4OBSA

Crystal structure of human alpha-l-iduronidase in the p212121 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
594
Chain Sequence
APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLAAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human alpha-L-iduronidase in the P212121 form
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 194
structure length 594
sequence length 613
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2014-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4obsA03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4obsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4obsA02
3QNZA 4NNYA 5KOVC 2PF6A 4LSQL 1P5VA 2D7OA 3NSNA 2NMSA 4ZUWB 3ZKND 1PJ9A 2ADIB 2D7PA 3ILQC 1KXVA 2XPGA 1S7RA 4IOFD 1CD0A 2ZX9A 5F3HA 3HE6A 4ONOA 3CUJA 3V7MA 1M05B 5GJTL 2CKBH 4L5FH 4PRHA 1YMMB 1PKQE 5D8ZA 3ECBA 1UM4H 3G08A 5D7JA 4FFWD 4PJAA 4ZS6C 4X7DC 4HTYA 2P5WD 5T33H 2B4CH 1ZE3C 4X8XA 2YD8A 3KS0H 2ITCB 4Y5XB 2VAAA 4TULL 3VM5A 4FTVB 1QSEE 4DVBA 4KJYB 4EZMA 3P73A 2R0KL 1UCBL 5BOPA 3KXFD 3EGSB 2WHMA 1RUQH 5A2LH 4LLYA 4JM2C 3PTMA 4QHMB 2DTML 3IRZA 1ED3A 1T7YA 5EH1A 1Q9OA 5E8DL 5DYOA 5EO1B 3PWJB 3PWUA 5TPWH 5DD3H 1N6VA 2EH8L 2MQCA 1QRND 3PNWA 5J4MA 3O6AA 1W3JA 4X8JA 1FAKT 1KXHA 1U8IB 3D0LA 2DT2A 4ZUWA 3FW6A 1J1PH 3MNWA 5E1AB 4YXHH 2VQ1B 2JIWA 2DQCL 4O00A 5IMMB 2D31A 1B6UA 4G3YL 4XVSL 2V9RA 1KJVB 1HHKA 3VIJA 3GMMB 4N0YL 2G2RB 4RZCB 4ZAKA 1PKQB 1OOAA 2ORBH 2BNQB 2XYCA 3CPLB 2CDEB 1I9JH 3VPLA 2JK5B 3E8UH 1DFBH 4CVZA 3AXIA 3QNXA 4M1RA 1A7RH 2QQLH 5IK3A 4Y16C 3NJ3A 2B5IC 1TVPA 3B43A 5GIRB 4ALAH 4H8HA 1NP0A 3T0XA 3KPSA 1PW3A 2DB8A 4LPUA 4AJ0A 4YO0B 3SKOA 3QFJA 4KTDL 1BQLH 1Q1JH 3JXAA 4JM2B 3AROA 5E94B 3CLEL 3UG3A 2CXGA 3BO8A 3WEXA 1U8JB 5ACLA 2XRAL 2ZNWA 3DO7B 3UTSD 1G9HA 3AC0A 5J11B 2F8OA 4OZHF 5I18H 5I9QC 2VCAA 2VL5B 3O6KH 4GAYA 2XTJC 5D7LB 4XX1E 1SJEA 1AQ0A 3H42L 4X99A 3WE6A 1AGEA 1W2KT 5C08D 3LKOB 2BNRB 2X1XR 1DQJA 4JFSA 3VXSB 3B9KB 3WNNA 4OFKA 1ZA3A 4QTIH 3JV6B 4WU7B 3EYVA 2ICWJ 1B2WH 3ZDYF 1VGEL 3HRPA 3UR7A 4HPOH 5D9SB 3CUIA 4RCAA 4NO0D 3WKNA 3V6BR 4LDLB 2WMIB 1AGFB 1KB9J 4P5MA 3EFFB 2ZCKH 3UP1A 2W0FA 3U36A 3GGWA 3IDMA 5F70A 5J13C 4M7ZB 4M93C 3ARGC 1V3HA 3KPQA 3T2PA 5I6XB 4YNYA 2HH0H 1BHGA 3BWUC 1S9YB 3QIBC 4KRMB 3GSUB 2OM5A 1R3KA 2A73B 4H0IA 1QSFA 3CFJA 5DHXB 5I1EH 5CUSL 1RULH 3BJLA 5DRNB 3WFEL 1GOKA 3VXQB 1LP9E 4RAUA 4LRIC 2JELH 2R0ZH 1MHEA 1UD5A 4DVRH 7FABH 1KXTA 3DTXA 3F65A 1DE4A 3JVGA 3VGAC 3PV6A 1FFPA 5HBFA 1ZGLM 3RY4A 5D2LB 5DR5L 3K46A 2MHAB 4Z76B 2YL8A 2DS4A 1HSBB 3T1WA 4ZXOA 5DVMA 3W6LA 2H3NA 1E6OL 3OQ3B 2YL9A 4PJDA 3W39B 3M1BA 3STZA 4I48A 5IVNA 1K4CB 5ITBH 2V38A 1U6AH 3D39B 2N1KA 1KCSH 4Z7UF 5AYUL 15C8L 1CGYA 2ZXDA 1U8HB 1ES0A 2DQTH 3Q5YA 5M95B 4P5MB 1RD6A 4URTB 2C1OA 4Q2ZA 2Y36L 1U58B 4OBRA 2MCPL 5E5UB 4PY8J 1WK0A 1S5HA 1FFRA 3OR6A 5FDYA 4G6KH 4MJ6A 3W28A 3UTZB 3BH4A 5FV2A 5GRVK 4XCFH 4WKAA 5HDRA 1G6VK 4OV5A 3SE3C 5LWYL 5DT7A 2WMGA 5GS0C 3OR7B 5GGSY 4ZPVA 5JZ7C 3AU1B 4MNQA 3NIDF 5HDOA 5I1AA 1Q0XL 3P4MB 3QISA 4BQCA 5E8DH 4QP0A 1D3CA 3FQRA 2L0DA 2Z4QA 3ARUA 3DX8B 5DMIH 1XGZA 4D3CH 4W8LA 1OBAA 4OTXL 3SCPA 4UINH 2FYYB 3REVA 3S37L 4XP6H 2OBGA 4LLMB 4JFXB 3WFHA 3MO1A 5LBSL 2J4WL 2WC4A 1HIML 5DT1H 1J5OH 3PUCA 5ALBL 1NFDA 4S0TD 4JFDB 4EUPA 5A8NA 4CNIB 4G3YH 3GXIA 2YBRA 3CMGA 3W0WE 6TAAA 3KR3L 1FO0H 3VMNA 3EMZA 2VXUL 5I5RA 3QQ9C 4R2GD 1J01A 4NQCA 4RGNE 2VDLL 1FPTH 4CD6A 4WHTA 4FXKB 2Q86B 4G8EB 3QEQA 4ODUB 4XNMB 5EORH 3DRTA 4EBQL 1HOCB 1HSBA 4LEXH 2WYSA 3MXVL 4QRSA 4XMKL 4XXDB 1UADC 1RH9A 4ETQA 5IVXE 4R4ND 3QXAB 2ZCLL 1AGBA 1HILA 4M8QB 3ARQA 1QW8A 2QSTA 1Z9LA 4XBEL 1AHWA 3WDJA 1GW1A 1JPGB 4R0LB 1FORH 2YD6A 1CD1B 1W8OA 1L6XA 5GZOD 1FLRH 1NC2A 4G8FB 5AG8A 4KC3B 1Q9LA 4XNUH 4W6XB 1WC7B 4ELKA 5KZCD 1WT5C 2DDQH 1CZ8H 2H41A 4AG4H 5D1QD 5HYQA 5DHVB 3T65A 1NAKH 3S34L 2I9TA 2YK1H 4NM8H 1KJ2B 1QKZL 3LV3A 4XI5D 5F7HA 5ELIA 5I1AB 1NBZB 3W9EB 3SKMA 1LE5A 3K8KA 4FG6C 3MCKA 1E6RA 1VFAB 1C5DA 3QJFA 5TE6L 3EYSH 4NBYB 1W9BM 2YWYA 3KLHD 5GS0D 1HIZA 4CMHB 3SDCC 3FKUS 3GMMA 3RNQA 1KCUL 3JWDH 4P4RB 2P5WE 5D70H 1VA9A 2D20A 2X1PA 4IRZL 2PCPA 5CEYB 2OL3B 1QYGH 5DQJB 5D93C 1J9CT 1K4DA 1LEIB 1ISZA 3BIKA 3QR3A 1UD6A 1F11A 4GKZA 5H94B 5KTEH 4P2QA 2CIIB 2WZEA 4Z5RB 1RJLB 4XCNA 5BWFA 1PEWA 4M03A 1ZHLA 1T4KA 4YBLB 4LLYB 5DSCB 4MA7H 1FBIL 4MSWB 2UY4A 3WF1A 3CFCH 1CICB 1ED3B 2C1PA 2F54A 5F9OH 2UY2A 4P8WA 1RUKH 2AV7B 2I9TB 3GIZL 4G9FE 1TZIB 5HOSA 4W4NA 3VIMA 4LGXA 2R69L 3JTSA 4G7VL 4JFFE 2PTVA 3WS3B 4GMTH 5H35A 3CZEA 4H04A 2O5XL 4YZFE 2NW3A 1WGOA 1XF4A 5KN5A 3QIUC 4J2XA 1MFCL 2DLFL 3SHSA 4L8DB 1GOQA 3HPJB 4G8GB 1CLZL 1DQJB 4L9LC 2ZKHH 5SX5K 5FUCC 4K23L 1IBGL 5EZJB 4JIEA 2VN7A 2HFFA 2IALB 4IRSD 4XBPB 2I60H 5IHUL 4JAMA 2CO6B 4J3UA 1X5ZA 1OPGH 2WMIA 2Y8KA 4JZOB 2ESVD 4FHBD 1GC1C 3LQAC 3RA7L 5E2TL 5GGTL 1CE1H 4AY1A 5D2LF 1UWIA 2G8ZA 1EDGA 3ES6A 4U6HA 3KPQB 1T5XB 2NX5D 1FFOB 2X9XA 2DQJL 1VEMA 3OKMB 5DI8B 4YHZL 3CDCA 5DEGA 3BFOA 2XWJB 3HLAB 4MA3A 2OYMA 1MCJA 1EV2E 1E56A 3MLUL 2VLRE 1OINA 4QHUB 3QI9B 4HMCA 2V2XA 4LCCB 1BPVA 2WZPD 2CGRH 5CJBA 1G7IB 3PZIA 2VDOL 5F9WB 3D69A 2VERN 3PDGA 5BYWA 2FD6H 2MHAA 2BC4A 1EVTC 1FYTB 3MV7D 2EIDA 4KQ3L 1OARH 4L3EE 3WFDH 5I2IB 5CPQA 4NKOB 1HYSD 4Z7OE 2J4GA 4D0BA 4D1JA 1MIEL 4JFZH 1K4CA 3ZHLA 2IXUA 4U1JA 4ERSL 4WFED 3G9AB 3QDJA 1NP2A 2WPGA 1P4BL 3WJLC 3OKEA 3QNYB 5CGYD 1LL6A 2YDRA 3NCJH 4LLWA 1K9DA 4I2XE 4HX1B 3S3PA 2IFFL 3HMXL 1MFDH 2X4OB 3D2UB 3BPCA 3JBG7 4BJLA 4JKLA 5F96L 4HWNA 4GPNA 2VRQA 5A43C 1DSFH 5DRNA 1LD9A 3MRDB 4PJHE 2IAMA 3PHOB 2EEDA 2AJXH 1T5WA 4YHLH 2HKFL 2CR3A 3S34H 3QUMA 4POYA 4M1GH 3QXTA 5F44A 2R23B 4QO1A 5DK0B 2GCYA 5CJOH 1OQOA 3MUGB 5ENWB 2Y5TA 4RWYL 1IZKA 1MF2H 5TE6H 1DUZA 4OD1H 3IDXH 4TVUA 3RBGA 1JGVH 1MCQA 2OTUA 4X4ZA 3QWRA 3VH8A 4DGYL 1SM3L 3QHFL 1C8PA 1RMFH 3W4RA 2WBJB 1VGKA 1KCUH 2KH2B 5CP7A 5FCSH 4I0PA 1OAUH 4UB0L 5DWUL 3OKEB 1C7SA 1T0NA 1V3KA 5B3JF 5ADOH 1G6RL 3DGGA 4LBEB 1HHJA 4NRXB 2JLLA 5D6CA 4LPTA 2VLJB 1U8QA 2V2WB 5C08E 1S7UA 5EU5B 2CKRA 2MCPH 1KPRA 3WD1A 4X6FA 3HE7B 4JO3L 3MV11 4JY6A 3T2OA 2FHFA 4WI6A 3CZGA 3WKMH 3EYFA 5DEFA 1IM9B 4OIIH 3D9AL 4QHNA 2HT2D 3BD4A 3WUGA 4KK8D 2C9AA 4QHLA 1EXPA 4JR9H 1C8QA 4IHOA 1BFTA 3QQ4A 5IW3A 4G7VH 5C0BA 2LU4A 3B9KA 1KN4L 5IB4B 1DANT 1D5ZB 5I2UA 5F3BA 2R2HB 4DOHE 5F88A 3K4DA 4MZ2A 2GKIA 3ILPA 3SOBH 2FH6A 1CGSL 2ICES 3HB3C 5I1GL 4CUCA 3PF2A 2AS5M 1NGQL 4HV8B 1LVEA 3GBNL 3PGCA 2J4WH 2VMFA 3MOBL 2CDGB 2IAMD 1IT9H 4NZRH 4Z0BL 1EFXA 5I76B 1RURH 4Q7DA 1C5DB 2XQYK 3GEWB 1II4E 4CD8A 3V8OA 3AHTA 3RY6A 3HE6D 5ALCH 2MFNA 3KR3H 4XPHL 3SGEH 1NBYB 1U8OA 1A6PA 4OLZH 1JGUH 4A3YA 1HKLH 3AFLA 3K80A 3VXQA 4UNIA 5EORL 4BA0A 4TVCA 2Y06H 5FD0A 4LEXL 1R3IL 2VLRD 3SJVE 3HC3L 4LHJB 1YNTA 3O6FB 4MDIA 4Z7WF 1JZ5A 1PG7W 3WDPP 3ALXA 1DBKL 4OUOA 5FEBA 3CUFA 1BJ8A 4EI6A 5DUML 3UTTD 2HWZL 2QTEA 5ISZE 3OGOE 1W3HA 3WBAA 3I84A 1EK3A 1VFUA 3IDGA 4AENB 4NT6A 5HPMB 3D39A 3H2WA 4OKVA 1LHZA 3TN0A 3K2MC 1DP0A 5A6AA 3GSVB 1J87A 1HVXA 3GNML 4E41B 3BXWA 4XZBA 4BM7A 3GJFK 1OTSD 3AY4A 3QSKB 1MJ7L 3DUUB 4HIEB 3QXVA 3VGGA 4C56B 2CKNA 1D5ZA 2NT1A 4BQ9A 1H8OA 3G6JB 4BZ1H 1DANU 1U8OB 4DKEL 2R2BA 4Y4FC 1T83A 4MJID 2NY3B 4KY1L 4PD4J 3BESR 2JF1A 3OR7A 1JTTA 5J6HB 3KE0A 5FIPA 3IF1A 4EIGB 4G6ML 2AJ3B 4W5ZA 1CZ1A 3DC0A 4XVJH 2OP4H 3WUWA 4U2YA 4M1DL 4ZUVB 2WVUA 4JDZA 1TFVA 5D6DA 3CMJA 3O8XD 1U9KA 3K1DA 4KH2A 2ICWI 1UA3A 5IR1A 1S7RB 2XXMB 3VFMA 2YKKA 3JV5A 3ELAT 3MJ8A 1U41A 1M6OB 2E7HA 1ND0A 5A16A 5ABDE 5DI8A 2ATKA 1YUHB 4Y4KD 4H0HB 1XH3A 4UFMA 4M5YL 5HI3D 3V95A 5FF6A 1R5VA 3S35X 3RX7A 5FXCH 2V9QA 4HLZH 3AREA 4P7QA 1E0VA 3MRMB 5M7QA 1PZ2A 4KHTL 3IJ8A 1ZANH 3SDCB 3P73B 1G9NH 3QDMB 1GOGA 4YH6A 4F9LC 2X7LA 3MV7A 4D9QD 3G6JA 5ADPH 3RZCD 1MHCA 3G5XB 5BS0A 2O9RA 1G6RH 5EBLB 5EZJA 3CSGA 4I9WD 5IBLC 2XFXA 5A95A 2ID5A 3IFOA 4DGVH 1QFPA 1PQZA 5J9PA 1OAKH 4KVCL 4OGXH 3ZT7A 2GJZA 2R39A 3RWHB 3UMTA 1BD2A 1KWGA 1NUGA 1CD1A 4Y2DD 2ICCA 1NMBL 4GO9A 2W4XA 2XICA 1E28B 3GNPA 4QT5A 3MNWB 1A1NA 4JPIA 3GJEA 1QSEB 5I1LA 3VVGA 4KXZI 4L4TA 1JGLL 2D23A 5F6HJ 5JR1L 1X5HA 1NWSA 2ITDB 4NQVA 2QPSA 3BPCB 2VISA 3K4AA 4MZ3A 1MFAL 4XPAH 2OMNA 4XZUA 4Q9CA 4AZGA 3P4OB 4OZHA 2CDEA 3N1FC 4TPRL 4IRSC 5FYJU 3W2DH 2HMIC 4Y4HA 1T5WB 5GGRY 1EOMA 2DWDA 1MQQA 1JD7A 4UZGA 4TX8A 4YGVA 3OX8B 4UT6L 3OXSA 4NOFA 4F7EA 1UQZA 4D9RD 1NGQH 3D3VB 4AD0A 3C8DA 1OP5H 5D71L 4NDMA 4WHYG 1BWWA 2BC4B 3BN9D 2DQCH 3V9FA 1UHVA 4HGKC 4J7RA 4JPKL 3PZUA 4WUKL 1A4KB 3RWIA 4HFWB 5J9PB 1T03H 1HYSC 1HXYA 1W9VA 1JUFA 4TRPH 5CHNB 4M62L 2GJZB 3PTKA 1M7XA 4GKZB 1T1YB 4E0RA 3SDAA 2H6PB 4Y8DC 5A6JA 3L95A 5JXED 3IKCB 4RGOH 3QDMA 5IOPB 3GSXA 3QG7H 1UGNA 5ICYA 3BLKA 3NDZA 5GS0H 2D24A 3BH8B 2PO6D 5EU6B 2RAMA 2XNAA 3VA2C 5DD1L 3VINA 2QSVA 4XZUB 3OGVA 4OLXL 1KPUB 2BS9A 1XZ0A 3OLIA 4F8XA 4R7NB 2IFFH 1NSNL 1EUUA 1F6AB 1QRKA 1FSKC 3HI5H 2Y4SA 4AZHA 4D6EA 2VITB 2XZCL 2Z31A 4LDEB 2GK1A 1KBKA 1S9VA 3MA7A 4G5ZH 3ZDZF 1I9RL 3CLWA 2D4FA 4OFPA 1IQDB 1WT5A 3D3VA 4WUUE 1OW0A 4IRSA 2C3HA 4P46C 4HMEA 4I8DA 2EYTB 4PSRA 1ZK9A 5DYOB 5CBEB 1QQDB 4S2SB 5I19L 4D6FA 3GSUA 1I8IB 4OGYL 2HVMA 4H25B 2R4SL 3VXMD 4PMUA 4IRJB 5C09A 2XVKA 1VGEH 1D6VH 2YPVL 3QEGH 4CCDA 1VGKB 4Z7QF 5C0ND 1ZHKB 3G5VB 2E40A 1EEQA 3V4VH 4DN3L 3G6LA 3ZTNH 3PV6B 3ULVC 4BFBD 4W85A 2Q7NA 5DK2A 5D1QA 1BBJB 1OTUC 4WWKC 5B21A 3ZE2F 3APGA 2Q6WA 1BFSA 4ZXBD 1BWMA 3G08B 5D7JB 3RPKA 1UACL 3T3PF 4UTAH 2GEEA 2J6EH 4PJAB 4HIXL 3ARED 5CHNA 1CDBA 1AD9A 3BH9B 4XNXL 1AQMA 5GS1B 3CPUA 2A0LC 1RK0A 3OGRA 5A69A 4OCXH 1UQYA 4WWID 5DFTA 2OXHA 1EBAA 3R06B 1KULA 4HKZB 3D18A 4TULH 4EI6B 2IPKB 2ZOLA 4WO4A 5C6PB 4MD0B 3KPRD 3O3DA 5EB8A 1RZKC 4JFDE 4UAOB 1GQLA 4JZNB 1Q9OB 3UTZA 2QMKA 1G7MA 3O3EB 1G7JA 3FB7B 2W9DH 5LVEA 4YEEA 3V0AC 1CENA 3SKMB 3MS8A 3CSBA 5HGGS 1GONA 4QXUH 1MCSA 3FONA 2JEQA 3MRBA 5C8JB 1DTUA 1IQDA 4UDTA 1UXWA 1GRWA 3BEWA 1HHIB 4TNVK 2BY1A 1Z6JT 3RNQB 4CBPA 1NCAH 2Z91B 3AVEA 2WP3O 3RILA 3MJ7B 2EECA 4ZO7A 1D5IL 5D1ZB 4QCIA 5HYIA 5LA2A 5D1QC 4DZBA 2ZP0T 3BIKB 3T0EA 4I5BB 1IQWL 2FECL 2EBNA 3WHXB 3MRFB 4LHQB 1CLOL 1OSPH 1T89C 5TDNA 3FNDA 2EDEA 2C3VB 4MQSB 3L7FA 1NUDA 1A6VH 1ZKAA 3MUGA 3U46B 1AKJA 5D7IF 4WGWB 4UIKH 3A6OA 3HC3H 1R3KB 5TDOA 1TZHA 2OWXA 1V6XA 5HHOB 4LASH 4RIRA 3O3EA 5JW3L 3OPZL 4DUWA 5C2BH 1GGBL 3X17A 2J7BA 4F66A 3M7SA 1DE4B 3OKOB 3LPWA 4MAUH 1H0DA 2R9HC 4Z7OF 4JFFD 4NQXA 3VMOA 1VAHA 4OUUA 4AD4A 5FYLD 5FUOL 3S3JA 3FB8A 4EAMA 3QG7L 4OLWL 3WDQA 4U3XA 2BRRH 3QAZC 5C0NC 1I8KA 3NPSB 3IJSA 1WIOA 4NGHH 3FO2B 3QIUA 5C3LD 5FKPA 5F1KC 3PQYB 2R15A 4OLYH 1NGZB 1NEZG 4WI2A 3VFOB 2G4FA 4U5KA 1D5MB 4GMSL 1QI0A 2PETA 5C0BB 1JHKL 4WFGD 5T5NF 2PYEA 4C7FA 3NZ8B 1X5LA 2K1MA 5JBDA 3O2WL 4ODTH 1CL7L 4YDLC 1UD3A 1K2DA 3WENA 1DQQB 3EHBD 1QBLL 2EC9T 4ZOAA 1RIVH 4NZTL 1BTCA 1KIRA 2DL9A 4ELMB 1MY7A 1U3YA 4XP5L 3U4AA 3BJ91 2UYLB 3OKOA 1PX3A 5IG7A 5SV4A 1SYVA 2A6IA 3WLWC 1NUFA 2YC1B 1JNHB 1NBQA 2BVOA 3HZMA 4UFIA 3MO1B 5GHWL 3TESA 1ZHLB 2EDOA 1JHLL 4PJ9A 4F7PB 3D5OF 2QADD 4GLRH 1YQ2A 1FGNH 3TVMA 4G80B 3OG6B 5DRXB 2IBGA 4MDOA 1HI6B 5HVHB 3LSOA 5EBLA 5FYKH 5JLZA 1HDMB 4LPVA 3C9NA 3MYZA 1UYWH 3KJ4C 3JUYA 3VD5A 1CGVA 2JIXB 4IRZH 1U8HA 3I6LD 5E0FA 2R2EB 4NKIH 2EPNA 3B2VL 2HJLB 2AXGB 4C56E 5DJ6B 1OWQA 4U7SA 5E6YA 1IKFH 5C07B 3SDXF 3ARRA 4CADB 5EU3B 5BMFH 4MA8L 4PJEA 3RHWF 3ZKQD 3OHXA 4G8GA 4M7LH 4WFHD 3QJHA 1FRGH 1T1WA 3ULSA 4XMLL 4W86A 4Y16D 5I1CH 5JQ6H 1Z9MA 4OFDA 3SN6N 1HEZA 3TN0B 4XMPH 4NQDD 1BMGA 4Z7UB 2EDRA 4H1LB 3VXUB 3RZCA 1LE9B 1BF2A 4XTRD 1TG7A 1I9EA 1C92A 1U8IA 4KK9C 4H8VA 4ZPTA 4X6CA 1LO5B 2NY3D 4FK9A 2CR6A 4JQXC 2WMHA 1LQSR 2GK0B 2X5PA 4X5WB 4IOIA 1FZJB 4MX7B 1FAIL 4PJ8C 1HJVA 1SEQH 1T89A 2P47B 2GFBA 4PRIA 3BPNC 3U1SL 4LQFL 4S2SA 4EI5D 1WSST 4Y19A 2E27H 4QRPE 1IBGH 4Q74A 1GCYA 1MHPL 4P2OD 4TVPD 5IROC 4L1DA 2VLLA 3W11D 1FZKA 1NMCB 1BVLB 1F58L 4H88L 1NGPL 3V6OC 2FR4B 3DWTA 2J6EA 1ETZA 2F54E 4KPHH 4U6VH 5D6CB 4KK9D 4PJFE 2VCCA 3EMCA 2YD5A 4L4JA 1CIUA 4F7PA 2V17H 4ZXBA 3IGAA 2AV1B 5GGTH 1JWMB 2AK4A 1QSZA 4MLSA 4KKBC 2VOTA 3A67L 4M6OH 3VCLA 3KWWA 3QGVA 3UJIH 4PRNB 5FYLH 3S35L 1E6JL 1PPIA 1PSKH 2L7UA 1MRDL 2CERA 1TITA 2VITA 4HGWB 2GK1B 2HT4C 43C9B 4I18B 4UNTA 4KUZL 4AYSA 5D1XD 1MIML 1WC7A 3CAFA 4PJXA 1ZLWH 1Q9KA 4IOFC 5AAMA 4NUGH 2IPKA 2ZOLB 4WO4B 4F2MB 1XD0A 1NCDL 2D9QB 2CYGA 1FVEA 3OJDA 4KKLC 3IFOB 4KTEH 5CBEA 2OK0H 4RQQB 3DOSA 2WINA 1H3XA 1DBML 3O4LD 2OSWA 2EDLA 1JDAA 1MCNA 1ZWIA 5DRWA 4BK5A 3RX5A 2ZICA 4LVNB 1CLYL 2ZUWA 5KVFL 3BLPX 5F9AC 5DO8A 1NOWA 3ZKXC 4OJYA 1A5FL 1S3KH 1OL0A 2XZQH 3HNTL 5MEND 1YN7A 4HF5H 4JQIL 2GUOB 3H9SB 3VIFA 4OZ4A 4O2CA 3EYSL 3VFGL 5HSFA 2NW0A 3CVHA 1YYMH 1PG7H 3LIZL 3ZJ7A 1F4XH 3PABA 3P30L 3IS1X 1BVKA 4LP4A 4JM2D 4X9GA 2VAAB 5J13B 2J6EL 1CLCA 3O45A 4NC2B 2B31A 4PRHB 3W5MA 4AMCA 3ALFA 1M7DB 4R4BA 3Q1SH 5DMKB 4U1KB 1CD9B 4PIRF 3AIUA 1BOGA 4FZEH 4G7YL 5GISH 4QHUA 4ML4A 3NSMA 1FGNL 3TH4T 4UOW1 4X8JB 3OKYA 1J0YA 2Y5EA 3ESVF 3VFSA 2NLJA 3AMGA 1KXQA 1KEMH 1LNUB 3WXVH 1I75A 4JEGB 3RWFA 4DWSB 1P2CB 1S5HB 3BH8A 3I6KA 3DNKA 4BFGA 5GJTH 4JFHD 4F37K 1U8KA 3RDTC 3FO0L 4V1DB 3LQZA 5EO0B 3LEYL 3PP4H 1R0AH 1NFDF 1E6PA 3U6RB 3PDOA 2ZWZA 4ONHB 2OMBA 5CD3B 2K3TA 4NKDA 3MA7B 1BPLB 1QBMH 2YRZA 1XT5A 4KI5F 3W9DB 1UD2A 3HU7A 2I60L 5IHUH 4ENEC 3DUSB 4NN6B 5FYJE 3GBDA 3TBYA 1G6RA 4G6JH 1T7WA 5E2VL 4P23D 3THCA 3DBXB 1KPVA 3PP3K 5A94A 3PQYE 2EYTA 2YS4A 4LYRA 4JFEB 1JHTB 2DSZA 3C5JA 5BZDB 3NH7H 1JGEA 4HJJL 5E4EB 4YPJA 4JAWA 2OWWA 4UR9A 4QGTA 5MEOA 5I30H 4NNPL 4G43B 4YPGB 5BO1H 4RAVB 4PRAB 1A7QL 2VKWA 4QHKI 3MRQA 3MV9E 3MGOA 1QFWI 4HC1H 3DHUA 3OTTA 1M71B 4G8EA 4PJAE 2BOCB 2DMBA 4FXGA 3RWFB 4DWSA 4HAGA 3JVGC 1OVZA 1V6VA 1QRNE 4PP2A 2DMCA 3VXSE 3WY1A 4XRCA 3CC5B 4DAGL 3EO0B 2CDFA 2YD2A 2XY1A 3RPMA 3MU7A 3HI1A 2YPLA 3W38A 4QY8A 4LLDB 1QI4A 3B2UD 2W59A 3MRCB 5JW4M 1JGUL 4GUPA 3WFDL 2OX5A 2WKLA 2B7DT 4HCRH 1G0XA 2O5ZL 1EEYB 4ZFMA 3KPRB 2WAHA 3O9WD 3A3HA 3IDNA 3OJ2C 4X7TA 4IMKC 4RRPG 1YZZA 1FDLL 1Z5LB 3DVNB 4WU5B 5MI0B 1DBKH 5BRZB 1TCMA 2E9BA 2XA3A 2ZPKL 3I75A 3LKPB 3DXAB 3MRIA 4Z8FH 3NCBB 4NYLB 1I1YB 5HD8C 2UZIL 1KJ2A 4Y5YC 1NPUA 4QRQB 5C0JB 2QEJA 5D5MF 4YR6B 4JGMA 2E9IA 3MACH 5I77A 4HP5A 4X6CE 1H4PA 4AEFA 2F5AL 3GI9L 1WZAA 5E5RB 2D3LA 2X05A 5KSAD 5JMOC 4OM1H 2YPLB 1PVHA 3C5JB 4P4RA 3UZVB 1JCKA 4MB4A 3VM7A 4J4PC 3V0WL 4I5BA 1BVZA 3CMOH 5DD5L 5T3XL 5I8KH 1T1YA 5L9DH 3PXJA 3ZOAA 4MXQC 1KEGL 1Y6NR 4M7JL 3GM0A 4NJAL 3SJVA 3AB0C 1NEZB 1ACZA 4CRPA 3X3GH 5GS1C 3WD5L 4ZNCD 2LFGA 1DZBA 4RSVA 4V2CB 3GXDA 3MSDA 4MQTB 2GSGA 2ZX8A 2IJ0C 5CJXA 5HHVH 2YWZA 1YNKL 2WXDM 4XNYH 5BZWB 4UILL 3GJFB 2BSSA 1U8NB 3I3EA 3L7EA 1ITCA 4JRYD 2Z31B 4TUOB 5E8NA 1LO0H 3VUPA 4MJ2A 4POZD 4DVRL 3F12A 2A38A 4ODHL 7FABL 4NZCA 1KCVL 4NUJB 1CF8L 4WFEE 2AJZA 2CNCA 4ZUSB 2FLBT 4GKSB 1DVFC 4AIUA 5F3BB 5DQDL 3FZUC 5F71A 5GRJL 3KXFA 2WCSA 4NNXA 4B7IA 2HFFB 4UNVA 4O2EA 5C0BD 4M6ML 4JLRA 1NGXB 4I2XA 2A3EA 3FO2A 4L9LA 2WB5A 4XAWH 2CUIA 5HHQB 2VABB 1SEQL 5C09D 4E41A 3V4UL 5CSBA 4P23A 3WUZA 1C91A 2SEBA 3VXTB 4X80L 4FXKA 4QOKE 2Q8AH 3W81A 4R96A 3DRTB 2APVA 4MVBD 1LP9A 4AD5A 4HKBA 2WMKA 1MCOH 1RURL 4ODXA 4CD4A 1X5KA 2BHZA 2W38A 5TE7L 3C08L 2V5MA 1AD9B 4OLVL 2YBRB 4BFIA 1IC1A 3T04D 3WDIA 2NXZC 1I1RA 3CUGA 2G75B 4CKVX 2AJSH 2Y06L 1FH5L 4WTZA 4ZDHA 3VD7A 3LN4B 5LGHH 2XG9A 3O45B 4KMTH 2EDJA 4XGZB 5AYIA 1Y0LB 1FZOB 1CGUA 2YSSA 1KACB 2XVGA 2NY1C 3VWJC 4D0CB 4CJ1A 5FGSA 1JGDA 4YXKL 3ALWA 4GXUN 1JMZA 1T22B 4BSVB 4TOYL 4TUJA 1UUQA 4HWEL 2X1QA 3CU7A 1S7SB 3WSQH 3BP7A 4LCWA 3RVVC 4QWWD 5IVXF 1K85A 4TRPL 5D96B 1RJYB 3P2TA 1VFAA 4KI5C 3FB5A 2XGBA 2Q3ZA 1QBBA 3TYFB 3TN0D 3ARZA 2HLAB 3OWEA 4LGRB 3VXUD 3KPOB 4J3SA 5E9DB 4IRSB 5HI3C 2AEPL 5E2WL 2CRMA 1VBUA 5HHMD 2N56A 4IM4A 3U5YA 4JKMA 3C09B 5EO0A 2RFXA 2C4FT 2IC2A 1UXSA 3VG0L 4LSSH 4PRID 4N8VA 4S3KA 1I9IL 3FQXB 2BX5A 3QFJE 1MQKH 1S7WB 5CQ1A 3G04A 1BFNA 2WUBL 1O7AA 4M82A 1HHHA 2A6DB 4IDJL 4KRPC 2QL1A 1M6OA 3NUKA 1M03A 4NC1C 2P8PA 3P11H 4CGTA 2HTLD 2ZOKA 1WKYA 2QKIB 2A3HA 4P4KD 4U1KA 1A7PH 1RUAL 2VXTL 2OQJB 4AH2A 4EN3D 1RZJL 4HCRA 1XF3B 4O58H 3NAAH 1MVFA 5C86A 1U2HA 3OF6D 1OM3L 3TA3B 2VWEE 1HSAB 5JW4R 5I75B 4OUUB 4N1EA 1I4FB 3ZYOA 4HT1L 1N6QL 2WWDA 3O3BB 3U2SB 1HL8A 4F15B 3LEXB 3MV9B 1DLHA 5FM5M 2VLJA 1MFVA 5E6ID 2DMKA 5EIQA 1I8MA 3L1OH 5FYJH 4I18C 3LQZB 3JWDL 3JWOH 2J8UA 4GRMB 3AS1A 1UACH 4H5SB 4S1QL 1QPPA 1RZFL 3FN0L 4P59H 2XKUA 4JRXD 1HINH 3MRRB 1MAJA 4D6DA 3OAZH 4WFFD 1RZJC 1P9MA 2M8XA 4AIOA 2JJSC 3G5ZA 5GGRB 1QA9A 4LPCA 3BRGC 5EU7E 1TA3B 5SX4I 4OCXL 5IKCA 2DD8L 4HPYH 3LRHA 1UQSB 1QRNA 3A6CL 3T77B 5ILTH 1EEZA 4RQQA 4Z7VB 1OGAB 1KLFA 2JJTC 1W9XA 3BP5B 3OLGA 3QXDA 2J2ZA 5LGJA 3JV4A 5AYBA 2RCSL 1MLBA 3PJSA 5JBFA 3DARA 1LL7A 4XP4L 4AIZA 1MOEA 2VQ1A 3H0TB 4TSAL 2B1AL 3GH7A 4JHOA 3DX8A 4HJJH 2IAMC 4L8BB 2UVFA 2EE2A 2WCAA 1EDQA 3VWKD 1DWJM 1FFOA 4J28A 1E15A 3OAUH 3U7AA 1Q6FA 4XRCB 2XWJA 4MA3B 4HC1L 4UV7H 3RVXC 3AMKA 5D4QA 3PWPB 2ARJA 3GXFA 3N18A 3CJJA 3IXTA 5JIKA 1FV1A 3K2UH 4XWGL 3EDFA 5KVGH 3MROB 4C83A 3VXMA 4F80A 2J12B 4PMQA 4TVPE 4PYSA 5KAQF 1MRCL 2VXSH 1DLFL 5JUEL 3TN0C 4Q58C 3PL6C 2CPUA 5DJYB 4Z7NE 2F15A 2HT2C 1FPTL 3QWOB 43CAA 5C0GA 2QMJA 5TF1H 1UA7A 3LEXA 5BRQA 1J0JA 4XPGL 3MGTA 1W32A 4UI2A 5LQBL 3WQ6A 1CFSB 4I4WA 3P9WB 5T1DH 2ESVE 3VU2A 2IANA 3MX0A 4D9LL 3IAQA 1XGPB 1MWAB 4NZUL 3I2CH 1UZ4A 1NGWA 4OZHE 3UJJL 3HUJB 3PHOA 2GJJA 3IJ7A 4HQQH 5A2IH 4GBXC 4X6DF 4UFKA 3VFOA 3NPZB 3ARFD 1A2YA 4WCYH 1S9XB 3AISA 4GXPA 3QIBD 5CP3A 1KTLA 1CBVH 5DMYA 4P2YA 1RHHA 3L3DA 5BW7A 8CGTA 1UOKA 5HYJD 5B38A 5AC4A 1WO2A 1CZ8L 4PJGE 2NY5C 3UCRA 4QAWA 5CINL 4AM0A 2IAMB 4RX4D 3PHQB 3O2DA 3ZT5A 5DQ9B 4UQ9A 4JRXE 4NWTH 4JDVA 1BQSA 1YECH 2CUMA 3FHAA 4CVUA 1GVYA 4QRRA 3GMQA 3BZ4B 1MW3A 4WNQA 3NCJL 2BFVH 1AQHA 1LP9B 4R9HA 5L9DL 3FHQA 4JFTA 3WKZA 3KPTA 3QIWD 4U6TA 3KYKL 4GFTB 1VBRA 2ATPB 5D6DC 2WNGA 3PL6A 1ZBCA 3QOKA 1L4IA 3E6FA 3LMJH 5JW5B 3U57A 3QQ3A 1MH5A 3V6OA 3KPRE 5JO5A 4U1LA 3EYFB 1WTLA 5AZ2H 4XB7A 2J25A 2VZUA 4J27A 1QYGL 1CDIA 3NPSC 2O9OA 2C1OB 1PLGH 2D9CA 3DECA 4WW2F 1J8KA 2XG5A 3BEVA 3IETB 3V5DA 4OQTA 1JPSL 4B3KA 1X3DA 1R5IA 3GIVB 43CAB 2F58L 5J6GA 1XGQB 4KDTA 2C7UB 5IB4A 5ETUB 4RNRB 3TO4D 4URIA 3VILA 1JGIA 2BDNH 3W39A 1XGRB 5AUMB 1N7ML 5J89A 1G7MB 3UZQA 2QR0B 1TXKA 3EDKA 4OD1L 4Q6IA 4JN2A 3OB0H 3BUTA 3UC0L 5DJ8A 5I78A 2IAND 4E41D 5HGDB 5I75C 4M6AA 5DD6A 2VXQH 5BRZD 4MD4B 3DVIA 3SE9H 1KR0A 4IOSD 4KKBD 4KROB 5ERWA 1B1YA 1Q6CA 3ZL4L 5CEXB 2JJTA 4ISVB 4PLJD 2GSIA 3OXRA 2XYLA 3REWB 1S5IH 4HXBH 2DIBA 2HLAA 2E4TA 4OCMC 3LN5B 1XMWA 2Q7YB 1B3YA 4RMQA 3DI2B 3S36H 3ZHDA 1TLKA 1JPTL 2FJHA 1GPOH 3NCYP 3HPLB 3FT3A 5T1LA 1MY5A 1I7RA 3U30B 3VFWA 3L3HA 5JQ6L 2XN9A 4K94L 4U6YB 1G7HA 2E6JA 3OKNA 4U1IA 5TDNB 2AGJL 5HGBB 4PJ8D 2R56L 1QLRB 1IGFL 1AGCB 5E7FA 5C7XH 4TTDD 3AXXA 4PP1D 1CFTB 4WW2B 4Y4HC 5K59F 2CBVA 2ADJB 5B3JE 5SWQB 1RUPH 1CE1L 5I1KH 3K4ZA 2O92A 4JFDA 2F19H 1ADQA 4IJ3B 1ACYL 5HHOA 5DC4B 5F7KC 4HBCL 1A0QH 2EXYD 3E6FB 2F8VA 4PGCB 3D85B 3MJ9L 4KZEH 1CGSH 1CXEA 2AABL 1BJ1H 1YEDA 1P4IL 1P7KB 2Z93A 3ALPA 4U1GB 4PJHB 4Y1AD 1H3VA 4X99B 2WIIA 4E41E 4ZS7L 1EHXA 1OTTC 3V5KA 4ZFOL 1NCNA 1KJMB 5KVGL 3WH7A 1I4FA 4OM0H 5FGBC 4C56A 3WSQL 1K5NA 3GUTB 4XCEA 4ZUTB 3MODH 2UZYB 5D7SL 1E4KA 2LAAA 3CIQA 5IF0B 5E24E 3STLA 4HZAA 4BZYA 2FJHB 5DJAB 2XNAB 4MAVA 4R6UA 4G6FB 4HK3J 3S36X 1YEFH 2FSEB 4U1JB 3TIEA 4PMNA 3TBVB 1Q9WB 1HN1A 3JZ7A 3U30C 3U9UA 3VFRA 5J3HD 3ULUH 3QP3A 3OKKA 2ZUSA 2Q76A 3GGWB 2GSIB 2ZNXA 3IDMB 5E99H 5EUOF 1IC5L 1GZQB 3CXHJ 3MRJB 5HHXL 5IGXH 2ADFL 4PS4L 1RQ5A 4K7PL 5JNYA 5C0BE 3HE7C 4RX4A 1FP9A 2CIKB 1T2XA 4PMVA 2J47A 8FABA 3H9SA 3L5HA 3T0BA 2VLJE 1MCBA 2VC2L 25C8H 3R0MA 3GDBA 2AK1L 1A1OB 1JRHI 4KJQC 4EANA 1IM3B 1GH7A 1UKSA 2NY5L 4IDJH 1GHRA 5EOTA 3QHTC 4XPFH 3RL1A 3QHMA 3BX7C 3FOMB 4TSCH 3TM6A 4GIAA 4XZWA 1FFPB 2ED8A 2P7TA 2LVEA 4HLJA 1UR8A 1DBJH 2XPGB 5CSZB 4JZJA 1MVUA 1GCFA 4YFEA 2CLZA 4L8BA 1XV8A 1MNUL 3HAEA 3Q6FB 4P46B 2GFBB 4DKAA 2C5DC 2V3EA 5IMOA 3EZJB 2YN5A 1KJ3L 1RIHH 4HK0A 5CIPA 3FOLA 4Y4FA 3KPSD 5HXMA 5IW6A 3VH8B 3PE9A 2A9NH 3QCTL 3L9RA 3WS3A 1XFPA 5D7LD 3MTRA 1MCPL 4QYOB 1XGTB 2EIEA 3SDYL 4PJCB 3CU1A 5GZOC 5FYLE 1XAUA 2CK2A 4MSWA 3BOVA 5KG9A 1SYTA 4YHIB 4LKCA 5IF0A 5DXWA 5EZIH 4Z2GA 1DR9A 1BFOA 5TH2A 4CW1B 3DSFL 3BAKA 1A1MA 2VZSA 4LLUA 5FGCE 5KS9E 2OJZL 2CLRB 4HH9A 1PKOA 3AB0B 3P4MA 3B5GA 3VFVB 4CMHC 4TYUA 1XF2B 5GISL 4QLKA 1AE6H 4OUEA 4PMOA 3KS0J 2NNAB 2OL3H 1WFNA 3E2HB 3QUKB 4XP6L 4EDWH 1UJ3C 1A1NB 2Y25A 3VD9A 1UCBH 3TZVB 4LLMA 4NN5C 2HLFC 2EDDA 4JFQB 1JK8B 1R3JB 1S7QA 2VZVA 4E42A 2UY3A 4NFCA 2AI0H 4Y5YA 5EO1A 3UTOA 3IRPX 2A77L 4IRJD 3N06B 1WLHA 2ESVA 4DGVL 3LY6A 1EIBA 4RWHA 3MO4A 3GM8A 1NGYA 3FRUB 3DLQR 3OAUL 3LCYA 3TPKA 3EYUH 1MFBL 1KYOK 5DUPH 3BCFA 5IFTA 4P4KB 4P9HC 3L3IA 4LF3B 5IB3B 3K2UL 3OF6A 5D7JD 1G9ML 2BOCA 4PB0L 5MERA 4OZ4B 2AGJH 3IGAB 3SBWC 1OAXH 1IGTA 1IGYA 4WY7L 4HWBH 3PL6B 2DKSA 1WAWA 1U8NA 4FQLL 1FLRL 5FGCB 3CSYA 3O0RH 3SO5A 2XTKA 3L3OB 2W65A 4GG6B 1OD0A 3MV9D 4LP5A 5BS0E 3A67H 3HFML 3S88L 1ERNA 1WNOA 2V3DA 4ZSOA 2WWMC 4KZEL 4HK3N 5L0QC 5CJ8A 2KDGA 4JPWH 4LCYA 4O4YL 4HX1A 4KTDH 4UQ2B 1JK8A 1R3JA 1S7QB 3H3KA 4OIBA 4R3SB 2GAZA 5EU4B 4P3CL 1F5WA 4Y5VC 4APQB 1OB1A 4OJFL 3SGEI 1U95B 1JZ2A 2Q3AA 5T3XE 2JB5H 2QHAA 1A6UL 1HCFX 2EXYC 3QIUB 4Z2HA 4U1MB 3ETBF 4XPBH 4MS8C 4UIMA 4HD9A 1KCRL 1LG1A 3VI4E 4P7OA 4R96B 1F8TH 2P5EB 4F9JA 1FL3A 4K7FB 1P2CA 5I1IH 3G6MA 5FO8B 1KXQE 1T04A 4JFQA 4L29B 2D22A 3R1GL 3JV6A 4PG9A 1JV5A 4WI9A 1JAEA 3CFBB 5ANMA 1K2DB 3VDAA 4JRYE 1WITA 1CECA 4JZJC 4E5XA 2CBUA 2AVGA 3QWQB 3E3QE 2OL3A 5I74C 2Y6SC 4MNLA 1XSKA 2B1HL 5DVOA 1KOAA 2ZX6A 4NN6C 3S96B 1A4JA 1CR9L 1ZHKA 4PRIE 4C58B 5JW4Q 3B9VA 3S6TA 5TFSH 2AXJA 1JYXA 1I9RH 3V7AE 2GDVA 3Q5OA 2PN5A 2H2SC 1JDCA 4RA0C 1IGTB 3RGVC 1JAKA 5EIIB 5IVZB 4YHNB 2F53B 5BXRA 4PPTA 1IT0A 2BHYA 1YUHA 2EEAA 3R8BB 4K9EC 4MDJA 4PJCF 1MW1A 4YPGA 3VRJA 2XWBA 2A9MH 2W65B 4Y5XA 4Z0XA 3UBXI 5JQHC 3W82A 5IHZA 2KUTA 3V4VL 5DMGD 4ZUSA 4K2UH 4UQ2A 2FATL 3F5KA 2W60A 2P45B 5DDHB 1XYZA 3O3DB 4JQXA 4I4WB 1NFKA 1MHCB 3G5XA 1QFWL 1AH1A 1LO4H 1KPRB 1KBBA 4JAMB 3O2DH 1ORSA 3TGXA 5JOPD 4JY5L 3JWDC 4ZPVB 1LK2A 4KQ4H 3GBEA 4FMFA 4XNXH 3BAEL 3KNBB 3DSFH 4BA8A 3BN9C 2DH3A 2FL5A 4XXCA 4PTXA 3IJYB 3ES6B 4L3CB 4U6HB 4Q9RH 5FOBB 1P7QB 2P43B 3TBWB 1S78D 2NY6C 1P1ZB 4S0SD 1G1YA 5KVDH 5J56B 8FABB 3V5HB 1TVHA 5F9OL 3MREA 4G6KL 4JFUA 5EFDA 4LPWA 4P99A 3NCMA 4KI1A 3WIJA 2EDQA 3C8KA 2IH3B 5E7BA 3TCLA 5FYKU 4JKKA 5SX4H 5TQ2L 5E95B 5BV7L 3B9KC 3DHPA 4TVDA 2R4RH 2DWDB 4P2CG 4TQEH 2DLFH 4MNGE 2YPKB 3AS0A 4KDTC 1EO8L 4D3CL 4Q97A 2X0HA 1UH4A 3VMPA 3S37X 3SCRA 3TH3T 3ARSA 5B39G 2ATPA 4PJXF 3IDJB 5HPOA 4AZ7A 1U2CA 3ULVE 1INDH 1U92B 3W0WB 1A9EA 3PZGA 3MLXH 2F9BT 3MJ6A 3D0VB 4JPKH 3MRPB 1KQYA 3MV7E 3B83A 4L3ED 1JNNL 4KKCC 3HMXH 3C6LC 4H20H 1OSPL 1HOCA 4LEOB 1SY6L 3W37A 3DVNA 3KZSA 4JGUA 1ZLUH 4BELD 1QR1B 3ARDA 3EUUA 4UIKL 1KLUA 1MFUA 4MTVA 1FL6A 4QHKJ 4P7RA 2A3AA 1PYWB 4A6YH 2P44B 3X14B 3JTTB 5F72S 1X5JA 5ERWB 5F7EL 5BXTA 4P3CH 5DJ2A 3S8WA 1QLFB 1T6WA 2XJ7A 2FB4H 2J8FA 2XI9A 3GBML 4OZIE 2R23A 5DRZB 4RWYH 5AWNL 1A6WH 5J1AB 3NZ8A 3UPRB 5FOBA 1QACA 1W1PA 3TZVA 4R97C 4D94A 4FMVA 4HUWB 1WFUA 3ME0A 2G60L 6FABL 3S97C 5I1IL 4W7WA 5IFJA 5I0ZA 4WUUB 3CVHL 2AEPH 5E2WH 2VUYA 3CK0L 3RWEA 4Z78B 3T0EE 4XV0A 1GIGL 1QUNA 2EH7H 1ZLSH 1P9MC 4UZUA 1DQMH 3GB7A 2IUZA 4K3JH 4JCLA 3LKSB 1W0WA 3BPLB 2D1ZA 2FX9H 1A6TB 1EZVX 4KGJA 3DIFB 2OYPA 2C8NA 1CK0H 4LF3A 5DVLA 1MQKL 1KFWA 3WEMA 1CR9H 4N0UB 3QCTH 4NQCD 3WQWA 2DF3A 1VPOL 3MV9A 4HWZA 3RIAF 3QDME 3PZNA 5LGKA 3CTTA 3WO4C 3UEQA 4PGDB 1P7KA 1V02A 4UZSA 1RK1A 1FL5B 2YD9A 4IHOB 5CKGA 3MLPA 2VDNL 4JFYB 5J1AA 4C57C 3CLFL 1T7VA 1FZJA 1VADB 3FO1B 2GFTA 4L4TB 3UCQA 4ZSOE 5BS0B 1A7OL 5F9WC 2AV7A 4MA1B 2VRKA 1D9KB 5C9KA 1MCHA 1OB1B 4FQCH 4HGMA 4XHJD 1LE9A 1P4LB 5ESVB 3ULVL 4KAQH 3IANA 4JDVB 3WO3B 5JPMB 2HYMA 5HYEA 5KN5B 1I8LA 3AS3A 3HG1E 3O2DL 4JQVA 1A6TA 3IXAB 2AP2A 4L5FL 4HG4J 1FIGL 4GINA 3QUZD 3VIGA 4PBXA 2VZOA 2D3NA 2E9JA 2JF7A 1ONQB 5DEGB 1MI5B 4OZGF 4XMLH 3D3VE 4WUUA 2Y7QB 2NXZB 4NBZB 4OIAA 5F93C 2J8GA 4BQBA 3H3PL 2H32H 4LLQB 4RAUB 3GZAA 3TT3H 2ZSWB 2BNUA 3LKQA 3MLTB 2B5IB 2BY0A 2YKLL 3SQOL 1ZLUK 3HAEB 1CFQA 3Q6FA 5I73B 2DPEA 4KI5D 2YJQA 3HFMH 1CL7I 4LSUH 4L8SC 1YPZB 4CU6A 1LWHA 4QWWC 4P3DA 2YOCA 1SR0A 1JNLL 4F8QA 3M1BB 4JHAL 3STZB 3HE7D 4KRUA 1HH9B 3GK8H 4R7NA 1R87A 4Y16A 5JDJA 3C5ZD 2DWEB 1IM9D 4GRWF 2L7JA 5IW1A 1RJYA 3ARPA 2OLDA 3MMEA 2X4TA 5JXEC 1L7IH 4JFFA 4ACPA 1JPFB 2VWEC 3RTQA 5BVJB 5HHNB 4V1DD 3ZJ8A 4YQXL 2VNCA 5ID1B 5EU6A 1YY9D 1BZQK 4G8GE 1NCUA 1L7TL 1ZS8B 3LB6D 1F8TL 4IIQB 3LV3B 3MRIB 3AM8A 1HNFA 1QI3A 1ORSB 3GHEL 3B5TA 4YHYC 1JBJA 1QR4A 3TZVD 4F7TB 4PBGA 3BUYA 1OTTD 5IBUG 3PHQA 4P2QE 3PBGA 3NIYA 2VAJA 3EYQD 2ZJSH 3BW9A 4IPLA 1CFTA 1AKJD 4WW2A 1V6YA 1OHQA 4GLRI 3NCCB 3ALGA 4FQJH 2CHNA 3EAKA 3RDTB 2AKRB 3TCXA 1KBGL 1BG4A 3N15A 2PYFB 4M5YH 4DWSC 3BSZH 1A6WL 5EUKA 5CJQL 2DM3A 4EUPB 3L5IA 2J7GA 2MKLC 1G7PA 2XXCB 4D0DA 4FQXD 4LHUA 4PJIB 3Q6GH 3RKDC 3TJEL 1YEJL 3UR8A 4NZTH 1KIPB 2VLRB 5C0EB 5JHLL 4YFLF 4I0PB 3FO9A 1E4IA 2AK4E 3UJTL 4K3GA 1ZA6A 2XWTB 1U30A 1ISWA 1UD8A 1RIUL 3CHFA 5FUZH 1EX0A 3BQUC 3QEQB 3DRQB 1UT9A 5I3DA 2EDNA 3QDGE 3HZKB 2IBZX 1R5WB 4Q9BA 3I85A 4GI9A 5A2FA 4W93A 5ICXB 3IDXL 4Y7EA 3RWHA 3BC9A 1KFAL 4RFNB 2GTZA 5GS1A 1GORA 2XKSA 4WJ5B 2EDKA 3BAJA 4GG8A 1ZTXH 3CXHK 3W9DA 1QFWH 2HJKA 4EXPX 2R29H 2DICA 4XVTL 3R06A 2X44D 3ARGA 5C07A 1XRVA 5IKCB 5EU7C 1ZEAH 3QUYC 3DXAE 3JUGA 1KTRL 4K8RL 4M5ZL 4V1DA 1YMME 2Q8BH 4F9PA 4RRPA 5CUSH 1JHTA 1A1OA 2YZ1A 3V5HA 2ZX7A 2EIZA 1QNZH 3POCA 5DMIL 1FZMB 4QRRE 3RL1B 4U1HB 4Q9RL 7A3HA 4JO3H 3BDXA 3BKYH 1IM9A 4LQ1A 3A6CH 2GJ6A 3PGFL 4L8CA 3ROOB 1BYCA 1R24B 3WMSA 1QLFA 4G8GD 3FO9B 4NRRA 1HIMH 4X6CB 1I7ZB 4QRPD 1W0VA 3IB4A 5EFFA 4WFGE 3KL3A 1XSJA 5KJRL 1KEML 2EDYA 4NQEA 4WUKH 1GQKA 1H8SA 3HZKA 2VXUH 1DDHB 3SE3A 2ZG1A 3IDJA 4OQTH 3QG6A 4N5EC 4P57A 5BQ7B 2PUQT 1FFQA 2AOSA 2KKQA 4Y4FD 1JPTH 4EBQH 3QNZB 1JZ7A 4XBGA 3UETA 3HTLX 1CTOA 1IVLA 2IPTH 4RDQG 4EN3A 5FIEA 2FR4A 2NX5B 1PBGA 4Z0BH 1U58A 4OZIA 2AQ3A 2NXYC 1WTGT 3SBWA 1KF9B 2DQHL 3MR9A 1N3NB 2BJMH 5DJXB 1JNNH 3L2LA 5GGQH 1UZ6E 4LLUB 1UB6A 4BK4A 4LVHC 2F54B 4OSUH 4PMDA 3E8UL 1YY8B 4HG4K 2D0GA 2J5LB 4G5ZL 2BNQE 5BXFA 3ARFC 1EEYA 5IIEB 3VA6A 1CYGA 3GMRB 1HWHB 4XP1L 1BREA 3VJ6B 4F9PC 5A6BA 2YZ8A 2Z4QB 5FYLL 5L88H 2CUHA 1SBSL 1EPFA 2YK1L 1FC1A 3VD4A 4AQOA 3VFPA 2YUXA 2XIIA 4HFUL 1VADA 2JKXA 4M9PA 4R5EA 3IFPB 1L9NA 2YRLA 1EA9C 4OI8A 3PWLA 4QRTB 3AHYA 2OK0L 2QHLA 1JIBA 5TD4A 3TH2T 3WMBA 2ZWLT 2W1NA 3X13B 2CSPA 2D0HA 3GSRA 3G5YA 3ZSTA 4OLEA 5L8JB 1F4HA 4ZD3H 4GW5A 4FOMA 1F3JB 1U8LB 2J88H 3MV8B 4HEPG 2A6DA 1FH9A 2WP3T 4PREA 4NRYA 4PY8I 3J7HA 3VFTA 2ZJSL 1HI6A 1B0GB 2A74A 1I7RB 1A7NH 1FORL 4QXGL 4TUOA 3N17A 1NWRA 4OLUL 3LIZH 1MUJA 1O6IA 5CJQH 3O81A 1H5VA 2XSBA 1QLRA 4XPFL 3LMJL 4PLOB 4ORZC 4XNUL 1MWOA 3HG1A 3WBDA 1E4XI 2EKJA 3HN3A 1KTDB 1JFQH 1INQB 5D8JL 4F58H 4Q9QH 4E4PA 3V4PL 4WTZG 1QHOA 1EJOH 2BNRD 5DUBA 2WWCA 1G7JB 3FB7A 5FUZL 3QBTB 4IPNB 2F5BH 5F7WC 4L4PA 4XUYA 1G5AA 2QBWA 3UTQB 4Q6IB 3LD8B 2X70B 4A3HA 2EYSB 4M7KL 3QFDB 1FCGA 4H5SA 1QVOB 2PW2A 3SKNA 1Z3GH 1LE5B 3RVWC 1HJWA 3RGVB 1OWRM 2VYRE 4P2RB 3O9NA 1MWAH 3KLAA 3I3DA 1NCAL 1WISA 3HZVB 2Z35B 4PLNC 3ULVH 2O61A 3ARDB 2DQIH 5EC1A 4XAKE 4YDLB 3EFDH 1OWWA 2M1KA 2VDMH 2X4OA 2E9LA 4JKPH 3UYRH 1BG9A 4PTUB 2ZXBA 4P8UA 2XA8H 5EC2B 3DURB 1WWAX 4X4MA 1MAMH 1JWUB 1X6NA 3RNKB 3E6HB 4YDVB 4UU9A 2BP3A 2JF6A 5E8OB 3PP3H 1CQYA 4N8CH 1A6VL 1YEIH 1LO0L 3WF2A 1B90A 1ORQB 4WUUD 1KCVH 1KTDA 4KKAC 2CRYA 1HHGA 1T4KB 2Q1EA 3R0NA 3TT3L 1EAPA 4W5UA 3MLVH 3ECBB 4TSBL 4OGAD 3PV7A 4JDTH 1DQLH 4S1SL 4MQXC 1NC4A 4KRPD 1PX4A 3U4EB 2ARJB 3LH2L 1E4LA 1A9BA 4M3KB 3QCUL 1MQRA 2W0KA 5DFWH 2DL2A 4WHYH 1A0QL 4HBCH 1FN4B 2P49B 1MVUB 3U83A 3ZKSD 4TNVF 4I1NB 3IKCA 3IYLW 5KS9F 5CGYC 3PWVA 3TYFA 4R4FL 4UINL 3DGGB 3ARTA 3NCYS 2HFGL 5KZ6A 2OLHA 2AK4B 1U3HD 1GGIH 4F79A 2J79A 2GAZB 3NIFE 1PY9A 4HFWA 4UTFA 1NAMA 1ISXA 2W62A 3GMLB 3VIIA 1TNNA 1UXSB 4HWBL 2IFGA 4LCWB 5BS0D 1MFDL 3O6FC 4DVBB 4XC3H 3L3KA 3KLAB 3LRGA 4W4OA 5DMGC 5IBTH 4X6EA 2E5EA 3FFDB 3FO1A 5I79A 1MCFA 4YHZH 4XMKH 3BAWA 6A3HA 5D7IA 4I13B 1JFXA 1K6QH 3L4TA 5HI4C 3OR6B 2YBUA 4MNJA 4NN7C 3DURA 1PKQA 1FP5A 3W11C 2H32A 1BLIA 4QOKA 4GKNA 2V6HA 3IFNL 3DETC 1NM9A 2YDSA 3WJLA 5K9KB 1CDHA 5CJOL 2WNWA 3S96A 2QV2A 2AK1H 5GHWH 5EG6C 1ORQA 5C0AD 4QRRB 4RISH 5CSUA 5HGHB 2VZ1A 4NQED 4X0KA 1QOKA 4PV9B 5EZLA 3TJEH 3DRQA 3GKZA 3PWPD 4ZAKB 4AG4L 2NY4C 2X41A 1IC7L 4YHNA 5IVZA 5EIIA 2XFRA 2BNQA 2V7HA 1HP4A 4K3EH 2OQJA 1U2YA 2P1YA 3OB0K 3THDA 5J57B 1IKFL 2R2EA 1CVSC 1NOFA 1K9FA 1AO7D 1TTUA 2EPOA 5A2BA 1CFNA 3IAPA 1FRGL 2OZ4L 1GJUA 5EO9A 5GGRA 3O3BA 4Y4KB 1T1WB 1LDSA 3C5ZB 3K1KC 5DURD 2XIBA 5DMKA 4NQEE 4KDWA 3B3IA 1PQZB 5D70L 1NC4D 3VXOA 3VX1A 1NJ9B 3NGBC 3X3GL 1OGAA 2BNRE 4H26B 3N9GL 4PY7B 4M1CD 5KZCB 4JL2A 5MP6L 5BZWA 2P5WB 5FECB 3AGVA 1EOKA 1INEL 5EOQL 2VXTH 4K71B 4NKDB 4PN2A 4E8CA 3MRBB 2F5BL 1WDSA 2QADC 2A9ML 4ZFOB 3GJEB 2D03H 1F45A 1EO5A 4ISVA 2J7CA 3QHNA 3IVKB 3U1SH 1NFDE 3FTGA 4D6CA 1UM6L 1P7QA 5C0DA 4YHOL 3WD2A 4EDWL 3HMWL 4KRLB 1J1PL 1JZ6A 1HX0A 1A3HA 3SDDA 3LPFA 4XVSH 3QEUB 4LVOB 5CD3A 1OP3H 4GXUM 1FNEA 3KLHC 1CE6B 5DLMH 5ACZB 1MCEA 1VENA 4OQTL 4JDZB 4CVWA 3G5YB 1WFOA 1X4YA 1X5GA 3QIWB 4X4YA 4J4PD 2XZZA 5IR1B 4CDGC 1JV5B 1EFXD 1IE5A 3POHA 1R8LA 1IFHL 1I1XA 3BZEB 4W87A 3VFNB 1DUYB 4NHCL 2X89D 4KKAD 1IGYB 1A4KA 2YLLA 1NDMB 4X83A 2VIRA 1WBYA 2JJWA 1PSKL 1Q94B 1SJVA 4OB5H 1WZLA 2BRQA 4WY7H 5GJSL 1YMHB 2RCSH 3FQUA 1OIMA 3GSXB 4L3AA 5BV7H 2CLVA 3M46A 2QSQA 4NF7A 5C07D 4TSAH 4XGZA 1IEBA 5L2KB 1FHGA 1U42A 3ARVA 3B5HA 1F2XK 1DBMH 1TZHB 4XP1H 2B0SL 3PXHA 3SGJA 5CILL 1EO8H 3X11A 1XIWB 5MENA 5B38B 4O4YH 5C09E 4HUVB 2WKGA 3OPZH 1UWEH 3GH4A 5DK3A 4IJ3C 3GRWL 5JXEA 5DS8B 4UFLA 1AJ7H 4HF5L 4WW1A 3SUVA 1MCWM 3TNMB 1UB5A 3U0TA 4X7EC 5F7UA 4XC3L 1PG7L 4MYWB 5HJ3B 3FB8B 2OP4L 2EXOA 1JFHA 4XPTH 3QWRD 1MIEH 5C3TA 5KSVA 2VX5A 3HS0B 5E9DE 4X4ME 1E6JH 3OGSA 3G5VA 5D7JC 2LVCA 4YDIL 4X6BB 4V28A 1AD0B 1RJZA 4PRBB 4S10A 4WWKB 1I9IH 3HR5B 6CGTA 3ULVF 4TVPH 4U0RC 1OP3K 1JXJA 1P1ZA 5D7KE 4PGJA 3FXYA 2CKSA 5D7LE 1FH8A 1AQDA 4UUJB 3QG6B 4YHKH 1PEZA 1BBDL 3L5WB 4HUUA 5E2JA 4ZTOL 4P9MH 3VRJB 4IEFB 1IGJA 1PIGA 3RL2A 2FWOB 4JO1H 4N0FB 3U4BH 5KVFH 1ZJBA 3I6GA 2VZTA 2PR4L 2IANE 5ITBL 4ODWA 3FO0H 5I24A 1E6SM 1JF5A 3HNTH 3LKRA 4WJXA 1DQML 4ZODA 3U0TB 3VXRA 5J1SC 2CXKA 4G9DB 5INDA 1C5BH 2YIHA 3IKKA 1IAIH 5F7NC 4LIQE 3UO1L 1WCQA 4LNRA 1IAOB 1HQRA 3MRPA 5JW4N 1XH1A 4E2OA 2EDFA 1D9KA 1OGBA 5EWIL 2R1XA 3EO9L 2HJFB 3MBXL 4L1HA 4G6JL 4H8UA 1PZ5A 4F8TA 5A2JH 3RDTA 5CWSA 4B3LA 3OHXB 3TBWA 4MMZC 2EEBA 3LVEA 5ISZA 4MA8H 3ULSB 2DLTA 4P5TC 2V7NB 3TYGL 2PYEE 2YXMA 2B4CL 5CLTA 3HNVL 1WAAE 4G43A 4KXZH 3TCLB 1FG9C 4Y1AA 3WKML 1WVZA 2FWOA 5EPMA 3DTXB 5FHAH 2R8SH 4GQ9L 4HEME 1A64A 3MRMA 3VOCA 4CMMB 4KAQL 4Y4HD 4HIJA 4QKXB 1V05A 3LN4A 2WZIA 5I8EA 3LKRB 3MGAA 4PTWA 3BD3A 5MERB 3BCDA 5LG1A 4PJ9D 5IXEA 4LSPH 3SOBL 4JANB 2J8UE 3P9LA 3BKJH 4OCYL 1M01A 3GBLA 2PCPB 3SO3C 3MKKA 1U36A 1EGJL 4R2GB 3L4ZA 4AYFA 3LHPH 2OTWA 4X98A 3G6DL 4NOBA 3GFUA 3FQNA 5GGTA 1FHDA 1OM0A 1ZT7B 5ICZB 2KZ1B 4WU5A 2DT3A 1NUNB 1OSZA 3T8XB 1Q9KB 2CRZA 3SQOH 1RZIB 2X4NB 4MD0A 1XGUA 1RUML 4JREB 1QNOA 4BCEA 4TUJB 3VI4F 1JTPA 4MNQB 5FKPB 3NCOA 1JP5A 3C60B 1Q9WA 1HJSA 2Z1SA 4NN5B 3WQ5A 3TTOA 1I7ZA 1VJZA 3FQWA 1KB3A 4BUHA 2VXVH 5HI5C 4OZFB 4AZCA 5HHPA 3CH1B 4NKMA 3WFHB 3F4VA 2CIKA 5FO8A 1G9MC 4LSRH 5E03A 4OM0L 5FCUH 2G9HB 1A22B 1UJ3A 5EC2A 2PB1A 3LS4H 4U2ZA 5FL1A 2IBBA 2E7LC 3S5LA 4WKHA 3TJHD 1SHMA 1AXSB 4FQ1L 1WEJL 3O11A 5E1HB 5IW6B 3EOTL 5EZOH 2R0LL 4FQXC 2QF8A 4WENB 4F7CB 4E0RB 4TTDC 3WUEA 3EDDA 5JIWA 1A6ZB 4JFWA 2XWTA 3F5LA 2Z8SA 1YN7B 3QHZH 2DQGL 4NHUA 4HIXH 3F7YA 4P46A 2D2OA 4PTTB 5FA3B 3SE4C 1KELL 4LVOC 5A8MA 4XNYL 5CJ5A 4EI5C 1AY1L 1U3HA 1BFVH 4C7GA 4HPOL 5D7IE 2A2QT 1I8MB 2JCCB 3O2VH 3V2AR 2OZ4H 1CNVA 2R2CA 2NY4D 3DX9B 4PJ7B 1CXFA 1RZKL 4MJ4A 2YL5A 3FFCD 5GNZA 2YEZA 4B53A 2H1PH 2DOCA 4HBQA 2AK4D 4GKLA 3LB6C 3FQWB 1GGYA 1LNUA 2DI8A 5KG9B 4ZYKB 2YMXH 3VXSA 1V0KA 3WEXB 2C7UA 3KYMB 5I19H 1MNUH 2HVKA 1SY6A 4F7MB 2Z0BA 4OM1L 3RM9A 1N0LA 2VVNA 2FO4A 3EOBB 5K9QI 4L4VE 4FFWC 4U0RB 5HI4D 3NIGF 4X7FC 1AI1L 1KENH 3SDDB 3SIMA 4FFVC 1DEEB 5E56A 4V2XA 3GSRB 3QUZA 4Z7VE 3PJSB 3BP6B 4PGZA 3DV4B 1J88A 5T1MA 3UBXB 3TBYB 2FL5B 4H0GA 3WL1A 3CGTA 1QHPA 3UAJC 3LEVH 1C5CL 1VF8A 3NDYA 2W9EH 3P4LA 1BQCA 1EGJA 5EUOB 2FX8H 4YHMH 3WEOA 2FZ3B 3WNLA 1FIGH 2YPLD 1WWBX 1WICA 4NIKB 5DQJA 4PJBA 4M93B 1MUJB 3C09C 1IAKB 2FEDC 4C83B 3LDBB 1G9EA 3SCMA 3CH9A 3PTQA 5FYKD 4XCNB 3MLUH 3P0GB 1JNHA 3HZMB 1B31A 3WF0A 1IGFH 1GGBH 5D96C 2FGZA 3DJ9A 3VO0A 1N4XH 2YKLH 2W9DL 3ZTJG 1FVDA 3N0PB 4MAYA 4C7DA 1U92A 3W24A 1MEXL 2F19L 1MHEB 2PW2B 2DSVA 4UTBL 1OARL 5EBWB 2GTWB 4I3GA 3ZO0A 3W6MA 1NANI 2NY1B 3VWJB 5T1MB 3UBXA 5JOEA 1KUMA 1P84K 4KRNA 2CETA 2DLHA 4CADA 4DZ8B 1R5WA 2KPNA 4PTUA 3SCTA 4BSWA 1MCOL 4M4PA 3ZHKA 3RJXA 4HW6A 4PV8B 3MRCA 4X7SL 3W0KA 4ATDA 5GNXA 4DZBB 4MDPA 4OAWA 2XZAL 5JPNB 4U33A 4HCRL 3CDFA 1IAII 3K3QA 4DFIA 3IDNB 4X7TB 1F4WH 1QBLH 1SYSA 4U7MA 1ODZA 1FL3B 2Z8RA 4G6AD 4ZFGH 4GH7B 5BRZE 3FCTA 5CAYB 1IMHC 1KJVA 5GRWA 5JNYB 3BAYA 1JXKA 2PYFA 5F88B 1QNQA 3NN8A 3DXAA 1W72B 2VC9A 3G6JE 2CD0A 3TP4A 4FQJL 4RL3A 2XQBH 1H2JA 4CVZB 1KBGH 3SE4A 1QPXA 1KB9K 1BJ1J 2GTWA 3KYOB 3U0WL 1CD8A 1NC2D 2UUDH 2IEPA 4JM2A 3DX6A 4X4YB 4ODUA 2FCBA 4XNMA 4FQ1H 4P9ML 2FJFA 5J6GB 1JWSA 3IK2A 1TVBB 3MCLL 3LKNA 3NA9H 3CFDA 3L3GB 4J3XA 4RMWA 2CITA 4JANA 3TNNA 1PAMA 3BDYL 4QF1B 1UG6A 3U79A 1OLZA 1VFFA 1J18A 2XFYA 1KJ3H 4W6YB 2HT3C 3NIFF 5DD6B 1QW9A 1UM4L 1FGVH 4JHWL 4OBSA 5K9JH 1DHKA 1GZPA 2ZWYA 4N0CD 3SJVB 2FBJL 5ICZA 2NTFB 2I9LB 3I02A 4NRZA 1RPKA 5TGBA 2VCBA 2D7QA 5ETUA 2UY6A 2Z35A 2O61B 3O4LA 1RIVL 2C4XA 4PRPA 3NN8B 5MEPB 1LL4A 4D72A 3IU3A 2H8PA 4HPHA 2ZSVA 4LRIA 5E6IC 4UU9B 2AJ3A 1S9WB 2JJSA 3B8SA 2WVSA 5KTEL 4S1RH 4JRYA 5JPMA 4ODHH 4JREC 2X1IA 2DSUA 4PV9A 4D1IA 1X4XA 5E8EB 2RBLA 4R7DB 5D2NB 1P6AB 2R2BB 3HRZB 5FO9A 1JE6A 1CDYA 4XWGH 4ZXBC 3EMQA 3BMWA 5DJZA 3QZWA 4KDVA 3ZTJH 3T3MF 3LZFL 1KGCE 1OTUD 4PGCA 4WWKD 3T0EB 3I9GL 3VFWB 1R5VB 4IRJA 4KI5E 3AREB 4TTGA 3E3QC 3F7VA 5F3HB 2EJ1A 4NO2B 3RI5F 4Y4KA 4I3RH 2ADJA 1L0YA 4HKBB 4E8DA 3MBED 4KJWC 4XCYA 1P6WA 4LLDA 5KVDL 1GQIA 3KGRA 1D5IH 5DJAA 2ZUMA 4FNLH 4OLVH 1MPAH 5DUMH 4TSBH 1FE8L 1T20A 3ARBB 2WLZA 5DT5A 2NW3B 5I18L 1FVCB 3S4SG 1J8HA 4PJGF 5C0CA 3DV6B 3IJHB 1TENA 2AJSL 2B1AH 2VKXA 4ZSOB 3EOAB 1XSIA 2CJUL 5D8WA 4JQVC 4GRLD 1B3JA 1T3FA 4DGIH 5ABFB 3JSSA 3KYMA 1IKNA 1D9KD 4HUWA 4QEGA 4POZC 4HHAA 5ITFA 3TLRA 4NO0A 5HYFA 5DHYB 2VQTA 2X4PA 5C9JB 2VLKA 4HKXA 5C9JA 1S3KL 4M6NH 4X0VA 4HWEH 2W07A 4P5KB 4HZLB 4UT7H 4DKEH 3DYPA 4JN1H 3RWEB 4Z78A 4W7UA 2VJXA 2RIKA 1VFBB 3Q48A 3QUZB 1ZT4B 4JFDD 2PYEB 1FHLA 2P8LB 5CEZH 4UQBA 4PYHA 4PUBH 1HHIA 4YDKL 1BYDA 4RFEA 3HZYA 2NXZD 1KIRB 4JVWA 3ARDC 4OCNC 3FOLB 5JW5A 1F4AA 4OZHB 5D93B 4OOZA 3ZZ1A 5E8OA 3IFLH 2J1KA 1D5XB 4FFZL 1PLGL 1JUFB 3INUL 3QHOA 5GXBB 4AMKL 1I3VA 4RGMB 5DEZA 1KIPA 2VLRA 4MVBC 3N1QC 4GMSH 1RJCA 3KL0A 4LSTH 1UR9A 1KJ2H 4FZEL 4G7YH 4NDMB 4Q6IC 3MNVA 3O2WH 4ODTL 2HFEB 4LLVB 1OCWL 3VDHA 5I71B 5ESQB 1P84J 4P49A 4HWZB 1Z9SA 4M8QA 3EO0A 4HK0B 5CIPB 5F96H 5D8JH 1A1MB 1CDGA 2IQAA 3VGAB 3NA9L 2BSRB 3QPQD 3CVHH 3OA5A 3VRIB 5CEZE 1GZJA 12E8H 1DVFD 3PN8A 1BLNA 4Y2DC 1J0HA 5GSRA 3QUKA 1S8DB 1QEWA 5AYUH 5CPTA 4DQOL 2IH1B 2X4UB 5F7YC 3MUJA 3QIBB 1GSMA 1T3FB 3AIBA 3KXFB 4PJ7F 3VFGH 1H15B 3FQTB 1NANH 1WF5A 1HEZB 1I3GH 1NAMB 2FATH 4R0LC 4DGYH 1GQJA 4F3FB 2DQIL 5IT2L 1NCTA 3H9HA 1UYWL 4U1HA 4JKPL 2R56H 4LYQA 3KYNA 3WFLA 5C6WH 4FLRA 1XIWC 3IDYB 1W0VB 3H9ZA 4WIQA 3KHOA 3GNOA 2M26A 4B41A 2DLIA 2AMGA 5I71C 5HGAA 2AABH 4HUMB 4LVNC 3NABH 1MCIA 4XCCL 1A9BB 5D71H 4ZFFB 2KL6A 4Z2JA 5ALBH 3O4OB 1AVAA 3W5NA 4JR9L 1CICD 2RJMA 4M61B 1BAFL 5IFHL 5J11C 2JCCE 1QEWB 3OV6A 4D6GA 1FZOA 1HVQA 1RP9A 4OZIB 3WFCL 2FJFB 1NFIB 3QIBA 1E6NA 3WDHA 4NQTA 5TPWL 4DZ8A 4DTGL 4W6WB 3U5UA 5M5DA 1UZ8A 2HTKC 2VZ3A 3SDXE 3MXVH 2NXYB 4OOUA 1AC0A 1XC6A 4N0RA 5DTFA 5E08H 2ERJB 2HG5B 3QUMH 3QUZC 43C9A 4W8AA 3QXUA 1BQHA 4LXFA 1AP2B 5EO9B 5T3XD 1EGZA 1QSEA 1S7TB 3QULB 2AKRA 3FJTA 5EUOE 5ID1A 4H20L 4RBPK 2J7FA 1HKLL 2V7NA 5TF1L 1YJDC 4APQA 3NH7L 5KSBB 1H1NA 4H26A 4PY7A 2DGAA 2V3GA 2QHRL 1OGAE 4JLRB 1H5BC 3WQ4A 4FFYH 4UIMB 2LAGB 4M3JA 4P2OB 2AEWA 4NPYB 1UH3A 1LO5A 1N0XL 35C8L 3GRWH 4WNQB 3A6BH 4J3TA 5HHMB 4UQCA 1J1OH 3GO1H 4GW4A 4O2CB 4MHHG 4M24A 1LO3L 2J75A 3RY5A 4PRIB 2JE8A 3F8UB 4M7JH 1KCLA 3RWIB 2NT0A 3KL5A 3ROLB 5ICXA 1GAFL 1YEFL 1N5AA 5I8OL 1KCKA 1RZGB 4K8RD 1FP8A 1HKIA 1V3JA 4KJQD 2NW2A 4P23C 3SKOB 3UTTA 1MJ8H 4IS6A 1P7HL 3KPSE 3HG1B 4Y19D 2W0PA 3ARGB 1T1XA 3FT2B 4HKJA 4N0UA 1XGUB 3O41B 4PBVC 3UZEA 4GRWE 2KBGA 4PD4K 5F6IC 4ZG1A 4Q0XL 1CK0L 1G0DA 2FBJH 2YD1A 3N85L 4ETYA 3QQ3B 2X8RA 2R1YA 4N9GB 2ZCHH 4LDOB 5IB2B 1X5IA 1BZ9A 1RVFL 1SJEB 3D2UD 2JEPA 1KB5A 1CT8A 4MCZA 5JHDB 4CN4A 4Y2OA 4YAQB 3U48A 2EQDA 5E6IB 1WWCA 1KYOJ 1AMYA 4M6MH 2TAAA 2F58H 1LK3H 4ELKB 4PJXB 3RM4A 4Y5YB 3W25A 1NCCL 5IQ9B 1MFCH 1H8NA 4U1NA 1XIWA 5MENB 3KAAA 2XTJB 1H9VA 1RIHL 4J6RH 2DIEA 2GQHA 3QZWB 5I9QB 4OAWB 4NFDA 4F7CA 2I26N 2OR9H 4KHTH 1NGZA 5D9OA 1RU9L 4WW1B 2VXQL 1ZBWA 1OQXA 2K9UA 4OT1H 4DEPC 3ZL4H 1ZTXL 3ZR5A 3DUUA 3ZLQC 3P9MA 4IS6B 4KJPC 4MGXA 5DK0A 4KKCD 4YHYB 4D6IA 5ADPL 5ENWA 1S5IL 1H3TA 2QLVB 4NRSA 1ZVHA 2E9WA 5HNNA 2WWKO 1WCBB 5HY9B 2Q8BL 4MNHA 4LMQE 5CJXC 4P2OC 1MELA 1R7AA 1GPOL 2YEZB 2NSXA 1MCLA 4JG1H 1QNZL 2BSSB 4GG6A 2E6QA 1V02E 2JJUA 1H5BB 1Z0MA 3HAEG 4LU5L 4U1SB 3WLBB 4AT6A 1NLDL 3MUY1 1KNOB 3H3BC 3KPPB 5E2UH 2OJEA 3OZ9H 1HSAA 3EDEA 3RJQB 3RJYA 2D3VA 5DSCA 3QJHB 3JWNC 5DRXA 2LTQB 4PJGA 3BE1L 3SE8H 1OY3B 1F3RB 4TPRH 2AQ2A 1REIA 4O2EB 3AXLB 4KKLD 1LEGB 2J8UB 4GRMA 3ZE1F 4N0FA 3JTSB 3WF4A 2B0SH 2DT0A 2AERT 1FIEA 2AXHA 1P69B 1MFBH 1A2YB 2Q76B 1EGJH 1NCWH 3FB6B 2YBTA 1KSRA 5TGBB 1JN6A 2A1WH 3UEZA 4JFFB 2P8LA 4GAGH 3QUML 2KQMA 1D5BA 5IV2B 1L7IL 2W61A 4NM4H 5D7IB 5D72L 5GRVL 3T77A 2X6MA 5GGQL 1XR9A 4LK4A 1DBBH 1B3ZA 3BP5A 1L7TH 1IC4L 1A4JB 4YDKH 3FOMA 2EXWC 3OKKB 4OCWL 4QLJA 3GMQB 1H41A 2GK2A 3ULUL 4HS3A 1CWYA 4AIZB 1JZ3A 1QOXA 4UFJA 2IPUK 3PWNA 4UDUB 3DBXA 1D2KA 5FA3A 2HN7A 2VISB 3NAAL 2AEQH 3EJZD 3SY0A 3VFUA 4TOYH 2A74B 1HXMB 1KC5L 4MAYD 3N1GC 1G7PB 2XZCH 4ZO9A 2JB5L 4Z0XB 1KB5L 4DN4L 3L9RB 1GUVA 1TJIH 2DYPB 2E8YA 3BZFA 4K94C 1KNOA 3CUPA 4BQ4A 3BKML 3SDAB 3OXSB 3RGVA 1BLNB 2I24N 3RAJH 3RZWA 1I3UA 2RB8A 4HJ0D 1JL8A 3O9WB 1KR1A 1MVYA 2X40A 3L4VA 9CGTA 3SCUA 4FXGB 3OJMB 5ADOL 4NP4H 3C5ZA 4EVNB 3GMOB 2CKBL 4BF7A 1J11A 1ZOXA 4GS7C 3L4XA 5BMFL 2XACC 3GSNL 4R8WH 4GRLA 1H0IA 2WAGA 3DXAD 1XR8B 5CMAA 1XF2A 3QIUD 4M02A 3UO1H 2IF7A 3CCHB 5BVPL 1J8HB 1S9VB 2VI0A 3P0VL 4MJIB 4ORGB 4RMUA 3TO4B 5HYJE 4K3HA 4MS8D 2A3CA 3MOAL 1M7IB 1QBAA 2EKSB 1UKTA 2OCFD 4FN0A 1S7XA 5HHOE 4N90D 4XVTH 3NVQA 3L5XH 5F8QC 1I8IA 1NGXA 4I2XB 4W84A 1FJ1B 5EZIL 2QKIA 5ESVA 5KSAB 1B3VA 4XX6A 5SWZE 3N11A 3H9SE 4TQEL 4YN5A 1G7HB 3OKNB 3QEUA 1QI2A 2ZUXA 5DO2D 4GQRA 4OIFA 3RVXD 3VFMB 3WLWD 3BAXA 3CH1A 4NKMB 4ZOBA 3GBNH 1MJUL 2BZDA 2H9GB 4E42B 1I1CA 3RVUD 4HA1A 3TVMB 5I17A 3V79C 3G6AA 3VFNA 5FYJL 5KJRH 1A3RH 4S11A 5ALCL 2AI0L 4EDXB 5HYSG 3D0VA 1GOOA 3QQNA 5A2AA 4HH8A 2DQUL 4IDLA 1MAML 2FX8L 4YHML 2WLYA 2Z93B 2VL5A 3C6LB 1JPST 1SY6H 5ID0B 1NEUA 1PY4A 1EBPA 1T6VN 3PZ9A 5D7LA 1RK0B 2APBA 1X7QB 4WEUD 2QQLL 4HZ8A 3EYUL 1Y0LA 4FQHB 3BPOB 1TR1A 1OSZB 5FKYA 3RU8L 4OZOA 4YZFF 1GGUA 3RUGB 3RDKA 1E4XL 4RNRA 3RO8A 1MJJB 1QRNB 8A3HA 3C5SA 4OCSL 2BJML 3DX9A 1FNGB 1H09A 1N4XL 2B8OT 4GJTB 1U8MB 4OFYA 4WCYL 3AS2A 3WIFA 1P53A 3M45A 5CMAB 4FQLH 3C8HA 4XC1H 5E2TH 5AWNH 4V1DE 1QNPA 1A3LH 4QRUA 5L0QB 3GSQB 1GHFL 1EFQA 4HLZG 5LGHL 3QO1B 3QQ4B 4MX7A 1XCWA 4MQ7B 1T04B 2FLRT 3QUYB 4DUXA 5EZLB 5FFLA 3S4SB 4JZNA 2V5RA 3MPCA 4GAFB 2A6KB 2HA1A 1DUZB 1XCTA 4OF3A 3X3FL 5LKNA 4KVNL 4XVUD 5IFPA 2C4FU 3AREC 2VLLB 1CGWA 4DOHB 3AAZA 3WHE1 2VXSL 5C6TL 3WQVA 4BSJA 1IJ9A 4RFNC 4PCSA 5D72H 3KYKH 4NO2A 3U7WL 4R2GC 1WV7T 1KCRH 1BGXL 5AZEL 1WEJH 3BIBX 4NHUB 1TZ7A 3HR5A 4P2RE 5ECUA 3ULVD 3RWJB 3AM8C 3RUGA 2UUDK 3ULUD 4ODBD 4XWOC 2ZZUT 4PJFF 5L6YL 1BIIA 4ERSH 2HRPH 2HISA 3UJJH 3NACH 1YA5A 3UTPE 3BHBA 4M43H 3ISWA 1U8MA 4I77L 5GGVH 1IGJB 5J8OA 4FTVA 5IVXA 4B7LA 4MHHI 2CEQA 4P46D 3ZM8A 1KC5H 2EPLX 4DCQB 3OAZK 1CI5A 4FQIL 1OT2A 4I9WE 1R3LA 5KSBE 3GUTA 1OF2A 2OSYA 4H8WC 2XOTA 4NO0B 1UM5L 4L3EA 4TNWK 4D9QE 4FLSA 2Q8XA 5CINH 1IC7H 3ILPB 2HKFH 1HYRC 5GGSB 4WF7A 5DQ9A 3W53A 1TQBC 2HJKB 4MNGA 2CDGA 4PJEF 5HHME 3VW3L 1GC1H 4GSDL 5IMKB 1HHKB 1X5AA 4D6HA 1UWGL 5C0DB 1JGVL 1ZVYA 5D2NA 3H3PH 3QAZB 4PRPD 1A7BA 2YUZA 1GGCL 3T3ME 2UWFA 2OR7A 4BS0A 1TPXB 4N8VG 2W9EL 4S1QH 2AXFB 2UZXB 3ZQ9A 4U1LB 4XPAL 3WFBH 1EZVY 2BERA 4J3WA 4LCWE 1JNJA 1QFUH 4ZUVA 2DM2A 4EN3B 4P2QD 3IJYA 4L3CA 1E5NA 1U3ZA 3HC4L 1UJTA 4DW2H 1N8ZB 1FH7A 4LSUL 1S9YA 3LMYA 2B2XL 1DUYA 3TA3D 4LU5H 4Y5VB 1C16B 4O51A 1YPZA 3WXWL 3GK8L 4MWFA 1A7OH 1OAZL 4WV1A 5I8CB 1A9EB 1MFEH 1VDGA 1XF1A 5C8BB 1KXTB 1MRFH 4ZENA 1C90A 1M04A 2XV6B 2EIBA 3GMRA 3PZTA 5BRPA 4PR5B 4B15A 3MA9L 2PXYA 2ZUQC 5A3HA 1RP8A 5EU3A 1HQ4B 1JN6B 1IGMH 3AHVA 3O41A 1CFSA