4OBSA

Crystal structure of human alpha-l-iduronidase in the p212121 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
594
Chain Sequence
APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLAAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Crystal structure of human alpha-L-iduronidase in the P212121 form
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 194
structure length 594
sequence length 613
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2014-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4obsA03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4obsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4obsA02
4PJCE 2OYLA 1KTDA 4QY8A 2IBZX 1JGDA 4FXGA 4RMUA 5HY9B 2J7FA 4DWHA 4W93A 2DDQL 2X89D 4GAGH 4KQ3H 1BOGB 4Z7UA 4JFFA 3MYJB 1ZA3B 2K9UA 3EDKA 4OQTH 2Q86B 4EOWH 4WU7A 1KLFA 4XVSH 3VWKD 3O3EB 3WH8A 3QT2A 1QNRA 3FT2A 3GRWL 3LOWA 2VE6A 4M7JH 1SMOA 3QJFA 4KAQH 4PUBH 2H45A 1UUQA 3GSVB 3OZ9L 2B1HH 3TOPA 5HHQB 4PJHB 2RHEA 3CVIH 3NVQA 4YPJA 5CZXD 2R8SL 1YYLL 3NOIA 3BWUC 1PGRB 2GHWB 5TDNB 4OCWL 5C07E 1KTDB 3BH8B 1JGDB 4FXGB 1KCSL 4HIXL 1QYGH 1JNHA 1W9BM 4L4TE 3MLYL 2NTFA 1TLKA 1UM5L 3WNNA 4WU7B 4HOWA 2H26A 5D2LB 1KCRH 3ARVA 3QDAA 4NO3B 2AMGA 3FT2B 1MEXH 2OI9B 5KVMC 3D0VB 2WLZA 3MSPA 3MRRA 1AP2A 1FRGH 3MV7A 1E72M 1KFAH 4PBGA 2AOSA 4EXPX 5EA0L 1QR4A 3U46A 2NY7H 1X5JA 4LPXA 1J0HA 2PBGA 3JV5A 4JG0H 3RU8H 5KW9L 1T7ZA 2V17L 3G5VA 2EDFA 5BV7H 4UTAH 1MVUA 4FOMA 1JNHB 4W8AA 3V0VB 4LX4A 1S7WA 1LO2L 2NTFB 1I1RA 2NZIA 4Q6YA 2Z1SA 3DSNA 1DEEA 3AMCA 2H26B 4NQCD 4FTVE 2PKDA 5IHUL 3SKMA 1EUTA 3BMWA 2OL3A 4KQ4L 3SDDA 1N5AA 3ZDYE 4YGVA 5C86A 2VDMH 4NQEB 4U7SA 4U3AA 1MAJA 3SE4A 1F4WL 2GTZA 3MRRB 1AP2B 4BFIA 1N4XH 3RGHA 3OKMA 4GT7A 1VEPA 4R8WL 3SQOL 1IFHH 3U46B 3ZKNC 4HS8H 4GXVL 2IGFH 4DW2L 5C9KA 2I5YH 4M03A 1MCWW 4WFEE 5A6BD 1RZ7H 3CVHH 2X40A 4RAVA 5EIIA 3UROR 3CX2A 1JWUA 3NMEA 4JIEA 4AZGA 4Z76A 1MVUB 4TSBH 4P46D 5E2TH 2VZTA 2BRRL 2DMBA 4YHKH 3G6LA 4HU8A 1X5YA 1S7WB 1EHAA 1NGWB 2ZCLL 3QHFL 1VPOH 2ZG2A 1RUQH 2NX5D 1NM9A 1GZJA 4M8VA 4GAJL 3SKMB 5EORH 1E4NA 2OL3B 3SDDB 1N5AB 4NP4L 4YGVB 3GZAA 4KPHH 3KYMA 4XVJH 2WP3O 4BFIB 3W5NA 1I9EA 4ZFMA 3OKMB 3MRBB 3BAKA 2YL9A 5IT2H 5FOBA 1SY6L 4PRPD 3FQUB 1RVFH 1QZ1A 4QRPD 5JDSA 4PMZA 4JZJC 4LHJB 5I1IH 1XR9A 4RAVB 5EIIB 3TBWA 1JWUB 5I8CA 2D22A 3R1GH 4AJ0A 4Z76B 2IUZA 1JTTA 4NO0D 4WO4D 2B0SL 5C3TA 3VXRA 1QD0A 1FOBA 1TVHA 1DWFM 1A6PA 4J23A 3C8KA 3RGVC 1F42A 1T2QL 4NSKA 3IU3A 1BX2A 4EI5C 1JXKA 4JZOB 3VFWB 3HMCA 4JFPA 3KYMB 5L7XL 3CPLA 4HXAL 1TJIH 1H3PL 5GISH 4CBPA 1BD2B 5HYSA 5FYKL 2DOCA 3SGKC 3TWCH 4IOFC 4TRPH 4U6HA 5CUSH 5FOBB 1HXJA 2W62A 5HDRA 3TNMA 3V4VL 1QLEL 3D3VD 4XMKL 5TQ2H 2R0LL 3N17A 2J5LC 1QNOA 3FFDA 1BGXH 4DGYH 3WBAA 2YPVL 4BQ5A 1FFNA 4PJ9C 5DMKA 2ADIA 3TBWB 2DDQH 1MAML 4KDTA 4AD5A 3QP3A 2WUBL 4RBPH 3PWJA 5FCSH 3WUFA 2AQ3A 2AKRA 2J7HA 1ACYL 2ZE0A 4D0CA 3VXRB 2PNDA 1TVHB 3INUH 4ZO6A 3C8KB 1NWUA 4AH2A 4YDIL 2BNQD 4NSKB 3IU3B 1BX2B 4JJHA 4LRNL 5IQ9A 1HNYA 4QRTA 3NFPA 1XV8A 2R4SH 5FUCC 3CPLB 4URTB 2XTJB 4M00A 4S2SB 3OZ9H 4R5EA 5ABGA 1Y18A 5HYSB 2IQ9L 3ALXA 1QNZL 2BERA 1SVZA 2ARWA 4P8UA 3BE1L 3TNMB 3QUZD 3TO4C 1T66D 3ZE0F 1YYLH 4J7RA 2NXYB 2VR5A 4Z2GA 3FFDB 4OCWH 2DSUA 5F96H 2IQAA 2ENYA 1FFNB 4HIXH 5DMKB 1KCSH 2ADIB 1XRVA 2NY6C 2CHNA 3WYRA 2A83A 3MLYH 5AC5A 1UM5H 3ZTJG 1F45A 3PWJB 1QPKA 3AHVA 2NXZD 1TA3A 2BX5A 2AKRB 2B31A 4PSRA 5MEND 4D0CB 3SCNA 1TZIA 1AXTL 2W66A 2IBBA 3WJJA 3WL1A 1QRKA 3NIDF 4LOUC 4AH2B 4Z7WB 1FPTH 1C12A 4IBLT 4KHTH 4FMVA 3RDTB 2E6PA 4GH7B 4Q9BA 5IQ9B 3AIUA 1QRNE 4NRYB 1V6VA 4QRTB 1NOWA 4GI9A 1YMHB 2UWEF 4QRSA 5EA0H 3LH2L 1FZOA 2ZCHL 3HC0A 4NQDA 1Y18B 3GHBL 2GJPA 1ZT4B 1FP5A 1G7QB 4OLZL 4MDJB 4MX7A 3VXPA 2XSBA 2N56A 5E08H 4KDVA 1CDJA 1IAKA 5TPWL 5AG9A 1NFDA 2V17H 3UDWC 1SJEB 5DEZA 2D9QB 3PGCB 3DYPA 1VB9A 1LO2H 3RJQB 4X7TA 2JEQA 3EFFA 1NGXA 2WBJC 4JQXA 1KC5H 4UIMA 1TA3B 1DP0A 4MNGA 2XIIA 5IHUH 2QV2A 5A95A 2VQ1A 3MLUL 4KQ4H 4JGUA 1NMCB 4NFCA 1C12B 1J05B 1F4WH 1ZWIA 2PYFA 4P5TD 1P6AB 5BRZD 5C6WH 5T3XE 1ZLUH 4R8WH 2V5YA 4QRSB 4NQDB 3MOQA 3PZOA 1O7SA 4QTHA 3ARTA 1WITA 3LB6C 5BS0A 2Z93A 1G6RB 4JRXA 4PUDA 2G3JA 3VXPB 2YUXA 3D1MC 4M6AA 1IAKB 4OAWA 5E4IA 1NFDB 2GT9A 1HCVA 1PBYA 3UYOD 2E3ZA 2BRRH 5F1OB 4G7YL 2ZCLH 3QHFH 3Q48A 2R1YA 4LEOB 4X7TB 4XPTL 3EFFB 1X7QA 3WIHA 4UIMB 2LU7A 2EC9U 3HE7C 2PO6C 4Y2DA 4P3WA 4GAJH 3SCRA 2EIDA 2VQ1B 4AG4L 4PBVC 4NP4H 5T1KA 3VH8G 3C8HA 4OLWL 6A3HA 2PYFB 4QHLB 1DWGM 3APGA 2DLFL 4MA3A 5D7IA 4OD3H 3RIFF 1FGVL 1JDCA 1OCWH 3GSUA 4QTHB 1T0PB 5BS0B 8A3HA 2Z93B 2D23A 1KR1A 3ZL4L 5D9PA 3UBXB 2C1PB 5DZOA 2HP4A 4NHCL 2GT9B 5CJ8A 2ZICA 3AC0A 3QUXD 5IESL 4Z6AT 4HSQA 5EBGA 1P7QD 1EBPA 2W61A 1F90L 1EAPB 3QFJE 1X7QB 3KPMA 1PIFA 5FIEA 3TTSA 3S6CA 3RKPA 1U3HC 3MO1A 4P4KB 4Y2DB 3HAEA 1DEDA 5TD4A 5HDLA 5EOTA 1T2QH 4QRRE 4DFHA 5T1KB 1DQQB 1AGBA 5L7XH 4Z7VF 1NBYA 4KJPC 3WV0A 1N59A 4NCC2 5HI5D 1UCBL 4L8DA 1H3PH 2NY4C 4MA3B 5IG7A 4HC1A 2VDOL 5E5UB 1MWAL 5E2VL 5FYKH 3ZJ6A 4OT1H 1X5AA 1QLEH 4KK9D 2VN4A 5HI4C 4XMKH 1UB5A 2R0LH 2FRGP 2VC2H 2NPLX 4HWZA 4J1UA 3VGHA 1PG7W 1R3KA 2IAMD 4KK8D 2P44B 4HZLA 2XNAA 1MAMH 1OM3H 2EDDA 3DOSA 1FH5H 3MGAA 1JDAA 2WUBH 4JPIA 4WTXA 2V3FA 4NM4L 2YUWA 3QUYC 4P2YA 3QHMA 2J47A 5KVGH 3HAEB 1S7RA 5DD3L 4YDIH 3CSYB 4HKBA 5EOTB 3NN8A 4LRNH 4GLRH 4Y4HC 1AGBB 3RTQC 1NBYB 8FABA 1N59B 2IPUK 4L8DB 2IQ9H 1QNZH 5SWQB 3PHAA 5FUZL 5IB1B 1TPXB 3BE1H 4Z7UE 5D5MA 4JFFE 4D3CL 3SDAD 1UB5B 5KSUB 4HWZB 1MI5A 4J1UB 1KELL 2RGMA 4PJ5B 5HHNA 1NCTA 1R3KB 1MHCB 3IXAA 4JZNA 1FVDA 2XNAB 1CK0L 1BZ7A 1MF2H 2EC8A 3O81A 4TTUA 4JPIB 5GHWL 4LFHD 3G5XA 1NGYA 2OXGA 3W26A 4P2QA 4ONOA 4XBPB 4WHDA 1RU9L 1VEOA 3K46A 3ZT5A 2VWEE 1MFCL 1AXTH 1QSEA 4MAYA 2P5EA 2LABA 3FN9A 1O5DT 2GUOB 3K80A 4HKBB 1B2WH 3SDCC 3NN8B 3QXAA 5I6XC 5F7DA 1S9XA 4HH9B 3TBSA 3CZKA 8FABB 3LH2H 5CGYD 2ZCHH 4Q9QL 3BFOA 3QWOA 3GHBH 2ZUQC 4GZJA 2EDBA 5C07D 5DQDL 5BV7B 2VLJD 1N6UA 5D5MB 3QSKB 4MVBD 5CGMA 1OHQA 5C0EB 2OWWA 3SE3A 1MI5B 3VO0A 1HINL 3OF6D 5TPWH 2PXYC 1KJ2L 1SYSA 2FL5A 2DAVA 1XF4A 3IXAB 4JZNB 4N5ED 4N68A 3VFNA 1OD0A 3CUFA 3PZGA 1CGXA 2OSLA 2NQCA 3VXSA 1YEGL 4GI8A 1Q4NX 4WY7L 5GSVA 3MV7E 3ECBA 2X4RA 5DD0L 4AXNA 4XHJC 5D7SL 3G5XB 1MAKA 1NGYB 4P2QB 5TFSL 2D3VA 2DJUA 4WWKC 1UCTA 1YEDA 3AAZB 2D4FA 4UT7L 5J0BA 3O6FC 3O4OB 4PJIA 4C83A 3TF7C 2FHFA 1RULH 1J1PL 2ORBL 1ZT7A 1S9XB 2UUDK 2WMHA 3W9DB 1PEWA 5HVHB 4ZS7L 3VKKA 5FYJL 4PJHF 5DA4A 3CVHB 5J6HA 4RGND 3PP4H 2HMIC 4MNQA 4NPYA 5JIHA 3X12A 3O41A 4F7PA 3AREC 1E4MM 4QHKJ 4APQB 1SYSB 2FL5B 3I2CL 1XF4B 5C71A 3VFNB 3BPCA 3RBGA 2OSLB 3VXSB 1K5NA 3L5HA 1H1NA 2QADD 4G7YH 3EDJA 4XPTH 3WS6A 1T0MA 5GSVB 1SR0A 2PTTA 2X4UB 3ECBB 2X4RB 3DI2B 5D2LF 1CENA 4BUGA 4BZ2L 1YEDB 4OI9A 4AG4H 1BYDA 1DN2A 3L95A 2WINA 3G9AB 4OLWH 4DKFL 4C83B 3QULA 1GVYA 1ZT7B 1OAQL 2DLFH 1RIUL 2C4FT 4I0PA 3UTPE 2YD9A 4WFED 1FGVH 3QCVL 2NT0A 4YK4C 3EO0A 1EXPA 3WEZA 2HRPL 4MNQB 4NPYB 5IMMA 2APBA 3CFIC 5CD3A 3X12B 3KNBA 2VR4A 3O41B 2OWCA 4M1CD 1A3QA 2ATKA 4F7PB 3BMVA 1JMZA 1HL9A 3BPCB 3FB6A 5IESH 1K5NB 4S0TD 2LVEA 1FQ9C 1HN1A 3TN0C 1E6JL 1T0MB 2EDKA 4NBXB 2PTTB 1AD9A 4YHIA 6FABH 4HX1B 4PMXA 1U8PA 2R23A 3GTNA 4Z95L 3LMYA 5I24A 2OTUA 2VUOA 3NCFB 5EFDA 3L95B 2WINB 4AM0A 4TOYH 2VRQA 3D18A 3STLA 1CIUA 3QULB 2XICA 1YMMA 1UCBH 4G43A 3U57A 4LVNC 2BHYA 2VDOH 1MWAH 4RGMC 1G6VK 1M05B 1ORSA 3OB0K 4PJFA 3UX9B 3GK8H 4JFHE 5EUKA 4RDQF 3UESA 4X8XA 1OP3K 1JMXA 3KNBB 1AJ7H 2OM5A 4LSUL 5EH1A 1PPIA 2ATKB 1E15A 5E00A 4N0CC 4FQLL 4N0UB 3T77A 5FKYA 5HPMA 5BVJA 3MODL 2VKXA 2F61A 5DLML 4WUKH 2ESCA 4NUGH 1HZHL 3BT2L 4NM4H 5BO1H 5M03A 2OYMA 1AD9B 4W6XB 3K2UL 1YEFH 3GSRA 1IL1B 2R23B 5DD3H 2FSEA 1L6ZA 2OTUB 1N82A 3KYKL 5JNYA 1MIMH 3A6CL 1LL7A 4AM0B 3P3YA 3D18B 3STLB 1S9WA 4RMTA 1XH3A 2EDTA 5D7KE 5A2IH 1YMMB 2R1XA 1YEEH 4FP8L 3MRDA 4M43L 1OTSD 5FUZH 1ORSB 5ECUA 4LKCA 4PJFB 3AXLB 4CKVX 5A94A 4D3CH 4PYSA 5CBAA 1ONQA 1A8JH 5EUKB 1V6YA 1LQ0A 4PMVA 3VOCA 2VDPL 3GYCA 1KELH 1KCUL 2PYEA 3C6LC 4QP0A 2DSZA 5E00B 3ZE1F 3EDDA 3F58L 3T77B 3DNKA 5KS9A 5BVJB 4LVOB 4OZIB 5C0BD 1OAZL 1W1TA 2DL9A 3C08L 2EO9A 4P7NA 3MJ6A 1RU9H 1NMBL 1MFCH 3GSRB 4DFIA 3AHTA 3ARRA 3N50A 3VWJC 2WC4A 3JTTA 4KUCF 4Z7NE 5JNYB 1UJ3A 3HZVA 2JCCB 4G8IA 1GXEA 1CU4L 3IDJA 4AIZB 1S9WB 2EH8L 2NY1B 1CTNA 5ID1A 2R1XB 4Q9QH 3O3DA 4LKCB 5DQDH 1UKQA 4WF7A 2XVGA 4M61B 4Z8FL 5CBAB 1ONQB 2MHAA 3L1OH 1RIHL 1HINH 1GNXA 4OUUA 1R0AL 3O9WC 1KJ2H 3QG6A 1HL8A 3CMOH 1YEGH 4TTDD 4WY7H 2WMKA 1ZGLM 2J1KA 2DMKA 3G08A 5DD0H 4U1IA 5D7SH 4MS8C 1NBZA 1EK3A 2JIXD 3ILPA 5TFSH 1MCRA 3MMEA 3QIUC 4NKQB 5L2JA 4NQDE 1OW0A 2MKWA 4UT7H 4WU5A 3PTKA 1PEZA 3PE9A 2ORBH 1J1PH 1UJ3B 3HZVB 3RJYA 3PGFL 5IIEA 1GC1C 1UKTA 3IDJB 2XACC 1NFDE 3VRLF 5GS2H 5ID1B 5FYJH 2Y24A 1R7AA 4LLAA 3FCTA 3O3DB 5HD8D 4I1NB 2ADGA 1B31A 2CR3A 1T2XA 1F11A 5ICZA 4MNGE 5DRZA 1RQ5A 4OUUB 5MHSE 5D72L 3I2CH 1GC1L 1JGUH 1WFOA 3QG6B 4L4VA 3UR7A 2R29L 1A4KA 5FDWB 2VIRB 4G9FA 5GGTA 3ILPB 3MMEB 1LEKB 5L2JB 4CADB 5CZVH 5T3XD 4PJDA 4Z7WF 5CEYA 5BS0E 12E8L 1NLBL 1ZMYA 4JRXE 4DKFH 3BDYL 1CN4A 1OAQH 3VXUD 5IIEB 15C8L 1IJ9A 3QCVH 1WWAX 3FCTB 2HRPH 2ADGB 2UY6A 5IVZA 1YEHH 3MNVB 1XGZA 4UDTA 3VUPA 2XWJA 3IFPB 3OL2A 3HR5A 1F11B 4P3CH 5ICZB 1F2QA 3WO3B 3TESA 2J8UE 1IGJB 2CDFA 3FONA 4G8GA 4RE3A 5DMJB 4L4VB 4JZJB 4HUMB 3G6DH 1A4KB 3D85A 1OM0A 1E6JH 3C6SA 2UYLA 1HH9A 1ZS2A 1K3ZA 4F7TA 1INQA 4WKHA 5D7IE 4K7PY 4M1DL 4Z95H 2P48B 4PJDB 3CUGA 4UQEA 4EAMA 5CEYB 5FK9A 3HKFA 4AEFA 1EZVX 3POHA 5BVPL 3UYRL 2NY0B 1ZHLA 2ICWA 5GGQL 1GPOL 2JIWA 4HA1A 3MJ9A 2NW3A 5I0DA 5JIKA 2QHRL 4UDTB 4XH2A 4LSUH 4NWUL 3HR5B 3KJ4B 4O58L 4PMUA 4EVNB 1PZUB 3QFJD 2J5LB 4FQLH 3FONB 4G8GB 4M1GH 5ABFA 4XCFL 1JZ2A 1X44A 5DLMH 3D85B 1HZHH 3BT2H 3C6SB 1HH9B 4QRRD 4X6DB 4R7NB 4F7TB 5IFJA 3UAJC 1INQB 3K2UH 4ZQKA 2Y5TB 5DT1L 3JWDC 5CILL 5BWFA 1VDGA 3KYKH 2QV4A 3A6CH 3LRSA 3PP3K 5FK9B 4X9FA 2GFBB 3QXUA 1W72L 5INCB 4Y88A 4NOFA 3HPLA 3CX5J 4C4KT 1QSZA 4FP8H 4L8SA 1JBJA 3SE9H 4M43H 3DUSA 4KKAD 1ZHLB 4E41A 2E7MA 2UV3A 5FKPA 2XA3A 4MQXC 3JWDL 4JN1L 3EJYD 1G1CA 2VDPH 1CD1B 4UOQA 4P48A 4HPHA 3RY5A 2VC9A 2QSCL 5K9JH 4NN7C 3TO4B 4LSPL 1D5XA 3F58H 4ODWA 3OR7B 1JHLL 1RIVL 5ABFB 1CXLA 2ZX9A 1OAZH 4FFWC 2VMFA 4OIBA 1WBZA 2GSIA 4MCYA 4PRNA 4X6CB 2W0KA 1NMBH 3R0MA 4ZQKB 1MIEL 3BWAB 3ZIZA 5D5ME 3CLWA 1UGNA 4X7FC 4XC3L 3RFZC 1MI5E 3CCHA 3LRSB 4P8VA 1CU4H 1I7RA 2CLZA 3MV9A 3VFTA 2YL6A 2EH8H 4QXUL 4F9LA 4HA3A 3ES6A 4O4YH 5IF0A 5ABEA 3DUSB 3QB7C 4E41B 1I8KA 4A3YA 4AK1A 4Z8FH 5EZLA 1RIHH 3N1MC 4P2QE 2NR6C 5EBAA 5FA3A 5C0FA 1MCPL 2ZUYA 1FNAA 1R0AH 2DLTA 1OF2A 1QSEE 2P5EE 1JRHI 1D5XB 4ODWB 1P7KB 5CLTA 2COQA 3VJ6A 2QF8A 3TBVA 1WBZB 3OPZH 4O51A 2GSIB 2XA8L 4HUKB 1H11A 3VG0H 1MW1A 3AS0A 3WH9A 4LQFH 1BBDH 2D7MA 5E2JA 4NJ9L 4P59L 4B50A 2F19L 1WZMA 3PGFH 1V0NA 3CCHB 3SDXB 2VX7A 1I7RB 2CLZB 3CLFL 3VFTB 5JIIA 3G5YA 3EYUH 4HUVA 3ES6B 4L3CA 1TTFA 4K3DL 1CIDA 5IF0B 3VXSE 2YOCA 1KNOA 1UYWL 4PJEB 4MAUL 4KRNA 4PFEA 3EZ8A 1G0YR 5EZLB 1MRCH 4MB3A 4NQED 4XRCB 5FA3B 2ICEB 5C0FB 4CD4A 1W3JA 1MVYA 1GC1H 3GSWB 2R29H 2YD7A 4OGAC 4PJIE 3W53A 1XR8A 1M4KA 1E4KA 3TBVB 3AIBA 3T65B 4O51B 5DQ9A 2HTLD 2WM0A 1B4RA 3HNSL 4HPGA 2QMKA 4MNQE 12E8H 4WHTA 5AAWA 4GQ9L 1GGIL 1T4KB 3BDYH 5CSZA 1GOGA 5F7YC 3NPSB 2R2HA 15C8H 2EE9A 4EKJA 4HUVB 3G5YB 1E6OL 1O7VA 4L3CB 1GAFL 4MLIA 3K8KA 2PW2A 3VMPA 1GSMA 3SDDD 4XI5D 1VIWA 4EZMA 3BKCL 2X09A 4OCRH 2XRAL 5EUOA 5F9OL 2FNBA 2EXWD 4HIJA 3U30C 3BQUC 2GSJA 4GIAA 1E28B 1NQBA 4KKBD 1XR8B 3PTMA 1MOEA 4KKCC 1FCGA 2AGJL 4UCFA 1Q1JL 2DF3A 5DQ9B 4C7DA 4M1DH 1DZBA 3VXOA 5DMYA 4UZSA 2VXTH 1XGQB 2B7DT 5M17A 3UTPD 4X7SL 2RCSL 1KIQA 3E3QE 4JHAH 5AY7A 4K7PH 4GKSB 3UYRH 3I75A 4ENEC 3P0YL 4XNUL 3AM8C 5GGQH 3U4AA 1GPOH 2PW2B 4FQ2L 2NY4B 2X4OA 2DQCL 1FO0L 1BF2A 1WEJH 3MOAL 4XZWA 4H41A 4O58H 1ZANL 1W9VA 3GHEH 1NUFA 1NDMA 4JGJA 4XB7A 3TNNA 1BD2D 4HIJB 4IRJC 5IBUG 4UNVA 1NFIA 4XCFH 3WNPA 2BY1A 1F97A 5GGUA 4JG1L 4Q2ZB 1UZ4A 1YMME 4F15B 5IMKA 2BJML 5EBWA 3MUGA 2VL5A 4R26L 5L2KA 4PGCA 5DT1H 4PJFE 5CILH 3VXOB 2AJZA 2V38A 1KIQB 2WWKO 1DE4B 1W72H 3W11C 4JFHD 2HRLA 3CZEA 1WJ3A 5L0QC 3I75B 1QSFB 3WHE1 3VXRD 2R69H 5F7EL 4GKNA 4P7LA 3JWDH 4JN1H 4DZBA 3EYFB 2XGIA 5E24E 1A4JA 5EB9A 1LO3H 4GRLA 4LSPH 2XTJD 3TNNB 2A6KB 4QYOB 2CBVA 1JHLH 3N9GH 3K7UA 1NFIB 2CETA 3AZRA 5GGUB 4UTBH 1BQLL 4FG6D 3AMKA 3EO9L 5IMKB 4HJJL 2NXYD 3MUGB 1J12A 2VL5B 2OJEA 5EBWB 5L2KB 4PGCB 3A67L 5D7KD 4ZE5A 5F21B 2AJZB 4XC3H 3TA3A 1EFQA 3PZUA 3IAPA 3GUTA 3EYQD 4WCYL 1KIUA 2PYEE 5JO5A 5I6XB 2ARJQ 5KS9E 2CJUL 4GKNB 5DZLA 3RVTC 5CEZL 4DZBB 1KPVA 2WNWA 1FIGL 1F4HA 1MCPH 3RDTD 2F5AH 1A4JB 4PJ7F 4JM4L 1UKOA 2B5IC 4YX2L 3R06A 1NEZG 3DWTA 5ESQA 3UERA 2VCBA 2HVJA 2XA8H 3OJ2C 4Y7MA 1UWUA 3OTTA 3IGAB 1OIFA 2OJEB 3VM7A 2EKSA 5C0ND 4P59H 1BHGA 4XVUD 3VGGA 3GNRA 2F19H 1A7QH 3TA3B 3JVGA 3CLFH 3KE0A 3GUTB 2X1WL 3O6FB 3HUJA 3ZE2E 3PZQA 4U1GC 1T03L 1UYWH 2E4TA 3AIQA 4MAUH 1DBBL 1T20A 1KPVB 4OZFG 5A8OA 1LL4A 1RZIB 1N5YL 4IJ3B 1P84J 4O2CA 4OZIF 4NQDD 1VFBA 3R06B 3LQAC 4QLJA 5GGRY 3L3HA 2WSKA 3OGCA 1ETZB 1JFHA 3UTTA 1C8PA 5GRUH 4KJQD 4GINA 3AZSA 2EKSB 1URLA 4CU6A 1R6VA 2JCCF 4GQ9H 1JRHL 1GGIH 3UZVB 4H8VA 2I26N 3M7SA 4MJ4A 3LQAL 4LLMA 5TE7H 1BYAA 4OJFL 1FHDA 4P8XA 3HUJB 4MNHB 1IGTA 4OTXL 1H3UA 3QDJA 2ZUUA 4L4VE 4X6FA 3LPFA 2CXGA 1U91A 1GOKA 5DGRA 2X1PA 1FN4A 3BKCH 4RA0C 2YKKA 4M56A 1LO5A 1E6SM 1XAUA 4G9FE 1T20B 4MSWA 3TJEL 2EE3A 2XRAH 5F9OH 3W81A 1VGEL 3DGGB 4PJDE 2VAAA 5IB2A 4O2CB 2OS7A 5B3JE 3QNYA 1MLCA 4OKDA 4GSDL 4PGDA 5BS0D 1KTRL 4X4YA 1E6XM 2AGJH 1L4IA 4AIOA 3ZHDA 4IRSA 4LMQE 2Y6SD 3UP1A 4F33B 1NWSA 2RCSH 1TNMA 3BO8A 5JXEC 1HP5A 3WH7A 2GDUA 4G80A 4W7VA 1EEYA 3LIZL 3SIMA 2LE9A 1SYVA 3LS5L 3MUAA 4HK0B 1OPGL 4XNUH 1SJVA 1HK6A 2XWEA 2X10A 1IGTB 5E99L 5GQBA 3QDJB 4X6FB 4P4KD 4Y2DD 5D1ZA 4FQ2H 3RWCA 1WFUA 5GZOC 3LKNA 3BYYA 3WEOA 1U91B 1ZK9A 1FO0H 1CL7I 4NQXA 1UH2A 1FN4B 5T1KD 4EK7A 2FGWL 3MOAH 2CGRH 1BSIA 1AKJA 1ZANH 1ODZA 3W37A 4PGEB 4PJBA 5E2UL 5FM8A 1BQHA 1R3JA 4ELKA 2VAAB 5IB2B 3GMPA 1GJWA 5T1LB 4GXUN 4JG1H 1MLCB 4ODHH 3K4AA 3DC0A 4PGDB 2GTWA 3DMMC 2BJMH 4X4YB 5EO9A 4MPKA 4IRSB 5GS0C 1V7NL 2IADA 1T7WA 1NKOA 5J12C 3BSGA 5T33L 1W0WA 1AC6A 3BO8B 3OKLB 3A0OA 3N1GC 4I0KA 1EEYB 3EMQA 1SYVB 5DHVA 4PG9A 3AY4C 5F7EH 4YXHL 1R87A 3ZKSD 3PABA 1UA7A 1LEGA 5GS0L 5D1ZB 3RWCB 3LKNB 3ELAT 3IETA 4PMQA 1LG2A 4AIXA 1AKJB 2NZ9D 4NN6C 3TONA 1E70M 3WF4A 1AGEA 3MR9A 3K8MA 1R3JB 3QEQA 4ELKB 1IC4L 1EA9C 1ZLSL 4PD4K 4TVPL 3GMPB 3O9WA 5DHXB 4F66A 3S2CA 1V6WA 5I6SA 1BQLH 3SQBA 1JP5A 2GTWB 3EO9H 1CFSB 4UT9L 1HE7A 4HJJH 1JNEA 3MX0A 4JQIL 5EO9B 2D31A 4PJ5D 1KOAA 4LF3B 3A67H 4LCYA 2IADB 4E41E 4PGJA 5CXPA 3LDBC 3WQ8A 4GKZA 4UQ2B 1IT9L 3FRPG 4L9LC 3D25A 4WCYH 5D8WA 1C90A 3MGOB 1BWWA 2CJUH 1LEGB 4LNRB 3UCQA 3PWNA 2A3AA 1NJ9A 1FIGH 1UZ8A 4F3FA 4P99A 1HQ4B 2F9BT 5IJVA 3T0XA 2J7EA 4ONFL 1JZ7A 3MR9B 1AGEB 3QEQB 2XN9A 4WK9A 2WCGA 2J74A 1X9QA 3O9WB 4X6DF 3MV9E 1XIWC 1MI5D 4MWFA 2OLDA 2DKMA 1AO7A 4QLLA 1XF2A 1JZ8A 2FB4L 4CU7A 4GKZB 4OV6F 4YWGL 1YECL 5MP6L 1EDQA 1NGZA 3D25B 3LV3A 1A02N 3MU7A 3JV4B 4P2QD 1X4ZA 4DN3L 1C92A 1JI2A 4NKMA 3AMGA 3V8OA 1T03H 5IV2A 5JBDA 4OOUA 1CXIA 3PWNB 4TNWF 3AHZA 4FQCL 1NJ9B 4TN9A 1UZ8B 4F3FB 2PW1B 1YDPA 3SURA 1F3DH 5D4QA 1N5YH 5D96C 3MS8A 2A9NH 2G3MA 3Q5OA 4OJYA 2XN9B 3RBSA 5LA0A 2O5XL 4X6CF 2A6JA 4Y19A 1OQXA 4KVCL 2FDBP 1W32A 3NUKA 4X98B 5JR1L 4HLJA 4MWFB 4KHXL 1XF2B 4APQD 1CGYA 2YPLB 5DEGB 1JRHH 3VXSD 5HDBF 5F3HA 3BKMH 1NGZB 3BVNA 4MMXC 4OJFH 1BIIB 4OTXH 4HLZG 4PJXF 4NKMB 3ZKQD 1B6DA 2P8MA 5IV2B 2VLME 4WW2A 3CFKA 2WANA 2FJGA 3TJEH 1ZEAL 1G0XA 4Q58C 2V2WA 1VGEH 5CZXC 4CD5A 2ZCKL 5B38G 3MA7B 1EJOH 2HG5A 2W9DL 3IVKA 3ARBA 4GSDH 4LCCA 4XAWH 5SWSB 5FEBA 2CDGA 1AIFA 4MNQD 2HJLA 1MHHA 2A6JB 4Y19B 3U0WL 4KKNA 1QI2A 1QFWI 3FB8B 5GRXG 2ZUTA 2WQRA 3O8XC 3QCTL 3GZKA 1WCGA 5GJSL 5FHBL 3SDXF 1LILA 4AT6A 3LIZH 1BAGA 3LS5H 4LU5L 5F3HB 1KB5L 5SV3A 5EUOE 1OPGH 3BVNB 5E99H 4PJEF 3FB7A 2FGLA 2P8MB 3LKRB 1YN6A 4WW2B 3U4EA 3KLHD 3CFKB 1KIPA 2FGWH 3MRPA 5TGBA 5IW3A 4OCXL 3W28A 3ZYIA 1CR9L 2V2WB 5E2UH 1IVLA 5A2JH 2F8QA 1CG9B 2HVKA 3EMCA 3UPCA 1MCLA 4LLQB 3IVKB 4JPVL 1I4FA 4LCCB 4XNQA 2ZWZA 3L3JA 1OT1A 2CDGB 1MHHB 4ACZA 3P2TA 3IYLW 1V7NH 1JGIA 2Q1EA 2VQUA 4HQQL 5T33H 4NN5C 1MXGA 2GY7B 4O02H 5ENWB 2D0HA 1KXVA 4AT6B 1VJZA 4WI9A 1ERNA 1AVAA 4HU0A 5EOCJ 3VIPA 3W27A 3WEMA 2YD2A 4ZODA 5GS0H 2JB5L 1UXSA 2PTVA 3QG7H 3TVMC 3U4EB 1KIPB 3MRPB 5TGBB 1ES0A 4Y4FA 5L2KE 5B39G 3SPVB 2V6HA 3ZZ1A 1YMMD 5GPRA 2HT2D 4PJAF 2B4CH 3NCEB 1ZLSH 2E7LA 2KL6A 2HVKB 4GG8B 3DV6A 4NN7B 2HT4D 1I4FB 5HSFA 4XNQB 3L3JB 4UT9H 1CGVA 4P46C 4IMLB 4QRUA 3T1FA 5LYRA 3RWEA 4HZ8A 3C5ZA 1FH8A 4WDIA 5A40E 1ORQB 4MAZA 5B22A 4AD2A 2Y4SA 1XCTA 1ESWA 1QLRA 1VENA 5BZWA 1C16A 1CWVA 2O61A 2EIZA 1H0DA 5FYLE 2DT2A 2WZEA 4G7VH 1UXSB 1J0YA 2OSWA 1SVCP 4HFWA 4OLXL 4R4BA 5I1HH 4Y4FB 4F7EA 2NY1D 1Z0MA 3W0KA 5L8KB 2X4TA 1HVXA 4K7FA 3FB5A 1WISA 4ODSL 4QRUB 1NDGA 3RWEB 3C5ZB 2MMXA 4WDIB 5IFPA 2BSTA 1J8HA 4PRHA 1MPAL 1AMYA 5MI0C 5MP6H 4NQVA 3LKQA 2HKFH 1XCTB 1IAIM 3ETBF 5HHVL 1SJXA 4EQ3A 3V8CA 4ODVL 3S4SG 1QLRB 4L3AA 1WC7B 5BZWB 4DN3H 4OCNC 4CJ0A 3EDEA 2EIZB 1NANI 1P6WA 1H0DB 4WGWB 4NJAL 4FQCH 5I73B 3EOAA 4R4BB 1CF8L 1HKKA 1Q9WA 3REWB 1MCQA 4ZFGH 4M5YH 5B8CA 4LBEA 5EZOH 3ARQA 4Z18A 2O5XH 3P4NA 4NHUA 4UU9A 2X4TB 3RY6A 4K7FB 1W9DM 4KVCH 3FB5B 3ABZA 2J25A 2X0YA 3HUJE 2ARJA 3HC3L 5JR1H 1NDGB 3EYVA 4GXPA 1IRAY 4KHXH 2XQYG 2VDQH 5AZ2L 2BSTB 3TLRA 1J8HB 4PRHB 3L3DA 1SM3L 3GBEA 1KFWA 1W3KA 5LGHL 1RUPH 3W39A 3H9HA 4NQVB 4UQBA 1UM6L 1UD5A 3RRQA 2V5CA 2V7HA 3VH8A 5E8PA 4QXWA 3DHJA 4KK5C 2DTMH 3ROLA 3WF3A 5C6TH 2QQQA 2AV1A 4PLJD 3EOAB 3UTTE 1EEZB 1ZEAH 3QUZC 3SJVA 1Z3GL 1Q9WB 1T66C 4LSTL 1OAYL 2ZCKH 2OJZL 1MCHA 3O9NA 1QOXA 4LBEB 5F1KC 1B3XA 3KR3L 1WSST 1BVLA 4NHUB 4UU9B 3U30B 1MY5A 4XMLL 3AB0B 2ARJB 3QDJE 3QCTH 3DARA 3EOTL 5GJSH 4L4VD 4C7FA 3L3DB 3HZKA 1FO0B 1KB5H 4DKEL 1SHMA 2BHUA 2V7HB 3RNQA 3VH8B 5E8PB 4D6CA 3STBA 3ROLB 2CRYA 1FHLA 3WL0A 2AV1B 2QLVB 4OCXH 1KEML 4YXLL 4GI6A 4X80L 3ZO9A 4LARL 3B5TA 4X0VA 3B8SA 5CSYA 2NY0D 3AU1A 1L6XA 5DFAA 3VA6A 4JPVH 3B8YA 3RL1A 4M8QA 4IRJB 5F7LB 4ZAKA 3PNWB 3WD3A 4IOFD 1CD8A 3CNKA 1II4E 4G8GD 2AP2A 2VZSA 2XTLA 3OKYA 1NL0L 1ADQL 3V6OC 3RWFA 2YA0A 3HZKB 1WZKA 3D85D 1BWMA 1KJMA 1TDQA 4PJBE 5KVEH 2AJUH 3D2UA 4HBQA 2YL5A 1KG0A 2BY2A 1E3XA 5D6DA 5DVOA 3RNQB 2VRJA 2JB5H 3PDOA 3MLWL 4M8UA 2F2HA 3HI1A 4GW4A 1E4XI 1P84K 1S7VB 5FXCH 5IHLB 3NH7L 1WT5C 1I1AC 1YUHA 3AU1B 5K9OB 3NIFF 2C4XA 1FFPA 1MYRA 3RL1B 4HZ6A 4M8QB 5JBFA 4NNYA 3X14A 4ZAKB 5I76A 1F4YL 1AXIB 4OKVA 1JF5A 4PLKC 1GGYA 1TENA 4D6IA 1LDSA 3VI3E 3TO4D 5JUVA 1OIMA 3BDXA 1WDQA 1VSCA 3LS4L 5ILTL 1PKOA 3RWFB 4WIWA 3MLVL 3RM4A 3AMLA 2N7BA 3QZWG 1KJMB 5JLZA 1YJDC 3D2UB 5C0RL 4BFGA 3EYSL 3F5WB 1GW1A 2XYCA 3HPJB 3IDIA 3PDOB 3UCRA 4BQCA 2H32H 4R0LA 4H25A 3HI1B 4GW4B 5C0GA 1RPKA 5M94B 2QJDA 3H7LA 4LLDB 1YY8A 1YUHB 4FQQA 4Y7EA 1A9BB 1YJDL 4ALAH 3P77A 3L3OB 1FFPB 4E41D 1UJTA 2AI0L 4YDKL 1Q6DA 4HUWA 4DN4L 4NNYB 3QUXC 4ODSH 3X14B 5I76B 2LTQB 4OKVB 4WFFE 2DS4A 4ZFOA 3WFZA 4LVHC 4KXZI 4JY6B 4EN3A 5EU7E 5JIPA 2DBJA 2H41A 3O4LA 2BMKA 4ODVH 5H35A 3W9EA 4XB8A 1ZA6A 4IMKC 5JLZB 2DM2A 5ADPL 3B2VL 2XN9E 4P9HC 3RL2A 2FJFA 5HI5C 3LKSB 2VXUL 3LPWA 5J13C 3DV4A 1QOKA 3FHQA 4ZEPA 3D0LB 4R0LB 4H25B 5GGVY 1CF8H 5MERA 5FL1A 1ZHNA 3TT1L 1GQIA 1AO7E 3DSFL 1OARL 3GB7B 2YRLA 1IC7L 4UV7L 5GGRB 1MQPA 1YY8B 4KK8C 3RI5K 4FQQB 5EG6C 5GGVL 3P77B 5DHYB 4P9HL 1KEGL 5C92A 5E7FA 4G8FA 4HUWB 2BOCA 3OKDA 3HC3H 5JORA 3RUGF 4LLVB 4X5LA 1QFHA 5A2LH 3LB6D 5JW4Q 3THCA 4XPGL 4YHNB 1M01A 4ZFOB 5AZ2H 2XM2A 1SM3H 3IS0X 4R9HA 1FFRA 4DZ8B 1U95A 4EN3B 3WUZA 1UM6H 1E5JA 3O4LB 5H35B 3BP4A 3UZQA 4PRIA 1T5WB 3VI3F 4R97B 3RL2B 2FJFB 1BAFL 2EDYA 3DV4B 3PGDA 1MVFA 4Y19E 1FSKC 3CJJA 2OZ4L 5MERB 3HRPA 2EYTB 1ZHNB 3SDAC 4LSTH 4M7ZC 1OAYH 1NAKL 3NFNB 3U79A 2OJZH 5CBEA 5KSVA 4R6UA 1GHFL 4KRLB 3AI0A 5DFWH 3KR3H 2R15A 3N1QC 4WEMB 4G8FB 5KN5A 4ELMA 2BOCB 4XMLH 3OKDB 5JORB 4PCSA 3AUVA 3NFSH 4HG4J 1AGCB 4WEBL 3BD3A 3C60A 3H9SA 1WIPA 2VAJA 5F7FA 5KSBB 3RIKA 1U95B 4MD0A 4PTXA 1GZQA 5L8LB 4M62H 1XH2A 5T5NG 4PRIB 5EU6A 4EIZC 3PXHA 1EXUA 5CSBA 2NTSP 3DVNA 3GSOA 3Q5TA 4HPYL 4IIQC 3C09B 5TH2B 4X80H 4MVBC 4L4OA 4LARH 2XIBA 4UNIA 2N7AA 1HXYA 5BW7C 5GRYA 5CBEB 1E0VA 4X6BA 4N5EC 2NY4D 3ZHLA 5FGRA 2EYSA 2QQLL 5KN5B 4N9GA 4ELMB 1CDUA 2A3EA 2FD6L 1LLOA 1QW8A 4L3EB 5KAQG 4XTRD 3W29A 4LAQL 3RWIB 5C8BB 2XXMB 2VQTA 4AENA 3H9SB 1NL0H 4NGHL 1HJXA 3TM6A 4MD0B 3VU2A 1ZHKB 1GZQB 1GGUA 1QFWH 4A6YH 5EU6B 4R2GB 1C5CH 1IAOA 1T0NA 4ZUUA 3MLWH 4CAGA 3AJ7A 4RGNC 4H0GA 1HJUA 3GSOB 5BJTB 1F6AA 1CDGA 4XMPL 1ZLWK 3ARGC 2OTPA 1JNLL 1NLDL 2IFFL 3NH7H 5SWZB 2K7QA 1QSFD 5C09B 4X6BB 2WIMA 4U7KA 1MWOA 4DGYL 3GMOB 2V7NA 3BD4A 4KJYA 3H3BC 4IOSD 2G75A 4N9GB 1H3GA 4EUPH 2QADC 4K3HA 2JB6A 4I4WA 3WD5L 4KUZL 4ETYA 5IM7B 4D0BB 3VDAA 5E56A 1VADB 1MFUA 3LS4H 4AENB 5ILTH 1DN0A 1EH9A 1MRFH 3LDBB 2W0PA 5FFLA 2EBNA 5C0RH 3RWDA 3GM0A 5L2KD 1CDBA 1OQOA 3EYSH 1IAOB 2ATPB 1T0NB 1T1ZB 4ZUUB 3ALPA 3RIAK 1US3A 1J7VR 1F6AB 3O3BA 5DJDA 5F6IB 4HT1L 4H8HA 1TMQA 3QIBA 4O5LL 4WWID 2BSRB 5DRNB 4WTWA 3RVVD 4TUFA 1YJDH 5EU3A 1B30A 3VIGA 2AI0H 4YDKH 4GW5B 2Z92A 4KV5F 5DR5H 4DN4H 2V7NB 3PWVA 2FLBT 4HMEA 5CJXA 2G75B 1JZ5A 3VFGL 1RFDL 1RAMA 2WK2A 1U92A 3RY4A 1SYTA 5ICXA 1DN0B 3WL9A 3HMWL 3IFNL 5ISZA 1HHKB 5ADPH 3ARXA 2GEEA 3B2VH 3W24A 5GS2D 3SGJC 2B39A 4HPOL 1KQZA 1RJZA 4NRXB 4XHJD 5A8PA 2R0KL 5J11B 3TA3D 3TT1H 1I9JH 3VFUA 4U1HA 3O3BB 5DMIL 3DSFH 3AXIA 3O6FD 4POZD 1J8HE 1IC7H 4ODUA 4PRHE 2V9QA 1H5BA 4UV7H 4XP9L 2DSWA 1EX0A 5EZJB 4OZOA 4UFMA 5GGVH 3WELA 2AEQH 4DUXA 2XQYK 4P9HH 2R2EA 1KEGH 3KHOA 4LIQE 1H15A 2Z92B 3GI9L 2R0WL 1CI5A 2BVPA 3PWVB 5C0JA 4Y5XC 1EPFA 2HMID 3V4PL 3LD8B 2MTPA 4XPGH 3ECQA 4E0RA 4P2RB 3OX8A 4B5EA 3RVWD 2PN5A 3SGEH 1U92B 1L0YA 1WAWA 1X5FA 3AYRA 4D6HA 5ICXB 3ARED 3P73A 5B3NA 3WL9B 1W2VA 5ISZB 3RKDD 1FVCA 3KYOA 1BAFH 3GSNL 4WJXA 2F53A 2C7UA 3TH3T 5FCUL 3QAZB 3IDMA 4I9WE 2E0PA 1NAKH 4U1HB 3VFUB 1KWGA 1C5BL 1GHFH 5IFAL 4ODUB 1H5BB 1BFTA 5BOPA 1NANH 4QCIA 2R2EB 4ZS6D 4JPWL 1H15B 2WMFA 3B9KA 4FA8A 1KB5B 4LAJH 5C0JB 4K2UH 1OB0A 3IDGA 3S8WA 1JVKA 4TUJB 3DBXB 4E0RB 1X1NA 4OZFH 1ZTXL 3OX8B 1BLNA 1CZ1A 3G9VA 25C8L 3MRFB 3O8XB 4GS7C 2VX6A 2EO1A 2ERJC 3P73B 3SJVE 2GJRA 4M24A 4I18A 3KYOB 1XH0A 3L5XL 3MACL 1E6QM 1FNGB 1CDIA 3WS3A 1NWTA 4MQ7A 2ZUMA 4BYHA 1ZBCA 3IKCA 4LHUA 2F53B 1OGSA 2OSXA 4H7VA 2C7UB 4HPYH 1PFCA 1KV3A 2JK5A 3QA3A 3QEHA 1HX0A 4MDOA 3QDJD 4HKZA 1VGKA 2C3GA 1CZ8L 3OGSA 4QCIB 2IG2L 1ED3A 1YEKH 4TTDC 3B9KB 2FD6H 3OAUL 1QNQA 4DWSA 1YEJL 5I78A 4RRPG 4LAQH 4U2ZA 4I48A 1A6VL 1NAMH 1LHZA 3LN5A 1AGFA 5AD0B 1BLNB 4FQJH 32C2B 5T1LD 2IMNA 4XCCL 2VLRA 3AIVA 2FWOB 3D9AL 4MDPA 1E40A 3UG5A 4LPWA 4N8PA 5CINL 2EDOA 4IRSD 4I18B 4RL3A 4QCEA 1IKNC 1PQZA 3U0TB 3JBG7 4NF7A 3QDGE 5KTEL 4PGZA 2HVMA 4HUUB 3E6FA 4XMPH 4UIKL 5HD8C 3TVMB 1JNLH 1NLDH 1Z9MA 1CLZH 5J1AA 1HSBB 2JK5B 3QA3B 3QEHB 3S96A 3W0WA 4M6OL 1RURL 2DLHA 4HKZB 4PTVA 5D1ZD 5GSRA 4YFLI 4AL8L 4PYGA 4M7LL 2F5BL 2WV3A 4LYQA 1AKJD 1RZFH 1HVQA 3WD5H 1BYBA 4DWSB 4KUZH 3LN5B 1I3RA 1AGFB 2AABL 4H20L 4ZUVA 2CUIA 3JZ7A 3SCUA 2HTKC 3BDBA 2BVDA 2WVSA 4HP5A 4FQHA 5FO8A 2GUYA 1R5IA 4JFDB 1RI8A 4Q9CA 1BFVL 4GKLA 4FFYL 1HSAA 4U3CA 3P9MA 4P23A 2P49B 3E6FB 3OKKA 4HT1H 5T3XL 4O5LH 5EN2A 1A3RH 1TQBB 3U2SB 4LPYA 2XZQL 4JL2A 5J1AB 5T5FL 3W0WB 2P45B 4AIEA 2BNRA 2AXGA 5GSRB 3F5JA 5F1NB 4XWOD 3VFOA 1ECEA 1G94A 1UOKA 1E4XH 3BEWA 3QHZL 3VFGH 5FHAH 2F8XC 1VFFA 1RFDH 2D1ZA 2P43B 3QEQD 3CUHA 5A69A 3O9WD 4ODTL 1LK3L 2DQUL 5TE4L 2MSPA 3IFNH 4QLRA 5MI0B 4QTIL 2XUCA 1TQCC 4HPOH 4MNLA 1BQSA 1KLGA 3EOBA 1M71A 2R0KH 5DFTA 3B3IA 1INDL 3MSDA 3BJ91 1VEMA 3P9MB 4P23B 4NQTA 2A9ML 1FZJA 3GIVB 3OKKB 5EN2B 4OD1L 1FIEA 4LVEA 2I07B 3DVFA 4XP9H 2V3DA 5FDYA 1XSJA 3NDYA 4WFFD 1WWWX 2GYSA 3N0PB 4BQ2A 3CZ8A 3CZGA 1VFAB 3GI9H 3WIJA 2R0WH 2BNRB 3O4LE 3OA5A 3VFOB 3V4PH 2X2YA 5J1SC 3BEWB 2QQNL 5F9DC 1PX8A 2O9OA 2AK4B 2HJFA 2XN9D 1B90A 2GCYA 3H6JA 4U0RB 3CC5A 1BF8A 2CBUA 3A6BL 1W0YT 1DJSA 4GZIA 4CVWA 3BKJL 1IZJA 4B9YA 1KLGB 3EOBB 3GSNH 1M71B 2YPLD 4X5WA 2WHJA 5D2NA 4KKAC 2I27N 5FCUH 3K8LA 4HKXA 1A0QL 1FZJB 1S7QA 1ZVYA 3WNOA 1C5BH 3LEXA 5IJKC 5IFAH 4N8VA 1CICA 4JPWH 4P9MH 5DJAB 3SCOA 5DVKA 4G6FB 5LWYL 4W86A 4DVRL 4A6YA 3CFDA 1KYOJ 3SKNB 2HJFB 25C8H 5M95B 1OGAA 5SWSD 5ELIA 4Y19D 1W2PA 3CC5B 4ZSOB 4GJTB 1JAEA 5JOFA 3L5XH 5D8ZA 3MACH 5CSGA 5D2NB 2J88L 5FGSA 4ELME 2YXMA 3OAYH 1PIGA 2BDNL 3SCMA 3TBYA 4FLOA 4HKXB 4TTGA 2EEBA 1U2HA 1S7QB 5BCAA 4BZYA 3LEXB 2JF6A 2Q8AL 3MRKA 1E55A 2ICWJ 5CWSA 1E6NA 3PTQA 5A8MA 3H9SE 5I1DB 5FM5M 2H9GA 4HLZH 2IG2H 1CICB 4D2NA 5EOCL 5KOVC 3HR6A 2VWEC 2WUCL 3OAUH 1G7LA 1QR1A 4LPTA 4UAOB 1YEJH 4WUUA 1X5KA 4XP6L 4A6YB 4BH8A 1A6VH 2E27H 1BVKA 1LWHA 3UPRA 4JRWA 1AR2A 1OGAB 4XCCH 4YO0A 5IVXA 4N90D 1DWHM 1UQZA 3PIQA 1E6ZA 3ZT7A 4KRMB 2ZKHH 3D9AH 5CINH 4MQSB 3LN4B 4MXVF 4HGMA 5C1MB 1KPUA 5JOFB 1MFAL 3UAJD 4Y5VA 5KTEH 3CLEL 4NNPL 4UIKH 3SCMB 3TBYB 2VRKA 1C5DA 5D9MA 3LY6A 1D5BA 4AY1A 4EUPB 3SCWA 4WKAA 1HKLL 1KACB 2XPGA 4M6OH 5CWSB 1HJWA 1OGBA 4WHYG 2VXVL 3NCJL 1I1AB 2FDMA 4AL8H 4M7LH 5IBUB 5IUSA 1E43A 3MMUA 1G7LB 2F5BH 1QR1B 4KK6C 1U8MA 3RAJL 4MQXD 1ZBKA 4S3JA 1UWTA 5F72S 5FB8A 4BH8B 5KSBF 1J0ZA 3NZHL 1BVKB 2AABH 4H20H 3ZDXE 1JPGB 4KY1H 4ZUWA 1KTLA 4YO0B 3WIIL 5IVXB 4Z0XA 3HTLX 1BIHA 1V0LA 3X13A 4H0IA 4FFWD 5FO7A 4B0MM 3T2OA 1KPUB 4FFYH 3VFMA 2C7FA 4Y5VB 4Z7QF 5T3XH 4CW1B 3UETA 3SDDC 3T08A 1IMHC 2XZQH 4BSVA 2A3CA 2AJSL 3WXWL 1D5BB 2DDXA 3OR6A 5T5FH 3LPGA 3SE4C 4WFGE 2A1WL 1N6QH 2CKBH 1REIA 4JCMA 4LGXA 1KXTB 1RK1A 4F2MA 3QXDB 1E4WL 1NEZA 3TPUA 1NC2A 4Y4FD 3QHZH 1U8MB 1H3XA 3STZA 4NQUA 3N1FC 1LE5A 4XC1L 2OL3L 3TIEA 5FB8B 2ADFL 4R90L 3QUMA 3BIKA 4ODTH 1LK3H 2DQUH 3C5JA 2DQXA 5A2BA 1KTLB 5TE4H 4JFEA 1QEWA 4Z0XB 2HFEA 4LVHB 2EDQA 2YD5A 5DS8B 5ACLA 1ZOXA 3H9YA 3GI8L 3X13B 3SGDH 3U7YH 3C5ZD 3EHBD 3TTQA 3VM5A 2VH5L 4GG6F 1Y0LA 1INDH 1WQVT 3PHOA 2A9MH 4MJ5A 4PRAA 3KPRA 4OD1H 4DM2A 3BAEL 3EIFA 1J01A 4AIUA 4OZFA 4OBSA 4O2EB 4MJIB 1A7NL 3F65A 4A2MA 3VXMA 5ISZE 1XF5A 2O26U 3GEWB 5DEFA 4F2MB 1NEZB 3ULUE 1RZKC 3TPUB 1NC2B 5L9DL 2QQNH 1Q9KA 4MCZB 3STZB 5FOJA 4LSRL 1MJJA 5K33A 5F1SA 3TIEB 3N9KA 5K59F 4LCWA 3QUMB 1X6LA 1WWCA 4I5BA 1AE6L 4JFEB 1QEWB 3A6BH 3L3GA 2GKIA 1ZBWA 1ZJAA 2HFEB 5D71L 4OGAD 4LLUA 2WW5A 1CDCA 3BKJH 2L7UA 5MEOB 1FNLA 4NKDA 3O45A 1RZKL 4XBEL 1J8HD 3KG5A 1V8HA 4PRHD 3LZFH 4OF3A 1QI3A 5IMLB 1XZ0A 1A0QH 3IRZA 2AJVL 4MJ5B 4B41A 4J4PA 4PRAB 4M80A 3P11L 3BYTA 5F3BB 5HYJA 4XWGH 1MCFA 2W63A 4M7ZB 5GJTL 4OZFB 1GOWA 4LEXH 2EDNA 5K9KA 4L4TA 5FO9A 3VXMB 1XF5B 3IDXL 5DEFB 3ROOA 1QG3A 4FG6C 3RP1A 4HKJA 1Q9KB 4GMSL 4JLRA 2ZJSH 5E6YA 2NXYC 1C1EL 1IGFL 1MJJB 3X11A 2F53E 2J6EA 2V9TA 4LCWB 1HHHA 2DQEL 5KBNC 3L3GB 4YDVA 4K9EC 3L7EA 4KDTC 1CS6A 4LLUB 4I9WD 3PZNA 4NKDB 3O45B 5FD0A 3VGDA 2J88H 5DUBB 4FZEH 4D6EA 2BDNH 2HFGL 1XZ0B 2ZSWA 3NA9L 4F37F 3N15A 2I25N 2X4QA 5ALCL 3DHUA 1NC4A 5EMYA 2Q8AH 5IW6A 4CCDA 5HYJB 2DT3A 4K9EL 1NAMB 2IBGA 3NZ8A 4ISVA 4XZUA 3V79C 2DEPA 4ENED 1Q94B 1BG4A 4MB5A 5K9KB 5EOCH 4L4TB 1P4BL 5IFTA 2WUCH 5FO9B 1O7AA 1W9XA 4JO2L 4FQIL 3ROOB 4XP6H 5CSUA 1E4IA 3IDYC 2YD6A 4HGWB 1IV8A 1CPUA 4PRDA 2V2XA 1HHGA 4XVUC 1GCFA 3PZIA 3VVGA 4IRJD 2XI9A 2GITA 3CUIA 2DQFA 4AISA 3L7EB 3ZTNL 1S9VA 2CIIA 5TDPA 1MFAH 2CCRA 1X5HA 3CLEH 4NNPH 4AD0A 3WJJC 2ZSWB 1OAKH 3S3JA 5BZDA 2X4QB 1NC4B 1CD9B 1NMCC 1V3LA 1HKLH 2OK0L 2BSED 3ARGB 2VXVH 4Z78B 3ESVF 3NCJH 3NZ8B 4POUB 4ISVB 3N85L 4XZUB 2VLRE 2GQHA 5E70A 4V27A 4ML4A 4PEEA 3RAJH 1B6UA 3NZHH 4FTVB 4KJQC 4G6ML 4XX1G 2DMCA 4OF5A 3WIIH 4PRDB 2V2XB 4I3RL 2MANA 3VMNA 2GITB 4ZAKD 1NSNL 2DQFB 3UXFA 4N8CL 1FJ1A 3W0WE 4M3KB 1A7RL 1S9VB 2CIIB 5TDPB 4JQXC 2WMJA 4JHWL 3IJHA 1FP8A 3QCUH 2HH0L 3LSOB 4UTFA 4KTDL 4ERSL 2DN7A 5C0AA 2AJSH 5BZDB 1NH6A 1GORA 1HIML 1EJ6A 1RUKL 3D2UD 2ZX6A 1CCZA 2A1WH 2J7LA 5GS1A 3MRCA 1S7XA 4LGPB 1OTTD 2PETA 1LD9B 1E4WH 5F7UA 3L4ZA 3MRNB 5F9JA 4ZXLA 2NLJA 1WDRA 4XC1H 2OL3H 4J6RL 2ADFH 4MXWL 5F6HJ 1MQKL 2Y6SC 2ZXAA 5I16A 1BREA 4EIGB 5IB3A 3RZWA 3CH8A 1FJ1B 3QI9A 4Z7OE 2YBTA 1UZ6E 2QKIA 1YY9D 2BNRE 5IOPA 4BQ3A 4U1NA 4OF6A 4Y2DC 1T2JA 4PCTA 4W5ZA 3S37X 3CXDL 1G9MC 3BAEH 4IISA 5IDIA 1ISZA 1T04A 5GS1B 2C3HA 3MRCB 1S7XB 5DJYA 4IHOA 1FC1A 5JUEL 2I24N 4PP2A 3WIHL 3S7GA 3BISA 4JVPA 4M29A 5L9DH 2AS5M 5DTFA 1KXQA 2NLJB 1KIRA 2Q8XA 1G9ML 1J0JA 7CGTA 3VX1A 2ITDA 4TX6A 4OZGF 5I16B 2YBUA 2HN7A 1S5HA 5D71H 4YPGA 1AHWA 4LLWB 1H0IA 5I71B 3D3AA 1RZKH 3RA7L 2YD8A 3BGFC 4XBEH 4XT1C 2DPEA 3DPBA 1UADC 4W85A 1CFVL 3ULVE 2D3NA 4U1NB 4DKAA 4EN3D 3P11H 3RMEA 3O4LD 4XVSL 2OP4H 1U2YA 5GJTH 1IC5H 4PJGA 1P5VA 1T04B 5DJYB 3F5LA 2C1OA 5B38A 2I60L 1U8QA 4GUPA 2W65A 3IDXH 5SX5H 1TPXC 4PP2B 2EEXA 4JFYB 3VPLA 5IR1A 4DK6A 2X4NA 4KDWA 2B1HL 5DTFB 1C1EH 1IGFH 1KIRB 1PD6A 5D2NE 1WV7T 3FXYA 4NCC1 2DQEH 3D87B 5I15H 5JW5A 3BJLA 1FNEA 2HN7B 5CCKL 1S5HB 4HC1L 4YPGB 1AHWB 1JPSL 2C0HA 1UH3A 4FZ8L 3MRJA 4UMGA 5J4MA 4OM1L 3O2VH 3NA9H 4WEUD 5ALCH 2PC8A 3ZYZA 1RHHA 3EDFA 4PRID 4Z7OF 3K1KC 5DYOA 5F7HA 2XGBA 1OGAE 3Q6GL 1MEXL 1P4BH 3WN5A 2C1OB 5B38B 4PTUA 1UR4A 3Q6FA 1U8QB 1PDKA 4RFOH 4JO2H 4FQIH 3VE0A 5IR1B 2BFVL 4UUJA 3W38A 2X4NB 4DVBA 5EBMA 3T3PE 2OR8A 1JCKA 3DETC 1CXHA 5TE6L 1HCFX 2XKUA 3OAZH 5JW5B 1QRNB 1FNEB 4TVUA 3ZTNH 4L3ED 3PJSA 4UTAL 2JJWA 3T09A 1DQDL 3MRJB 1N64L 2CKBA 1OL0A 3H9SD 5GS0D 1WE5A 1KCVL 3BESR 4W7WA 4MAYC 4FRWA 4M48L 4WUUE 1IEBB 4A4AA 1F4AA 4L4JA 3O4OC 4ZFFA 4IS6A 1LP9A 3F5KA 1RHHB 3IDNB 4H1LG 4R2GD 5EU6D 5DYOB 4POYA 5B39A 5IK3B 5IVXE 4LYPA 1AC0A 4PG2A 2VDML 3WN5B 5ERWA 4PTTA 5D7JA 4PTUB 3Q6FB 2DKSA 1OOAA 4BQ4A 3VE0B 4RE4A 4JDTL 4UUJB 5BXTA 1MCBA 4A2LA 5JQHC 4OV5A 5SWZD 4FS0A 3SE3C 1B0RB 1NCDL 4G6MH 1UWXH 3O6ML 4TXEA 4XB3A 4HFUH 5C09D 2IGFL 4APQC 2E9LA 2I5YL 4I3RH 4WVRA 1CTOA 5DT7A 1VRXA 3QFDB 4X99A 1A7RH 3PJSB 3IB4A 4JHWH 4WFHE 2LAAA 1DQLL 4YHKL 2CKBB 2HH0H 2R2CA 4CUCA 2PCPA 5H2BA 1VPOL 4KTDH 4OGYL 4ERSH 3JUZA 4M6NL 1XD0A 1OSPL 1RUKH 1LEIA 5FL0A 1LP9B 2YD1A 5EORL 4P2OA 5B39B 1N0XL 1U41A 5F44A 3W2DH 2VI0A 3CMJA 2JELH 4XVJL 1E56A 4U1JA 1ZB5A 5IT2L 4OV5B 4RDQG 1W1VA 1MQKH 1A1NA 3WUBA 1RVFL 4G6JH 2CLVA 4YZFF 2FBOJ 1PX3A 5I1IL 2VCCA 3OG2A 3WS6C 1BJ1J 4X99B 1XIWD 5I74C 1D6EA 1DQTA 3JV6A 1QBLL 3S4SA 4Y5YA 4WFGD 3VGAB 2PCPB 5H2BB 2ZUSA 3DECA 1K4CA 5K93A 3ARZA 4GRWB 2DQIH 5CD5C 4AD4A 1LEIB 2JE8A 4UDUA 3DXAA 1N0LA 1MFBL 1F00I 1P53A 2W59A 4P2OB 3WENA 1HXMA 4I0PC 5AYIA 4JFEE 4KZDL 5JUEH 2WZIA 4D9QD 2YR3A 3WIHH 2DIEA 4FLSA 4U1JB 1TJIL 2ICWI 1ITXA 5GISL 3K0WA 1DVFA 3E3QC 1G9MH 1T1XA 2P1YA 1R3IH 4U1MA 1BQHG 3OGVA 1A1NB 2GJZA 2CRMA 4U4BA 2CLVB 1VFMA 1EFXB 3KPRE 2W9EL 3FQRA 3QYCA 4H26A 3LEYH 5FUOL 3W4RA 1MW0A 5A6KA 3RA7H 1ZLVH 2NY3B 3DUUA 3BCDA 5IGXL 4P2RD 4RMRA 3JV6B 3S4SB 3VXME 1CFVH 4Y5YB 3D69A 3U4BL 3QJHA 4U1SA 3CFBA 4P2CG 4HS6B 1AI1H 4QXTA 5ISZD 1K4CB 2AAVA 4P7OA 3ULUD 3INUL 1WBYA 1WZLA 4FFVC 3DXAB 4LCWE 1JZ6A 3G6JF 3M46A 1N8ZA 2ZOKB 1HXMB 2HT2C 4U5IA 2I60H 1YEIL 1Z9LA 4HV8A 2HT4C 2R4SL 1EQCA 5F93C 3HAEH 3U9UB 2K3TA 3LMJH 3BAYA 1X3DA 1VKXA 1IGIH 1T1XB 4U49A 4UBDD 1AGDA 1KBBA 4U1MB 4QT5A 3S36H 1V3HA 2GJZB 4P4RA 5A3HA 2IPUG 3NCYS 3JWOC 5CCKH 3FQRB 4HC1H 4H26B 5HYJE 4LVOC 1JPSH 4QY8B 5F96L 5ITFA 3QOMA 4FZ8H 1RP9A 4PUEA 4L29A 1H3TA 3DUUB 5ABDE 4X9GA 4OM1H 1WCQA 4Z7UB 4JFFB 4Y16A 4NDMA 3D69B 3U5UA 3O8XD 3QJHB 4U1SB 1HOCA 3CFBB 4HD9A 3VIIA 4QXTB 4NKIL 2X4PA 5IEKA 3JWOL 5GRVL 5D6CA 2O9PA 4G6AC 1WBYB 2NY1C 3B9VA 1YNTA 3Q6GH 1RZ8A 2VE6B 1N8ZB 1FPTL 4KHTL 3QJFB 2F53D 4HV8B 1OSEA 3QWQB 3HC4L 5DVMA 2BFVH 2IANA 3P9WB 2BRQA 2OWXA 1VKXB 2RJMA 4Z2LA 5F7NC 5DJXA 5M3WA 3FW6A 5TE6H 4MLSA 4W6YB 2APFA 1S7TA 1D5MA 5E08L 3B9KD 1GYAA 3WJLA 5HDQL 5ITFB 9CGTA 3HHRB 4AZHA 1DQDH 4L29B 1N64H 4LCIL 2ZSVA 2B2XH 4BF7A 3IT8D 1KCVH 4NDMB 4E4PA 2MJWA 4M48H 4ZDHA 2HLFD 4PJCF 4HAFA 1KC5L 1HOCB 2D2OA 4JREB 3QHNA 4PP1C 4CN1A 1UJ3C 2X4PB 4UFIA 5D6CB 5I1EH 3T0BA 4WSJA 1U36A 1YNTB 1RZ8B 3FJTA 3K1DA 2DQHL 3GKZA 2J77A 1I3VA 3MV7B 1ZL1A 3TVMD 4JDTH 2IANB 1I8IA 1HJQA 1TMCB 1NCDH 3O6MH 2JJSA 3GH5A 3UO1L 2BCKA 1MHEA 4JPKL 5AWNL 1CEOA 1S7TB 1D5MB 5IROA 3G5VB 4JJ5A 5DJZA 4DWSD 1DFBL 4MHHG 3QZWA 1DQLH 1PJ9A 2ZSVB 3VINA 1L0XA 1OW0C 1M6OA 2C8NA 3BC9A 4OGYH 4ZDHB 1FG2A 4M6NH 1DEEB 2FYYA 1OSPH 4IEFB 4PLJC 3GXFA 2FEEI 3FN0L 1AQMA 4JFDD 1N0XH 3CU1A 2GTZB 4B3LA 2ZZUT 5A6AA 3ZO0A 4XNMA 1NPUA 1F3RB 4NIKB 4OD3L 2YC1A 3KEHA 1OCWL 1IE5A 3W0WD 5C8JA 4N9OB 2EDEA 1MHEB 4LYRA 1KCKA 3KXFA 5C0AE 1H3WM 3DX9A 4GQPH 1NBQA 5CP3A 5DJZB 1J5OL 3NJ3A 1DDHA 4XAKD 1Q72L 1QBLH 4C58B 4AEIH 1S78D 1UKSA 3QZWB 2E8ZA 2Q3AA 1D2KA 2ZXBA 3GH4A 2Z35A 5IWLA 1J0IA 1X5XA 4QNPE 1GCYA 1UR8A 1WLHA 2DBLL 5JOPE 1H4PA 1MFBH 2VZ3A 1P2CA 2P47B 2NY0C 4KZDH 1HQRA 2R56L 5GGTL 4P23D 2FECI 2YL8A 3BRGC 3O6KL 4XNMB 2Z1KA 4CU8A 3L5IA 4D72A 4OT1L 1P1ZA 4OZHA 2YC1B 3QPXL 4YHZH 3ZDYF 3KJ4C 5HYFA 4ESKA 4GO8A 5C8JB 1MFNA 4IPNB 2VC2L 3MBXL 1QUNA 2BNRD 2W9EH 3LQZA 5JDSB 5FUOH 1G9HA 7TAAA 3CZFA 1XR9B 4YN5A 5I8CB 5IGXH 2A3HA 1OM3L 1DDHB 3CBWA 3O0RL 3G04A 2UZYB 3QIWA 4OCSL 3S88H 1FH5L 3KL3A 2AK4D 3L4VA 3U4BH 5KSAA 2H2PD 1AFVL 3CD4A 2MCG1 2Z35B 4R7DA 3MRQA 4YE4H 1KXQE 2OCFD 4CVXA 1M1SA 5KVGL 3VD7A 1P2CB 5J56B 5E9DD 1YEIH 4JFPB 4XPAH 4KK5D 1GVIA 3ZQ9A 5K9QG 2X89A 1JHTA 4U6HB 1P1ZB 1N2RA 4HWNA 3GBLA 2D03L 2AQ1A 3NTCL 1ZU8A 4HZAA 4ZTPL 1H9VA 4G6FD 3LQZB 3VWKA 3CZFB 1N26A 1FNSH 4PJGE 1MELA 3G04B 3MJ9L 1MF2L 3PQYA 3VG9B 4M7KL 4XBGA 5KSAB 3BRDA 4FABL 2XZZA 1BBJA 1I3GL 5DF0A 1JPTL 4R7DB 4NKIH 3JWOH 4CVXB 4YBQD 1J8KA 1B2WL 4L8SC 2B1AH 1LG1A 3NFPB 3HC4H 1UB6A 4KI5E 1CGSL 2DQGH 4OM0L 1WIOA 5DD6A 1JHTB 3PZTA 2YPKA 1N2RB 1NCAL 5JQ6L 2J7DA 3IDYB 3E6HA 4KMLB 1CICD 5F7MC 1Z2KA 1ACZA 3BLPX 5HDQH 3RILA 1GGBH 2IQAB 2P8PA 5F6HI 5ADOL 4BKLA 5I79A 2J7CA 3HZYA 4LCIH 1WAAA 2UY5A 4OFDA 1OAUL 1F6FB 3U83A 5A43C 3FTGA 2X05A 2A83B 3PQYB 1P5UA 4XBGB 5AG8A 5CPQA 1OGAD 3QRFM 1BBJB 4GRMA 4D0DA 1UR1A 1Z5LA 3ARWA 3MZGB 1D9KA 5E8EA 4DAGL 5AUMA 1TZIB 1JJUA 3TJHD 4F9LC 3FO2A 2DQHH 2X1OA 1RULL 4AYSA 2WP3T 3BIBX 5J3HD 4UQ9A 3SCMD 1UB6B 2H2SC 3VW3L 4HWBH 1FZOB 3HC0B 1JL8A 2GJ6E 4D9RE 3S34L 1EDGA 3PP4L 5DD6B 4F9DA 2YPKB 3WF1A 3UO1H 4JPKH 5DRWA 3V2AR 1I1AD 1T6VN 4MX7B 5AWNH 3S6TA 3QH3A 3U48A 3RJDA 1LP9E 2P8PB 4TSAL 1DFBH 4BKLB 1WTGT 3TIDA 3FHAA 3FTGB 3KPTA 4P3DA 5EIQA 4PLKD 4UFJA 4NKOA 1NGXB 2RIKA 1SFSA 2ITCA 4GRMB 1V3JA 1HYSC 3OG4B 1FAKT 3OKNA 1D9KB 2J8UA 4MNGB 4S1DC 3L2MA 5E8EB 3FN0H 3L9RA 1HKFA 3NPSC 3WLBA 5AUMB 4WI2A 1NEUA 1V05A 2VABA 1KGXA 1H09A 4JM2A 3FO2B 4G9DA 2XVLA 3WKZA 2Q8BL 5CFHA 1SEQL 4RFNB 1ZWIB 4HZ7A 5DT5A 4E42A 1A1MA 2X6MA 3KPSE 4BQBA 5E8NA 5DA0B 3MXWL 4R4FL 1QA9A 3WBDA 3BAWA 4JRXB 5DRWB 4WFHD 3SUSA 1QW9A 4QKXB 5JHDA 3OG6B 3IFLL 4GRWE 4I77H 3ZDZE 3KZSA 4OAWB 2C9AA 1J5OH 1E4KC 1WBXA 3FRUA 3T3ME 5I1CL 1Q72H 5A2KH 4OLYH 4HOZA 4XGZA 2VCAA 2ZUNA 4P3DB 2QSTA 2R1YB 4NKOB 5F88A 4XP1H 2ITCB 5F8QC 2QBWA 3L3KA 2Q7YA 5H94A 6FABL 3OKNB 2J8UB 2DBLH 2QR0A 4PRPA 4L5FH 3UMTA 2D7PA 3J8F7 4R3SA 4XP4L 4JM2B 3VMOA 1I7UA 2R56H 4TOYL 4G9DB 5GGTH 4YAQA 3O6KH 4E42B 1A1MB 5D7IB 4U1LA 3UTZA 4CMHC 1VJSA 3QPXH 5E8NB 3GSUB 4UNTA 3EOYG 3GK8L 4FXKA 3TP4A 4XTRC 3MBXH 3MUIA 4MJID 1QA9B 4S10A 4WO4A 5HYIA 3D48R 2X4SA 1AJ7L 5JHDB 5HVWA 3E8UL 5E5MA 1NC2D 3DXAE 4F15C 3FRUB 3O0RH 4OCSH 4TUOA 4HUNB 3QRGL 1S46A 4WUKL 4RMQA 1AFVH 4FFZH 4NUGL 5BO1L 3BGFB 5F88B 3KPMB 3VFSA 4JFED 1LP9F 3FOLA 3L3KB 2Q7YB 3HMXA 5H94B 4AZ7A 2ZNWA 1YEFL 5IFHL 3MO1B 3SCQA 4V1DA 3D3VA 4R3SB 1MIML 2HWZL 3QHTC 1I7UB 2DD8H 5JBEA 5I5RA 4WI6A 1YEEL 3LEVL 5IG7B 3GFUA 3P40A 3WQ4A 1S7UA 4U1LB 3UTZB 3U5YA 3MUHL 3HI6L 3B5HA 4TSCL 2D03H 1K85A 3NTCH 3RJXA 4ZTPH 1K9TA 3VXMD 2X4SB 3VXNA 4PY7A 2YKLH 1JWMA 4HZLB 3LPOA 4WENB 4WV1A 5E5MB 2WXDM 1I9IL 2LVCA 3MJ9H 4TUOB 5JMRA 5CJQL 4M7KH 2YLAA 4FABH 4LCWD 5LGJA 1I3GH 1JPTH 4R27A 4J3TA 3VFSB 1XCWA 3REVA 3FOLB 1U6AL 4H04A 1S7RB 2H3NA 4V1DB 2J4GA 4H0HB 2CQVA 3WDQA 3RVVC 3M6DA 2CR6A 2Z4QA 5HTSA 3DX8A 1CGSH 1IKFL 5A2CA 4J4PD 4J12A 4OM0H 1S7UB 5HYJD 3I6KA 3OBAA 4YIQA 3BKYH 1NCAH 1ZXQA 5JQ6H 2NY2B 2JLLA 4GRLC 4WLCA 1AY1H 4RRPA 3L1OL 3WFDH 4HMDA 1QPPA 4L4TD 5HHNB 1JWMB 1BQCA 5ADOH 1FVDB 4X9BA 4WV1B 3CMOL 3I6LE 1OAUH 5J89A 2ESVA 3WH6A 2DQJL 1BZ7B 2Q20A 3IKKA 1MFEH 5AZEH 1C91A 5LGJB 2EIEA 3QWRD 2IANE 3WKML 3REVB 3TA3C 4DAGH 1QSEB 1MNUL 4MAYB 2P5EB 3TGXA 3A4XA 2H3NB 4POZC 3QXAB 3L6FA 5F7DB 3CFCH 2Z4QB 3TC9A 4NCDA 3DX8B 5DFVC 3TBSB 3TYFA 3VW3H 2WBKA 4M81A 3S34H 3QWOB 1NC4D 2P42B 5I8OL 3I3EA 1W3LA 2PWEA 1PZ5A 1N3NA 1RMFH 3ARGD 3U7AA 4UILL 4IJ3C 1FGNH 1TTGA 3RVWC 1FNHA 1KB9K 4W68A 5E6IA 1ZBVA 4TSAH 1JGUL 4Z7UF 3WDPP 3GIZL 3RKDC 4FTVD 2C3VA 2ESVB 1NP2A 1G7IA 3O6LL 4P5TA 4MHHI 2YWZA 4NUJA 3RWJA 4BS0A 1CXEA 4AD1A 2EEAA 1M04A 1I85A 3TEUA 5CZVL 3JVGC 3OB8A 4UR9A 1UKPA 1I8MA 1T21A 35C8H 4Y8AA 4PJIB 2Q8BH 1SEQH 4ZXBA 5E8OA 3L6FB 4ZS6C 3TYFB 5HYQA 1GHRA 5HHPA 1EHNA 4OFVA 4W4NA 2WHLA 5J6HB 1A14L 1W8OA 2WKLA 1JNJA 1JV5A 3MXWH 4R4FH 1PZ5B 4XXCA 4TVPE 3VFPA 1YEHL 4KROC 3IFLH 4P3CL 4YUEH 2IWGA 5E6IB 1DBAL 4W89A 5I1CH 2DI7A 2APVA 2C3VB 4JR9H 1G7IB 1OP5K 3G6DL 2HJKA 4KRTA 5DSCA 2EPKX 1FZMA 4NUJB 1MH5A 5E8DH 5I74B 4JKWA 5CP7A 2VN7A 1A6AA 5E95B 4XP4H 4M7LT 1T21B 1A1OA 2HT3D 4ORZC 4YHYC 3KXFE 4ZXBB 3EBAA 5E8OB 3WNMA 3IAQA 4G3YL 3VCLA 4PB9L 4XCYA 5HYQB 4I0PB 2W07A 3EO0B 1JV5B 1XC6A 3WLWD 1P7QA 2XG5A 1Z0NA 3UBXI 2ICES 3VFPB 5IMMB 4CN4A 2DIAA 1TIUA 4BZ1L 1RJCA 5CD3B 1HIZA 1FL6A 2X1IA 1U0QA 1U8KA 5HGGS 1OGGA 3OLDA 3E8UH 2BY0A 1MCWM 2APWA 1QHZA 3BAXA 1DBML 4LGRB 4M1GL 4WJ5A 4KMTL 1FFQA 3FB6B 4IRSC 3QRGH 2EECA 4MB4A 5JOPD 3EJJX 2HJKB 5DSCB 1VACA 1MH5B 4YHIB 5FGBA 5LVEA 3S5LA 5IFHH 2DQDH 5CP7B 1A6AB 3V0WH 4OZHE 1U8PB 4H5SA 1A1OB 2HWZH 4JEGB 1HH6A 4YFLF 4EJ1C 1D5ZA 2IAMA 5T1DL 4G43B 5D1ZC 2BY3A 2YRPA 3LEVH 1R5VA 3SE9L 4K23L 4BM7A 5C0IA 3EBVA 3HI6H 4GO6B 1I1CA 3FQTA 4TSCH 1NMAL 4NRRA 5K9QI 2DI8A 3GJEA 1FL6B 3I50L 4AQ1B 4BK4A 5INDA 1U8KB 5K9JL 1XT5A 1Y6MR 1A9EA 4U6YA 1I9IH 2EJ1A 2HLAA 3FMGL 3V4UL 4WJ5B 5HI3D 5T3ZH 4EQ2A 5CJQH 5HPMB 3I85A 3ARDA 2XFXA 2QQKL 4BH7A 2E6JA 2RB8A 1U6AH 4HWBA 4H5SB 5JPNA 4KRPB 1I1XA 2FSEB 4W84A 2Z31A 3RPMA 3S98A 1QVBA 5I8EA 4Q97A 1D6VL 1RZGA 3ZHKA 1HH6B 4GAFB 1XH3B 3VFVA 1IKFH 1UXWA 3ET9F 3MRDB 4O4YL 4XWOC 1GJIA 1U58A 2A74A 5ANMA 3FQTB 3PQYE 4PLOB 4GXUM 3S35L 4NO5A 4OQ1A 3GJEB 4GBXA 1BFOA 4NZJA 2CXKA 4ZXOA 4QWWD 5INDB 2UVEA 2PYEB 3ZSTA 5J7CC 2O5ZL 4U6YB 2DQJH 5KS9B 4K3EL 3ARDB 3UTOA 2JF1A 3OPZL 2I9TA 2OX5A 5BYWA 3VG0L 1CLOL 3QEGH 3SO3B 3WKMH 4TVDA 3U7BA 4X9HA 4BH7B 3THML 4L8CA 3THDA 1QRND 4LQFL 1BBDL 1MNUH 3WEXA 3UPAA 5FYLH 2VLJA 3JTTB 2Z31B 4F9PA 1KN4L 4G8IB 3OF6A 3ZM8A 1RZGB 5T1MA 3EYUL 3VFVB 1CBVH 1UXWB 2RAMA 1QSVA 2CH8A 2VVNA 4LPUA 3QQ9D 1WAAE 5I8OH 5EU7C 3Q1SH 4JFQA 1U58B 1OSZA 2A74B 2ED7A 4RFEA 5ANMB 4UILH 1BPLB 3WSUA 4U1KA 1P4LA 1X4XA 4I8DA 4AEHH 4Z77A 2MHAB 3EAKA 1T1WA 1MRCL 4GBXB 3KPOA 2XVKA 1BFOB 4OIIH 2APTA 2H8PA 3RM8A 4X4ZA 4QCFA 3GIZH 2DJSA 2CKSA 2EQDA 2AQ2A 3N1PC 1MHPL 3O6LH 3K2MC 4PD4J 3G08B 1OAXH 4U1IB 1NBZB 3BIAX 2WMIA 3HE6A 1PZ3A 1U8IA 4WU5B 2HTKD 3DHMA 4D9RD 4P5KA 3WUEA 3VD4A 1L7IL 5T1MB 1PLGL 3MUZ1 1D5IL 3QO0A 2ED9A 1A14H 3HA0A 4F8XA 1F8TL 4Z7NF 4JFQB 3SKJL 1OSZB 3V5DA 4RFEB 5EWIL 5JW4N 1UYQA 4U1KB 1P4LB 4Z77B 4K71B 4XZBA 2Y07L 1T1WB 3MGTA 4OCRL 3TO2A 3KPOB 5DRZB 1DBAH 2J2ZA 3DROA 1OINA 1KF9B 4CD8A 2YA2A 1KULA 3FAWA 1QO3A 4G9FB 1S7SA 3OGOE 2W67A 2BVTA 4FNLL 3HE6B 2VXTL 1U8IB 5A6MA 3VRIA 3FO9A 2GW5A 4JO4L 1IQDA 3M8OH 5F9AC 2LQRA 4JHAL 4K7PL 4P5KB 3AS1A 5JHDE 2W0FA 4YC2C 3ESUF 4G3YH 4PIRF 4JFSA 4PB9H 5D4YA 4ZD3L 4WW2C 4LHUG 4BJLA 3DJ9A 3QO0B 1I9RL 1FHGA 2CRZA 2EDRA 2DSVA 3V5DB 4BZ1H 5IVZB 1WEJL 4P2OD 1TCRA 5EFIA 5DGQA 1NFDF 1EVUA 2XWJB 1JNNL 3TYGL 3TO2B 4UV4L 3ARBC 3GHEL 4PRPE 4LCCC 2CDFB 4Q6IA 1DBMH 3TH4T 5FF6A 1WPCA 1MW2A 4K8RC 4KMTH 3DROB 1E6PA 3BXNA 4D6FA 4XNZB 1KN2L 1XF1A 2YEZA 2EH7L 1QO3B 2UYLB 2Z8WC 4BFEA 4IM4A 1S7SB 4YXKL 1EFXD 1EQPA 4RZCA 1FE8L 2CERA 3S3SA 3GXMA 2MKLC 4BCEA 4MA1B 3FO9B 5I17A 2OYPA 1VFUA 2NY3D 1HT6A 1IQDB 2E9IA 3KPPA 1V02E 4K8RL 3S35X 5T1DH 2W0FB 2WIIA 5C70A 5HGAA 2DWEA 3WF2A 4GKOA 4K23H 2R4RH 2GJJA 1RHFA 2R69L 2UWEA 5CAYB 3HJEA 1Z9OA 2ICWB 4Q0XL 5BXPA 1NMAH 5EOQL 4OCMC 3DXAD 2NW3B 5A16A 1TCRB 5EFIB 3I50H 1PYWA 4XH2B 1EGZA 5L6YL 1LO3L 1ISVA 1QQDA 3X3GL 5FF6B 4Q6IB 4DEPB 2C4FU 1W8NA 3FMGH 4V1DE 4PRBA 4XPFL 3D3VE 3V4UH 3N9GL 4AEEA 2F74A 1PG7H 5LCVH 3BXNB 4UTBL 2YEZB 2KH2B 2J8UF 2QQKH 5IFJB 2AERT 1KXVC 2BNUA 4RZCB 1LL6A 2WVTA 3EUUA 1T22A 4L1HA 4AMKL 3BSHA 3QXVA 5I17B 1RPQA 1D6VH 1GQLA 2WSPA 4JFFD 5FM4A 5D7IF 3HPLB 1UEMA 5HGAB 2DWEB 4L8SB 4NWTL 1HEZA 3O2DH 2UWEB 1T7VA 4EDXA 3N18A 4Y4FC 2CLRA 5FKPB 4IDJL 5GNXA 3QO1A 3RVUD 3S35H 5A16B 5DHVH 5C2BL 2E7LC 3M45A 1PYWB 2F5AL 1U93A 1Y6KR 4BA0A 3VDBA 4YBHA 2O5ZH 3T0AA 4R4ND 3WIFA 4LP5A 4PRBB 3BLKA 4K3EH 5CJBA 3C5ZC 3EHBC 4MCYB 4PRNB 1CLOH 1EEQA 1WK0A 5TQ0H 3THMH 3WE6A 4F57H 4HOXA 3O3AA 2R2BA 2GSGA 1T22B 3NIGE 5I1AA 2XWDA 1A7QL 1KN4H 1J9YA 5IVNA 4GO9A 5A3ID 3MV9B 1PAMA 1YPZE 2ED8A 3MO4A 5I73C 1A7PL 1AD0A 2ESVE 1I8KB 2CLRB 1F13A 5A2AA 3QO1B 5JPMA 3I6LD 1EERB 3QQNA 2JIXA 3OQ3B 4OGXL 1ZLUK 2EDLA 2FATL 3MV7D 1OF2B 2VVSA 1AR1C 3SE8H 5TF1L 1I3UA 2IAND 2VL4A 3HCVA 3WIFB 1MHPH 2IBZY 4YHPA 4P7QA 3VJ6B 3BGAA 4KK6D 2J8OA 4K7P<