4OBSA

Crystal structure of human alpha-l-iduronidase in the p212121 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
594
Chain Sequence
APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLAAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human alpha-L-iduronidase in the P212121 form
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 194
structure length 594
sequence length 613
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2014-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4obsA03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4obsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4obsA02
4QTIL 3FN9A 3GSNL 4D0CB 4H8VA 3QJHB 4QLKA 4HLZG 1G7IB 3BPNC 4UOW1 3KYAA 2PO6D 4G7YH 4X9GA 4YHPA 4NQEA 2AEPH 3BWUC 3PGDB 5JR1L 4NWTH 2HISA 3M07A 4LIQE 4HPYH 5FKAB 5CLTA 1YYMH 2CRYA 1IGYA 1VGEL 3KS0H 3GHEL 3KVQA 4WJXA 5DYOA 1UM6H 3DUSB 1IAKB 1OAYH 4LEOA 3VM5A 4OLVH 5HPCA 3Q5TA 1U42A 5IVXE 2YDQA 4OCWH 2DQDH 3W11C 1JWMB 1WT5A 4PTVA 4M61A 1BSIA 3MUJA 3GB7A 4FMFA 2C1OA 2CO7B 2ICEB 4L3ED 2EDQA 1CD0A 2IH1B 4ODUA 4YO0A 4Z7UB 4XPFH 3UTSB 2I07A 4W8AA 1N5YH 1N3NA 4MA7H 1AQKL 1L4IA 1HHIA 3Q5OA 3G5YB 1KG0B 1CL7H 1D5XA 5GRZA 3HZKB 1MW0A 3WO3B 1RK0A 3KJ6L 4M7ZC 1MY5A 4D6JA 5KVFH 4X9BA 4P2RE 3SE3A 1PIFA 1DQQB 2KBGA 1RHFA 2PO6C 4WENB 1CZ1A 5I30H 3RHWF 2GSJA 4QWWD 5KVDL 4OIBA 3D3VA 3VD5A 3GJFK 2EPOA 2ZPKH 3JWDC 4TUJA 1ZA6B 1OT1A 1CXLA 4AD3A 4K71B 4KTDH 4PRWA 1H49A 2FIKB 2P5EE 4S2SB 5FHBL 3VFRB 3FONB 5M17A 4WNQA 2VUYA 1YECL 1E6QM 1E6OL 1G7HB 1N4XH 3S34H 3VRJB 3DC0A 1I9JL 2GJ6A 4E41E 3BKYH 5HYFA 4CW1A 3K80A 3O41A 1A7NH 4XHJC 4S1RL 5JZ7C 2F5AL 2WWMD 1S9VB 3FB5B 1MCPL 4RBPK 1FV1B 3FQXA 2V2TA 2BSRA 3P4OA 3PL6C 4RAVA 2DQCH 1KBBA 4LLUB 3BZFB 4XPGL 4TUOB 1P7QA 3CDGB 3D0LB 2VRQA 3FL7A 5JOPD 4UTBH 4GKNA 1NDGA 4OCSH 5HOSA 1NLBL 3BHBA 4WGWB 3A6OA 4MCYA 5MEPB 5EA0H 4EDWH 3VIHA 3IFOA 1WCQA 3DTXA 4LCWD 5EB8A 2D0FA 2VX7A 3OLGA 1J0ZA 5FM4A 1MFVA 3STZA 1JCKA 5DHYB 5SV4A 1MCWW 4LAQL 2R1WA 4KQ3L 5E6IC 2VDLL 3GSWB 5E99H 4AZ5A 12E8L 2J8HA 4NPYA 5EFIA 5EZJB 4JZNB 3WD4A 3X3GL 4U33A 4QP0A 4V2XA 4OFKA 4PMDA 4KV5F 3IDJA 1RVFH 2Q3AA 2YSSB 1QYGL 1GC1C 2HFEA 1QLEL 3CUGA 4UQ9A 3P0YH 5CJOH 4Y4KB 2Y24A 5CP3H 1XGPB 5IM7B 3HUJE 1FYTB 5ISZA 4MNQE 4LCIH 3D39A 3WEMA 3BQUC 4GAJH 3F7PC 4ONGL 5T3XL 3N15A 3HZYA 4YDKL 2F2HA 4YHEA 4PJ5D 3EYOB 3QI9D 2FSEB 1IC4L 4NWUH 4R8WL 3O4LB 5EUKB 4JN1L 3UAJC 3MV01 2FB4L 3BDXA 4G43B 4HGKC 4JFED 1GPOL 3OZ9L 1KGWA 2NY3C 4PRPA 3QCUH 3U5YA 4RMRA 3QPQD 1DTUA 4X8XA 1YUHB 4LGXA 2V2XB 4PTXA 5ADPL 4KKBD 2X1QA 3TIEA 3OJ2C 4PLNC 5BVJA 1UHVA 1A3RL 2W0LA 2XWTA 3MGTB 4YE4L 3RVVC 3X3FH 2DF3A 3RWJB 5FK9B 3ABZA 3UJIH 1IBGL 3MLSL 5DJDA 4C4KT 2E6JA 3AYSA 1VFBB 4LAJH 5FOJA 4F15C 4PYGA 1QRKA 1H3PH 5D7SL 1LDPL 4NQEE 3VE0B 1RZ8A 5KSBB 1PBGA 2QPSA 3IJ8A 4ZYKB 5IB3A 1HXYB 1CTNA 1UR2A 1E70M 4UB0H 4XCNB 4MX7A 1DQTA 1J12A 1W8OA 3Q3GA 3RI5F 2CIIA 2DLEA 1B88A 1JTTA 1RUAH 4IRZL 4Z8FL 1BFVH 4ODSL 1SYSA 3SCMA 4HCRL 2YJQA 4Z9KB 1G9HA 2IBZX 3CVHB 1GL4B 1YJDL 5CJQH 4G8GB 1JZ3A 4QXUL 5I2IB 1A5FH 4K7PX 5EU3B 3RPKA 1DFBL 4JFYB 2P47B 3FTGB 3HNVH 5DK0B 4NO2B 4JANB 3VFMA 3BI9X 2Z92B 5F1IB 4PJEA 3R8QA 3H3KA 3G6AB 43C9A 2AJYH 4JPWL 5D1QA 3RJDA 1JNHA 1ZLUK 1AY1H 2AK4A 3MXWH 4Y2DA 4M7LT 4TQEH 1A1NA 1NGYA 2A38A 3DYOA 2R29L 3GDBA 1KB5H 2XPGB 4JPIB 2Q7YB 3PGDA 5F97E 3S4SA 1X5IA 4BSJA 5ICYB 3L3JA 2XIIA 1OGAE 2F5BL 5HDLA 1IAKA 3NMEA 1OSPH 5ID0A 3BGFC 3LIZL 6TAAA 2EYRB 4IHOA 1LP9F 4OCWL 3RWDA 3RVUD 3TBSB 2W91A 4EUPG 2EYRA 1XZ0A 4MXWL 2FZ3A 4WSJA 4BFBD 3VXOA 4HD9A 1I1YA 5F88A 4PRIB 2D4FA 1OGTA 4LLWA 4RGMB 5TE4H 4P2OD 2CKBH 2W0KA 2BHYA 2Z8VC 1DJSA 2ZX6A 5KBNC 5DLMH 4QCEA 3AXHA 1MREH 2ZG3A 3P30L 4UIMA 3HMCA 1TNMA 3QO1A 5JMOC 5ISZE 1T0MA 3SUTA 3WQ4A 3QO1B 3RGVB 4LF3A 1QSFE 4OZGE 3MFFA 3AIEA 3WDQA 5L6YH 3HS0A 5ICXA 1QA9A 1HSBA 2IPUK 3T09A 3H9HB 3KHOA 1XF2A 3C9NA 4J8RB 3ULSB 3MRMA 5EO1B 4MJ6A 4WF7A 4WI5A 2DLGA 5CD5C 4PJEE 4Q0XH 1BWMA 3QXDA 1H11A 1BF8A 1IM9A 3QIUA 4HIXL 2QF8A 2QSCH 4X0NA 1M05A 1DQDH 3HG1D 4G8GE 3KPRD 3PTKA 1NFDA 3LCYA 5K9KB 3AFBA 1OARH 3KYNA 3VA6A 1WWBX 4JO3L 3PTQA 2YPVL 1P9MA 1FP9A 1NFIA 3WUFA 5D7LE 1UCBL 3E8UL 1T1WA 3JWDH 2DQJL 2NXZC 2BY1A 3TH3T 4QXGL 1U8OA 4RIRB 3ALFA 3TNMA 1WAAA 3II1A 1CGTA 2OS7A 3M17B 3PL6A 1SYVB 4PRHE 1U58A 3RUGA 2D20A 1EK3A 1A7BA 5HGHB 2YRPA 3VCLB 3D3VB 4OQ1A 4HTYA 4IOFC 4FLOA 5DK2B 5C0AB 1J87A 3ORJA 3D3VD 1X5FA 4Q2ZA 2UYLB 3L6FB 1U6AH 5C09D 4XNXH 1C5DB 3L9RB 2NY1D 4OT1H 5E09A 2LVEA 2NYYC 1CLCA 3QDJB 4C83A 4XCYA 5I8CB 2IG2H 1CWYA 4HWBH 4UQCA 4MB1A 1G9MC 3K2UL 4GRWB 1JZ2A 5JIWA 1MHPH 5DMKB 5KAQF 1N7MH 3T77B 5IB2A 4L1HA 1ZVHA 3D69B 1O0VA 4QOKA 3TA3A 3OZPA 3W24A 3IF1A 4LLQA 1FAIL 4U6YA 4WY7H 5A8QA 4F8XA 2RBLA 3PWPE 3MR9A 4NO0A 4WSKA 1KN2H 3N1MC 5KVFL 2ITDB 2ZOKB 1AP2B 2A1WH 1T0NA 3O2VH 5IEKA 1K6QH 1U8QB 3B43A 2G75B 4P57A 3TT3H 1JFQH 1FC1A 1KJ3H 2GK1B 1UC6A 4WHYH 1XC6A 3W0WB 3VPLA 1UWSA 2R56H 1F4AA 5E6IA 2YPKA 1A6UL 4UIKL 1UKOA 1HSAA 1XIWC 3QDMD 2AXHA 2D9CA 4H0HB 5FGRA 3DVNA 5KZ6A 3U7YH 1ZEAL 3CCHA 3U9PH 1F58L 2HTKC 3CMJA 4LSSL 5I1CH 5DT7A 3LRGA 2CKBA 4Q22A 2AJSH 3K8LA 4Q58C 2NT0A 3MCLH 2DGAA 3DIFA 4HUUB 5AZEL 5ERWA 2J6EH 4OFYA 3DI3B 4LLUA 1MQKH 3QFDA 4KMQA 2X1PA 32C2B 3TIDB 1RJLB 4AMCA 1N0XH 4OZIB 4TVPE 1BVKB 5EO0A 4O2FA 5C07D 2VDOL 4Y5VB 4G8FB 1UQYA 1HINH 5EMYA 1PYWB 2VKXA 2GSGA 4P7QA 3SCSA 2AV1A 4Y5XC 5L8JB 2EDOA 4F33A 2HAZA 3ARGD 2BNRA 3IJ7A 5DJXB 1CQKA 4ZS7H 1UM5H 2WVVA 4DM2A 3GH4A 1EVUA 1TJIH 1J0HA 4P4KC 5FCUH 2MHAA 1KENH 2A6DB 4UNTA 1I4FA 1UFUA 2GFBB 3BZEB 5AD0A 1NLBH 4JPKL 2WAHA 4XBEL 4JLRA 1R7OA 5F7NC 1NBVH 5IFHL 3QPQC 4G8GA 3TT1L 5AYBA 4ATLA 2VDMH 3VWKD 3FN0H 3QXUA 5SX5K 1U92B 2XN9B 2DQEL 5E2JA 2E4TA 1LO3H 1P7QD 2W65B 3AMGA 3L3KA 4FLRA 5FO9B 3IJ9A 3KPQA 3LDBB 1SBSH 3MUHL 4XI5C 2FEEI 2BVYA 4ONGH 5T3XH 3GHEH 3RMEA 4ZFGH 1WBYA 4YBLB 4LNVA 4FG6C 4KJWD 4GAYB 1KXQE 1YEJH 3S4SB 1HILB 4M93C 3SE4C 4PJ7A 1EO7A 1NOWA 4P7RA 3TOPA 1VJZA 7A3HA 1GC1H 3MUGB 1RZKH 4G5ZH 5D7JB 2EEAA 1HHHB 3BC9A 4M7KH 1AJ7L 1MRFH 4FQ2L 5D6DC 3QNYB 4TRPH 3UZQA 2NXZB 4RQQA 4CJ1A 3KXFB 4Z0XB 1DBBH 4F2MB 4P9HC 4QRTB 4M5ZH 2H2SD 2FBJL 1T2QL 2OR7A 3WEXB 1ZE3C 5DVLA 3TA9A 3KPMA 1A4KB 4HS6B 3G6JB 1RHHA 2X4PB 3O6MH 25C8H 1QSEB 2Q8BH 3M8OL 1IC5H 3WFBH 5C0ND 1MI5D 5AZ2L 1HHKA 4KKNA 1F02I 1TJGL 3C09C 3MBEB 3KPSA 5CJOL 4PJCE 3ZE1F 3PZ9A 5HHPB 1ZBCA 1DE4B 2ZUUA 1NWUA 3X13A 3ZR6A 3O4LD 4UB0L 1UYWL 3RWIA 4PMYA 1WGOA 3ZHKA 5KG9B 3HC4H 1LO0L 1F6AA 4LHUB 2X8RA 5C0CB 3CUHA 3MV7B 3G9AB 2Z31B 3ZIZA 4Y4KD 3TESA 1UT9A 4Q0XL 4XAWL 4N0CD 3MGAA 2A6KB 1HIZA 4XP9H 1P2CB 4JFYA 1R0AL 4QRPB 2VYRE 1U8IB 3CX5J 3F8UB 1D5ZB 3DWTA 1AD9A 5EU6A 2EYTB 3CFJB 3OXRA 4ACZA 2EKSA 1OM3L 5GRUL 2PTTA 1YEHL 4LVEA 2VIRA 1FBIL 2Z31D 3CUPB 4UBDC 5HVGB 3KPOA 2WMIA 5ACMA 5M3WA 4LCWB 2RHEA 5D1XB 1V3IA 4PJBF 4AEIL 5A2KH 1K4CB 1V08A 5FIPA 4X0KB 2IAND 1IC7H 4U0QB 2ZWZA 4OLYL 4NQCA 3DSFL 4PJBA 5IR1B 3OGRA 1J18A 3VD7A 2DQGL 5L88L 4PIRF 5J3HD 1ZLVK 2YRZA 4U1NB 4FF5A 4S0TD 2C4XA 1BQHB 3UTQA 5F6HI 3UTQB 2WHJA 4G7VH 4Y8AA 2A3EA 4H8HA 2W62A 2R23B 4UAOC 1OB1B 3O6FB 4BSVA 2VRJA 3U0PB 1T1ZA 1A2YA 4MHHI 3L3HB 4L4VA 4GRWH 1YY9C 2OR9L 3QDHA 1PX4A 3EYSL 2I5YH 3H3PL 4FQCH 4ZQKA 2P5ED 2NY4C 2WC7A 1ZHNB 4ZO7A 3KNBA 1JHKL 5D71L 1IZKA 4YUEH 5D7JD 3GI8H 1PGRB 4W6YB 5E5MB 3I9GL 3TO4A 3QZWG 2EPNA 4FQ1L 3TJHD 3WE6B 2YPLE 4J8RA 4DUWA 3OGVA 1A9BB 3HMWL 5F6IC 2Q8AL 4AG4H 4NT6A 3CVHH 2AJUL 1YN6A 3BKJL 2ZXDA 3WFEH 4Q9CA 3BAXA 4JFVA 4GSDL 1NCNA 1IJ9A 1A9EB 2FO4A 1A6ZB 2Z31C 2XQBH 2BNUB 1IFHH 2BMKA 3PABB 4NQXA 5D9MA 3Q0HA 4NPYB 1G7HA 5FYJH 3VWKB 1IGTB 3VFNB 3HUJF 4MJ5B 5IMLB 1KFAH 2ITDA 2ZOKA 4L3EB 3AHYA 2VDPL 2DPEA 4U1IB 5M03A 3U7WL 2K7QA 1QHOA 4JO1H 4PLOB 5IK3A 3BISA 1BYAA 1L0QA 3JTTB 4OZFG 4YBHA 4CADA 4WV1C 2J88H 3ZHDA 3QAZC 4W8LA 5C0BD 3L3OA 1MPAH 3TN0A 4Y5VA 3JWDL 1V7MH 4IMKC 3E3QC 3FZUC 4GKNB 5GS1C 2KL6A 5C1MB 5CILH 4DKFH 2KPNA 2HT4D 3K81A 3L1OL 4ORGA 5LKNA 5TQ0L 5ADOH 3OX8A 5EBWB 1NCWH 3LIZH 5EBAA 1A6WH 5BVPL 2HJKA 4DEPB 2NY3D 1W3KA 3B5GA 1YUHA 3QEUA 2CKBB 3HJEA 4C56A 2WINA 3MV11 2J7HA 3TO2B 3KWWB 4F57H 4MJIE 2R29H 4DGVL 3KLHC 3KJ4B 4ZE4A 5GS1B 4PUDA 2I24N 2AK1L 3IXAA 2F54A 3KPQB 4GMTH 4M1CC 5I9QC 2X0YA 2X89D 32C2A 3UG4A 3L95B 3PG2A 2B1AH 3PQYD 4XHQA 3REWB 4J3WA 1HQRB 3T0ED 1ZKAA 3LZFL 2V9QA 1MCHA 3U6RB 5C6TL 1FRGH 1HX0A 3WDPP 5EZOH 4FFVD 3RX8A 1B3JA 3QUXC 2WZIA 3BGMA 3FOMB 1EFXD 4MCYB 1U3YA 3JV4A 3SKJL 4H25A 3BSZL 3WL9B 2DQFB 4KFZC 2J7FA 3BN9D 1J9YA 3WD3A 1TETL 3FRPG 3SOBH 1JK8A 5F9AC 1OAXL 1EGJL 2L0DA 4QGYA 2O9OA 5GJSH 4MAYB 5HGDA 5GRYA 3NTCL 2WMJA 2R1XB 2VSCA 5FGCB 4Y19B 1WPCA 4P23A 3U46A 2F8OA 2VQTA 4GBXA 1VFMA 2VLRE 4BELD 4A2MA 3HNSL 1PIGA 2VN7A 1LD9B 3MRIA 2ORBL 3ECQA 1LWRA 1T4KB 2XWTB 2X70B 5ALCH 5C9KA 1WIUA 3FFCA 4JGJA 5JW3L 2YBUA 1XH0A 1RJLA 1NCTA 3C6SB 5GGQH 3AZRA 3NABH 3GXFA 4OBRA 3RIKA 3GRWL 2NCMA 4YC2B 2OWCA 4JGMA 3QB7C 4BSWB 5A8PA 5K59E 5INCB 3FXYA 1QI5A 2Q86A 1UKQA 2UVEA 1RFDH 5HHNA 1T1XB 5IHSA 2V9TA 2X4RB 2WW8A 2JEQA 3VXQA 4NQCE 4RQQB 2G5BA 4AEEA 2HVJA 2Q76B 4DZ8B 1V0MA 1GZPB 2D2OA 5JXAH 4XNZC 2ATKB 4RFEA 1HHGA 1JGVL 3LKOB 1IAMA 5F7EH 1A22B 1P2CA 1H15B 4H0IA 6A3HA 3BP6A 4RGOL 2VAAB 5CFHA 4Z7UA 3OKEA 1CFSB 2AQ3A 5ANME 2YOCA 2A77H 4XBGB 3C5SA 4QHKI 3ARSA 4M80A 2PYED 1N59A 1YEHH 4W6XB 2CMRL 2UWEB 5DZNA 3BE1H 1QVBA 3GKWH 2YBTA 5CMAB 3MFFB 3HAEB 1JDCA 3QCTH 3T0BA 1U8NB 2ARJA 1EDTA 4D71A 4XNZB 3TNNA 2DYPD 1QD0A 2R56L 3MODL 4WU5A 3DX6B 5JW5A 3V4VL 5I8EB 1MCOL 1RD6A 5I8EA 3MJ8B 3RVXC 1KJ2A 2OJZL 3AREC 4ETYA 2WMKA 3NZ8A 4MSWB 1K3IA 3UXFA 3SDAB 3NA9H 1KN2L 1KPRB 1NC4D 3O3BB 3VIJA 4LU5L 4NUGH 1AVAA 4S1DC 4N1EA 1MH5B 5J56B 4NRZB 1IZJA 3RNKA 3F7YB 3HE7B 1UEYA 1NLDL 1V02A 1FL3A 4PJ9A 1DE4A 3VFGL 3HE6D 4XB8A 4ONOA 5DTFA 1KCRH 4RDQF 4MQ7A 5BYWA 4DFHA 2YK1H 1A1OA 7FABL 5FYKU 4IIQB 3C09B 3FHQA 3MBEC 3SKMB 5KANG 1NGZA 4YC2C 2AXFA 4XZBA 3IRPX 1ZTXH 4UZUA 3LKQB 3AHVA 3ULUE 4GO9A 1XIWB 4AD4A 1CICD 3BQUA 4HWZB 4IJ3C 4ODVH 1C08B 4XVSH 1T7ZA 3DX8B 4M5ZL 2P7TB 1CECA 5CJ5A 5CPSA 5FYJD 3RJQB 1X9QA 5A8NA 5IFTA 3OR6A 4QHLB 2W9EH 1X5GA 4HIIB 2DQTL 1DWHM 4UCFA 5EU6B 2YPVH 5EU6D 1FQ9C 4LGPB 2WBWB 3GNML 4OD1H 3WQ5A 4UT6H 2ZUQC 4DK3A 5D9PA 3E6FA 1CBGA 1BM3L 2Z93A 5I73C 1RK0B 4BFEA 1FFPB 4FN0A 1X44A 3ARBA 3TO4B 2VB5A 4ISVB 4XMPL 4XH2B 1VJSA 1AGCB 1ACZA 2APVA 3W2DH 2VOTA 4HUVB 4J4PD 5BV7B 3TWCH 2G8ZA 4ERSL 1NGXA 3PV7A 3QJFB 1N8ZB 1VGKB 4U5KA 4G7VL 3RA7H 3L9RA 3HE6B 3BVNA 1JHTA 1HL9A 4KWUA 5F3HB 2ZUQB 4GG8B 1U3HA 1OAKL 3MJ7A 5C2UB 1MI5A 2B39A 3WSQH 4CW1B 1MY7A 3NPSB 2VDQH 3PWNA 2PCPA 5HD8D 5AZ2H 4NFBA 4PMVA 3BMWA 5CGTA 3F62A 1XGQB 1A47A 1E4JA 1MFDL 1RZIA 5C0IB 1J1PH 2R2CA 1YMMA 4IOIB 3M17A 3NN8A 3PL6B 2KZWA 1U58B 4LX4A 1SY6L 3QOKA 1MW1A 2YUXA 4M1GL 3TN0D 1FP8A 3P0YL 1S7UA 3CDFA 3TBWA 1FFRA 5C0FA 4XPAL 1IAOA 3WKML 3SKJH 3JV4B 2OQJB 5H94A 1A14L 3QQ9C 2R15A 4QGTA 1V0KA 4HXAL 4BQBA 2YHGA 3L3IA 4LCUA 1DBMH 3VXUA 2FO4B 2H32H 4Z7VA 1FNSH 1N6QL 2PYEB 3WSUA 1SJVA 5IXEA 4BCEA 2NY0C 5E94A 4M8UA 2XTJE 4BK5A 3FT4A 2Q8AH 4PGEA 3G5VB 4I5BA 4TPRL 3FT4B 2KH2B 2IJ0C 1KXHA 1W72H 1WFNA 1FOBA 3WENA 4LSRL 4EI6B 4HFUL 3PIQA 2QHLA 4XPHH 5D9SB 4CU7A 2DT2A 5EIIA 2EBNA 1XD0A 1PSKL 3ARVA 4LIQL 4KRPD 5B39G 3WNMA 4NUJA 1UJTA 4ZDHB 3C60C 1NCDH 4YWGH 2C0HA 3LH2L 4FOMA 4IDJH 1BQUA 2FX8H 4JJHA 2L7JA 3I6KA 1NKRA 2B5IC 2D0GA 4X5LA 4WCYL 4MXVE 3SDYL 4HKXA 3B4NA 3MV8B 5HHNB 1W9BM 1CIUA 1S5HB 5KN5B 3DJ9A 1Q0XH 1HQ4A 4F9PA 4J3XA 4OZ4B 4X7EC 4OCXH 3VNZA 2NTSP 1B3WA 2D3NA 3WF3A 4ZAKC 4X6CF 5I1EH 1JAEA 1TITA 5F7UA 5F89B 4XTRC 5F7EL 5E8NA 1VFAB 3O2WH 1LEGA 4QF1A 4OIIH 1LD9A 3MRIB 5E8NB 3AVEA 5HHMB 4Y19D 2BX5A 3HC0B 4PJXF 4W7VA 2EH8L 2APTA 2QKIB 1YPZB 3MROB 4JRXB 5HHVH 1I7ZA 3BAEH 4G6JH 3LOWA 3KWXA 2VLJE 4KZDL 3EMZA 1RURL 4P2QE 2FR4A 3SGDI 2VH5L 1NAKL 1A3HA 3WFZA 4XHJD 2WZPD 4FZ8L 3UP1A 4WTWA 5KSVA 1R86A 3O11A 3SOBL 1F3RB 1VGEH 4FQ1H 5A6JA 3N9GH 5IVZA 1NCAL 4F7PA 3PWUA 4B5EA 1LL4A 3PWLA 5I73B 4Y19E 2V5RA 3SIMA 3OAUL 5D4QA 3V7AG 4C57C 3QRFM 2NLJA 4HKZA 5BS0E 1MCIA 4MA8H 5ELIA 5FL1A 3VXRB 3TVMA 4TTDC 1FHDA 1CD1B 2DOCA 3ARFC 5I6SA 3S35H 3PZIA 2AK1H 3BAKA 4NP4L 3MNWA 5EBLA 4X98A 2OMBA 5EIVA 1T6VN 4JO1L 3CFDB 5A2LH 1CL7L 5DD3L 5GGVL 4CJ0A 2GVYA 3POHA 4ODWA 1X5HA 4WIQA 1ZLSH 2DTML 2Y07H 5IP4A 1NMAH 4P0DA 5B21A 2ENSA 1E9LA 1J1OL 4NO3A 1BBDL 2FD6L 5SWZE 2UY5A 1IGCL 3MO1A 3OB8A 4M7ZB 2WIIA 1JGVH 4XPBH 1UWGL 4F9PC 1LHZA 2HJFA 2ZUTA 5L2KA 2HT2C 1TZHA 2Y6SC 3VW3H 4LYPA 1K2DB 1VF8A 4Z2KA 3ILPA 5FXCH 5BOPA 1EBPA 1TVHB 4JCLA 3LS4L 1UUQA 5EBMB 1MIML 1DQMH 3MBEA 4PJAE 5FO7B 1OBAA 3BW9A 4FQXA 3VD4A 3WNKA 1TZIA 1KB9K 5BXFB 4UAOB 4PRAB 5FM5M 5D2LE 3WBAA 3MRFA 5HDBF 3FFDA 3MRLB 4YHKL 4BUGA 3CH1B 3RBGA 4XH2A 1HSBB 4X4MA 1LILA 1A21A 5FFLA 4E9LA 3ARFD 1X5YA 3GMPA 4I0PB 2CKRA 4MSWA 5CJ8A 1RZJL 3WNPA 5IHUH 1OL0A 3JWOH 5HTSA 3TTYA 2PYEE 2JCCF 4RMQA 5E6ID 1EQPA 4HP5A 4MJIA 3BP5A 4OB5L 3WXWH 1PQZA 4YK4B 2XKNA 4GZIA 5EZOL 4UINH 5KS9B 3R06A 3MZGB 2NW0A 3CX2A 3IANA 4KUCD 1NAML 5DTFB 3TIDA 1ZHNA 5DQDL 3FN3A 4UFKA 4M6NL 4Y5XA 2R8SH 1QRNB 2ZKHH 4X7CC 2DWEB 3G6DH 3O2VL 4OQTL 3L6FA 1U8HA 2IGFL 2IANB 4PRPE 1H0IA 1B4JH 2J1KA 3BJ91 1WEJL 3INUL 4EOWL 1NMBH 2G3JA 3KL0A 3UESA 3QEQB 5BZDB 5JQ6H 1A9EA 3K0WA 8CGTA 4I9WE 1GAFL 2F58H 2LE9A 3G5VA 4DN4L 3VMOA 4LVOC 2W60A 4D9RD 4HKBB 3RCNA 1ES0A 5GRVK 1C1EL 4L9LB 2XKUA 5I75C 3SJVB 3VFSA 3L95A 1GQJA 4F3FA 2PI6A 3B6SB 4N0YH 4U3XA 5I1AA 1CIDA 3O81A 2RJMA 1NH6A 3MV7D 1MFEL 2Q7NA 2EIBA 5I1LB 4AMKL 1HKIA 4OM1L 5H94B 3W0KA 1ZVSA 4NM4L 5LGHH 4NZUH 5TE6H 1NQBA 3OLIA 3TJHC 3DVNB 2VZUA 1YN6B 5C0RH 5INDA 4OUUB 1UWEL 3M1BB 2DQDL 5I8OL 5E08L 5I9QB 1ZBKA 2C1PB 3WIJA 4XZWA 5E5RB 3HCVA 3AIWA 1FIEA 1IMHC 3CLEH 5CCKL 3CHCA 2IC2A 1GZJA 1MI5B 4OLEA 3VXMA 1NSNH 4MD5B 4KGLA 4H20L 4HUUA 5KW9L 1XCXA 2A73A 1NUGA 1F90L 4E8DA 3LS5L 1WDQA 4WWKD 2C9AA 4Q6YA 1G7JB 4P2QB 2FNBA 4LLVA 4MB3A 4HCRA 3MXWL 5E2TH 1OTSD 2YRLA 2MCPH 3VOCA 4IJ3B 1CPUA 3QFJA 5B4MD 1M7DB 3MRPB 3DMMD 4ZOBA 4X6BB 1T1XA 4F9LA 5D5MB 4ERSH 5TPWL 5D2NC 1XGTB 4JPVH 1D9KC 2DB8A 3VFTB 5FUOL 3IETB 5E6YA 5GRJH 3S36H 4WW2C 4JO4L 2ATPB 2F53D 5DF0A 2ZUNA 4CD5A 4OTXL 4JO2H 4HT1L 1QBLH 1YECH 4L8BA 4BH8B 1W0WA 3TFKD 4R4FL 2XN9D 3AIQA 4KQ4H 1CK0L 2MOVA 3KJ6H 4ELMB 4NKDB 1UCTA 2YA0A 3NCJH 4ELMA 4OOUA 5F71A 1V6YA 3BXWA 1QSFD 3IKKA 4A3HA 4KRTA 3H9SE 1FNLA 2XVGA 3VFOB 3U6RA 35C8H 1OP5K 4R96B 5DVOA 1RV6X 3EDDA 2MJWA 1V5JA 4EI5A 2AXGB 1A3LH 3P40A 4CAGA 4CN6A 1Q8MA 3VU2A 1Z3GH 5JA9A 1YZZA 4OZHF 4WI3A 1HIMH 4XXCC 3LKRA 3T4YB 2J78A 5T1LD 3GBNH 3I02A 1OAZH 3CVIH 3UBXG 4U0RC 1P6WA 1AI1H 1D6VL 5HDQL 5J0BA 3CFIC 5CINH 3ME0A 1U93A 3KYOA 1T3FB 2F19L 3GJFA 4FQIL 3HAEH 1F4YH 1KXVC 2VC2H 4ODHH 2BRRH 2E27H 5I8KH 1PSKH 2GIYA 2O61A 1Y6KR 4KRUA 3QUYD 4XX6A 4YZFE 1ZLUH 1YEGL 3VIKA 2YIHA 1CFTB 4KKLC 4HIHA 4UV4H 4BSWA 5KOVC 2B1HL 3DETD 1CZ8H 4MDIA 5ABHA 4P8UA 4GFTB 1E6XM 3W0WD 3W5NA 4CU8A 1ODUA 4FHBD 4RNRA 1S8DB 1GQLA 1QI4A 3V5KA 3SCTA 3MTRA 2CKNA 2YA1A 3DX6A 4OCXL 5LQBL 1XGUB 4ZUWB 3ULSA 5IHZB 3V4PH 3MRMB 2D22A 3SCPA 4FP8L 3HI5H 4ZTPL 5IMMB 3MCKB 4XVUD 5IMMA 3E3QE 4HZ6A 2Y36L 1UADC 3CH8A 5GS0C 1W72L 2WCSA 2WVUA 4HFUH 4IMLB 1QR4A 2B7DT 3VDBA 4DVBA 5GJTH 4QCIA 1TZIB 4Y5VC 3SN6N 2APBA 5HHOD 2CJUL 3KPOB 5D70L 3D18B 3MA7A 3S8WA 1IC4H 4NWUL 1EXPA 2ED8A 1NAKH 3CFKB 5KVEL 3I75A 4ALAL 2EXWD 1YC8A 4QRQA 1RIHL 3F5JA 5C0AD 3LMJL 4M4PA 5BQ7A 2BS9A 1OQXA 2VXTH 3WLWD 1L7IL 3MMWA 4TUKL 3D5HA 3WUWA 1W91A 2AI0H 2OI9C 3TLRA 3WFHB 1ISVA 5DJZA 4B0MM 1N5AB 2BSSB 1R3HB 3HUJA 3K4DA 1DUYB 4QHKJ 5IMKA 1UM4H 2Z35A 4U31A 3P4LA 5AUMA 4D3CL 4TOQA 4IMKA 4NKQB 4P49A 2Q6WA 4TVUA 2JF7A 4C7DA 3W9EA 3PBGA 3QHTC 1AQMA 1D5MA 2YD1A 3LH2H 2NR6C 4FRWA 1KSRA 2MTPA 3GO1H 5C07E 3VGEA 1Q9LA 4MCZA 2VXQL 1IL1A 1YNLL 2H9GA 3GGWA 1N0LA 3QR2A 4AZCA 4IOIA 2V5YA 4MJ4A 3FO0H 3LSOB 5E7FA 3LS4H 3CZGA 1U8PB 2EJ1A 4GXPA 1AC6A 5DJ0A 5GNYA 5JOFA 4QRRD 5DJ0B 3O3DB 5EU4A 2IADB 1SMAA 4NNYB 5FKPB 4KXZH 4JY4A 3RA7L 1I9IL 3DX8A 1C5BL 2I26N 4QRUA 1J0KA 2NY7H 4Y7MA 3BAEL 2W60B 5GGRY 2BVDA 2NY0D 1QVOA 5F7YC 3IS0X 2G9HB 3TIEB 5LWYL 3RFZC 4JM2B 5IMOB 5J13B 1YJDC 1VKXB 3E2HC 1EHNA 3NAAL 4JG0L 5SV3A 4I0KA 1FCGA 3WQ8A 5IVXA 2YD3A 3BEVB 5DD3H 5GGVH 5CBAA 4O58H 1SY6H 1UR8A 5FO8A 1TPXC 2BFVL 4OCRL 3QFJB 3TBTA 4JKLA 3WJLA 5F3BB 4ZPVB 3CUFA 5ITBH 4ORGB 3WHXA 4DWHA 4WI2A 4CVXB 4MNHB 1N8ZA 3EOBA 5FGSA 1FHGA 1XGTA 2QQQA 5I16B 1M7IA 3KLHD 1BD2D 4HXAH 5I16A 5LGJA 1HNGA 1RUPH 3DGCR 1ZAGA 2G5BB 5CEZL 5ISZD 1CLVA 4ZNEE 3P9MB 1ZJBA 3QG7L 3BZEA 1QLFA 2MPAL 1PPIA 2OSLB 5DURD 1OWQA 4ELME 4IRSB 2ADIB 1TPXB 4S1DD 5A16B 1VBUA 4XXDB 1I1AD 3DV6A 2HLFC 1K8DB 1REIA 4M3KB 4GRLB 1RZ7L 2OTWB 2H8PB 1JGEA 1IARB 2R2EA 1BBDH 2FD6H 5DO2C 4PJGA 4OM1H 2ITCB 3ZHLA 1KIQB 4UUJA 2BRQA 4NQDB 1QSFA 4OZGA 2OSWA 5CGMA 1VHPA 4ZTOL 4YAQA 1MLBB 1TVNA 4JQXC 2BJML 4XBEH 1FCCA 1KGCD 2A3BA 1KPUB 1QSZA 4FQXC 1DQDL 5FDWB 5GHWL 1E0XA 1IRAY 5E8DL 1QACA 4PJDA 5LA1A 4LCUB 1DLFH 1M03A 1QKZL 1BZQK 1CU4L 2F54D 4K8RD 3DHUA 3MC0A 4IS6B 4I1NB 4L4TE 2APXA 4NZUL 5TE6L 2CPUA 4I5BB 2R2HA 2F58L 5CSGA 1MCLA 1X6LA 5T3XD 5IBTL 4GRLC 3T65B 4P4RB 5B22A 4H26A 2DM4A 4MNQD 3LRSA 5FYJU 1FVEB 3HRZA 1G7JA 4HHAB 2A74A 4JL1A 4GW5B 1NJ9A 1IT9L 4UIMB 2VT0A 1JGLH 3UTTB 2GY7B 2MQ3A 4MJ2A 1A1MB 4JPIA 3WBDA 1G7LB 2WV3A 2HN7A 2WBJA 3BD4A 1QFWM 4P8XA 3B2UC 4PSRA 1N6UA 5E4EC 1OQOA 2YD4A 3RWIB 4IISA 3MX0A 5BO1H 4PGDB 5CSYA 1IM9D 3QIUD 4KVCL 4W88A 1AGDA 1VCAA 5MENA 5HI5D 3OTTA 1YHTA 1XIWA 4B9YA 2CDGA 3WXVL 1V0NA 2R0LL 3QG6B 5EU5B 3U0WH 4S3KA 4MQTB 5H2BA 3WFCL 1SMOA 2FJHA 2GTZA 1AIFA 1ND0B 4EK7A 5D7KD 1T03H 1A7QL 4JRYD 3ARDC 4NN7B 5DGRA 1G01A 1DEEA 4XRCA 5TF0A 5GQBA 2P8LA 4G6FB 3LN4B 4JJ5A 2Z91A 4ODTL 1HOCA 1U8OB 3MRFB 4L3EE 2CETA 4NCDA 4WU7A 5BRZD 5FB8B 2DM7A 3C6LA 5HYQA 2GEEA 2AKRA 3N0PB 4JG1H 2QPUA 4TVCA 5KVMC 2J8UB 4U1MA 4PUBL 4PBGA 1F4XL 1MJJA 3QZWA 5IVNA 1BVLB 1DLHB 3LKPB 3L3DB 1EZVX 3D0VB 3VIIA 2XWEA 4CD6A 5IBUB 2N7BA 3H7BB 4X7FC 5FHAL 2GFTA 3QWQB 2CGRL 4MDPA 1HJUA 4FQIH 1F4YL 2PNDA 1P4LB 2BNQD 1ZGLM 2VZVA 3T77A 3FN0L 5FUCC 4MDJB 4YNYB 5GGSB 4KUZL 2FLBT 4NC1C 5A8MA 3NCJL 3MQIA 1KXQA 4DCQB 1G7IA 1P4BH 1ISZA 3CXHJ 3D0LA 3U7WH 4ATWA 1OGSA 1TZ7A 1HHIB 4RAVB 3WLWC 3WUWG 2YL6A 5MEOA 2XTJB 1JPTH 2ADFL 5KVGH 3HB3C 4IIQA 4ZXLA 4WUUE 1A3LL 1U8HB 4O51B 4RZCA 1JIBA 2P48B 3P4NA 4QFUA 1G7MB 1KXTB 4Z7VE 1F97A 3UBXB 2CR3A 4FP8H 3CLEL 1AC0A 2IQAB 2X1XR 2YPLB 5HY9A 5K9OA 3R4DA 3WFHA 4E41B 5J11C 1E73M 2ZWYA 3Q6FB 3SDCA 1JF6A 1IGFH 2H26B 4FQHA 3CFBA 5AUMB 4XWGH 2FHCA 4S2SA 2R1WB 2OLHA 4Q9QH 4ZSOE 3WJLC 4N0FA 1X5LA 3BP7A 1FG2A 5C07A 4R4FH 2BNRE 2CK0L 2ZCLH 1P7KB 4FK9A 1W9PA 4YUEL 4L8DA 3HMXA 4UT7H 5E2WH 5E6ZA 1T0NB 4TNVF 1GGTA 5CP3A 3D18A 2YBRA 2A9MH 2EKJA 3V8OA 4Y7EA 3BUTA 1UB5B 5FUOH 3G08B 1FRGL 1P4IH 4U6VL 4G9FB 1ZBVA 1Y6NR 4I9WD 5GJTL 1ISYA 1C12B 3BKJH 5ILTH 4LPYA 1MI5E 3SDAC 5FA4A 3S37X 3OPZH 3QNXB 1RZJC 4LCYB 4ZUSA 1DBJH 1Q0YL 3QIBA 2AVGA 3OAZK 3VH8B 4MAZA 2PW2A 1PLGL 4FQQA 2BSSA 4JFFB 4Z7UF 1BPLB 5GSRB 4ML4A 3DVFA 3P9MA 4JHWH 1F8TL 1FNAA 4MAVA 4EI5C 1R87A 4GKZB 2AAVA 1KBGL 5A2JH 5D9NA 3P0VL 4X9FA 3MOBL 2ADIA 1XFPA 35C8L 2O5XH 3ARGA 2I5YL 4W68A 4AW7A 2J88L 1GGIH 5BVJB 1PEWA 5DJ2B 4L4OA 5AC5A 5DRNB 3WNOA 1T0PB 3I2CH 2XGIA 2B31A 1J05A 1O7AA 2R1YB 1AKJD 3AHTA 2HFEB 1KEGL 1XAUA 3QUZB 3CZFB 4PRHB 3JTSA 2D7QA 5HHXH 4GLRI 4HJ0C 5T1KA 5JW4R 3ULUC 3PV6A 4ZTOH 5JUVA 3EYOA 5DXWA 4XB3A 4U6TA 1ZVSB 3CMGA 1ORSB 3C5ZC 4HIJA 4ONFL 4P2RD 4XVTH 1YQVL 1FZJB 3KPPB 3G5ZA 1C8PA 4M5YL 1JYWA 2X42A 3CVHA 4U0RB 2IANE 2AJXL 1MVFA 3CTTA 3CLFL 5ESQA 1TZGL 2QLYA 3GKZA 3IDYC 1J8HD 5TH2A 3SPVA 3FT3B 3EYFA 1DVFC 1FL6B 3U4EA 3VFSB 4RGND 1B3ZA 3A4XA 4LP4A 3IRZA 4EN3A 5D72L 3EJYC 2GJJA 2ZXAA 4JFDD 5E2TL 3EUUA 2EE3A 2UWEE 4Y4FA 5KAQG 1HI6B 4QLLA 1T5XA 3NACL 5DO2D 3O3EB 1R8LA 3AS2A 5C08D 4ZFMA 3OJDB 5FUZH 4KVCH 1KB5L 2OYLA 2VH5H 1HQ4B 4R4BA 3TBSA 2XWJB 4O2CB 3TT3L 3OHXA 4TSCH 3MRHA 1B3VA 4X6DB 3KPSD 4JHAH 1WCGA 1RIVH 5MEND 1I8IB 3NOIA 3KYOB 3OKOB 4P4RA 2ICEA 3NIGF 1LEGB 3QIUC 4Q6IB 3H9SB 1QNPA 2HT3C 5A6MA 1T03L 3AMKA 4QHUB 5JTWA 3H9SA 2HTLD 2EE9A 5CSZB 3S9DB 4LCCB 3TZVB 3DX7A 2R9HC 4JFSA 2XZQL 3GIZL 4LLVB 3VDHA 4RFNB 3VX0A 4GO8A 3FQTB 1C92A 1FFOA 1NPUA 2ESVB 2W92A 3PUCA 3V6OA 3RBSA 3QHNA 1JYXA 4IPNB 5CMAA 4GXVH 4S10A 2XPGA 4E4PA 2YS4A 3N04A 1SJHA 2GHWB 4WJ5B 5I30L 4DQOH 1GW1A 1QKZH 1TVBA 3C9NB 3EOAA 3PP3H 1GH7A 5HGAA 3L3JB 5FDYA 5GGSY 3H9HA 1QPPA 1XR8A 4M61B 1I1FA 1NCWL 3DROB 3SGJC 1PY9A 4KK8C 2IAMA 3PGCB 5A8OA 3RDTB 3QISA 3VUPA 1YEFH 1YN7B 4LK4A 4MVBD 1WWCA 4RFNC 3B5HA 2J8OA 2IMMA 2Z92A 4UFMA 4WV1A 5JBDA 3MOAL 5CIPH 3C6LC 1E4WH 5F1SA 3NA4A 3AI0A 1TE1A 5DJYA 4AIEA 5D96B 3RX5A 1FH9A 3NABL 4D0CA 3CDCA 3EYPA 4TUOA 3MODH 3CDGA 5SWQA 1KTDA 2B0SH 1X3DA 5E8OA 2XTKA 1TMQA 1S7XB 2HRPH 2B4CH 4KHXL 5IG7B 1E0OB 4NQED 4CD4A 4LKXB 2GT9B 1K9FA 5CLWA 1OCQA 4HBCL 3UTTE 1NEZG 2FATH 3F5WA 5I18L 4LAQH 2EDWA 2P5WB 1QNOA 3F5WB 2JFEX 1T1ZB 1E6RA 2ZG1A 1LE9A 3X14A 4HK0B 4YGAB 4D9QE 2JB6A 5B38G 3UROR 3X11B 5LXGH 4HBQA 4DCQA 3S3JA 1YC7A 2DBJA 3OGOE 2EXYD 2WWCA 2NY4B 4LFHD 3ALPA 4FZEL 3RY5A 2R4SH 4QRSB 4IIQC 4AEFA 3EYUH 3RVWC 4HH9A 2J7GA 4W7WA 3SDCD 3WFBL 4FXLA 4NRXA 4XPTL 4AK1A 2WNGA 1UGNA 1KC5L 2ICWI 3HS0B 3EMQA 1MCKA 3EOYG 3RI5K 5F21B 4NT6B 5SWSD 4PJAF 1MJJB 4LFHG 2J7EA 3LB6C 1DN0A 1BVLA 3ARTA 5A69A 2XICA 5CIPA 3MMUA 2EIZB 2RCSH 4X4YB 4K7PY 4C83B 3HNSH 2DQUH 3BPLC 4HIXH 4YIQA 5BZWB 2IBGA 1K8IB 4HPHA 4L4PA 5D7LA 1KLUB 1P7KA 3KG5A 3C2SA 2D1ZA 1BJ1H 2XRAH 5EPMA 4IMLA 3RNQA 4U6YB 2GDVA 1JPTL 1WZKA 4X5WB 3ZYJA 2CBUA 1V3MA 3TPUB 4RIRA 5D9OA 2CXKA 4LGSB 2BVOB 1KJVA 4OZIA 1I9RH 5LAXB 4EUPA 1AFVL 3FQUB 5DUMH 4GRMA 4BZ2L 3ULUF 2NW2B 4MNHA 3A4WA 1FNFA 2ZCKL 1CVRA 4AZ6A 1B0WA 4EN3C 4AIXA 2O92A 4FQQB 1OLLA 2LU3A 2VQ1B 2WSKA 3IKCB 1YNTB 3GSOA 3L7FA 2XXMB 2HFGH 4E0RB 3BZ4A 3VMPA 4CD7A 3BE1L 5ESQB 2Z8WC 3ARED 1V02E 3NYDA 4PJAB 4F7EA 1DBAL 4CVWA 4JG0H 3EKCA 4M9PA 3QWOB 5KW9H 4W86A 2W5FA 5FGBC 2G75A 1ZLWH 2H3NB 1LNUA 3SEPA 4GMSL 3QA3A 4NNXB 2WC4A 1DBJL 1J0YA 1G0CA 1GPOH 3O3DA 2C7UA 3OZ9H 5EU4B 2X7LA 4KU1A 5D71H 3N1AA 3EJZC 3ES6A 4PJDB 5C0BE 4HIJB 5JDJA 4CBPA 2EXOA 1ZEAH 2F8QA 3LY6A 1I3VA 5T5NG 4IHOB 3L2MA 4MQXC 1GC1L 2ZSVB 3PHQB 1ZWIB 2H32B 5DS8A 5F7WC 5C09E 3SCMD 1PBYA 3DUUA 1FYHB 3ZT7A 4YFLI 4GW4B 1CI5A 3THCA 1CICC 2V5SA 1MCFA 1E6SM 3IJSA 2YK1L 4AY1A 3BUYA 4PGJA 1Z5LA 5J89A 1HH9B 1QQDB 1S5IL 4LSQL 3E1F1 1US3A 3VXRE 1OD8A 2NY4D 2ZPKL 1UXSB 2E9BA 1GGIL 2BC4B 2YD7A 5D1XC 5CPQA 1Q6GA 3P9WB 5EU6E 4QLJA 1GZQB 1YNKL 4Q7DA 5F93C 5CJQL 3RIAK 1VADB 2VR5A 4YHMH 4RL3A 1FNSL 1KJ2B 4KPHL 1Z3GL 5BW7A 4UT6L 1JE6A 3QXDB 3QWRA 4UI2A 4N90D 1JNDA 2PWFA 1KBGH 2H2PC 3LB6D 1D5ZA 3FB8A 2HVKA 4JGUA 2H6PB 5EZIL 3ZYIA 3SPVB 4RBPH 4JZJC 3G6AA 4DK6A 3PDDA 2ADFH 4M5YH 4X6CB 3QUYA 4Y5YB 3NZHL 2H8PA 2Z91B 4H1LH 2AJXH 1T1WB 1IKNC 4R4NC 1WZAA 1LK3H 5CJBA 4FZ8H 4UBDD 3OKYA 3FQRA 3A3HA 3GMQB 3UJJH 2ITCA 4M1DH 5IW1B 1LK2B 3C60B 4QT5A 3F58L 2ESVE 1MF2H 4QHMB 1MW3A 2B0SL 5E8OB 3RPMA 1P1ZB 4NNPH 3B9KA 4K7FB 1ZT7A 3RDTD 1FGVH 3DUSA 4LEOB 1KTRL 1UZ4A 5EWIL 3U57A 1NC2B 1EQCA 1Z6JT 1JUFA 3MLVL 3N9KA 1ZHKA 2XGBA 1I1YB 2BERA 3ZKXB 1HEZA 2YMXH 3I3BA 4OZFH 4ZXBD 1P5UA 3OA5A 5H2BB 4UQ2B 4TPRH 3GJFB 2IPTL 4EIGB 4LQ1A 1TVHA 3F7YA 3HE7A 1RP9A 3GI9L 5DC0A 5HYSG 3NBNA 2GTWA 2X2YA 3S96A 2GTWB 4NHCH 1U8KA 4EQ2A 4WO4C 4UNVA 4GPNA 1LE5A 5D1XA 1NANH 5JMRA 4WJ5A 3UBXA 2VN4A 4U1HA 5KJRH 2QADD 1DQLH 4FNLL 3VG9C 3OSKA 3HR5A 2XY2A 1F11A 2D0HA 4DGIH 4JY4B 4AD0A 2V3EA 2DJ4A 4H88H 1VA9A 3SGEI 2QQNH 3VXSD 1W9XA 2CITA 3HMXH 3GZKA 5C09A 2X5PA 2WVSA 1O7SA 4ACYA 2NNAB 1MJ7L 2Q3ZA 3D85D 4HF5L 3S5LG 4JFEE 2E7HA 1LDPH 4WHTB 5EOCJ 3SGEH 1JN6B 1SJEB 4FFYH 4Z2GA 3G5YA 1D5XB 1FFPA 4K94H 1E0VA 5JPMA 3BO8A 2XA8H 1NGPL 3IDMB 1P9MC 1FV1A 3MLYL 5KZCB 4F7MB 5DJAB 4W7UA 4PGBB 1AGFB 1OPGL 4PP1C 2EO1A 2C26A 2HWZH 4KROD 2DTSA 2DI7A 4M8QA 2FRGP 1C93A 3K2MC 4HPOH 4Q2ZB 3DO7A 3V7AE 5T3XE 3BIBX 3THML 3RWEB 4MA3B 5J1SC 4FXGB 3UPRB 1INEH 1R5IA 2Z35B 4Q6IC 3L7FB 5DHYA 3QDJE 1PKQE 1R5IB 2NSXA 3W39B 4HK0A 4UINL 4NBYB 1A7OL 1H3UA 3DIFB 4JQIL 1DCLA 3L3HA 3W0WE 3WMCA 1I7UB 1D5MB 4QHNB 4JFFE 4ATDA 3RWCB 3U4AA 2YD5A 2UZXB 4DKEL 5JHDA 3IS1X 4F57L 3GBML 1Y18A 1GORA 3P3YA 2YL5A 4MD4B 3AIBA 4CMMB 1C8YA 1L0XA 5D6CA 4ZDHA 2PB1A 2NX5D 4G9FE 5J12C 1JYNA 3SURA 2K1MA 1GVYA 2A3AA 3TYFA 1KJMA 5CAYB 5AYUH 4ZFFA 2YPKB 1QW8A 4JHAL 1AO7A 3WYRA 5HBBA 5C6TH 2C7UB 4YPGA 5JW4Q 4JDZB 4R3SB 2E6QA 3QNXA 4JFFD 4GSDH 4U7SA 1PAMA 4EZMA 4PMOA 5INDB 2R1XA 3DBXA 4P9MH 4YIQB 2EH7L 2BFGA 3P73A 4PJFF 3GUTB 1DUZA 2Q87A 2X0HA 4NSBA 1HYSC 5TH2B 3H8NA 2PYFA 3VFVB 3BN3B 2MPAH 1ESWA 3V4UH 4QF1B 3BIKA 4IRJA 1FZOA 3SHSA 2BP3A 3WS6C 1WDRA 1DQML 3SDDC 1CF8H 3UO1H 4WKFA 2BOBB 1KCKA 4W81A 2QLVB 3MRJA 4HOXA 4JVPA 3KYKL 3CPLA 4M1RA 3WN5C 2CSPA 1QLRB 2D31B 5CEXB 5L2JB 3MV8A 1QRNE 4MXQC 1U0QA 1MW2A 5EO9B 1IV8A 4OCNC 3UTZB 5EBWA 1MRCH 4XVTL 5CKAA 4HZLB 3ECBA 3IDNA 2Z31A 2VL5A 3GSQA 3ULVF 3VIGA 1W1TA 2NYYD 4AY0A 1E6OH 1N4XL 4S1SL 2V2XA 4LPUA 3BIAX 2D03H 5C9JB 2DIJA 3WIHL 3W29A 3ISWA 3T1FA 1OD0A 3BT2L 6FABH 3C87A 4IOFD 1MFNA 5DMYA 1GHSA 1CGYA 3LPOA 1QI3A 5EIQA 2JJTC 1UACL 1CGWA 4MA7L 3VFPA 3SDXB 1QNRA 2FL5B 1U6AL 2WQRA 1RULL 4H04A 5DC9B 1I7TB 1IM3B 4TSBH 3F7RA 1QR1A 2M1KA 4H1LB 4G5ZL 4J4PA 1IILE 1X4YA 1JGUH 1E72M 1W9VA 1TUXA 3QP3A 3WS6A 2BNQB 2JK5A 2X05A 3WUBA 1B4JL 1G6RB 3PWUB 4G80B 1L6ZA 4NQCB 5JW4M 2VZ1A 1XGZA 5IEHB 4LVNC 4XXCA 4HKJB 2H2PD 1B31A 2CIKA 1HJXA 1XH2A 3WLBA 2ICWA 1OGAB 4HSQA 5EN2A 2E9MA 2YMXL 2ZNXA 2XWDA 4PRNB 3PZUA 4OF0A 3EGSB 5C0GB 1MJ8L 3MNZA 4EDXA 5HHOE 3WBEA 4L9DA 2QR0A 4PJ8A 1PZ2A 4JCMA 5T1DL 2FDMA 3ARQA 2X4QA 4PJGE 3V6OE 1E6PA 3RVTD 3DX7B 1XV8A 5K9JH 4N0YL 1G7PB 4W85A 4ZAKB 2DSKA 1H8SA 1VPOH 2Q7YA 3FQTA 4QT5B 3DARA 3UEZA 3ULUL 5INCA 4TUFA 3AZSA 4PGDA 4U6HA 2AXFB 5DUML 4D9RE 1LE5B 2OP4L 3P4NB 3B8YA 2Y72A 1CXEA 4LLMA 3O45B 3VXQB 1DQLL 1QNZL 3ZL4L 3ZOAA 5BRPA 1QUNA 3F5KA 5L2KB 1MCEA 1FN4B 3QBTB 5M95B 5I8OH 5MERA 5E08H 5KSBE 5AZEH 1C90A 1MFBL 1Q9KB 1Z9SA 4P23C 2B2XH 5E8PA 4I3SL 4KH2A 4UQ2A 4UDUA 3PGCA 1IM9B 3QIUB 4ZS6C 5I24A 3QIBC 5BXRA 4OGZA 2JJVA 4WLCA 4H8WL 5I1JH 3CHEA 4OKVB 4QY8B 1TA3A 1MFAH 4A3YA 2XKNB 3HZKA 3UTTD 4HQQL 4RFOH 3JWNC 2XZCL 1JDAA 4X6EB 1AGCA 4ZD3L 1WNOA 5I74C 2AEIT 3DVGA 3O2DH 4PLJC 5J6GA 2IBZY 1FO0A 4PJHF 1KT2A 5EWIH 4JL2A 1RJCA 2J8UA 5HHVL 1W9UA 4ZFZA 5IFAL 3OL2A 1ZT7B 4HA1A 5IFHH 5BS0D 1AXTH 5DK3A 2JB5H 3DROA 4L29B 3F58H 4JRXE 1HKMA 5BZWA 4DW2L 2NNAA 1D5IL 4AD1A 4I2XB 2VDKL 4OGAD 5B8CB 3QHOA 4WFED 4PJ7E 5DSCA 2W63A 4IRJD 2DICA 1DFBH 2E7BA 3C8HA 3OR6B 4GG8A 4JN2B 4NYLA 3ZO0A 5I76B 4D72A 4FXKA 3EDFA 5A2BA 3R0NA 1INDL 1I3UA 1S9VA 1GGBL 3FB5A 1XGQA 3RWCA 5LBSH 4AIUA 2NY6B 3GIVA 3HPJB 3RZCB 5DRNA 4LYQA 3OV6A 2XNAA 1BVZA 5IKCB 4EUPB 1UA6L 5TDPA 2W9LA 3F6LA 4JM2C 4AENA 4M7KL 5DLML 4TULL 4L5FL 5GRJL 3P30H 1GOMA 2O9PA 7TAAA 2CKSA 4P2OA 1NMCC 5DK2A 3FO1B 2P43B 3AM8C 4J3SA 3OX8B 4HT1H 3BXNB 3LKQA 4ZXBB 2DBLH 1F3JA 1F4HA 1WAAF 3T0EA 4L8CA 3CDYA 2OK0L 3VVGA 5BRZE 3AXLB 1WZLA 3RY6A 3ULVH 4OI7A 4EBQL 4HS3B 2J7BA 4DWSA 1I3GL 1LP9A 2VUOA 2Y5TB 4J23A 4JFUA 4EI6A 1DBML 2XKSA 5DMGD 1JD9A 3QFJD 3MJ7B 1EMTH 3H0TA 2FWOB 2FX9L 4PJDF 2ORBH 2Y8KA 4EXKA 4Z95L 1V7NH 3IDMA 4XPGH 4U7KA 1TTGA 1UB5A 2VXUL 5DFAA 5CILL 5D2LB 2ICCA 3MRJB 3TO4C 4XC1H 3ZKMD 1Q1JL 4PB9L 5TQ0H 4PG9A 1KJVB 4AC1X 3CXDH 4O5LL 3ZKXC 2DQFA 4M8VA 5SX4I 2V2WA 5A2IH 4TOYL 1H3PL 3LEXB 2XG4A 1HSAB 2VDNH 2Q86B 3TBWB 1MHEA 3CO4A 1T20B 4M03A 3WJJC 4PYSA 3QIWA 5DGQA 3O3AA 3L5IA 1GCYA 1K9DA 3WMSA 1T6WA 3BCFA 4XTRD 1HYRC 3MYJA 4KV5E 5JXAL 1K8IA 1OTTC 1HHGB 4OT1L 3VXMB 5E99L 1E0WA 1EOKA 4V1DD 2NXYC 5A2FA 4M1DL 3FB7A 5IHUL 5A16A 2XXCB 5ITFA 4I18B 1IGJA 4P8VA 2FJFA 1OVZA 4M81A 4Z7UE 1DWAM 4W8BA 1C7TA 3ESVF 1C5CL 1T7VA 2A6JA 2ZUWA 2OZ4H 4NQVB 5E1AA 2L7UA 5IB4B 1N6VA 4PTUA 4LOUD 3UYRH 4EUPH 3RWGA 3VFOA 1KUMA 4GRMB 4HUWA 4U7MA 3IJHA 3SQBA 3IDIA 4RGMC 1KNOA 3EYVB 3C6LD 3QDGB 1SYSB 3SCMB 1YQ2A 1F3DJ 2R39A 2V7NB 3U0WL 4WKAA 4X5XA 2IAMB 1PY4A 3W38A 4FQCL 1H15A 1ITBB 3QQ4A 4KJQD 3RDTA 3EDEA 3KAAA 2DYPA 1EEYA 4JANA 5D70H 1QBBA 5CUSH 1EEYB 1NCBL 3TVMB 1GHFL 1HXMB 1T4KA 1XYFA 3CZ8A 3FQRB 4BQ5A 1E6JH 2NW3A 1O7VA 3SDXA 4WVRA 4K94L 5C8JB 3O3EA 4KKAC 5B38B 4JREB 1CDBA 3ARDA 1JNNL 2BJMH 4JFHE 4EI5B 4ETQA 3ZKND 2PR4H 5BS0A 1MRCL 1U95B 1G6VK 2X4NB 1NCCH 5T3ZE 3VG9B 3HZMB 1NEZB 4PUBH 4PJ9D 3OIHA 1LG2A 4OZ4A 3V5KB 3OKMA 3U9UA 4UQBA 5KSAC 3QHFH 3EDJA 3WLBB 1WK0A 1SEBB 1I8IA 4KHTH 2VNCA 1OOAA 3P77A 4KK6D 1CR9H 3ILPB 4MB5A 4RE3A 1GXEA 1RHHB 1JDDA 2ZX9A 3QHZH 1TJIL 1BYCA 3GJEB 3RJXA 3AISA 3GMLA 2D4DA 3AIVA 2NZ9D 5KTEL 2APFA 2CHNA 3UAJD 4NRYB 3QO0B 4KAQL 3CK0L 5DI8B 1E6NA 5GGVY 2JELH 5B39B 2PBOA 4K23L 2ZX7A 1BOGA 1N0XL 3MOAH 3F12A 1UH4A 4MAYC 2YLAA 2PWDA 3GRWA 1NGWB 3IDUA 3BDBA 1CLYH 2IF7A 2P49B 2Q1EA 5BQ7B 4AQ1B 4I0PA 4MJ6B 4NM8L 5JHLH 3PZVA 4MA1C 4JFWA 3MLVH 3LKPA 3HRPA 2VISB 3QIBD 5KOMC 3ZR5A 4KHXH 1OGAA 5TFSH 1ZHKB 1CE1H 3FT2A 1EGJA 3NDZA 3LHPH 4H7VA 2BY2A 1CT8B 2AJSL 1AD9B 4HWNA 1IEHA 3IU3A 1INQA 3Q48A 1V3LA 3E6FB 5IOPA 5I78A 5JIHA 5DVNA 5J6HA 1TCRA 4OZGF 3T3PE 4BFIB 2VLRB 4NHCL 3W81A 3OXSB 5CGYC 4APQD 1KIPA 5FECA 4X7DC 3C2AH 4TSAH 3OG6B 4CMHB 5IW1A 5EH1A 2PTVA 1FO0B 5F7MC 5FIEA 4J3UA 4FABH 4HPGA 1YMME 3B83A 1NARA 5KANI 3CH1A 3N17A 3QXAB 2Z4QA 3KPLB 4DZBA 3BQUB 1K5NA 2WIIB 3BXNA 2ZKHL 4FFZH 4I3SH 1Q0YH 2P5WD 4RGNC 3UPRA 5MERB 1FGNH 4M7LL 4QYOB 1F11B 4AL8L 1U91B 4UV7L 3C5JB 3WFCH 4KUZH 1NUFA 4URIA 1OB1A 1A7NL 3U36A 2HKFH 4LBEB 3EO9H 4KDWA 1B90A 2R69L 4PRBB 2WZHA 1MEXH 3QDME 2VDML 1R6VA 4NQXB 3DMMB 2JB6B 3UTPD 5AAWA 3KGRA 2XT1B 3P0VH 3QNZB 3GMMA 3SE9L 3O8XD 3GIVB 1QFWH 4GRWF 3WJJA 4W4NA 4A4AA 1KB9J 5IMOA 4D6CA 4YHNA 5EIIB 3LD8B 3HA0A 4EKJA 4PN2A 5IB5B 5I66B 4PJHB 4YXKH 3BO8B 4FFWC 5IVXB 3IJYA 4ODHL 2J47A 1G84A 4YHKH 1NGXB 1HE7A 2E7LC 3AROA 3RY6C 4NSKA 4N9GA 3QXTA 1QNZH 2Y8VA 3OLDA 1D9KB 1HKKA 5T1LA 3L3IB 4AEIH 3HFMH 5DJ6B 4AMKH 2BY3A 2PYEA 3L7EA 6FABL 3UCQA 5IQ9B 4N1CA 2AJZB 4CDGC 2VZ3A 1Q9OB 3H7LA 2OSLA 1DANT 4KRNA 4OM0L 1XF4A 43CAA 4Z2JA 4JDVA 1UVQA 5BW7C 5JLZA 4UFHA 3VJ6A 2X4TA 4JY6A 1V6WA 5DD6B 3FQWA 1MFCL 2OTWA 1YMMB 2DQEH 2VAJA 1JRHL 4KXZI 5EO0B 5DJAA 3QCVH 1Z0MA 3A0OA 3RL2B 4CMMA 5D6CB 4XMKH 5L0QB 1NBZA 2DWEA 3NN8B 1H3WM 3V5HA 3LQZA 2GJPA 3ARZA 4X6FB 4R90H 5MENE 1FNHA 3ZDZE 5L88H 3VH8G 3L4UA 3IETA 2YD6A 4POZD 4ZFOL 4B9ZA 1OTUD 3KEHA 3QULB 3QGVA 2EH7H 2QQLH 4J1UB 3BZ4B 3M7SA 2NY2D 2VO5A 4XCFL 1CDCA 3W39A 1KCVH 4MAUH 3QPXH 1HJQA 3BAWA 2CRZA 2ZZUT 2CIPA 4LSDA 3Q5YA 1C8XA 4BA8A 3O6LH 4I18A 2ZICA 1IGIH 4OF8A 1FLRL 5C08B 4BKLB 4L4VE 3O9WB 1OM3H 3KZSA 4Q9RL 3SBWC 2VVNA 3MLWL 5SWSA 3NH7H 4AM0B 2CHOA 3SDYH 4HW6A 4NUJB 2ZOLA 3IVKB 3GI8L 1AE6H 1VB9A 1WTGT 1UD8A 4ODWB 3IVKA 5KSUB 5AWNH 3SDXF 5ABGA 1IEAA 5A3ID 3IT8D 4KZEH 4X80L 1Y7VA 1GOGA 2HJLA 1S7VA 5ANMB 3SKOA 2NY2B 3MRQB 1A4JB 5LCVH 5LGKA 1YEIH 2VQUA 3E6HA 1DWIM 3PF2A 3ARFB 5DEFB 5GIRA 5HDOA 3ULVL 1NBVL 4LYRA 5EUOF 2EH8H 3G6LA 4GG6B 5JDSA 2XZCH 2A9NH 2HT2D 1EEQA 3UTSA 3FFCB 3EOTL 5C8JA 1R85A 3MRDB 3CK0H 5DJDB 4MLSA 1CE6B 1B2WH 2NXYB 4R7NB 2BCKB 3WIIL 3WH9A 5CKGA 3NZHH 1TQCB 1GVIA 3QI9C 5HYEA 1CENA 4HV8A 1FDLH 5GGRA 2G60L 3ZDXE 3CFCH 1NAMA 4FA8A 5I1KH 1HVQA 4HOZA 2XVNA 2FEEL 2B1HH 5IIEB 4D94A 4YXLH 2DH2A 1JI2A 1EXUB 2EC9U 1NC2D 3NFPB 1SEBA 1QFUH 4HBCH 3BESR 3L4WA 2VISA 4JO2L 4UT7L 1F8TH 4QNPE 1T66C 5EU3A 3VXRA 2ERJB 4JHBA 4O00A 3O3BA 1I3GH 2PWGA 4QNPF 2EYTA 1YN7A 1T5WA 1NFDB 1J88A 5C0GA 4F9JA 4W87A 5D1QB 4G9FD 4KTYA 2J8UF 2LU4A 1HP5A 2GJZA 2LQRA 2W9DL 5ILTL 4KMTH 3EYQC 2HFTA 2P1YA 3NGBC 4H1LA 1IGCH 1W1VA 1U8NA 5I1HL 5IBLD 5FUCE 4NOFA 4NO3B 4OJFL 3MSDA 3DX9B 1OWRM 2DT1A 1I1AC 4JHWL 2XACC 2IANA 2HVMA 1WFOA 3HTLX 1JTPA 1YDPA 3L5XL 5HSFA 4XP6L 1A3QA 3PHOA 1N5AA 4LVHB 2ERJC 3DXAB 4RGNE 1PJ9A 4Y4FD 4F58L 3MREA 3WUWB 5BVPH 4PJ8D 3IFPB 3PDGA 2P7TA 1MQPA 5L7XH 3W9EB 2Y06H 1DLFL 5EOCH 2VXUH 1FG2B 2YN3A 4HJGB 4K9EC 1QI0A 4F37F 5IQ7L 4BZ1H 2BRRL 3QEHA 4WW1B 3WD2A 4APQB 4JRXD 2XN9E 4YHNB 1OD7A 4APQA 2O9RA 3U7VA 1U8MB 3UDWA 4XGZA 4OUEA 2ICES 3E2HB 3GSNH 4G9DA 1XEDA 3HNTL 3KPNB 1RFDL 4MD0B 2DKSA 2IPKA 3AU1B 2W59A 2NZ9C 2EDLA 4NFDA 4Z7OF 1A7PL 1KV3A 3QIBB 1FJ1B 4Z18A 1ZA6A 4TSCL 2XFFA 4Z7OE 1MWAH 1G9NH 3L7EB 1OW0A 4X4YA 1UWIA 1UM6L 4OLUL 2VX5A 1M71B 2DLFH 1M53A 5A6LA 1J8HA 1E56A 3GUTA 1CDUA 1G0XA 1U2YA 3RKDC 2FGZA 2BY0A 2X9YA 4Q7NA 1EA9C 4C4KO 4H20H 4L8DB 1K6QL 4X4ME 3NPZB 3LS5H 4JHZA 4LARL 4HMEA 8A3HA 2GCYA 2GSIB 2UVFA 4I3RH 3GKWL 1ERNA 1OGGA 5I79A 1RK1A 3P4OB 1VFBA 3D9AH 4KJPC 4M48H 3G5XB 4ONHB 4ISVA 5IJKC 3LSOA 3VCLA 2JF1A 1N5YL 1I7RB 4GXVL 4JRYB 2B4CL 2PXYA 4GXUN 1H1NA 3CBWA 4GW1B 1FFQA 1QW9A 1W72A 4ODXB 4HWUA 3KLSA 4LSUH 1B3YA 2G4FA 1W72B 4ODXA 2A6DA 3DXAE 1Q6CA 2WINB 5EOTA 1QFWL 3TO2A 3MNVB 4QRUB 3ARPA 1LJYA 3MGTA 5F1NA 2WUCH 1K8DA 4AXNA 3DURA 4RISH 4YEFA 5E24E 4RE4A 2P46B 4D6GA 5ETUB 3PWPB 3OKLA 3MO4A 3EYUL 4AZBA 2XNAB 4PMUA 1GIGH 3BJLA 5IKCA 5TE7L 4I4WB 4GI9A 4KVNL 5FGBA 4M9OA 2RFXB 1PEZA 3GNMH 3VXPA 1UH2A 4X6BA 3NFSL 3JSSA 1MLBA 1YYML 4PGCA 5CPTA 4PRDB 2SEBA 1DQJA 1F6LL 4JKWA 1UR0A 1IEAB 4QAWA 1U3HC 3MUGA 2IAMD 5DJ6A 4GQQA 4UTBL 1I85C 2VLLA 5KVGL 2ZXBA 4XNQB 4K3DL 1T89A 4O2CA 3I84A 3ILQD 4MAYA 5HDBE 4M6MH 4NN5B 4F2MA 4XP5L 3EBAA 4HUMB 4MNJA 1CGSH 5D2NE 1ITCA 1I9JH 1CE1L 1JD7A 4J3OC 1CU4H 1B0IA 4A6YH 2ZSWA 3GBEA 4NGHH 4AISA 5A6KA 3W53A 3WF0A 4FQLH 5C0CE 1ED3A 3R8BB 4Q9QL 2E27L 5I8KL 4AM0A 4R96A 1GOOA 2VZSA 4R97C 1U41A 4DOHB 3MLXH 1GUVA 5ABFB 3ZT6A 4HIHB 2VCBA 4M7JL 3KPRA 4POUB 3RWGB 2BNJA 3KLDA 3W2DL 4D9QD 1EVTC 1RZJH 1M7DA 1CFNA 4PJCB 3IYLW 1W0YT 5KVDH 1FH5H 2LABA 1UOKA 4P8WA 2D9QB 3VXMD 4YHLH 3TH2T 1AGDB 4HZLA 2V5TA 4JM2F 3IDNB 4OSUH 3DMMC 4LCIL 1S9YA 2DM3A 4X6DA 1FGNL 4M7LH 3GNOA 5DRZB 1W3HA 3UC0H 3DNKA 1MCOH 1UEMA 5DRZA 4ZTPH 5FYKE 1E28A 1NAMH 4M3JA 2DQTH 5E00A 2HMIC 3FB7B 3SCRA 2F8VA 5A2AA 4YDJB 1IKNA 4PJEB 3BDYH 4CVZB 3VXME 2JALA 1J1PL 4W4OA 3VG0H 1HT6A 5FF6A 4CMHC 2Y25A 2X4OB 3FO2A 4JM2D 4P4KA 3TNNB 1WJ3A 5JO5A 3I75B 1M01A 1T04B 3ZQ9A 3WD0A 4GG6E 2D7MA 5FHBH 5GPRA 4GKSB 2XZAH 4NCC1 1JHLH 1TVDA 3B9KC 1KPUA 5I23A 1EJOH 5HPMB 5EUOB 2BNRD 2W38A 4J7RA 1S7VB 1A4JA 5J1TC 3D39E 5L8LB 3JV6A 5JNYA 2GUYA 2CIKB 4MS8C 5DJ8B 3DXAA 5F8RC 2J2ZA 1H0DB 3UBXI 3HMXL 1F4XH 2A0LC 3H7BA 2N1KA 5K93A 4ODVL 2DYPB 4JE4B 5IBTH 4M56A 4QRRB 1K9TA 2JKXA 4X8JA 1INQB 4PJIA 3OKDA 4R26L 3HE7C 1FVCA 1YEGH 2ZX8A 2F61A 2ESVD 1LLOA 4K3JL 4NO0B 5I1DA 1CE6A 1F2QA 3PWJA 1SJXA 3QO0A 1RZKC 5IVOA 2DL2A 4M6OH 5EBGA 1T80A 2X40A 4QRSA 3MRRB 4RWYL 1DDHB 3X12A 2NY6D 1HOCB 5MEOB 1NCUA 4MDIB 1F6AB 5HHQB 2OYMA 4Y4HC 5HJ3B 2DQCL 4Y16C 3CGTA 4M1GH 2Z4QB 3KPLA 3GBDA 5HJ3A 3MO1B 1BFOB 4PJGF 3QDJA 5MENB 3GJFH 2DWDA 1DVFB 4X0VA 1ITXA 3PQYE 5DDHB 5FGCE 5ID1A 1NQ6A 3BH9A 4QRPA 5IROA 4XPFL 4NZRH 4UU9A 5TJWK 2LTQC 2IEPA 4GH7B 3D6GA 4QCFA 3AS3A 1TIUA 3O41B 1EJ6A 4MB4A 2R0KH 1NLDH 3W26A 1JN6A 4P3CH 3AMLA 4C56E 4P57B 4RGNB 3WDHA 3CFKA 4BFIA 1GGBH 3PNWB 1UA3A 4I2XE 1G9NC 5LBSL 3WQVA 1GONA 1ONQA 4JFOB 1BZ7B 2RGMA 3EO1B 5DQ9B 4UTFA 5TF1H 4L9LC 3HZYB 4OTXH 5CIPB 3GSNB 3UR7A 3J8F7 4POZC 2LTQB 3QXAA 4Y4HD 2UY6A 5HGBB 4J2XA 3BAJA 3N85L 4I3GA 2AK4D 4NC2B 3O0RH 3D48R 3Q6FA 2DDXA 4Z78A 1MNUH 1Q72L 1KTLA 1D5BA 5DFVC 5FD0A 2NY5H 2FO1A 3IDGA 1NFDE 4C56B 1BFTA 4JQVA 1IQWL 4GZJA 4QOKB 3TA3B 4YJZL 4NF7A 3ZYOA 4F9LC 3AHXA 1MCPH 1NGQL 1WP6A 1IGJB 1JYVA 3UO1L 1LG1A 3B5TA 4MCZB 1XYZA 5DMIL 4XNYH 3HNTH 2M26A 4MNMA 2JJSC 4Y5XB 1GJIA 4PJGB 3CZFA 4AEHH 4X4XA 1LL6A 4RZCB 3RILA 5I1GH 3VNYA 2CRMA 1SEQL 5CGYD 1ZVYA 5HHXL 3UG5A 5AG9A 1RZFH 3KE0A 4ZENA 1UQSB 3T1WA 3ZE0E 4PY8J 5D7KE 2EDRA 5T1LB 3VRLE 4FQHB 3HKFA 4XP5H 1G94A 3OKNB 2P45B 1IT0A 3EFFB 1B2WL 2XTLA 4JZNA 2WVTA 3WFLA 1QSEA 3IU4H 1UB6B 4WI9A 5I18H 5IB1A 1XF4B 5HVHC 5AC4A 5TQ2H 5F1IA 3IJSB 2ZCHH 4FLQA 4Y4KA 4OFYD 5E4IA 3VRIB 4P5MB 4BQ8A 4ENEC 2VTFA 5EC1B 1QSFB 4OZGB 4TNVK 4UNUA 3NCMA 5I1LA 4G6JL 5DFVD 2Z0BA 5D7JC 1EZVY 1JFHA 1EGJH 1J9CT 4ZPTB 1QPKA 2XVLA 3MRQA 4B7LA 1ZJAA 1MCWM 4PBXA 1JTOA 4LPTA 1ORQB 5ESAB 3VGFA 2FB4H 1VADA 3AXIA 1B1YA 3ROLA 5ACZA 3AMDA 4X7TA 2WNWA 5HHOA 3QG6A 3OR7A 2FZ3B 5C08E 4QDMA 2VJXA 4GKZA 1QLFB 1AXSA 3UMTA 1WICA 1Q6EA 1AIFB 4LSUL 4X6DF 1E3ZA 1RUQH 4P3DA 4WY7L 5ITFB 3RWJA 2L4OA 2XTJD 3QQNA 5FK9A 3CIVA 1XSIA 4NRYA 2WSPA 4XWOD 3UTSE 1FSKC 2P5EB 1CXKA 2DRUA 1AD0A 4I18C 4N8CL 1Y0LA 3HLAB 2PWEA 1MCSA 1Y0LB 5IHLB 1A1NB 1NGYB 2COQA 2XZQH 3GIZH 2J8GA 1CFQA 2EDDA 4K3DH 2OR8A 4KC3B 5E2VH 3B9DA 4D3CH 3N12A 1HZHH 4X6CE 4YEEA 3V6ZA 5EUOA 1EDQA 2GITB 1MJ7H 2E8ZA 2V6HA 2XPKA 1F58H 5E56A 3OGSA 4HKJA 5J13C 3S98A 4HKZB 3NZ8B 4FQXD 4NJ9L 5EOQL 3C8KA 4OLUH 1T83C 1GGYA 2CUHA 2EIEA 4F37K 4H26B 4ELKB 3WEXA 1N7ML 4DN4H 2FH6A 2R2HB 5TDNA 4GBXC 4PSPA 5D1XD 1ZMYA 2PO6A 2FBOJ 2NX5B 3T0AA 3TT1H 3VIPA 3RGHA 4A6YL 5CJXA 2ZJSL 2ZOLB 2KQMA 5FB8A 1TDQA 5I15H 4Z76B 2PWHA 3LV3B 3PDOA 4HPOL 4ORZC 1F90H 4K71C 3CSPA 3Q6GL 4LF3B 5HGHA 4MWFB 3W82A 1VRXA 1XCTB 2W07A 4YDLC 4JAMA 4NO5A 1OF2B 1QBMH 5CEYB 4RNRB 1RUMH 5D1QC 1UWEH 3RWDB 4U5IA 2P5WA 1U3JA 3A6CH 1XZ0B 3CSYA 8FABA 5DVKA 1GZPA 1CNVA 2OL3H 3NFPA 2FEDD 2FJHB 2GTZB 3VDCA 3OKOA 1P4LA 4WEUD 4PRIA 5D1ZB 4R2GD 4LLWB 2YXFA 2I9LB 3BKCL 2EDXA 2WMFA 2ZUSA 4NGHL 2VI0A 4S3JA 4DWSD 4KROB 2JE8A 3RTQD 5LA2A 1MHCA 4UQAA 1QRND 4UU9B 5IUSA 1KLGA 4WW2A 1WF5A 3MCG1 1BG4A 4U3CA 2D23A 2QADC 5C0BA 1BGXL 2BCKA 1P69B 4JG1L 4XX1E 2G3NA 5ENWB 3SUVA 5I3DA 4UIKH 2DT0A 4RMUA 1ZHBB 1WKYA 3RVTC 5FYLH 5GGRB 4MNQB 5E95B 2W0FB 3WMBA 3WCYA 2IPKB 1ZGLB 1BFOA 4Z7QE 5JW5B 5E6IB 4TUJB 1IQDB 4G6KL 2ZE0A 2A83A 4CKQA 5EO1A 3MRBB 5HVHB 1UYWH 3MLZL 5ALBH 4XPBL 1DN0B 3MLUL 3IK2A 3EO0A 3K3QA 2RB8A 3PQYA 4NKIH 4EIZC 3RWEA 1IC1A 1WEJH 3INUH 5FKYA 4IUGA 4YR6A 2PF6A 1T22B 5GRVL 1S7RB 1CT8A 1VFFA 3O6ML 1XH3B 4IRSC 1T5WB 3PGFL 2Q8BL 4JFDE 4YN5A 1S7RA 5JIPA 1CK0H 4V1DA 4NQDD 3IF1B 2Z8SA 5DR5L 3FQXB 2GJZB 3MRKA 4XZUA 2F74A 4CNIA 1E1EA 2MFNA 1DWGM 1V7NL 2CESA 1C91A 1KF9B 1Y18B 3REWA 1G0DA 1KCSH 5GHWH 3B9KD 1P7QB 5IJVB 1ZLWK 1V3HA 1XGYH 2NR6D 4HH9B 3SUUA 1AXTL 2Z8RA 3SCUA 1PYWA 1G7MA 5GNXA 2AV1B 2JJSA 2JF6A 1JHLL 3DETC 1P6AB 4IRSD 1GGCH 4Y88A 5TPWH 5KSBF 4X6FA 4S1SH 4OIAA 3L4ZA 2GT9A 3D2UB 4ZXBA 2AABH 1J8KA 5MEQB 1DBKH 4B41A 2R0WH 2ZCLL 3O3UN 1J1XH 2VLJD 2V3DA 1SBSL 4B50A 1ADQH 5D7IE 3RWFA 2CBJA 1E27B 3GK8H 4PCTA 4DKAA 1CXHA 1ZT4A 3ARGB 4JIEA 1E71M 3TJEH 4K3HA 4HZ7A 3C60D 1GJWA 2J8UE 2EDKA 1SVZA 3LPWA 4RFOL 4QOKE 4L3EA 1LNUB 2GK0A 1FORL 3TPUA 2QV4A 1H9VA 1XF1A 3CIQA 1AO7E 4CADB 4JREC 5T1KD 4OSUL 3UYPA 3GI9H 2GK1A 3GM8A 3H3PH 2BZDA 2VWEC 5GS0D 3ZTNL 4JY5H 2VCCA 5TDOB 4PJ7B 4YFLF 4DFIA 5E0QA 3SDCC 3BCDA 4KI1A 4D9LH 1SM3L 2MSPA 5GGUA 5FYKL 2AJZA 3V8CA 5EG6C 3VH8A 3BPLB 5FEBA 4YZFF 1UD2A 4LSVH 1LL7A 4JFZH 1AJ7H 1MRFL 3PHQA 5T3ZL 1IAIH 3WL1A 2YC1B 3MCLL 4J3TA 4WO4B 1R0AH 2WWDA 3UPAA 5F89A 5T5FL 1ZHLB 4KJPD 4P7NA 4LLYB 4IDLA 4JFHD 2W66A 2FEDC 1S78D 3EFDH 5A1AA 4PJAA 4JB9H 2CJUH 3IGAA 5FCSH 3GSRB 3WF4A 5IHRA 4Y4HB 4F80A 2R1YA 1U33A 1X5JA 4X4XB 3I6GA 4GQ9L 3TBTB 5FCZA 2EEBA 2UY3A 3RL1B 2BC4A 5HHMD 1S7UB 1RZFL 4YDIH 3V5HB 2B8OT 1CFQB 1EIBA 3MZTA 5A3IC 4ZYKA 3MA9L 2B2XL 4JAWA 1KENL 3S35X 4Z7VF 2G3MA 3O2WL 2NT1A 4BQ6A 4DW2H 4JVUA 1J7VR 3TBYB 4RX4D 1V6VA 1AKJA 1MRDL 3ARUA 3A4AA 5I71C 4KHTL 3AHZA 5EU7E 4OAWA 4PJDE 4RA0C 3MV8D 5TQ2L 4P3DB 1H5VA 4BA0A 1TVPA 3AC0A 2OM5A 1XCQA 1V3JA 3CZEA 3EJYD 4AH2B 4NO2A 1X4ZA 1CD1A 1PD6A 4HEME 1DVFD 4ZUUA 3FT3A 4XP1H 4DM1A 2PF0A 3TCLA 4PMQA 1A6TA 3MLXL 3FO0L 3O2DA 4E42A 3DSFH 3LEYL 3C6SA 2WMIB 1ACYH 4H8WC 3VGAC 3QA3B 4NNXA 4QHMA 1T5XB 1G9MH 4KJYA 3AREB 1LK2A 4N0RA 4YAQB 5JUEL 4GAFB 3KPRB 3HG1B 4KK5D 4JPVL 5FDWA 1U8LA 5EDXA 2AJ3A 2EPKX 4HLZH 4W84A 5GS0H 1RUML 3KJ4C 1C5BH 1G1CA 4KKCD 3BRGC 4W5ZA 1ZANL 4KI5F 5F9DC 1OIMA 4DZ8A 4P3CL 2HTLC 5C92A 5ABEA 1CWVA 2NY5L 4UZGA 3OZOA 3IU4L 2EPLX 4M4RA 4L4VB 2CDFB 4XCEB 1NC4A 1J5OL 4PRPD 5CZVL 5HYJA 3GH7A 2DQIL 3QUYB 1I7ZB 4Y5YA 5JBFA 4YDJA 3H9YA 3RIFK 1TJHL 4AIZA 4LKCA 5JW4N 5HHQA 4LKCB 3MOQA 5FKAA 1XF5B 4LL9A 4WW2F 3SKMA 2UY4A 1WT5C 4NJAH 3U48A 3HAEA 5ICXB 1CFNB 4PJCA 3SUSA 1L9MA 2E9WA 3GXIA 4CCCA 3O45A 5CD3B 4U1HB 4MMXC 1XSJA 3VW3L 1R24A 3VI3F 3PZOA 1YEFL 2WUBH 4DWSC 1IEBA 4RRPG 3QG7H 1DL7L 1HKLH 2BVQA 4W6WB 1E3XA 3AM8A 5E2VL 4YHOH 3DHPA 3AMCA 2DIBA 4L4TA 1RJZA 2BVQB 3NIDF 2N7AA 1CLZH 2R69H 2EYSB 4PY8I 1A6PA 1NFIB 4OQTA 3HAEG 15C8L 2PETA 4UILL 2FECL 2QEJA 2WWKT 2XQBL 2FECI 3R0MA 4X98B 4WHTA 1I3RA 3KR3L 3VMNA 5GS2H 5J6HB 4UR9A 1CLYL 3JUGA 4TOYH 1G5AA 1TTFA 3BSHA 3OF6D 4I0PC 5B3JF 5CQ1A 5SWQB 3KPTA 1RK1B 3VXNA 1N2RB 3FO2B 3I6LD 5D2NB 1DEDA 4QRQB 4KRMB 4WFFE 3QRGL 4A2LA 2VLKE 3N06B 4MWFA 2UWEF 2X4UB 2BFVH 3C08H 3DECA 1YEKH 4GAGL 4JRWA 2K7PA 2ADJA 4PJFB 2YPLA 3HR6A 5K9OB 1BQHA 4X9IA 1DN2A 1HHJA 2MNUA 1LO2L 4NKOA 4GI8A 1RJYB 1H5BC 3TPKA 4XT1C 2EICA 2EEDA 1K2DA 4N8VB 4KKBC 3NTCH 3CFBB 1G0YR 1ADQL 1I9IH 1KELL 1AXIB 3LAFA 3BH9B 4D2NA 2OR9H 3RTQA 3KS0J 4U1LB 2WHMA 1IL1B 2LFGA 5CZXD 1WFUA 3U30B 5L9DH 1BEYL 1R3KB 4F7EB 4OCYH 1RZIB 5C0IA 1IGML 1U8KB 1QBAA 3N50A 2YA2A 4V2BA 1ISXA 1NDGB 4JM4H 1H5BB 5I71B 4G6MH 5E2UL 2IH3B 4G3YH 1E4XH 4D1JA 4A6YB 3MJ9L 1RIVL 4XPAH 4O58L 3EO1A 5DQ9A 1PKQB 4TNWF 3D2UA 5GJSL 4U6XA 3HR5B 5JQ6L 3CVHL 4KKAD 4R8WH 4OCRH 3CCHB 4OZFA 4H1LG 5MEQA 2VDRL 2DQHL 1ZA3B 4ZODA 3LVEA 4FQPA 1UM4L 4LMQE 3PABA 1ZTXL