4OBSA

Crystal structure of human alpha-l-iduronidase in the p212121 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
594
Chain Sequence
APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLAAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Crystal structure of human alpha-L-iduronidase in the P212121 form
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 194
structure length 594
sequence length 613
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2014-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4obsA03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4obsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4obsA02
1C8PA 5F7MC 5KSBF 2DQHL 4PRNB 4WEBH 1BEYH 3ARFB 4HZ6A 4UQ9A 3TCXA 4OI8A 5DZOA 2G60L 1BAFL 2DM2A 2VISB 4LEXL 3A6BL 3BIAX 5I23A 1G9NC 3DSFL 1FP5A 1UWEH 2XPKA 3RL2B 3LKRB 1I75A 3FO2B 2WBJA 3QCUH 2B20A 3DX7A 5DZLA 1LDSA 1BWMA 2Z35A 4P3CL 4JR9H 3UTQB 2MKLC 2YC1B 1GONA 1N5AB 2X89A 1UFUA 3HAEB 1PZ5A 1PGRB 5ECUA 4OZIF 4Y4HD 5DMJB 3G9AB 4HIXH 3ARBC 4OGAC 2OXGA 4P2OA 3PGCB 4Q9QL 2YSSA 1TFHA 4IBLT 4MMXC 2DT1A 5I6XB 4LVOB 1WPCA 3VIHA 4MJIE 4O2EA 5JZ7D 2EEBA 3FCTA 1YJDH 4C56A 2A9NL 1W9PA 5IHBA 4L29B 2J7GA 4ATDA 1T04B 3QIUA 1CL7L 2WB5A 2XXCB 3SOBL 1UR2A 3HNSH 3EUUA 5ITBH 1UJ3B 4AEEA 3CVIL 1KJMB 4PFEA 1G6VK 2CIKA 4XP6H 3NFSH 1VADA 5IESH 1UZ4A 1C8YA 1S9KC 1CLZL 3IAQA 5ID1B 4I0CC 4ODXA 3S96A 3WF4A 5DJZA 5E2TL 4ZYKB 2CO7B 2G2RB 3PDOB 4MAYA 4I18A 4WI3A 4DVBA 4W88A 4QRRB 2CDEA 4P2CG 1NCDH 2OSLA 2H41A 2Z31D 1T0PB 4NRRA 1NCWL 1RZGB 5E9DD 3N11A 4Q9RH 3HC0B 4HIHB 3SKOB 4EXKA 3HG1E 3IJHA 4HUWB 5SX5K 3RNKA 4Y4HA 5A8PA 3MRGB 1I1AA 1BZ9B 5DI8A 1U8QA 5FHBL 3PWPE 3WL1A 1OSPH 5A16A 1RIHL 3MLUH 3U0WH 5DEGB 1CR9L 2EDBA 1G7QA 3T0ED 1IBGH 3BHBA 4RDQF 3WMCA 2NX5B 4I0PD 1OTTC 1T5WB 2XVNA 2VXSH 1M7IB 2YKKA 2APTA 1FJ1A 3KPNA 4CNIB 1J8HB 1EXUA 4LSSH 3U36A 1QPKA 5LWYL 1A7PL 2HT4D 1DVFB 3MMEB 3L95A 1QBMH 2A74A 3D3VD 4HZAA 3AM8C 3KGRA 1TJHH 3X13A 2G5BA 4N5UA 5E1AB 5I8CA 1WWCA 2XIIA 1I3RB 1IGTB 1MQKL 1U8PA 3AQUA 3KLHC 2P44B 4W5UA 5F3BB 2F53E 4FQXC 1JTTA 4CJ1A 5EH1A 3LKOB 1MXGA 3QQ9D 3OKEB 1C5DA 2OR8A 4DK3A 3AAZB 5IG7A 1A7OH 3Q6FA 2OR9L 2VDOH 4GG8B 1KCUL 2Z31A 4X4YA 2Z8VC 3HNTL 5EO9A 5GGRB 3QHZL 3O6MH 5E9DA 2DLEA 2GSGA 3RUGB 5M5DA 1BYBA 4U1LA 4QYOA 5F7LB 2V2TA 4MXVF 3O6FB 4RL3A 3MLWL 3G6MA 1OGTA 2YL9A 2W0FB 3OJDB 4N9GB 2R0WH 1N2RA 2BVQB 2PNDA 4PMNA 3WFZA 3W53A 3G5YA 5DUPL 4Z7NF 1BECA 1CICC 3IVKA 1ADQL 4BSWA 1AHWB 2P1YA 5MERB 4GZEA 5IBUG 1E6ZA 5ID0B 5F7WC 4F80A 3T0EA 4G7VL 4K7PX 1PQZB 3RPMA 1CG9B 2OP4H 4I0PA 3EYFB 4QXTB 1JPFB 1K5NA 1KYOJ 4LCWD 2EEDA 3L2MA 1KJ2H 4LF3A 1HJUA 1KC5H 1KJ2A 4PUEA 5GNZA 2A1WL 3FNDA 1BIHA 3OKDB 3NCJH 4JJHA 4LLQB 4ZS6D 2X4PA 3B5GA 2XQYK 3C5SB 3P4NB 4Y2DD 5BS0A 4XPAL 2L0DA 3SKJL 3NZHL 5FEBA 4QLLA 4YO0A 4O02H 1A6UH 3D18B 3HN3A 4L3CB 3VMOA 3MRDB 3WKZA 3H2WA 3NGBC 4O2FA 2IMNA 3RM8A 3TJHC 1AIFA 3ZYIA 3ARFD 4RE3A 2I60H 3RWGB 4YQXL 5EOCH 2YUXA 4PD4K 1CD1B 4L4VB 2GK0B 1CDHA 4QLKA 3SGKC 1JGLL 2EXYC 1YC7A 2MPAH 5EIIA 3CFCH 4PJAA 4PRHE 4ACZB 1ZHBA 4IIQB 5INDA 2E7HA 4MQSB 2WVVB 2GSIA 5AAMA 3STLA 3KAAA 2HJLA 1QKZH 4IMLB 4HWNA 5DVNA 3V0VA 1CGXA 1I7UA 5DDHB 3VXTB 4DWSB 5SV4A 5IOPB 3HCVA 3BDXA 1EVTC 1H3GA 4U7KA 2Z92B 3H9SE 4XAWL 1US2A 1HQ4A 4MD4A 3QFJE 3WUGA 5TFSH 1UVQB 1Z5LB 1HCFX 2EDDA 3IKKA 3HZYB 1H8NA 3VFWA 4F7EA 1RZKH 3DWTA 4M8QA 2PO6C 5HVFB 4E42B 3NIYA 4QCIB 3SDDB 1TCMA 1A2YA 1Z9OA 3G08A 2D9QB 1CXKA 3SQOL 2FHFA 4EUPH 5B39B 1RIVL 1T5XA 4WTXA 4EUPA 1E55A 2DSUA 4Y2DA 3MODH 6FABL 3RA7L 2WW8A 4YFLF 5KVGL 4W4OC 1NMAL 4APQB 1JV5A 2GTZB 4CADB 2W63A 5CBAA 4GMSL 3G6JE 3AIBA 3IK2A 2VURA 4B7LA 2NY5H 2X4SB 4Y19B 3QO1A 4HIIB 1SBSH 4KXZI 3BSZH 3RWDA 5K59F 1N82A 3CH9A 4HXBH 5EBMA 1TNMA 2OBGA 3NBNA 4LSQL 3PL6B 1WT5A 4AENB 4XAKD 1JD9A 3X11B 3ZDYF 5JHDA 2W9EL 3F5LA 3R0NA 4QRRD 3ZL4L 3S2CA 3P4MB 2Z93A 4XT1C 4IM8A 2A9MH 1J10A 3HZKA 4WRLA 1AJ7H 1G7IB 4MNQB 1D5BA 4OZGE 3U0TB 4O5LL 4I77H 2IFFL 3O2VH 3UTQA 4N0FB 2YC1A 1N5AA 3H9HA 3W2DL 1A5FH 1DBML 2X8RA 1GORA 1WE5A 3ECQA 1BX2A 3MV7D 1RK1B 3MTRA 2VLJB 5DJDB 3VXMD 2Q6WA 1U93B 2DLHA 1Q4NX 1P2CA 3GKWH 3MSPA 4YXLH 3TO2A 3S37X 3WFCL 1ONQB 1Q8MA 4RFOH 5K93A 2NX5D 1SEBA 4HOXA 5SX4I 2XKNB 3BGMA 2OTUB 1H8SA 1UR8A 5I1JL 3EO0B 3ZE2F 5CLWA 3G5VA 1YPZA 3EYQC 5IBTH 5I0DA 1J8HD 3BH8A 2IH3B 3QNZB 2E3VA 4MA7H 4FQIL 4N0YL 5EULV 5E6YA 1DVFD 3RBSA 4BZ1H 3WQ4A 1QR4A 3CDYA 4P9HL 2DKMA 4ZUUA 3MRCB 3OF6D 2E8ZA 2MCPL 1JGUH 4JAWA 1HNFA 5C9KA 3G6AB 3AREA 1DE4B 2ARWA 1F4YL 4ZQKB 2G2RA 2EKSB 2P5WB 5HYJB 4F57H 2BDNL 3DHUA 4QRRA 2FR4A 1T0MA 1HIML 4PB9H 4I3RL 1PX3A 1ISVA 1I1XA 3BUYA 1TITA 3RY5A 4PJCA 3KWXA 3CVHH 2FLRT 3VXSB 4D94A 3CVHA 5A6KA 1ZT1A 2OSXA 5I18L 2VC9A 3GHBH 5HGBA 3CCHA 2NCMA 4K7FA 1FO0H 1XF2B 3MV7A 1FO0A 4YDKL 5CS7A 5C71A 4NWUL 5JW3H 4TVCA 1NJ9A 3MRGA 1KULA 3MANA 1RZJH 3VXMA 1G0YR 1M03A 4LXFA 5HY9B 3HRZB 2B0SL 4NKOA 4ZPVB 5DEGA 1HXMA 5I77A 5DUBB 3HAEG 4IDJL 3WIHH 2W91A 4FZ8L 4OGYL 3PTQA 3FFCE 2HRPH 2YMXH 4WO4C 3RVVC 1XF5A 4UOQA 4IS6B 1INEH 3ZJKA 1VF8A 3ELAT 1Q72L 1PDKA 3V5DB 1HWGB 3JWDL 4CD4A 5J6HA 3WJLC 3KPMA 3RWIA 1DVFA 3LN9A 5TE4L 4PJHB 3S34H 1CGWA 4YGVA 2QHLA 5E8DL 2GUOB 5FM5M 2DT0A 4FFWC 4U1NB 3GI9L 2IAMB 4WEMB 5HSFA 1XC6A 4GPNA 2YPKA 4HFWA 5E1AA 1NGWA 4YJZL 5F6IC 5C3LD 5FHAL 2FBJL 2CLRA 15C8H 1KENH 1WEJH 1WIUA 3CD4A 1FNSL 3OKEA 4HJGB 4UOJA 3WFEH 1I85C 1P7HL 4GG8A 1BGXH 2ZCLL 3T4AB 1PD6A 5FF6B 4ZFFA 4XWGL 2AXFA 2BRRL 1K9DA 1WAWA 5C6TL 4JHAL 3KPRB 3T2NH 3G5XB 3FO0L 4TVPL 2KL6A 1GC1L 1J05A 4YK4C 4OCWH 4WIWA 1DQDL 3SCPA 2W0FA 1CGVA 4L8DB 1EHLL 5TPWL 1F11A 2JELH 1CS6A 4ZUWB 4MA3B 4D3CH 1WC7B 3T09A 4IMKC 4JFHD 4X5XA 5F7NC 2XZCL 3BKML 3D85B 1OAYL 5FIEA 5DJ2A 4QGTA 3QHOA 5DJXB 3GSVB 3VX1A 1VGEL 2XZAH 5D7LB 3U83A 1T7VA 1QFWH 1QFOA 3GBMH 3VWJB 5I1HH 3RWFA 4F7TA 5EU7C 1HKJA 4S11A 2JK5A 2YOCA 5J3HD 1ZBCA 1LG2A 2DQFA 4RGMC 3CNKA 3PQYB 3QEHA 1JPSL 4PB0L 1T22B 5L9DH 1E71M 5D72L 2FO1A 3WQ6A 4QHMB 5E7BA 3PHAA 4QRPB 1MPAH 5E56A 5DK0B 2WWCA 4GW5A 3PBGA 4APQD 1EAPB 2PXYC 1E27A 1J86A 2OX5A 4I48A 1UB5B 3UAJD 3GMNA 1F5WA 4UZSA 4E0RB 5EFDA 2O9TA 2H2SC 4B53A 1CD1A 2CD0A 5LXGL 4MGXA 4PYGA 4GUPB 4ZXBA 2FLBT 5D1XD 1QW9A 4KJWC 1P4LA 1FGNL 3KPPB 5AYUH 1TTFA 3WHXB 5H8DA 1JD7A 4AM0B 1W2PA 3GBDA 2Z4QA 4HUVB 4MDIB 3PL6D 1ROWA 1A4JA 1RUPH 3K4ZA 3WO3B 1AGFB 2JB5L 4LMQI 2CCRA 1HIZA 3VXTA 3STZA 1JI2A 1JZ5A 4F2MB 4S2SB 4MNQD 1C7TA 1F4HA 1TENA 2E3ZA 3ARBB 4AEIH 4FMKA 1M7XA 2FB4L 5FYKD 4NGHH 4X6CF 4KDTA 2BMKA 3ULUF 5ISZB 1KGWA 3VX0A 4QTIL 3DV6B 4F15B 4HU0A 1ERNA 1UVQA 1WWAX 5JOFA 4HCRL 3LEXA 3WIFA 1G9ML 2CR3A 5EZIL 2B2XH 1QA9B 2PR4H 2VLJD 4G6KH 1S9XB 2VSCA 5IB2A 2ZSVB 3SCWA 5D9MA 2NW2A 2X9XA 5DQ9B 2ADIB 3T3MF 4M4PA 4TUJA 1LVEA 4Z8FH 1LDPH 4D6CA 3L5IA 5IFTA 1J1PL 2XGBA 3BJLA 2V7NB 4HXAH 4F9JA 4R7DB 1AGDA 4TOYL 3PG2A 5I19L 5T1MA 1CFBA 3JTTA 1DDHB 3QI9D 3N1PC 3CFBA 1NFKA 4NFBA 3K8KA 4JO3L 4LAQH 5D8WA 4IPNB 1NL0H 3B8YA 1I9IH 4L8CB 1NC2D 1EZVX 1ETZA 4LDOB 4PJ5E 5CJQH 1R5WA 1E4XI 4U5KA 2B4CH 1KJVB 5D1XA 4MXQD 3LAFA 2NW3A 3ARGA 1OARL 1KXVC 2W0PA 1MIEH 1ZLUH 3NCEB 3ZJ6A 4LSVH 4XB7A 2P5WD 3MCG1 2IALB 3VXUE 1IILE 3S36L 1Q9KB 1I4FB 4Z7UE 5HHNA 2J1KA 2DDQL 4KI1A 4WHCA 4RBPH 3TBYB 1OWQA 3GNRA 3DXAD 2EDJA 2HLAA 4R96A 5GGRY 8FABA 1KEML 4M6NH 1KIPB 3EDJA 1EAJA 1ED3A 3UTSA 3WO4C 2OWXA 4H88L 1YMHB 3FAXA 4XBPA 4LX4A 3SE8L 2ED8A 4AD0A 3WN5B 3RJXA 2YWYA 4TSAL 5D71H 5FKAA 5TDPA 3U7WL 1QLEH 5A8MA 1EGJH 1FZKB 4N0CC 1EGJA 4NPYB 1AD9B 4POUB 4ALAH 4O4YH 2XZZA 5HI4D 2VCAA 1U8LB 1RI8A 3KG5A 4K3DL 3IFLH 5FGCE 1CFQB 3ZKMC 4U6YB 4QXUH 4GH7B 2OTUA 3X3GH 1EBAA 3EJYD 3QI9A 2BFVL 3JUYA 3HUJF 2W60A 2Y5TB 1MCWM 3WNMA 5L0QB 3BH4A 4GJTB 4F7CB 1QLFA 4PJEE 1NQ6A 3CZJA 5BJTB 3ULVE 3FOLA 1PLGH 3R06B 1LO3L 1OD7A 4JZOB 5B39G 1FHLA 1XGPA 5IV2B 3QXDA 2F19L 1NC2A 2GJ6D 4F9PC 4FQXB 1FVCB 3L9RB 3NVQA 4XPHL 4ZFMA 3MRCA 2FD6H 4U05A 4M61A 4KHXH 1U36A 4U1GB 1YQ2A 2APXA 4OAWA 2DBLH 4L4VE 5E09A 1UH4A 2FH6A 3UXFA 4D6EA 2QADD 3FFDA 1QO3A 1JWUA 3EO1B 1MHHA 2J79A 3DXAA 2H32A 3IU4L 4G8GD 1EEQA 3OR7B 3FN0L 3TEUA 3QJFB 1T1ZB 3A6CL 3KPRD 3O2WH 2Z0BA 4A3YA 5D2LA 3JV6A 1MJJB 1E0WA 4P23D 3BEVB 3N1MC 5C0BA 4GS7C 2V9QA 1UZ1A 3PZMA 1S5IL 1MFAH 2V9TA 2WPGA 4C7FA 2Y9RT 3P9WB 3WUFA 2VX5A 1HHGB 5BW7C 4NQDB 3QG6B 2CYGA 1OAXL 3GB7A 4L8SB 4GI9A 1J1XH 1NC4A 4I0KA 1L9NA 5FA4A 3B9DA 1TCRA 4IS6A 3VWJD 4MWFB 1KOAA 2FBOJ 2ESVB 4TNVK 5DD5H 3BVNB 3R1GL 4HGWA 3PUCA 1WCGA 5D93C 1R0AL 2IPTH 2GJ6A 3C5ZC 5FYLH 5C0JA 2ICEA 3KWWB 3VXRA 3L3HA 4J3XA 1XF3A 5EOCJ 5B8CC 4Y19E 5EUKA 2DQDL 4I3SH 1QVOA 4HEME 3EO9H 3QZWA 4DKFL 4ATLA 1HN1A 2C4XA 4HJJH 3RJYA 5EA0L 4G8GA 3ULSB 3FT4A 5DUMH 3EDFA 2Z91B 2HWZL 4QHNB 3RX5A 4Q0XH 2K3TA 5JUVA 1EJOH 3VRLF 3H3KA 3LQAL 4P23A 1EHXA 3FQWA 1J1OL 2PWFA 4DZ8B 2O5YL 3BAJA 4Z2LA 4PJGB 3D69A 3NABH 5BRQA 1UWIA 1P7QB 4WDIB 5JPMB 1P7KB 4GXVH 4OF0A 1R3JA 3HLAB 2J5LB 3ARBD 3BGFC 3CZFB 3QPXL 4OGAD 2QTEA 5BRZB 3KJ4B 4Y4KC 1HP4A 4GRWH 2OTWA 3UJIH 4NZUL 4ZOBA 1J11A 5FA3A 1ZA6B 3VWJA 4JEGB 3OXRB 3RWEB 2NY4B 5GISH 3H3PL 1K2DA 4BCEA 4KUCD 1ZLSL 1KGCE 2CHOA 4NC0B 1A1MB 1GQKA 2DGAA 2GSJA 1VESA 3CDGB 4E41E 1LQ0A 4PV8B 2NY0C 3TBWA 2AJZB 3PIQB 4NCC1 4PGBB 4OCSL 1BWWA 35C8H 1HSAB 4LIQL 3KXFB 1RQ5A 4BZ2H 3GMOB 4FZEH 3NCCB 4C83B 1V02A 4C7GA 4N8CH 1TVDA 5IHRA 1G9NH 1HXJA 1KB5L 5I75C 3DURA 3PWNA 2D3LA 3L4ZA 5FOOA 1BQHB 3KNBB 2QF8A 4G5ZH 1KEGH 4OIIH 4HIEB 1EEYA 3BZ4B 1VA9A 4Z0XA 1QYGH 4GKSB 4AMCA 2DMCA 3K8LA 4LPYA 3RP1A 5CJ8A 4EI6A 4HJ0C 5ERWB 4F33A 4YPGB 1RUAH 1XR8A 1CLOL 4S2SA 2VB5A 2RCSH 1YEHL 1R85A 2Q7NA 3K1KC 3BH9A 3GIZL 3ARBA 1JGVH 4PGZA 3O6KL 1A1NB 4LP5A 1UM5L 3EYSL 1S7TB 5FL0A 3ZQ9A 3SJVE 3HE7B 4PLNC 4EZMA 4JPIB 3FQXA 1PG7L 1NCAH 1OLZA 3BP6B 2AJYH 2HP4A 3RU8L 3MNWB 1Q9LA 1OTTD 2ZSVA 4Z7QE 5D1QB 4MX7B 3BZDA 4PUBL 3ZR6A 1L7TL 1DQJA 4RCAA 3DUUA 2V7NA 3WDRA 4WV1B 3V52H 4YWGH 5H2BA 1KIRA 3MLZL 5I74C 5GGTH 1N3NB 3MRRA 4KAQH 5BXTA 5FK9B 1L0XA 3W82A 4XHJC 1PSKL 4DUXA 3MR9A 3SCOA 4Q9CA 1DWJM 4P57A 5IFHH 5DMKA 1WFOA 5BQ7A 4L8CA 4S3JA 4NJ9H 4FQXD 2O9PA 2BVPB 2NT0A 2QMKA 1Y6NR 1T1WA 2Y7QA 5CD5C 3I6KB 4UQ2B 3EJJX 2A73A 4R0LC 4JVWA 3QDAA 5K33A 5GZOC 2O5ZH 1FIGL 4RGOH 2ZE0A 1PBYA 1C93A 4F7PB 5E2WL 1P9MC 3TBYA 5C07A 3S8WA 5CHNB 4HH9B 1B90A 2YBUA 1A9BA 4XCNA 1XGRB 2FECI 1MVUA 1Q9OA 2VLME 2XN9B 1HXYA 4NRSA 3UR7A 3QQ4B 2G9HA 5KSAC 2P5EB 5GIRA 4P2QB 2J8UF 5IVZA 4WUUB 5AUMB 5FD0A 2UWEE 1T2QH 1Q1JH 4J1UA 5D7LE 1LJYA 4NQDD 5C8JB 3KYOB 2A83A 5E00B 5JR1H 5E0QA 4JFFA 5DEFB 5HVGB 1Z3GH 3L7EB 4O58L 4ZFGL 3BC9A 5FCSH 1XCXA 3PQYE 4LNVA 4N42A 3HB3C 4X6DB 3QH3A 5D5MA 2RGMA 3M7SA 1BJMA 1HHJA 4QRPE 3AM8A 1JBJA 4BFIB 5BJTA 1WFTA 3EKCA 4OUUA 2W61A 5HDLA 3VDBA 1WZKA 4WW2F 4FQXA 2D31B 1FVCA 4XNUH 3TJHD 3GO1L 4Z6AT 3QIBB 2BNUB 1ZLUK 1JF1A 3RQ3A 1X5GA 1A14L 4M48L 3TLRA 5IBLC 5HGAA 3HC4L 3C87A 4LASH 3GGWB 4X6FA 4PR5A 4RBPK 4Y16B 2AJXH 2CO6B 2CLZB 1TZIA 4G9FB 5D96B 1KG0B 1ZU8A 4ZUTB 3SKUD 4ETQA 2XZQL 3QUKA 5TGBA 4RMRA 4KY1H 1FP9A 3NA9H 1CBGA 3WEZA 1CICA 4ZFOL 2NLJB 4OSUL 5GRYA 2VH5H 2YWZA 2HKFL 1E6PA 2C3WA 1Y0LA 2VZ3A 3NCOA 1GL4B 1EBPA 1KNOA 3AB0C 1YEEL 4WI2A 5D2NE 5ISZE 4OQTL 1P7QD 4PIRF 1FL6A 2ZUVA 5JIKA 1E5JA 3LMYA 2Y72A 4P7OA 3EGSB 3RVUC 1FFOB 3SDXB 2PO6D 3QBTB 1HHGA 3I9GL 1FYHB 3PZTA 2YBTA 1F90L 1BQCA 4PMQA 2P8PB 4O9HH 3BCDA 4P5KA 1S7RB 3I75B 4MWFA 3O0RH 4M7ZC 1FVEB 2NY4D 2QJDA 3UTTB 4OD2A 2ILLA 3ETBF 4OF3A 2D03L 4M43H 4OZOA 1VB9A 1LK3L 5DMGD 4FG6D 4ELMA 5D9OA 4UT7H 1G7PB 3UTZB 2H26B 3KXFD 3SGKA 5F9OL 1WSST 1H8OA 1F3JA 3ILQD 5T3XL 1MCPH 3F62A 4OLWL 4M24A 5I16B 4U1IA 5CILH 5LCVL 2EYRB 3V4UH 3V4VL 2Z91A 3H8NA 3BRFA 1IEAB 2XTJB 4QHNA 3VFRB 3F7RA 4ENEC 3MLYL 2IUZA 3S35H 1VPOL 4FQJH 4PBWD 4G7YL 3CUGA 2DQGL 4DZ8A 1PX4A 5F44A 3W28A 2HYMA 2VAAA 1EMTH 4ZODA 4WHYG 3HLAA 3CZFA 1IC1A 2PO6A 3FB8A 2X10A 4OJFL 1K8IB 1JF6A 3HE7D 4QDMA 5I8EB 2F8QA 1X5IA 1B3YA 3D5OF 4N8VB 3WQWA 4PTUB 3QHNA 1JTPA 4AMKL 3FT3B 1YQVL 2JB6A 3LHPH 5D1QD 3RPIB 1C5CH 1S78D 1IC5L 1OGAD 3LEYL 4W4OA 4JY5L 4WTZA 1XH3B 1YNKL 5EU6D 5T33L 2X4OB 2HFEB 3TH4T 3CDGA 4R4BB 3ZE1F 1NBZA 2CIIA 3BAWA 3QULB 2GJZB 4N9OB 1NCCH 3ECBA 3ZTNL 5I1IL 3T0DA 4YAQB 2AERT 2CBVA 3GMOA 4C83A 3B6SA 3LS5H 1CGYA 4RIRA 4OFVA 4TSCL 3TONA 2DJ4A 2FZ3B 1MCQA 4FF5A 2ZXQA 3WNOA 1YUHA 3K7UA 3H7BB 2C26A 4W6WB 5D7SL 1UUQA 1UJTA 2R2CA 3BZEB 4PN2A 1N7ML 5J4MA 1NAML 1CT8B 2X7LB 3D6GA 5C09B 2I25N 2XQYG 5CBEB 2YD8A 3DVIA 3NSXA 1GGCH 4MVBD 3U46B 2BC4B 2CETA 2VUOA 5HHQB 1QTYT 1UM4L 1KBGH 2NXZC 5T5FH 3VH8B 2QQLH 3L3JA 5IQ9A 3TA3C 5ANMB 4A6YB 1HSBB 3RZCC 1V05A 5HYEA 5FGSA 3QFDB 5KG9A 1S7TA 1GOQA 1CPUA 2XN9D 2IJ0C 1H3UA 1EDQA 1WNOA 4B41A 2ZCKL 5DJAB 1F2QA 1N5YL 1UZ6E 1N0LA 3MNWA 4NKMB 3CUPB 1YYML 5C0IB 5CD3B 3HNVH 1KFAL 4P2QD 4YE4L 4Y1AE 1QPXA 4PP1C 3RVVD 1T0NA 2ARJB 1OGAA 4MX7A 4CD5A 4WUUD 5EU6A 4YIQA 4ZUVA 1DQTA 5GGQL 3T2PA 4BQ4A 3TBSB 3NIFE 1E6QM 3D25A 4QRUB 4E9LA 5DFTA 2ESVE 3S98A 1NUNB 3V5HA 2IQ9L 1O0VA 1AXIB 1JRHH 4N0UB 4YDJB 1CNVA 3IDXL 3TYGH 4FFWD 4U1KB 2OK0L 1S9YB 1SM3H 3MJ8B 4QO1A 1EEZA 1UACH 5HDQL 3BP4B 3BT2L 3T4YA 2FECL 3ARSA 4FQ1H 2NTFB 1MUJB 5HHOE 1CDYA 3DHJA 2CLVB 1GGIL 5LGJB 4UQ2A 5IIEB 4RGNE 4XB3A 4HS8H 1U95B 3KYMB 1BQHG 2OJEA 2HVJB 1HJSA 2FGWL 4Y16D 4LGSB 2BY0A 1MSPA 4G9FD 2Y36L 3OG2A 1WBXB 5J57B 5JNYB 4GS7B 4FABH 1A9EA 2IGFL 1Z9MA 1ZS2A 3V6ZA 3DECA 1KWGA 3W9DB 3FL7A 2VDLH 3D9AL 3ALPA 4M56A 2XN9A 5IB3A 1K3ZA 3VFMA 3THML 2B39A 1ZGLM 2AEQL 4R90L 5ETUB 3AC0A 5BRZE 5CZVH 4WKFA 4X9HA 3EYOA 4WO4A 4GAJH 2GHWB 4HLJA 3GSXB 1KTLB 4NO5A 2GT9B 4AD3A 2OZ4H 5KVFH 5KSUA 2OZ4A 1YYLH 5C8JA 3WJLA 3L7EA 3AXIA 2VRAA 3T77A 2B5IB 2O61A 3IDJB 1CFVL 2BHUA 4WI9A 2XRAH 1NFDB 3UTTD 1HHIA 3GIVB 4UV7H 3V7AE 4OJYA 4J3TA 1D3CA 3RDTC 4ZO8A 3QDJB 1NEUA 4JO2H 5SWZE 5IVNA 1VBRA 1EOMA 1QBBA 4AQOA 2BNUA 4KRUA 1PEWA 2HA1A 4P2RD 2J2ZA 1I7ZB 1I85A 1MH5A 4XPBH 4NQCE 4KJWD 1EHAA 2XPGA 4YUEH 1R3LA 1N64L 1D2KA 1TMCB 1Z0NA 3WS6C 5A2KH 3DO3A 3CIVA 1Q0XL 2DMKA 1IARB 2AK4B 2ATKB 4GO6B 5ICZB 3TT3H 3SGDH 1F02I 1T4KA 2DWEB 1RUMH 4HWBA 4OCLC 2CNCA 4YHNB 4TSBL 5IEKB 1RH9A 4IMKA 1JPTH 4XXCC 3X14B 1P5VA 3T65B 4Y4KB 2E7LC 5E99H 3U30C 5DRWA 3TO4C 3DROB 4GQ9L 1L7IH 3QXAB 3AHTA 3FQUA 5I3DA 3E6HA 1MREH 3S6CA 3SDXA 2WK2A 4KMQA 3I6GA 1E4KC 3G6DL 4L3AA 1AC0A 3FRUA 4CKVX 4TPRH 3TZVB 3WUWA 3L7FA 4LNRB 3U82B 3E8UL 2JJSC 1IJ9A 2GFBA 4L3EE 2P8MB 5D7IA 4BK5A 1FVEA 4BYHA 5KW9L 1SEQH 2PXYA 1EZVY 5MENA 2F8XC 1DQLL 2F54B 1UR9A 1HKMA 2Z1SA 4H20H 3WE6B 2AXGB 5HI3C 4P2RA 1QNQA 3L3IB 4W8AA 1HHKB 2CR6A 4FQCL 1MHCA 4LFHD 1OINA 3C6LB 5JPNB 2NPLX 3Q3GB 2J12B 5F7KC 4HUUB 1KELL 2AJSL 1YEFL 3MNZB 2EYRA 2X2YA 2WC7A 4MA8H 3L6FB 4MCYA 1U8NA 3SUVA 1XMWA 2JALA 1IEAA 4NO2A 5IJVB 5D6CB 2ZJSH 3U6RB 4FNLH 5DGRA 4KQ4H 5LQBL 3P73A 5CGMA 3RVXC 4JB9L 2CBUA 1CE1H 2YRPA 1O7VA 3IFNH 4UILL 1ZMYA 3B9AA 4H8HA 2OL3B 1MJ8L 4KKNA 1CZ8H 1SJEB 2DWDA 3GI8H 3VJ6A 1YY9D 2BNJA 3RVTD 3KDMA 3HZMA 3U0PB 1D6EB 3V5KA 2P5EE 4UIKH 3KPLB 4PS4H 4JDZB 3QXVA 4N0CD 4F3FA 1MRDL 4XNYH 5E2VL 2A6DA 3H0TB 4OZFH 3CSGA 3P9LB 3GH7A 4W87A 4ZTPL 3LY6A 1MWAL 3EBVA 1CLCA 5DT1L 1DL7H 3WXVH 4C56E 1YN6B 4M5ZL 2GJPA 3PHOA 3MA7B 1LE5A 1VAHA 2IMMA 3DLQR 3U57A 3RWJB 4CCEA 1DWGM 4URIA 1KXVA 5CUSH 3O3DA 2DF3A 4R0LB 4AK1A 2BCKB 3G6JF 3JTSA 4LCUB 3X3FH 1W0VA 2HVKB 4FQPA 5CSUA 1CT8A 2QQKH 3QJHA 5DTFA 3IDMA 4E8CA 2BVOB 2VXVL 4U7MA 3EDDA 3U46A 1OAZH 1OTSC 3N1QC 4XP1H 2ERJC 1KIQB 4FN0A 4FXKB 3FT2B 4GKZB 4HKZB 3TBVB 5F93C 4JR9L 1P84K 3T1WA 4O51B 1FPTL 1JP5A 3VH8A 4OZGF 3MNVA 1KJ3L 2WIIA 4BQCA 1R3HB 3DVGB 5KSBB 5DJAA 5GS2D 3DHMA 3RRQA 3OG4B 1XH0A 2OMBA 1J9CT 1NLDH 2X1QA 2X9YA 4G6FB 5DQJB 3TT1H 2WSPA 2F9BT 3MRNA 1YJDL 5DD6B 3JVGC 4QF1B 2CSPA 2C4FT 4U31A 2GTWB 4F9PA 2FRGP 4UUJB 4YDJA 4PJIB 4LSRH 5L8LB 4NN5B 4IOSD 1E0OB 3V8CA 5JQ6H 5EC1B 3WFDH 1QHOA 3HFMH 1AR1C 1DCLA 3W9EB 4IRJC 5AEAA 3FOMA 3L4XA 1IC4H 2J4WH 4OZIB 4L5FH 4LFHG 4NSKB 2QKIA 4HQQL 2WVUA 1CGTA 3QDGB 4JJ5A 4OM1L 4XC1H 1U95A 1YEJL 3MLVH 3VGAB 2FCBA 4MD0B 5ILTL 2DIJA 5IMKB 4GRMB 2XTJE 4JQXC 3VI4E 5E6IC 2FDMA 3DYOA 4Z5RA 3DRQA 3TTYA 4R97B 4BS0A 1IEHA 2G3MA 3WD3A 4QRTA 4RX4A 4LSTH 1N6QH 5DK2B 4Y4KD 5BW7A 4NUJB 1OSPL 4J7RA 1ZB5A 3P2TA 3U0WL 1IBGL 4LPTA 2OLDA 1KTLA 3GBNH 1S5HB 1IM3B 4JKWA 1G7MB 3VE0B 3CFJA 2NY1C 1KCVL 5E95B 3TZVD 2XKSA 4K3GA 5IW1B 3C5ZA 1CDCA 3UYPA 5EN2B 5D9SA 4LLAA 4HX1A 5TF1H 5DT7A 3C8KA 3KR3L 5EZJB 4KJPC 1H1NA 4TUFA 2ZWLT 2F54D 4NRYA 2LFGA 5BS0E 5B8CA 4F58H 4CL7A 4JFQB 4YEEA 3EFFA 3BESR 3Q6GH 1A6PA 1B2WH 3NACH 4RFNB 3L4WA 1B0RB 3QG7L 4ZFZB 2V7HA 3V6OC 1F3DJ 1ZWIB 5I1CH 3BX7C 2PWEA 5DA4A 5IMOA 4FQQB 1H0DA 2RJMA 1CXFA 2VDOL 3LQAC 3UO1H 1DJSA 5C09E 1LNUA 5IWLC 3MO1B 4PJAE 1BIIB 1I8KB 2DIAA 4Y7MA 3VFNB 2VO5A 5AG8A 5KJRH 1W72A 1R86A 3WF0A 4ZUSB 2DB8A 4NSBA 3WS3B 3ZSTA 2R0WL 4AXNA 5GRJH 1ITBB 4UQAA 2OJZH 3CLEL 4Y4KA 5DO2C 1UD3A 2PUQT 4KKBD 1FSKB 2UYLA 3QEUB 3K2UL 1P6AB 1MFDH 1INQA 1U6AH 3AROA 3VRIA 4PJDA 3WSUA 5ALBH 5IVXE 4JPVH 1GJUA 3MU7A 2ZUMA 1C1EL 4DW2L 5I1LA 4JY4B 5C0NC 5FYKU 4Z7WE 1KJ2L 1NMCB 2DQHH 4M8VA 4Z78B 1RZIB 2BOBB 4G80B 5HYSB 1BAFH 3OPZL 2FX8L 4LEXH 1BFNA 3BN3B 3UEZA 2F54A 2GK1B 5KN5B 3MYZA 4MB4A 1G7JA 2W38A 3DSFH 1Q6GA 4N0UE 5DJYB 3WE6A 5JOEA 4HDIB 3F65A 3NOIA 3OGRA 2F8VA 2X4RA 4JLRA 4JO1L 2I60L 5EOCL 4P3CH 1WAAA 2MQCA 3O3BB 5JMOC 3MNZA 1U8KB 3OKMA 5I66B 4PCSA 2DQCL 5FOJA 2MPAL 4GAGL 4KV5E 2XVLA 2F2HA 4NN7B 3WSQL 3FAWA 4L9DA 5C70A 1NCBH 1VACA 1A3RL 2VXQL 4EI5B 3K46A 3AIQA 1JUFB 4I2XB 1G6RH 2HT2C 2RFXA 1G6RA 2X4QA 5JHDE 3TA3B 2AK1H 4XNQB 4W4NA 4Q9QH 3P0GB 5ABEA 1DQQB 1FNEA 4PGDB 2IH1B 3IDGA 2AV1A 2VLKB 2JJTC 5KSAD 1SJEA 3B9KB 3O4LD 1S7WB 5IFJB 1GOWA 3W29A 4N1EA 1SFSA 1UD8A 2D1ZA 3MRMB 4AZCB 3BZFA 4Q97A 4P8UA 3ZTJG 2Y07L 5I9QC 1CL7H 4JDZA 3SOBH 4CMMB 3QPQD 4C54A 3U79A 3CVIH 4GRWB 2E6JA 3MFGB 5DRZA 2DM3A 4LL9A 2C3VB 1CYGA 5FV2A 1J0KA 3ROOA 1JZ7A 4G6FD 1E72M 4LVHC 3HB3D 1CLZH 3R4DA 4HWZB 2ADFL 3B5TA 4I3GA 1SMDA 1TA3B 4MS8C 1NLBL 1YPZE 5D7JC 1MJUL 5DK3A 2W66A 2PTTA 4IOIA 3TIDB 3RWJA 2A3BA 3QDJE 1LE9B 2LVEA 2Q86A 1I1YA 3SE9L 1NCWH 5DJ6A 3JWOC 4R0LA 5IBLD 1HJWA 5JO5B 4MNJA 2VLRB 2BCKA 1EHNA 2HTKC 3BSZL 1BF8A 4PY7B 1CGSL 1OP3H 4HXBL 3PHQA 4LCUA 3ZLQC 2UV3A 4H04A 3BJ91 1P9MA 3BKCL 1U8HA 3KPSE 4AIZA 3WELA 1A4KB 3WLBB 3AHXA 5FHBH 3SO5A 1N8ZA 2E7CA 1GZPB 1RIHH 3GSRA 1CR9H 1JFHA 5IMLB 4PJCE 3IXTB 2C4FU 4O51A 3SDYL 1NANI 2BP3A 3M17B 4Z7UF 5BXSA 5KSAA 5INCA 1LQSR 4BELD 3O4LA 4JKKA 5CEZD 4I4WA 4DOHB 1KTDB 4NRZB 4KQ3L 1R3HA 3WDIA 2XI9A 3LN5B 4X7TA 1CTOA 3MA9L 4JFEB 5LWYH 1A7PH 1LO2H 1YDPA 5FO7B 1H2JA 3WENA 4ONOA 3IF1A 2BSRB 1HX0A 5FAAA 4RFOL 4KDWA 1MLBA 4OUEA 4LLDB 3N9GH 5IMMA 1MQKH 4FXGB 3WHE1 1E3ZA 4BQ2A 2WNWA 1FN4A 2VN4A 3KYNA 4MA7L 2OR9H 3MRFA 3UZQA 3F7VA 4UT6L 4ONFH 3HNTH 2H3NB 4KU1A 3TYFA 5EC1A 4PJEF 3ULVF 1LGVA 2WVSA 2C3XA 4ORGA 4HWEL 5C9JB 3MLWH 2WMGA 4H8WC 4LPWA 4XXDB 3ZOAA 1FBIL 4J28A 4CW1A 4RE4A 5F6HJ 4F57L 1I7TB 5DUPH 5C0CA 3BLPX 4ENED 3GUTB 4QFUA 4D2NA 3OKLB 4G7VH 3CVHL 1A6TB 4MZ2A 4ZDHA 1CN4A 2AQ3A 5E4EC 1NGYB 3AXLA 5I1GL 1GOIA 2GUYA 3ZO9A 2BY3A 3GHBL 3TO4B 1E6NA 3UJTL 4ODUB 2WP3T 1XH2A 5DK2A 1RZJL 4RRPG 4MNKA 5FXCH 3B2UD 2CBIA 1CDUA 1UR4A 3MGTB 4XPAH 3SKJH 1S7QA 2ZOLA 3OB8A 1XD0A 4M62L 4D9LL 2GYSA 3DYMA 2YMXL 2FWOA 4NKIH 1ND0A 1XD1A 1XIWB 1C12B 3H7LA 4ODHL 4HW6A 4M93B 5EN2A 2V3FA 3QQ3B 2CDFB 2ID5A 5ESAB 5T3ZD 5FECB 2VI0A 1JGLH 4JAMB 2ZX6A 2W92A 3C6SB 1IAII 4G3YL 2OYKA 1LO5A 3MPCA 3QRFM 4P7NA 4X8XA 3BMVA 5EU3B 1BOGB 1MCWW 3SY0B 4ZFZA 1KENL 4P8WA 1OPGL 1FH5L 4JL2A 2AEPL 4PTMA 4XC3L 3RI5F 3WFEL 3FW6A 4XAWH 1W1TA 4D9QD 1BIIA 2H9GA 1ZJBA 2MJWA 2Q3ZA 3PWJB 4Y88A 1TMQA 4EI5D 3GM8A 4F8XA 1XGQB 3TA3D 2A6IB 3DPBA 4J6RL 1E4IA 1L0YA 1VFAB 3RZCD 4D3CL 1CDBA 2OR7A 4P7LA 5E9AA 4IHOB 2VLKD 3SQOH 1EX0A 2VRQA 1FL3B 2A3EA 3WH9A 2DKUA 1RIVH 3B9KD 4MADA 4PGCB 3RA7H 1RZ7L 3REVB 4KK5C 5KVGH 4X6EA 1NMAH 4JREC 1E43A 3GYCA 2XZAL 3F7PC 3IDYC 5IM7B 4WU5A 1S9WB 4CKQA 3CMJA 1NFIB 2BNRB 2VXUL 3MX0A 1W9UA 1BBJA 4KI5E 3I6LD 3QO0B 2BSSA 3LZFL 4WKHA 1F6AA 3WLWD 4N90E 1MPAL 3Q5TA 6CGTA 1AGEA 1I9JL 4ZNCD 1PZ3A 4LSQH 1BYAA 3AZSA 2YK1H 1G1CA 4PJIE 3E6FB 3OV6A 2E7MA 4HDIA 2W9EH 2AXHA 3ZL4H 1WDQA 3WIIL 4HGMA 3QEGL 4NRXB 3SCRA 1QG3A 3KL3A 3KYKL 2IFFH 4PJ8B 3UC0H 1ZVSB 4A4AA 3W2DH 4WFFD 3QDGE 3FONB 1DBMH 1RSFA 3UDWC 5J1AA 1JYWA 5BO1H 1Z6JT 4L4JA 1KCRL 1OW0C 4I2XA 3MOQA 3TA3A 5ABHA 4XNQA 2NR6C 4M6ML 4Z2JA 1U2YA 1Z0MA 3RZCA 4G42A 3VXQA 3WNKA 4RDQG 1KB9K 4GRLC 1JAEA 4GO8A 4PRIA 2CGRL 1Y6MR 1FFPA 3WFCH 2Q8XA 4MCZB 3VO0A 4JZNB 1BLNA 4HS6B 3MJ6A 3SIMA 2R1WB 4U1HB 1I1WA 4WTWA 3UTSE 1GJWA 2OYMA 5I1JH 5DO8A 2PR4L 1JIBA 1ZLWH 5DHXB 5BROA 4JFED 5IDIA 3MCKA 4N0YH 4FQIH 4QY8B 5MP6H 3DO7A 4EOWL 3W38A 4Z8FL 4ODSL 4PGJA 5SWSA 1CXEA 1SYSB 4P9HH 43CAB 4Z7QF 5BXRA 2MCPH 2A6KB 1FDLL 1X5XA 4U2ZA 5CLTA 5CPQA 1E4MM 1NUGA 2H1PH 3RDTD 3OLGA 4WWKB 1F4YH 5A2IH 2MHAA 5HYSG 1MELA 3EIFA 2BDNH 4RE2A 4M7JL 2VCBA 1HIMH 1OHQA 2A0LD 4I3RH 4WLCA 1LE9A 1WZ1H 2GVYA 3U4EA 4D6DA 4HF5L 2YIHA 5EO1A 4WSKA 4XCYA 4JRWA 5CJQL 3EOAB 3FZUD 4MSWA 1OT2A 4X6CB 5I18H 2B4CL 3UCRA 3VUPA 1M6OB 2YN3A 3TN0C 4LSVL 1U30A 1MFBH 2P48B 4OFKA 5DD1L 4JFVA 2OQJB 1A4KA 1OL0A 1U58A 1BFSA 2BOCB 2OTPA 3LKNA 4KRPB 4PJ9C 1CD8A 3ZHLA 5CZKA 4EN3C 2B0SH 3RKPA 5FKYA 1XYZA 4L4TD 5IMLA 4IDJH 5FYKL 4FZ8H 4OGYH 5IF0A 1QUNA 4IDLA 5L8KB 3VRJB 5D2LE 5M03A 3LKQA 1AQDA 5LBSL 2ZUQC 3TO4D 5FCUL 5BV7C 3VXOA 1KTDA 4BM7A 1J87A 5C0BE 4EVNA 1Q72H 4PLKD 5D4YA 3TJEL 4QGYA 5DLML 3VTRA 3S4SB 1FZJB 3ZDZE 2JF7A 1EGJL 4XH2B 5TE4H 3PGFL 2BSRA 6TAAA 4U0RC 1JJUA 5ACZA 5E8DH 1XCQB 5IROC 3LSOA 3GI9H 3IFLL 5L7XL 1ZGLB 1NWRA 2UWEF 1NGXB 2R15A 5E8EB 3RDTA 2UY7A 5FHAH 2FBJH 2G3IA 2X70B 4LHUB 43C9A 3NH7L 3LIZL 4FOMA 1CDIA 3Q2CA 2ZCLH 1QACA 1PVHA 2BRRH 1OP3K 1H41A 3IDNA 4MA1C 4G43B 4JHAH 5FYLE 2RQ8A 4GO9A 4TVPH 3FY1A 4NQVA 3NMEA 5GRUL 5GQBA 3VXRE 3WS6A 1AY1H 4K23L 4Z7NE 1DQDH 1EHLH 5TPWH 3TFKC 5LYRA 3WD1A 4OZ4B 4X5WA 2DICA 2V9RA 4NZTL 2EIBA 1HVXA 5DS8B 3W4RA 4AEFA 4O2CA 4H26A 1H15A 1ZGLP 4JN2B 4KVNH 2YD1A 2QSVA 4L4TA 5BZDB 4P4KB 1A6TA 4XXCA 3RVXD 5C08B 3W5NA 3PZQA 1DN0B 2E7LA 4PRDB 4QTHB 2IWGA 3GKZA 3TO4A 1BMGA 4FS0A 1UZ8B 3PZ9A 1E4KA 3D3AA 1RJLB 3SKMB 1JPSH 4PB0H 2AJ3A 2V5DA 1V0NA 1WZMA 1IAIL 4AL8L 1FYTB 2JJSA 5MI0C 1BOYA 4PMUA 3UG5A 4JZJB 4GRWE 4YDVB 1NQBA 4FQHA 1QOXA 2J25A 3PV6B 3VD4A 1AQKL 5J12B 1Q0YH 4K71C 4FFVC 2BNRD 1WFNA 3TCLA 4U1JA 1S7XB 3AMGA 5LXGH 2WAHA 4PEEA 1UM6H 2DMBA 4U4BA 3RWCA 2V2WB 3WXWL 2CESA 4J23A 3OKKB 5ABFA 1DLHB 5A6SA 1FGNH 4CU8A 1S7SA 1LG1A 4HUXA 2KBGA 2IG2L 3UG4A 3RZWA 2JB5H 3L5WB 4MNHB 1V02E 3P4OB 4AG4L 2J75A 3K0WA 3VFVB 1R5VB 2PYFA 3H9ZA 4PJ8D 4LYRA 4ZMAT 2FB4H 1T7YA 1WK0A 4TX8A 3MUY1 2FO4A 4GKOA 3P77B 1G9MH 1KPUB 3OGSA 2E8YA 2EICA 1K4CB 3BQUC 3WUEA 3C2SA 4S1RL 3NABL 4HTYA 3N1AA 4XZWA 3EDKA 4LQ1A 1ZHKA 1J1PH 4KXZH 4NQSB 1KPVA 3WDPP 4PGCA 4TOYH 5I19H 3IDIA 3OHXB 3REVA 3UJIL 1HEZB 4HUNB 4WU7B 4UAOC 4JRXB 4NT6B 2EH7H 3L2LA 2VDQL 4PJ7A 5JBEA 2GJXA 4JO3H 5GISL 3UYOD 4JM4L 4XBGB 4I9WD 2MNUA 3CPLA 3QR3A 2WYSA 3VDAA 3U7AA 1SBBA 4RWYH 1PYWA 1OARH 2XKUA 2X44D 2RGLA 1DBBL 2GITA 3S6TA 1KLUB 5DC0A 3L5XH 3ZT6A 5F1NB 3S36H 3EW3B 1G9NL 1MW1A 2DDQH 1FG2B 1LD9B 1FH9A 4HA4A 1XRVA 4LEOB 1B3JA 3A4XA 3W39A 3JZ7A 1KEMH 3ULUD 2IPKA 1UD6A 3VIMA 2EZ0C 1ZVSA 2HFGL 5EIQA 2DLGA 2XVKA 5J13C 1OP9A 3BW9B 4OKVB 1FVDB 1BD2B 4HEPG 3P4LA 3W25A 4H88H 2EDLA 4YEFA 1VGKA 5IHZB 3PZIA 3NCBB 4AYFA 3SE8H 4K94L 2XFXA 4AQ1B 4TSAH 3U7WH 3P3YA 5C07E 3LQZB 5EU5A 5TE7L 2R2BA 3QHTC 3TNNA 2V5SA 4PBGA 1JGVL 4UFKA 2J7LA 2BX5A 1BF2A 3RVWC 4K3DH 2NMSA 3SPVA 1KR0A 5JBFA 5ENWA 5HPMB 2QL1A 3SCVA 3WFHA 3EYUL 2BFVH 2EDNA 3DUSA 3WHE0 3JVGA 3QISA 5AZ2L 4EIZC 4JHOA 1LO3H 5IB5A 4D9RD 1JK8B 1UZ6F 5EBGA 2F19H 4OZFB 1LF1A 4JFOA 4XPHH 1JNLH 4YWGL 4P3DB 3FJTA 2NSXA 1OQOA 4JFFE 4LOUC 1PPIA 3MV9B 4N1HB 3WF1A 3NIFF 4W8BA 5CCKL 3BPNB 2BNQA 4IRJA 4LHUD 4MNGB 3V7MA 3PWUA 2BVEA 3B3IB 5FB8A 3AZRA 2AOSA 3IU4H 1BZ7B 3FN0H 4RZCB 3A6CH 2X4NB 4Q7DA 1BFOB 3O3AB 4NBZB 1FE8H 1XR9B 4JQXA 1CE6A 5E6IA 1FNHA 4U33A 5TDOA 4HKXB 4KPHL 3WEXB 2OQJA 4OIBA 4RGOL 5BXFA 1N0XH 4EE9A 3FB7A 1NM9A 1QHZA 1MF2H 2R4SH 2JIEA 2PYEE 4P4KD 4NM4L 4MQ7A 1HJXA 4PG9B 3JV4A 3CHCA 2NNAA 3T2OA 1OAXH 5DO2D 5F3HA 1ZSDB 4HOWA 1G7LA 1OAUL 5JZ7C 4HK0B 4OCXH 2CUIA 3NPSC 9CGTA 4HIJB 1EVUA 3OA5A 4DGIL 2KKQA 5GJSL 3R1GH 5C0AA 1FZJA 1R0AH 2BJML 1IMHC 2EXOA 4XH2A 1JNNL 2VDKL 1Q1JL 4GAYB 4WI6A 1FYTD 2X40A 1UD4A 4LLYA 2PI6A 1ZGLA 5GGUA 1WCBB 3MBEB 3BKYL 4UDTB 3BIKA 3FB5B 3W0WD 4M5YL 4MLIA 2O9RA 1WFUA 2DQDH 2IF7A 4NP4L 5D8JH 4BH8B 1QFHA 2V5MA 4HPOH 3QUMA 4DKFH 1B2YA 1TQCB 3INUH 3V6OA 2HWZH 3HKFA 3O8XB 3Q0HA 3ESVF 3UERA 3O9WB 1HKLL 4LHJB 2Q76A 3LQAH 4C59B 4HZ8A 4FK9A 3NFPA 3QDMD 1J1OH 1QSEB 2X5PA 2O5YH 2VX6A 4LASL 5IWLA 4AZIA 1NDMB 1UQYA 4JFDB 1LK2A 2J8UB 3VMPA 1G94A 4JHZA 3T1FA 4HWUA 2ZG2A 5F9JB 3RX8A 2HT2D 5DSCB 4ZEPA 3TGXA 3NA9L 3O41B 2P46B 3DGGA 4NZUH 1A22B 3RHWF 2F74B 2H45A 4QOKD 2FHCA 3UPRA 2VABA 4Y4FC 1B0GA 3HUJA 4CD6A 1TZGL 5E8NB 3H3PH 1RJZA 3D1MC 4P8VA 5D6DC 3IJYB 3SCSA 3MGOA 5J1SC 1QLRA 1EOKA 1I8IA 4WW2B 1NARA 1A6AB 2CKBB 5T1LB 6A3HA 4WHTA 1MHEB 4CDGC 3UX9B 1VDGA 1WP6A 4OCSH 5CJ5A 1JPGB 4LIQH 2ZSWB 3W0WA 4JRXD 1QEWB 4O9HL 1BJ1J 3S4SG 2E7BA 1QR1B 4E2OA 3OR6A 1F00I 2WVTA 1UXSB 3EJZD 2YL6A 2V2WA 5D7JD 3OKKA 1AKJB 3QQ9C 4UT7L 4S10A 1EUUA 2J8OA 4RAVB 1HP5A 2GEEA 1QNOA 1CDGA 2DSVA 1N4XL 4NO0B 3WD5L 4LHUG 3BGAA 3REWA 1W91A 3QDMA 4BF7A 1NWSA 1EO7A 2HTKD 4WFGE 4UQ3B 4X0KB 1KT2B 1MCPL 1AXSB 1GSMA 3SO3B 1CLOH 1EFXB 1PJ9A 1V0KA 3WD2A 2F58L 3TC9A 1YEHH 5CILL 3S88L 1R5VA 2E9IA 4JDVB 2DL2A 2J74A 1QSFE 4KMLB 3GIZH 1BFTA 3B2VL 3O6KH 4LLUB 4TUKL 1QNZL 1UM5H 3DVNA 3CH1B 1BVZA 1YMMA 4OLEA 1BD2D 1C90A 1PG7H 4QOKA 3RU8H 3T3ME 1AGCA 1UADC 2JJTA 1JGDB 4UZUA 4NNXA 4X4XA 3V6FB 2XSAA 1FZMB 1L7TH 3RX7A 1EMTL 1R7OA 3BCFA 1E4XH 2AP2A 1ESWA 1G01A 4NQSA 1XV8A 1K9TA 2E9WA 3F5WB 4PRBB 4PTTA 1Q9WA 4AT6B 4TUOB 5JDSB 5I15L 4WY7L 1F6LL 4MMZC 1PSKH 4UU9B 1JZ2A 1W9XA 4OQ1A 3LDBC 4OLVL 2RR3A 3QAZC 1ORSB 4G6AC 4UZGA 2WMKA 5DHVA 4NHCL 5EU6E 2LU3A 4AIOA 2EC8A 3UTPE 3ARFC 3PGDB 5D7JA 3AY4C 2DSZA 3P9MA 2MQ0A 4ATWA 2VE6B 2W9DH 5L2JB 4WFHD 1A3QA 1NCCL 3MV9D 3EOBB 1V03A 4WJ5A 1KLUA 5FOBA 4YR6B 1FIGH 1MRCL 3AIUA 4AC1X 5CINL 1RPQA 1IM9D 1TZHA 5E2WH 4YHYB 1DEEB 4G9DA 1MFNA 3KEHA 1JFQL 4PP2B 1IZJA 2EC9U 4LARL 3U2SB 3BW9A 3IYLW 5FV1L 2HJFB 4RNRA 1NWTA 1ZV5A 3MYJB 4Q6YA 7A3HA 4XMKL 1D5XB 2GJRA 1GGCL 2NT1A 1R5IA 4QWWC 5DZNA 4KZDL 4X9FA 4BSVB 5C08E 2JCCA 2YD3A 2N1KA 1DBJL 4L9LB 1LL7A 4JRYD 5HTSA 5HPCA 2YA2A 3KZSA 4AZBA 1IAOA 4O58H 4ZFGH 5I6XC 4LVOC 5LAXA 2QPSA 1RMFL 4U0RB 3EFDH 3WMSA 1BFVL 2FJFA 2IANA 5C0EA 3QDHA 3AIRA 3UTOA 1G5AA 3BOVA 1JK8A 2JIWA 4BKLB 1JL8A 3CC5B 5F97E 2CKSA 4TRPL 1PKQA 4MPKA 2AV7A 1UJ3C 1XF4A 1SYVA 3G5ZA 3GO1H 4LCCC 5FYJD 3PF2A 2V5TA 5B3NA 4V28A 5AD0A 1QP1A 3C2AH 3LN4B 4TULL 4R7NB 2XG9A 4M48H 2B31A 3HC4H 1TUXA 5IJKC 4XX1E 4YNYA 1GIGL 1NOWA 2N7AA 2VC2H 1SM3L 1R7AA 1IM9A 2IBZX 4X80L 1HZHH 2EYSA 2XZQH 3RIAF 3N18A 4D6IA 4R2GC 2YRLA 3PDGA 1IL1A 4X7CC 1Q6DA 4NZCA 3ZYOA 3O8XD 2CRMA 4OSUH 4NBXB 1BFOA 4U1SB 3IRZA 3O9WD 2OCFD 1IAIM 1JNDA 3AIVA 5GGSA 1XR9A 1JNHB 5TH2B 4PV9A 4HAFA 1QSED 4GG6A 2AXJA 1B30A 2X1IA 3BXNB 2DIBA 3GBEA 4GI8A 1YEEH 2OWWA 5E8OA 4JFDD 4OQTH 4PRAB 2CKRA 4OQTA 4RA3A 4Y5XC 4BUGA 5C0DB 4JRYA 3OX8B 3OKOB 3ALXA 4MJIB 3I9GH 2HG5A 3VXNB 2Q8AL 1F90H 4QHLB 3EOTL 4M1GL 5I73B 4K9EC 4HHAA 5I1DA 4NQTA 4OV5B 1DUZB 5CZVL 2D03H 4NKDB 3GMPB 1LK3H 4KKCD 5HD8C 2WMJA 3LQMA 4GAYA 2P24A 5FYJH 1GZJA 5T1LD 4ONHA 1FA2A 3OLEA 5EU7E 3TPUA 4R26L 1FL5B 2JF6A 3W27A 5B38B 1TJIL 1GQIA 1DWFM 4L4OA 2Y25A 5F9OH 4H0IA 2PW1B 3BEWA 5HDBE 5T3XH 3BE1L 4OLWH 4OZFG 4BQ3A 4YN5A 4Y5VB 4H8VA 1JMZA 3V4VH 5MENE 4JFXA 5J6GB 4JO2L 1AKJD 1LHZA 5KBNC 1DFBH 3MLYH 5I76A 1BGGA 2DEPA 1CBVL 4NO0D 1VPOH 3OQ3B 3HG1B 4JY6B 3LPFA 4G7YH 4YUEL 5E7FA 3O6FC 1TTGA 5ADPL 2J8UA 3ZSSA 3QCTL 4S3KA 2EDXA 4S1QH 4U6HB 1VFBB 3ZKSD 5HI5C 3PWPB 1CQKA 2FIKB 1XCTA 3WH6A 5GRWA 2X1PA 3UCQA 1JF5A 2D7TH 2XVPA 4OJFH 4HWBL 1AHWC 1QHPA 3BYYA 4IOFC 1RUML 4GRLD 3WQVA 5KSVA 4RFEB 2EKJA 4PJAF 3D0VA 5EO0A 2A3CA 4AMKH 4WW1A 2QQNL 1YQVH 5MEOB 3LEYH 4KGJA 4JY5H 3FTGB 1JVKA 3VIFA 1L7IL 5T33H 1KLGB 2I9TB 4Z2IA 1MHEA 3ISWA 1VKXB 5I1EH 3GEWB 1D5ZB 4NQEA 3SKNA 5I1IH 4NYLB 5H37H 2ESCA 5FM8A 1BVKA 1FNLA 2ZSWA 5IVXF 5JLZB 4UOZA 4JKPL 1UYWL 2DQXA 2FH8A 4C4KO 3NN8B 4TSCH 4Z7WF 3LPGA 3U1SL 4MNLA 2F53B 3ZJ8A 1UWXH 4R3SA 1YY8A 4S1DD 5D7SH 1IE5A 1N7MH 1NAMH 1AKJA 4HA1A 1NAMA 1EUTA 3QNXB 3ZKXB 3MRPA 4HKBA 4HT1L 1E6JL 4PMYA 4NO0A 3S3SA 3TF7C 1UD5A 4AY1A 1ZHNB 4ZO6A 1A1OA 5IEHB 1CD0A 1QBLH 2CDGA 4JPKL 1EJ6A 3UDWA 4ODWB 4IIQC 1CCZA 4S1SH 1UM4H 1L8NA 5TF0A 2WKLA 3JSSA 3TN0D 3TTOA 3W81A 3GSUB 4JDVA 1OW0A 4XNXH 4OLYH 4M1RA 5DRNB 4DWSC 4LLUA 4PJ9D 3AS1A 4GKLA 2GQHA 1EFQA 4EN3D 1JNJA 4YHZL 2GAZB 4GRLA 4MQTB 2I07A 5A1AA 4KV5F 1N5YH 3HR5B 4KQ4L 4OFYA 4UDUA 1UXWA 3FQNA 4DZBA 1JGDA 4ZPTB 1CE1L 1ZTXL 1RFDL 4YDIL 1KFAH 1GOOA 4YE4H 3IFNL 2W67A 1QRND 3MRJA 1JHTA 5GGQH 2FL5B 3L3OA 3SDDC 1GUVA 2OI9C 4U6TA 4TXEA 4LCYA 3RI5K 2X4TB 1P4BL 4UIKL 1OSZA 5JDSA 4TUOA 4PS4L 4AT6A 5K9OB 3OB0H 2IQ9H 2E9LA 3PWVB 3BWAB 5ALCL 4TTDC 3GMLB 3IDXH 1JWSA 1KCSL 1TVHB 3CFEA 5IFAL 4M29A 2VT0A 3S5LB 4APQC 2VZOA 2BSTA 5HDQH 3BT2H 2COQA 1WQVT 5IK3A 4DKDC 1NEZA 5F9WB 2ADJB 3PGDA 4MDJA 3H9YA 1GGIH 3FB6A 1T83C 2X4UB 4HFUL 2KZWA 1T80A 4Q2ZB 2WBKA 1RURL 1XZ0B 3FQRA 4PRHB 1K4DA 2VITB 2FGWH 4QRSB 1MYRA 4ZAKB 1QFUH 5DC4B 2Y36H 4MXWH 4XGZB 5HGDB 1YPZF 3PL6C 1RHHA 3CSYB 1QFWI 3MOBL 3X12B 4F7MA 3TN0A 5J9PB 2PTVA 1XFPA 3X3FL 4YHIA 4PJ9A 3OZPA 5I2IA 3H9SB 1BAGA 1MLCA 2DLFL 4EN3A 1AP2A 3A67H 1I8LC 1D9KB 1UR0A 1IAKB 3HHRB 3THMH 2QBWA 4U6XA 2AEQH 3CTTA 4OCYL 1PBGA 4XP1L 3L4UA 4OLUL 5D1ZB 5DEZA 5BV7H 5HJ3A 3MQIA 3VFTB 4UNVA 1RHFA 5DT5A 1QRNA 2SEBB 3OG6B 4O00A 3S36X 3NPZB 2NY2B 5DRXB 5A2LH 4A6YL 5EBAA 3MJ7B 1MI5A 4MJID 4PJCF 2GCYA 2ZUYA 5F89B 1A02N 4P59L 2VTFA 4RSVA 4X4ZA 4X4MA 1M04A 4E5XB 1S7UA 1V3LA 4P5MA 1CFVH 5JTWA 4LPUA 5IROA 3JV0A 1YEDB 2ZNWA 1E1EA 5LVEA 4GAFB 1NLDL 4WFEE 4D1IA 3G6JB 2OM5A 3QIWB 1OBAA 3GSNB 1ES0A 3QXUA 3QNYB 3ESUF 3HI1A 3HPJB 3TBTB 1JFXA 3GNOA 1N64H 3FQTB 2AEIT 4WGWB 3ZDXE 1H49A 3IJSB 1QZ1A 4G8IB 3UJJL 1QQDA 2VQ1B 4TNWK 3VFPB 3T08A 4OZGB 1K8DB 3SN6N 5E94B 3KL5A 3U9UA 1UWRA 4ODTH 5CJBA 4ZXLA 2NZIA 4TSBH 2XNAB 2PF6A 3HG1D 4N68A 4OD1L 1I1FA 2DD8H 4I5BA 3MLVL 1H4PA 3ET9F 3WL9A 2XWBB 1XGUA 1IZKA 3PWPD 2ZUNA 3BPOB 3MUGB 1FNGA 3W6MA 1X44A 3G6DH 3AS2A 1IQDB 3NDYA 4JPWL 3VXNA 3E8UH 1N6QL 5MEQA 2A6JA 2ENSA 3VGGA 1IV8A 1TPXB 1GNXA 4QT5B 4XX6A 1E4WL 5KW9H 4NKDA 5F88A 5GRVK 1WB0A 3F12B 5IB4B 3QP3A 5D7KE 4PJDE 2QHRL 1ACZA 1QPPA 3VCLA 5LGKA 4LVNB 5F96H 1I1RA 5A6BD 5DHYB 4FQCH 1I9RL 2G8ZA 1O7SA 1HILA 4GW4B 5KS9A 2GW5A 1ZS8A 1YEKH 2DI7A 1KBBA 2IAMC 1ISWA 1KELH 2AJSH 2F53D 2YPLE 1OB1A 3L4YA 1CFSB 4HKJA 1LLOA 5FO9B 4YBQD 2R2HA 4JQIL 4NN6B 4B0MM 3I84A 1JYNA 3DX9B 3DV4A 1HI6B 3NACL 3HG1A 5LQBH 3VNYA 1ISYA 1GQJA 2HN7A 5J1TC 3TNMA 3LVEA 4ONGL 1TE1A 1ORQB 4UILH 3MUZ1 3ORJA 2W65B 2ORBL 1WAAE 1MCKA 2ADGA 1MJ8H 2ZOKA 2VDNL 4XMLL 4A2MA 3BQUA 3IXAB 5A2FA 5EBLB 4OLZL 5EDXA 2MQ3A 2XVGA 1W72L 2L7UA 1E5NA 1NKRA 1HH6B 3L3KA 2WINA 5LJYH 5DMYA 2IQAB 5E2VH 1X7QB 2NY3B 3FFCB 3F4VA 3RVWD 4JANB 2WCGA 4UFIA 3UP1A 1DSFL 2HJKA 3BD3A 4ZTPH 5CMAB 4OIFA 3N06B 2NY6B 4YLQT 3RNQA 1MWAH 1MWAA 3VG0L 3ZKND 2QLVB 5DT1H 4AIXA 5EPMA 1VRXA 1PY9A 3RTQB 1KLGA 4M5ZH 1ISXA 3MRHA 3THCA 3F7YB 4U2YA 1WISA 3TV3L 2ED9A 3J8F7 4XRCB 4CGTA 3ZHDA 2R9HD 3WUZA 1U0QA 4PGEA 5A40E 5F71A 3B8SA 3M1BA 4Z7VA 4LOUD 4MJ5B 4XPFL 1Q6CA 3RCNA 3NZ8B 4FQ2L 4IM4A 3D5HA 3VW3H 5T1KB 5EBWB 3N15A 5CSYA 4BH7A 1AD0B 4KI5F 5B38G 4TVUA 2R1YB 4LK4A 5CKGA 1OCWH 1BVLA 1EDGA 4PMVA 4TQEL 1W1PA 2XA8H 3QEQD 5A95A 4PRHD 3LH2L 4X8JB 1P1ZA 4DCQA 2VXVH 3CZLA 5IEHA 2P8LA 4LBEA 4PJIF 5TJWK 3AFBA 3B9VA 1AXTH 5A6LA 4CBPA 4DK6A 1FPTH 4P5TB 4NDMB 1U8JA 2WCSA 4K94C 3SE4C 4K2UL 2C7FA 3VOCA 1KJ3H 1NCBL 3H9SD 1A7RH 1KYOK 3QFJD 3DX6A 1G6RL 3O2DA 4X6BA 2AK1L 1F8TH 4PJFE 4X99A 1KLFA 3MXVL 5D1ZD 4F15C 4ZO9A 4PYSA 1MCHA 3MSGA 5EZOH 2OL3L 3D87B 3HTLX 5DFVD 1RU9L 1KQZA 1U8OB 3TESA 5IR1B 4Z77B 4M6OL 1A3LL 5K9OA 4N0RA 3CX5J 4G8FA 2A3AA 2XWJB 4XNZC 3C9NB 4OBRA 4OIAA 3GMLA 4LCCB 4Y0GA 4ELKB 5M7QA 4HG4J 2UY2A 4QHUA 1R24A 2HT3C 4KTDL 1JGEB 1PG7X 2YLLA 5HHME 1CWYA 4L8BA 5EZLA 2PW2A 3CU7A 4HMDA 1W9DM 3LPPA 5LA0A 4HQQH 4MD5B 4OM1H 3QEQA 4R2GB 1YEJH 2VITA 1RZ8B 5ILTH 1IKFL 4CRPA 1MJ7L 3QRGL 3O9NA 2WMIA 4XGZA 1CD9B 2QSTA 1U33A 3RWHB 3DBXB 3K74B 4Y5XB 5EORL 1KWKA 5A2AA 2DSWA 1JHKL 3QFJA 3VWKB 2APVA 3TTSA 4F9LC 1VEMA 5C0CE 1BP3B 1TETL 3H42L 4XMPL 1ZA3B 4XV0A 1BM3L 5EOTA 3C60B 3DRTB 2MANA 4Y4FD 4Z95L 4XHQA 3GK8L 1HH9A 3WN5C 3OB0K 3I50L 5IHSA 2Y1VA 1H3XA 3UBXB 3PABB 1KCVH 2P7TA 3OGCB 3C5JB 5FDWB 1X4XA 2ZWZA 5D2LF 1YZZA 4JE4B 3MLRL 1LO2L 4QAWA 5CP7B 2H8PA 3SDAC 1YEDA 3DUHA 1HHHB 3KR3H 3MROB 2CERA 5L0QC 3KLAB 2YPVL 4HSQA 3ZDZF 1IGJA 4FHBD 1W0WB 4DGVL 3VFUA 1SMOA 3N9GL 4PJ5B 4YFLI 3IB4A 1WLHA 4JFPB 5BWFA 5BZWB 1T66C 3QG7H 5I6SA 3S5LG 1MAKA 1A6ZB 3GSWB 3QUYB 1EIBA 1T1YA 5BVPL 3HPLB 4U1GC 3VXUB 1H3PH 4ONFL 1CGUA 2NXYB 3IFPA 4W68A 4P4RB 4Z7UB 2VQ1A 4OZHA 5JXEC 4B5EA 5ITFB 2XG4A 3OMZA 4PJBA 2R8SL 1HJVA 3AHVA 3H6JA 3NCMA 4AZ8A 4CU6A 3W5MA 2ZX9A 3GZAA 3CLEH 2FDBP 3GMQB 4X98A 1WF5A 2D0GA 1KXQE 3K2UH 4ML4A 1MFCL 2IBBA 4Y4FA 2KDGA 1IKNC 5CEZL 4F9DA 1C1EH 4DW2H 1HL8A 3STBA 5D6DA 3NFNA 3NCYS 5JQHC 3N17A 3JUZA 5FGCB 4XCFL 2NY3D 3FFCD 4LKCA 5I1AB 1FORL 2ATPA 3OWEA 2XWTA 4L8SC 1MY5A 4EEEA 3L4VA 3GJFK 3OPZH 1T21B 2DLIA 2RAMA 2FX8H 2NY6D 4PJEB 5JW4N 1M7DB 3D3VA 4NQXB 3F12A 2AGJL 3VFOB 2DIEA 1G0CA 5CWSB 3C09B 3GXFA 4V2BA 4G6AD 2R2EA 4NOFA 3EHBD 4NKIL 4QCFA 3IDUA 2VDML 4XZUA 4GW4A 4GRWF 1LEIB 4JO1H 3QOKA 4XVSL 4PJXB 1FH8A 1RJYA 4D0BB 1TVBA 5MEPB 5GS0C 2VL5B 4JCMA 2DQCH 5T1KD 1CFSA 3O11B 4GAGH 4HH8A 2XOTA 3WSQH 4WGVB 5E1HB 3EMQA 5DYOA 4NCDA 2CJUH 1A3RH 2VXQH 3MXWL 1HNYA 2YBRB 3IS0X 3OKNA 4HPHA 1IEBB 2VNCA 1AH1A 32C2A 4GW1A 4CCCA 5ESQA 3DX8A 4M7KH 4P5TD 4L1DA 5EC2B 3SEPA 3GMRA 4V1DE 1VFOA 4QWWD 4GSDL 3A0OA 4W6YB 2Y07H 3MRLB 1UQZA 2J5LC 4LCWA 5CPSA 2Q7YA 2YRZA 1X7QA 2AKRA 3KJ4C 2MKWA 2OI9B 1SY6L 1TVPA 2LV4A 4PRIE 2C9AA 4H5SB 5CMAA 1A7BA 2EIDA 4PMRA 5JDJA 1DR9A 3BDBA 5H35B 3HC3H 5ESVA 1S8DB 2C1OB 2ADFH 2NY4C 1LP9A 2YEZB 1BLIA 4JVPA 5DMGC 4FG6C 2DTSA 1NLBH 2LQRA 1MJUH 4PRNA 3ARFA 3AY4A 3GSOB 1L6ZA 3SE9H 2VISA 3RHWK 4BSJA 5CIPB 2J78A 5SWSE 5T3ZL 3QUXB 1JMXA 5CSGA 1KB5B 2D7NA 5T1KA 1CGSH 4KUCF 3ILQC 2R1YA 3LKSB 2I5YL 3RL2A 3QWOB 2YK1L 3BKCH 3LKRA 4MLSA 5A2CA 3FO2A 4R2GD 5JIWA 2IEPA 5HYQB 2PETA 4YHOL 2DT2A 2EYTB 1A7NL 2F15A 3SBWC 3SDYH 1LEGB 3UC0L 3VGBA 4XVJL 3HAEA 3MLPA 3RO8A 3PJSB 5BO1L 5TDNB 1V0LA 4ZSOE 4KQ3H 3VWKD 3MA9H 3B4NA 2WWKT 3PGCA 4XCCL 4YXKH 4IJ3B 4GZIA 3CFIC 4Z0BL 3HE7C 2O93L 5AZEH 3VIKA 4UNUA 1NBQA 4S0TD 2RB8A 5D1QC 4L29A 1S78C 5ABDE 4E41B 1NUDA 1T04A 5HD8D 3RKDC 5ABGA 3MFFB 1UJ3A 4WV1C 1EGZA 1F4XH 1KJMA 4LCCA 3EBAA 3VFSB 5MP6L 3OJMB 4UT6H 3ROLB 3WJJC 4NKQB 2VKWA 5IJKA 5ID1A 4HWEH 4UR9A 4DKAA 4PJ5D 3TIEB 2H1PL 1AMYA 1FBIH 1CFTB 4MD5A 4ZYKA 1H9VA 3PDOA 4KJYB 3LV3B 4J4PD 4WCYL 2I9LB 1B88A 1H5BB 1WZ1L 1H3WM 3VXUD 1TJGL 3WIJA 5D5MF 1RZGA 1LWHA 1WWWX 5JOPE 1KGXA 4MVBC 1A7QL 3HC0A 3NA4A 4HIHA 3SKOA 4HUWA 4TVPE 5I1GH 4CDHA 3O6FD 2EDEA 3UJTH 1XGTB 4Y5XA 5HI5D 1MFBL 1BZ9A 4WVRA 3SJVB 4GOSA 1V8HA 5IT2L 2Y06L 4IOFD 1R3KB 5B3JE 1HK6A 1G0XA 5TQ0H 2F61A 2WMHA 4K9EH 3BO8B 2NX5A 2G4FA 2DSKA 4M62H 4D9LH 2CBJA 1T5WA 1ZT7B 5EFIB 3KPOB 2AI0L 1M7IA 5I78A 3VXPB 3RIKA 4ODHH 4DVRL 2VIRB 4CNIA 1J8HA 4JFYB 2APBA 2D7PA 5EUOE 3MMEA 2E4TA 2EPNA 3WEOA 5BOZG 4G3YH 3ULVD 3OF6A 3KLAA 1BHGA 2MTPA 3O4OB 1FHDA 3MREB 1KQYA 1GGTA 1I3RA 1IGTA 2W1NA 5F3BA 3QIBC 3LKOA 1OPGH 1FH5H 3MLTB 3U4AA 2AEPH 3CXHJ 4XC3H 4UQCA 3AAZA 4L4VD 4J2XA 5GGRA 5A6MA 2C7UB 4NZRL 1MCEA 4Z7UA 4FLRA 3RUGA 4Y16C 1GH7A 2WBWB 5A3IC 3OGVA 4NZDA 5D96C 3O6FA 4ELMF 1AY1L 3UMTA 2JFEX 3OJDA 4N9GA 1LEKB 5GRXG 3M6DA 1IGMH 4M00A 1UB6B 4B9ZA 2WC4A 2BVQA 1Y18B 4J6RH 1SYTA 4DWSD 4X7SL 2N4IA 4H8UA 3HJEA 1OM3L 2CMRL 5CQ1A 1AHWA 5MERA 3OBAA 3HA0A 4KVNL 5ID0A 2UY6A 4EDXB 1JRHI 1VSCA 3KHOA 1ZT4B 3GSQB 4YH6A 1PQZA 1RZ7H 1CG9A 3IJ9A 1HYRC 1QNRA 2UWEB 3EYFA 4PG2C 1JPFA 4QXTA 3G04B 1R87A 1ODAA 3RIAK 2HH0L 4CVZB 2VXUH 3KPQB 1I3VA 3SDDD 3WH5A 3LS4L 1OF2B 1T21A 3OKDA 4HV8B 1E4LA 3LZFH 4LLQA 1VFFA 4JDTL 4TTDD 4AZHA 3P4NA 3C5SA 1M7DA 3VFOA 3UBXG 1I9JH 3TH3T 4M3JA 3ES6B 4HU8A 3PNWB 3D18A 5L2KE 4L3CA 1SVCP 3MRDA 4PJ7E 3WIIH 4QP0A 2VLLB 1Q0YL 3QEGH 5CGYC 3BDYL 3RWGA 1EA9C 3KYKH 4L4VA 4Y19D 4M8UA 4DUWA 2GK0A 1TR1A 1UM6L 5AAWA 1FHGA 1FGVL 5FKPB 1KN2H 3NTCL 3UPAA 3IFOB 3V2AR 3HS0B 3DC0A 4ACZA 4IIQA 1Z9LA 2WVVA 4PBVC 2EECA 1B3WA 1KCRH 4IMLA 3BAKA 5DQDL 4M6MH 5J8OA 4DWSA 5DDHA 1IGFH 2XTJC 1JDAA 5IOPA 2CGRH 2QPUA 5JW4M 4XVUD 2Z92A 1YNTB 5ICXB 5D2NB 3U9PL 3IU3B 1QFWM 1Z5LA 5B4MD 1WKYA 4P2YA 4AY0A 3HZYA 2CPCA 4AH2B 4E42A 4QCIA 3SDDA 2EDWA 4WENB 4EOWH 4MJ6B 4ODSH 4J8RB 3CIQA 1CFNB 3KS0J 4KKLC 4XNZB 1GOKA 3EZ8A 5B39A 1XSJA 1WBZB 1KGCD 1JNEA 2ZXAA 1FDLH 2WWMD 3B43A 2XIBA 4APQA 4E41D 2GTZA 2D20A 4CADA 3BP7B 2EH7L 3HZVB 3IAPA 2DQTH 2DI8A 4M7JH 3SGDI 4ODVL 4GQRA 1JG9A 1KTRL 1MCCA 1T83A 4HF5H 4Y19A 2X4SA 1NANH 3M07A 2XM1A 4HIIA 4GLRI 2P42B 5M94B 4RWYL 2XT1B 3T2QA 4DAGL 2JIXB 1D5MB 1BQSA 2ITDB 3PL6A 4FTVB 1S7VB 1KXHA 4AENA 5I30L 5FYJU 3X11A 4PLJD 5DD1H 5HYJD 1P4IL 3L5XL 2BNQE 1UWUA 3APGA 3P4MA 3F5JA 5A69A 5F1KC 3ARVA 1VERA 3WFBL 4MNQA 1G7IA 4Y5YB 3SHSA 2QSCL 5AYBA 3U0TA 2DYPB 1I8LA 1O5DT 4RWHA 3C08L 1NGZB 3VXSD 2BRQA 5FYKH 4N0FA 1WVZA 1IGYB 4RAUB 3DSNA 5LBSH 1S9VB 5FCUH 3R8QA 5TDNA 1JWMB 1RK1A 5C2UB 2WHKA 2VLJA 1FQ9C 1YY9C 3TJEH 2H6PB 4D6FA 5DJDA 5DLMH 3SJVD 4F79A 3RVTC 1U93A 1DEDA 1OQXA 2G41A 5KVMC 4PRPB 3PGFH 4P9ML 3O45B 5BXPA 1A64A 1ONQA 4Y8DC 1T03H 3MUJA 4HZLB 5L7XH 2XKNA 5DJ8B 3SDAB 4R4NC 4Z76B 3EO0A 3CDCA 1UQSB 3MFFA 3AZTA 3J7HA 3NH7H 2IH3A 3QNZA 3LIZH 3WY1A 1FZOB 5C0AE 1H11A 2EH8L 4YHKL 1JNLL 5DJCB 3PWLB 5GRUH 2WNGA 4K23H 2IAMD 2Z8SA 2BERA 3G6AA 4PJXE 3EAKA 1DE4A 3MV8E 1HJQA 2R1XB 3L5HA 2P5WA 2EKSA 3D39B 1S3KL 3GBLA 4ZQKA 5F72S 5HYJA 4NZTH 4W5ZA 2NY5C 5D8ZA 4TTGA 2H32H 5CZXD 5FO8B 1W0YT 1MCNA 1U42A 1MOEA 3VXSA 3ULUL 3FO1B 3V6OE 1E6RA 3DTXB 2BV9A 3FO9B 2FX7L 1FE8L 1M71B 1XF2A 2VLMD 5A43C 2ZKHL 1N0XL 2FEEI 1DP0A 4AWEA 1OP5H 5HY9A 1U8MB 3A4AA 3HRZA 4ZPVA 1MF2L 3MMUA 3HMXA 5B22A 1IAIH 2R4SL 5DUBA 4AL8H 3D85D 4W89A 3BO8A 4ACYA 1A6VH 4Y1AB 1V6VA 5A2JH 4PBXA 5JW5B 1DBKL 5HYIA 4NJAL 2WW5A 4ISVB 5D7LD 4AEHL 3SUSA 1MY7A 4OCXL 3ZMRA 4KRNA 3SCMB 1AQKH 3V5DA 5IB1B 1JN6B 2DOCA 3BKJL 2E5EA 3FN3A 3PQYD 2LTQC 4HK3N 5A6JA 3RBGA 3Q5OA 3WXWH 2B5IC 4K8RD 4PJHA 4QRPD 4OGXH 4RMSA 2GUOA 3NAAL 4JFWA 4U1NA 3GJFB 5DR5L 2IAMA 4C58B 3O6AA 4AD2A 2IG2H 5HHOB 4LIQE 1VJZA 1JHLL 4AG4H 5D8JL 5ACMA 3QUML 2WAGA 4RGNB 4HPOL 1PEZA 4HJGA 1YEIH 2XFRA 1WDPA 3T4AA 5FF6A 5HDBF 5D7IF 1X5LA 3INUL 3V0WL 3OXSB 3KPRA 5DFWH 3G5XA 4XP9L 2J8GA 3LRHA 4L8DA 3K1DA 4S1RH 4ZUWA 4YHML 4MA3A 5EOQL 1WC7A 2RHEA 3DIFB 1OY3B 2VWEC 1R6VA 4C7DA 5M3WA 5ISZD 3D85A 1X5KA 2C3HA 8A3HA 1YMME 5CSZB 3BUTA 1J5OL 4MAUL 1ZVHA 5DJXA 3GSVA 2XFFA 2UWEA 4CD8A 4G6JH 2V5YA 5D7LA 1EQCA 2IADB 2VDQH 5CG0A 2XXMB 1G7HB 1GGYA 4JM4H 3GMMB 3PQYA 3TZVC 2WV3A 3BYTA 1T22A 4UINL 4XBEL 3F58H 3OAYH 3ZKQD 4QHMA 4QRPA 5DK0A 4GMTH 2HT3D 1DBBH 5ELIA 1ZLVH 1EAPA 5SWZB 1AGBB 4PY8I 1UB5A 2KQMA 2JJUA 4WWID 1TQBB 4Q6IB 4E0RA 4QRQB 4TX6A 4H1LB 5BVJB 4NQCB 1ITXA 4GUPA 2HFGH 3C6LC 4CN1A 2EDTA 4X0VA 3KPPA 2XGIA 3T0BA 3WHXA 5K9KB 4AM0A 4NHUB 3I02B 4HUVA 4MDIA 2ICWI 3E1F1 1JDDA 1AFVH 4U6VL 1AGFA 4RAHA 1OM0A 1NAKH 4K94H 5C0FB 3SCTA 3SE4A 2DPEA 4NO3B 1T1XB 1NGPH 4F2MA 3MLSL 1D6VL 5TE7H 5EMYA 4YDLB 5ISZA 1IQWL 3GXIA 5FDYA 1MCSA 4KKBC 4M7LT 3DV6A 3QQNA 4M02A 4LLVB 1RUQL 2BVDA 1CXHA 1T6WA 3EYUH 1QA9A 2G75B 1UH2A 3VIPA 4XPTL 1S9XA 2D9CA 5AZ2H 2IXVA 3OAZH 3PZOA 4UMGA 5DQ9A 2ADIA 1N59B 2JCCE 1RK0B 1K9FA 2GJJA 3T0AA 4L3EB 1E4XL 4LQFL 5ICYB 2EIEA 2HAZA 4R7DA 4JZ5A 3SDAD 1FCGA 4GBXB 2YDRA 1CZ1A 1DDHA 2C1PB 1C3FA 5CCKH 1Q94B 3HZVA 2IANE 1NDGB 3L3GB 4RIRB 3MV01 5GGVY 3E2HB 12E8H 1PKQE 1T66D 1H0IA 1B4JL 1KJVA 2FSEB 2XWEA 2BZDA 1JI1A 3SGEI 2W9DL 2ZUTA 3VM5A 4LGXA 3JWOL 3B9EA 4KPHH 2IALA 1TTUA 2VDPL 5JXED 4WUKH 4HLZH 1Q9KA 1I4FA 1MEXH 1UGNA 2QQQA 2YN5A 2WBJB 2B7DT 1MHPH 2ZWYA 4HPYH 1L0PA 4NM4H 2Z35B 4F9LA 4K7PY 1I1CA 1KIPA 3T0WA 4HUMB 1IGYA 1MWOA 1DN2A 4RAUA 4JFUA 1PY4A 1N26A 2JF1A 1OTUD 3N04A 1OAUH 1YMHA 1PZ5B 5DVMA 4GG6E 4JKLA 4RISL 4DGIH 4AZGA 5GJSH 3WN5A 4D71A 2BJMH 1BG9A 1FZKA 5F1OB 1JNNH 4NPYA 2VDKH 3QPQC 1AD9A 5JORB 3CSBA 2YSSB 4HMCA 4TTUA 4Y1AD 1V08A 3DARA 1U8LA 4O2EB 1CFQA 4U6YA 5DJ8A 5LGHL 3SDAA 3BKYH 3UESA 3FCTB 2OYPA 4M5YH 4C56B 2BVUA 2XYCA 2YR3A 4NP4H 2Y5TA 3EFDL 2ESVD 3SCMD 4KI5C 2YDSA 5F9AC 4F7CA 2D2OA 3QIUB 4UTFA 2M8XA 1M1SA 3R06A 4JZOA 4YX2L 5IV2A 1C8QA 1E6XM 4NC1E 3CUIA 5FUCC 1UEMA 1V5JA 4WEUD 5GNYA 2R69L 3L9RA 2CIKB 2DQJL 4Z2HA 3VD5A 5FYJE 4NN5C 1VADB 3LPWA 3C2AL 1HKLH 3T8XB 1KACB 3WFLA 5GS0D 5HHOD 4ODXB 3S96B 4EQ2A 1AE6L 3ALGA 2VC2L 4RGND 5T3XE 2F5BL 5JXEA 4MAYB 3EO1A 4I18B 4H8WL 4DVBB 5EB8A 4MHHG 2CDEB 1BVNP 1HZHL 1GZQB 2VX7A 3OR7A 3QJFA 4Z9KB 2OSLB 1T1ZA 3VGAC 4WHYH 3ZDXF 3SURA 5LG1A 3FO9A 4TN9A 1U2CA 1E6SM 1MJJA 1K9EA 3BEVA 3IJHB 3RNKB 4R97C 4HAGA 5DC9B 1TZGH 2DJUA 4Y4HB 4AYSA 1BPVA 1IKN<