3HUJF 4L3CA 3VXQA 1XF5B 4QXTB 2PI6A 2VDOL 1VFUA 2NXZC 3B2UC 3GSRA 5I74C 1AE6H 4KPHH 1J9YA 1Z3GH 3MXVH 3DETD 4JQVC 5C0NC 3CO4A 1FYTD 1RK1B 1XH3B 2CRZA 2HTLC 2ZSWB 3MYJB 1JFQH 1PLGH 1HILB 3RUGB 5F7EL 1I1WA 3CAFA 3N9GL 3UPAA 5E8OA 4C83B 3AREB 4NSBA 3EJJX 3CHFA 2PETA 3O6FC 1E6OH 3ULUD 3MC0A 2MTPA 4Y4FA 3MRDA 4K23L 3I6GB 3F12B 3L3JA 5E6IC 2X0HA 1S9VA 1OP3K 3PGFL 1X5ZA 1T83A 1CK0L 4U1JA 5DXWA 4I3RL 1T1XA 5ENWB 1DTUA 5F9OL 3JBG7 2W5FA 2Y5TB 4W6YB 2E9LA 5MEOA 5F72S 3ALGA 1FH7A 4Z7UF 5DZNA 3FO2B 3O45B 4Q9QL 1HE7A 3VE0B 1C5CL 5DEGA 1RUQL 3HPLA 1FFPA 4CJ1A 4ZE5A 3VWKC 1HJVA 1AD0B 2ZPKL 1FL5A 4YIQA 4LLUA 1R5WA 1G94A 3VG9C 4Z7NE 3RWDB 3P0GB 4P4RB 4MA7H 5C0DA 4RAUB 4IPLA 1MAMH 1UCTA 5L8KB 4HZ6A 2QHLA 4P2RD 3WEMA 2X4NB 4P7LA 4HU0A 3LCYA 1J05A 4PRPA 5E8PB 3TH3T 3ULVE 1T6WA 4XV0A 1CE6B 4C56A 3WN6A 4RZCA 4HMEA 3BP5A 1DN2A 3TIDA 2A2QT 5DJYB 4H2CA 3MACH 3MRBA 4I2XE 4J8RA 1W1PA 7FABL 3H6JA 2XA3A 3A6CL 2PO6A 2BNQA 1F00I 4K7PH 4F33B 1W9VA 2EO9A 4LASL 5D93B 2Y07L 4IIQB 4NQDA 3SDDD 3CMGA 3MJ9H 5BXFA 3ARPA 4UUJA 3ZDZE 1F45A 3BHBA 3MJ9A 4X5XA 2FH8A 2ESVD 3L5XL 4Y0GA 5FECB 43CAB 3H42L 3QIBD 4FNLL 3MJ6A 4EN3C 3VFWA 3WLBB 3GSNH 3JVGC 1A47A 6CGTA 3CDYA 4H1LH 5L2KD 1BX2B 4TVDA 3OTTA 1DE4A 2L4OA 2VOTA 3GSXB 4GSDH 5D7SH 3TNNA 4H1LA 4PLKC 5GS1A 5E24E 1KENH 4P23A 2IH3B 25C8H 3WD5H 4PLJC 3TN0D 3CSYA 3K2UH 4Z7QE 3ZDXF 1G0DA 1L7TL 3IFOA 5HDOA 1CS6A 5BVPH 4Z2IA 3P3YA 1U3YA 2A77H 4LSPL 5KJRL 2X4PB 2ZCLH 4XVJH 4NC1C 1T7ZA 1C5BL 2H2PD 4U7MA 5CLWA 5GZOC 5KS9E 2LAAA 4WW2F 1HKLH 2BOBB 1FA2A 2W92A 2OWCA 4Z2LA 3MV7D 2FJGB 1QHZA 4I9WE 1DQDL 1QSFE 3I9GH 3U82B 3O2LA 2MCPH 4Y5VA 4J6RL 3QHFH 4KVNH 4U6VH 3ARBB 3IDJA 4CVXA 1WB0A 2FYYB 2FJFB 1LO5B 4HPGA 3OKNA 1JXJA 3TYGL 2DPEA 4FMKA 4ZTOL 2DSWA 5ANMB 2ZNWA 2J7FA 1W9BM 4EI5D 4LCYA 4TQEL 4OCSH 4TRPL 3GO1L 1MJ8L 3THDA 2EC8A 4H1LG 2F15A 3TESA 2IFFL 4TSAL 5EC1A 1UKOA 2ESCA 4TUKH 1T1WB 1SYVB 1RURL 3DBXB 4EQ3A 2J25A 5I8EA 4PR5B 2EE6A 4H0HB 3U7AA 3OSKA 5EFFA 2GJ6D 4AL8H 1GXEA 3EYFB 1E4XI 1U42A 35C8H 3G5YB 3PXJA 5LXGL 1TVDA 3L95A 3PWVB 1JGLL 1WIPA 5D1ZB 3F5LA 4RBPK 3UTSD 1FZMB 4FP8H 5JBEA 1DBKL 4U6XA 4MJ5A 1JGEB 3L3IA 3D0LA 1U8IB 4BSJA 4E9LA 2QQQA 5I1JL 3CFKB 3CUFA 3KAAA 5ID1A 1U41A 3B6SB 5CZVH 3KPOA 5JHDA 4K3JH 4HUXA 5A8QA 1A6WL 1S3KH 4DTGL 3IXAB 4RFNC 4JPIB 4UDUB 4B3KA 4FQCL 1T4KA 2OBGA 3GMNA 4U1HA 4X4MA 5GRJL 1FL6A 4LSSH 3H0TA 3NCJH 4QOKD 5C71A 1WSST 2JIEA 2XVNA 5IQ7H 1H8SA 4Y2DC 4JPKL 4UTFA 4NRSA 4HX1B 1UOKA 3VXOA 4L4PA 1JWSA 5H2BA 5ESAA 2MJWA 3BSGA 1TQBC 2F5AL 3KPSA 4LVHC 4Z7OF 4GLRH 1QYGL 3I2CL 1UWSA 4RCAA 2FX7L 2I27N 4GRLD 4XCFH 1BEYH 2H32H 3DRTB 2AXGB 1OTSC 3T2QA 2RB8A 2BVOB 1KPVB 1T2JA 2IXVA 2VSDA 1H3GA 1EFXB 5I74B 3TOPA 5JNYB 1D3CA 1E4KC 1E6SM 2ATKA 1OGTA 3WFCH 2OLDA 4GKZB 1KPUB 4CUCA 5C1MB 3M6DA 6A3HA 3ZE1F 3P9MB 4ZAKA 5GNXA 1YPZB 5IGXL 2VISB 1Q0XL 5DK2A 3JV0A 2MHAB 1XR8A 4AISA 1QSVA 4PJIE 3FHQA 3SGKC 3MRLB 1WKYA 3EW3B 5EPMB 1XF5A 5DGRA 5E6IB 5I1EL 5E8EA 5IW1B 5JQ6L 4CADB 1UKTA 5I1HL 2OS7A 1YHTA 1A14L 3ULVL 5HDQL 2XIIA 1QO3B 4G6FD 3QOKA 1OCQA 2FECI 2E6JA 3MYJA 2ZSWA 1HILA 2NY3B 4JJ5B 2FEEL 3QIUC 3FOMB 4C83A 3AREA 3VXME 3VWKB 3C2AL 4OBRA 1CIUA 3WN5A 3D5OF 5I66B 4YHOL 4FQLH 5D1XC 3CH9A 3LKQA 3V7AG 3F12A 1Q94A 2EDYA 1FNFA 5ENWA 1YEKH 2Y5TA 4AENB 3QDJD 4HQQH 5KZCB 2J7CA 5BMFL 3FO2A 5DD6B 4APQD 4LPYA 4P5TC 3LQZB 2W65A 1T89C 3IDYC 4UMGA 3VE0A 3RA7H 4KZEH 1SFSA 4FQJL 4LXFA 7TAAA 5LCVH 2AJ3A 3PHAA 1AD0A 1A3QA 2GJRA 2YLAA 3NZHL 2G3MA 3HI6L 3I3EA 1DL7H 5CEYA 1MI5D 1V3HA 3QDGD 1FE8L 4GMTL 4KK8C 5C9JB 1GAFL 4JZOA 3VKKA 2YDSA 1Z32X 3KYAA 2X4NA 4Y19D 5SWQB 3O11A 4YPGB 5E8PA 2QMJA 3D39E 2Q86B 2BRRH 3TH2T 1QI4A 1CE6A 3VGGA 1CZ8H 4ZUWB 3O8XB 1ZVSB 4EN3B 5GRVK 4ZD3L 2V3EA 4D6CA 3FO0H 3BZFB 3F5WA 1DBMH 1IC7L 1BF8A 4OUUB 2ZP0T 3KLHD 5M95B 4F33A 2Z31A 4RE4A 2K1MA 5A6BD 4IIQA 1K4DB 2DMCA 1BYDA 5T3ZE 3WO4C 1RD6A 1IAIL 1NDMA 5HHMD 4LLMB 2QKIB 4ZUTB 5FECA 1HL9A 3FAWA 4QRRE 4O58L 3DVIA 3OB8A 2XG5A 4YHIB 2J6EH 1US2A 2AW2A 2YPLD 4HKZB 2HKFL 2MPAH 2J6EA 2KPNA 1K6QL 3TP4A 1RJLB 3DWTA 3GSXA 3ZTJG 3N12A 1B2WL 2SEBB 2FGZA 2IH3A 3KS0J 2NXYC 3RFZC 1W32A 3RVTD 4XPFH 1JYXA 1AKJA 3ES6A 4UR9A 2EBNA 5JPNB 5C0AA 3NFPB 5DJ6B 4YQXH 1INEL 4M7JL 5B3JE 3GMLB 4H8VA 3BZDA 4OF5A 4OJYA 4H8UA 2X4PA 1E43A 3EYUH 2A1WL 3LZFH 4AEFA 1T1ZB 1QRKA 3K4AA 1ZOXA 1S46A 3OG4B 3QUYC 3V4PL 4NIKB 3DPBA 3GFUA 1I8KB 4YC2C 2FJGA 5BRZB 5A6AA 1QSEE 5T33H 5KVDH 3VFTA 3WXVL 4KTDH 3NABL 3ARBA 1W9UA 4YX2H 4GT7A 4TPRL 4X9HA 2JELL 5DHXB 4FOMA 4ELMA 3X3GH 2FJFA 3RU8H 1LO5A 1K4CB 1XR9A 3PL6C 3S6TA 3LY6A 1HHJB 1S7UB 1I9JL 4J4PA 1IGML 1WF5A 3SCPA 5DJZB 1AQKL 4BFEA 1Q9KB 5F97E 3MV9E 4OI7A 3W4RA 1JRHH 1QRNE 3QUML 2XTJE 5CXPA 4JRWA 2VKWA 2OK0L 4IS6A 2HFTA 3OPZH 4PJEF 2E9IA 1C90A 2QR0A 2IBZY 1MY5A 4LAQH 1W0VA 4YAQB 1Y0LB 3OKDB 3QEGH 2RGSA 4PR5A 3NIGF 4M03A 1NFDF 1OVZA 4P3DA 1X4ZA 3I50H 4RFNB 4KV5E 2CYGA 3GYCA 5DQJA 3S88L 4FN0A 3HZMA 4WIQA 5EFIA 5HD8C 3U6RA 1W9PA 3KXFE 4GZEA 1M6OB 1MFAH 3AXHA 1JGEA 2PYEB 1OLLA 3MO1A 1U8IA 2DDXA 2DLHA 3ULVD 1XCQB 3CHEA 3CFKA 3VXRB 2IPTH 3ZJ7A 4NHUB 4OCNC 1C93A 3MNWA 5C92A 1O7AA 3RCNA 2WKGA 3IXTA 3IXAA 2DLIA 2HJFA 3BD5A 1IM9B 4F57H 1KTKE 1YMMA 2DLFL 2VDNH 2YKKA 4P9HL 4KKAD 3OKYA 4ZSOA 4TYUA 4HX1A 4LDEB 2CESA 3QO0B 3G04B 4FZ8L 4JLRB 4WTXA 4HK3J 2Y7QB 2VZOA 3PUCA 2I9TB 1QVOB 1HDMA 4TSCL 5IP4A 4KMTH 1WZMA 3LS5H 5CWSA 5GSRB 3M7SA 3THMH 4FF5A 3GSWA 1EFXA 4E41A 4X6CA 5ILTL 4X4YB 1VHPA 2FDMA 2J4WL 1HXYB 2XKNB 2HT3D 1FFOA 4YEFA 5F6IB 4OM0H 3STZB 3C09C 1O7SA 1EK3A 3II1A 4NRRA 3WHE1 2ZOXA 2DTML 1GH7A 2VISA 4IHOA 1T7YA 2E9JA 5SWZE 3WL0A 1V3LA 1PX8A 2MHAA 4XVSH 3EO1A 3FFDA 4OAWA 3MRLA 1EJ6A 1KJ3H 3HCVA 4XMKH 1G9MH 2WNGA 4ZQKB 5IVOA 4NC0B 4CADA 5IKCB 4I9WD 1H3XA 1LILA 4M62L 1QSFD 4ALAH 3SCNA 4G3YH 2F54B 4PJ5B 1QO3A 4X6DB 1CDYA 2P8PA 2YSSB 1EO8H 1MJJB 2XICA 4JJ5A 3IDYB 1M05B 5C7XH 2JIXD 4P2YA 4AJ0A 5J11C 3W0KA 4NKQB 1RK0B 3Q6FA 1SEBB 4MMZC 4BKLB 4XNXH 5F21B 2Y72A 5I66A 2ZX6A 1Z5LA 2WBJC 3ARDB 4WW1B 4J1UA 5ECJE 3LQMA 4BA0A 4K3HA 2D23A 3H3PH 5T3ZL 4BQCA 1IVLA 3H8NA 3ZKND 5JO5B 3QHNA 4HH9A 4AENA 3N1GC 2CKBB 5TDNB 2OCFD 4P3CL 2R0LH 5DRXB 1QFUH 4LSUH 5DD6A 2E7MA 4EUPB 3LQZA 2XYLA 1GQLA 3EYQC 1DQML 4MNQB 5EBAA 2DL2A 3BKJH 2OYMA 2NT0A 1XGTB 3CZFA 5D8JH 1V7ML 4I3SL 3M8OH 4YJZL 4K7FA 1UR1A 5DK0B 1R5IB 2X1IA 5C9JA 4PTWA 3UZQA 5A40E 3WQ8A 4B15A 3B5GA 1I1AD 3DYPA 5D71H 1IE5A 4M1RA 4WV1B 2B1AL 3ARGC 3OA5A 3SCSA 4YPGA 4G80A 2WMJA 2XZAL 1LK2A 3QQ3B 4KI5E 5E6YA 5HYJA 2N56A 3O2VH 5ETUA 4CW1B 4ZUWA 1U6AH 3O8XA 2L7JA 1XCTA 3EBVA 2Z93A 1X6LA 1YC8A 2C3HA 4MADA 5DD1H 4OUUA 2X4UB 4UQ2B 3RM8A 3EJYD 2DKSA 4LPXA 1FLRL 4AW7A 3FB6A 1G7MA 3S34L 4CVZB 4K71C 5GZNC 3MMEB 2FX8L 2NXYB 1TE1A 1SBSH 1OAZL 2WLYA 1X4YA 2Q76A 3CDFA 2NY1D 4HA4A 1S7XA 1ZLWK 3AIBA 4RGNB 3MLRL 4AH2B 5CJ8A 3CHDA 4NO3A 4HXBL 3W2DH 3HUJB 1U8PB 5FEBA 5M03A 4YHIA 1MVYA 5F3HB 1B1YA 1WWWX 3CUPB 3WKZA 1FVCB 2G3NA 2BHUA 1ZHNA 4R7NB 1RJLA 5DHYB 4LPWA 2IALA 5D1QD 2SEBA 4YC2B 2GHWB 1C12B 3CMOH 5GGQH 4NKIH 2AMGA 1EZVY 5JPNA 3NFPA 1KCUL 4LRIA 1W72L 4AM0B 5IDIA 5AYIA 4ZFGH 4YNYA 1J86A 1CFVL 3RIAK 4YHLL 4LSRL 3GXIA 1A7PH 3RM4A 4DGVL 3V79C 4WENB 1YEFL 4GQ9H 3GI8H 3TA3C 1NOFA 1T1ZA 4XBPB 1YNLL 3PWPB 4Z7UB 3WDIA 3UJJL 1I8KA 5BRZA 4U6TA 2DB8A 5I8OH 1M04A 5BVJB 1GUVA 2ZJSL 4LLAA 3L4ZA 1WEJL 1F6AA 5C3TA 4WWKB 1ZJBA 4HEME 4HIEB 1NQ6A 5D2NC 2NY4C 1T5XB 1IAOB 4ZE4A 3GDBA 4MA8H 1K4CA 1HXMB 4L8SC 3BSZH 4BA8A 1HHJA 1S7UA 3VXMD 5DJZA 4AMCA 3FQXB 1Q9KA 1ZT7B 3CSGA 2AABL 5IB3B 4QXGL 2AEWA 3RL1A 3RIKA 2KUTA 5F1NA 4ZOCA 3MMDA 1A22B 4GINA 1EEZB 3AU1A 2NY2B 2LV4A 3OV6A 3TC9A 3GJFA 3OKMB 5IW3A 4I0PB 3UTTB 1INDH 1PW3A 2EDWA 1FGNL 3CLEH 4NKMA 4HUVB 2XZQL 2CIPA 1ZA3A 4YAQA 1WJ3A 4AYFA 4R8WL 1BWMA 3RPKA 4XNUH 3P77B 4O5LH 3RX8A 1L4IA 3U4EB 3O9WD 5EA0H 5J56B 4OFDA 3CSPA 2ED7A 2EDFA 1U3HD 1A3RH 4PPTA 4PRHE 4JY4B 4P2CG 3BPLC 1CR9H 1WBYB 5AYUL 5ERWB 1M6OA 4EOWL 5JW4R 1ZHLB 1IEAB 5A8PA 1XCQA 3D39D 2NY6B 5TPWH 3HN3A 4JFEB 3ARFD 2VL5A 3KDMB 1ULVA 4GUPB 4Z7VF 2DQCL 4NRYA 1RULH 4U6HA 4EKJA 2V5DA 5IT2L 4HHAA 1JHTA 2JJVA 4CD5A 5E8DL 4AZIA 1UB5A 2F53B 2B31A 3RMEA 1IM9A 1RI8A 3BDYH 1KTLA 3ULUF 5GSVA 5T3ZD 4OGYL 2VLRB 5DEFA 4PY8J 4KRTA 1JYVA 4QHLA 4WW2B 4FQQA 1WQVT 2K9UA 4RNRB 5GJSH 4Z76B 3C6SA 4QRRD 2XWBA 3OHXB 3QIWD 4ACZA 4C7FA 2HAZA 4S1DD 2VURA 4JM2A 1RUKH 1FOBA 2WHKA 4B16A 5BOPA 4ZUUB 1NC4A 4H0GA 5GSRA 4UOZA 1PGRB 4IISA 4OZFA 1TCRA 4X4YA 3P4MB 4R6UA 4M1GH 3BQUC 3TZVC 3WQ6A 1HXYA 4CAGA 3KLAA 4D0DA 1CWVA 1MW2A 2AJUH 1R3KB 3T77B 4PS4H 4ZOEA 5BZDB 3ARWA 3JV4B 1LL7A 1I7ZB 4P7RA 2CMRL 2ICEB 5IF0B 4OQTH 1U8KB 1FRGL 4O2CA 2BNRB 2QBWA 4YDJB 3PIQA 1UT9A 1F3DH 3SDAA 1D5IL 1H3UA 5IMLB 5IKCA 2AP2A 5DC4B 2O93L 1R86A 3UR8A 4PMXA 4PJ5A 2WMIA 1U95B 4PTXA 2YSSA 1S7TB 4JFYA 3SE9H 1M05A 3OZPA 1UJTA 5DUML 3CLFH 3O2DL 4OF8A 3MU7A 3WBDA 4LLQB 4PJDA 1EHLL 1KB5L 3W37A 3BEWA 5TH2B 4GRWE 4FABL 3WIHL 2BVQA 5T1KD 3MV9D 4YDVB 4PRPE 5JO5A 2O5ZL 1QRND 1LHZA 2XTJD 5C0IA 5E4EC 1ISZA 2CKBA 1JNHB 4WDIB 4JRYA 4C56E 3WSUA 5JUEL 1H5BC 1GPFA 2VTFA 4EUPA 2D4FA 3QG7H 4HTYA 2Q8BH 2VDKH 3RWCA 1WAAF 3QPQC 4U1LA 5BROA 2C3XA 3DTXB 2BNQE 2G5BB 4OJFH 3SQOH 4FLSA 4MAYC 4ZYKB 2HFEB 3RVWC 1R5IA 3E8UH 3MMUA 3F7VB 3S8WA 3WUEA 5L88H 4TTGA 1ZMYA 1E56A 3AXLA 4WV1A 4RISH 1B6UA 3KXFD 4JFZL 3S36L 3SUVA 3WUGA 1IFHL 4PB9L 3MRHB 2WM0A 3V4VH 3PTMA 1EDQA 1AY1L 3VWJA 1S7VA 1KCVH 4S3KA 3IDIB 4KRMB 4NHCL 4UQ2A 5IB4A 3RKDD 5HGAB 2A38A 3QULA 2JJTC 4Q9RH 1JG9A 2OJEB 4CVZA 3MMEA 1KT2A 3BH9B 1K9EA 1LDSA 3U9PH 4NOBA 1BAFH 4HCRL 4XNMA 1BYCA 4EVNA 4G5ZL 1YQVH 2A0LC 3ARRA 3OR6B 3HUJA 3PWLB 1BMGA 5FKYA 1RIVH 4BUHA 1Q9WA 3AMDA 1R6VA 5F3HA 1KTRL 2VR9A 1F8TH 3GNPA 4EUPG 4PB0L 1LNUB 4R7NA 3SJVE 5DHYA 3RWGB 4JG0L 3NCYS 5D7KE 1QZ1A 1IAKA 3C60C 3I75B 2CIIB 2OX5A 1BVLB 4GBXD 4HOWA 3BMWA 4P2OC 3JV5A 3WQWA 1WCQA 3ZSTA 1JYWA 4AM0A 5D2NB 3TM6A 1UB6A 5HI5C 4NP4L 2P5EA 4QO1A 2VXQH 4RWHA 4POYA 5DC9B 1ND0A 3FQWB 4M5ZL 5SWZD 3GBEA 4S1QL 1XRVA 4XBPA 4KKBC 1IC5H 2ADFH 1PX3A 4W84A 2WAHA 4G9FB 4YK4B 3RGHA 3PWPA 4Z7UA 1AH1A 3PF2A 3RRQA 2YHGA 1JPSH 2AOSA 4A6YA 3EOTH 4H7VA 2YL5A 1P4IL 1A7QH 4GQPH 4HUMB