4OC1A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with coibzl, a urea-based inhibitor (2s)-2-[({(1s)-1-carboxy-2-[(2s)-oxiran-2-yl]ethyl}carbamoyl)amino]-6-[(4-iodobenzoyl)amino]hexanoic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc1A02
1V6CA 2ANPA 4K3NA 1Y0YA 3FMCA 4NGSA 3H8FA 4C86A 3BI1A 3D7DA 4MRIA 1QQ9A 3VTAA 1GYTA 3CDXA 4NGRA 4TJXA 4P4IA 4UEEA 1TXRA 3B3TA 4CPAA 1NSAA 3GB0A 2V8GA 4C9VA 3H8GA 5JGFA 3H8EA 4W9YA 2IQ6A 3PBEA 2RFHA 4F9VA 3SI1A 4MHPA 4C8TA 1XRYA 3KQXA 5K8PA 1YW6A 2Q51A 3EIFA 1Y7EA 3MRUA 4NJRA 1XBUA 1YSJA 4MHYA 4IAVA 2BCOA 4Q7AA 1VHOA 3LMSA 3FEDA 5ELYA 2QJ8A 2J9AA 3VH9A 1PYTB 1FT7A 3FH4A 4PXDA 1ZG9A 4OKOA 1WVMA 4YU9A 4AXVA 5HVGA 4Z65A 4EFDA 3PB9X 2C6GA 4EWTA 5LYFA 4OP4A 3VARA 4A38A 4C85A 4R8FA 4R76A 5LYIA 3I6SA 2PJ5A 3GLJA 4C9AA 1CPSA 5HVFA 3ISZA 4P6YA 4MXUA 2ZOFA 2BOAA 5JM6A 3SJEA 3NA6A 3K2KA 3B35A 5J1QA 4ZY1A 2WYRA 2PJ1A 1XJOA 3PB6X 5CPAA 4DJLA 1ELLP 3WT4A 4ZX8A 3CPAA 3QNVA 3IFEA 1ELMP 5K8MA 2PJBA 1ZLIA 2XEFA 2PIZA 3IWWA 5LYLA 4C8CA 1YMEA 3K9TA 4ZY2A 4OMEA 3WABA 2ZEPA 2F7VA 3HLPA 3D68A 4G1PA 2DEAA 3PEIA 3JRUA 4TWEA 2XEGA 3SJFA 3V38A 1VIXA 4P4BA 2AFXA 3KL9A 4PPZA 3SI0A 3RAMA 1F2OA 2QYVA 2C1CA 4YWYA 4KSIA 3D7GA 1VGYA 4NJQA 4MCSA 1Y9ZA 3TC8A 3VATA 3D7FA 2PJ9A 3B3WA 1Z8LA 3DLJA 1OBRA 4R7MA 1UWYA 1ZG7A 1XMBA 4C8PA 4X3RA 3PB4X 2ZEMA 1AMPA 4P4FA 2GU2A 4UF4A 2C6CA 2V8HA 2ZEFA 4NGMA 2I3CA 1DE4C 5JH9A 4PXBA 3KHZA 1R3NA 2PE3A 5IB9A 3I1UA 1CX8A 3RZAA 3D66A 3SI2A 1H8LA 1JQGA 1LCPA 3LWUA 2HB6A 4PQAA 3FX6A 1R43A 2AFZA 3CPXA 5THWA 1HEEA 5DS0A 4C9RA 3I74A 5D8NA 4JYWA 4UEFA 4OC1A 2O53A 2JBJA 4KNGE 2ZEDA 3GUXA 2PJ4A 3KI9A 2AFOA 4FBEA 1Q7LA 1CBXA 2PJ3A 4MCPA 4NGQA 2OR4A 3FF3A 4C8UA 5D29A 2EWBA 3S9MA 3IJ3A 4A39A 3SJGA 3IEHA 1QMUA 4B6ZA 8CPAA 4NGNA 3KR5A 2NSMA 2F8HA 2PJ6A 1TF9A 1TKFA 1XF1A 2V77A 1LAPA 4TJVA 4DUKA 3ICUA 4JZ0A 2PCUA 3B3VA 6CPAA 1F57A 1BPMA 2ABZA 1AYEA 4LQGA 4GM5A 2C6PA 2ZELA 3KASA 4NGPA 2GREA 5I4MA 4OC2A 2HC9A 1TKJA 1Y0RA 4ZYQA 2PJ0A 1LAMA 3PFEA 3T8WA 2CTCA 3IC1A 1IY7A 4ZX9A 4MCQA 4WWVA 4FUUA 4C8FA 4X8IA 7CPAA 1ARLA 1F2PA 1M4LA 1Z2LA 3PB7X 1Z5RA 2IJZA 1YLOA 3NH4A 3TX8A 4MHZA 2Q43A 4OC0A 3BI0A 2QVPA 2PJAA 2PJCA 5HXDA 1PCAA 2PVWA 5CBMA 1CG2A 1RTQA 2XEIA 1LFWA 3MN8A 3RBUA 3PB8X 4ZY0A 2V8VA 5K8NA 2O4HA 3WC7A 4MMOA 2PJ8A 2ZEEA 4RUHA 2XEJA 1EE3P 4MHNA 1BPNA 3DGVA 4OC4A 2G9DA 1YW4A 3FJUA 4OC3A 5LRGA 2FVGA 1HDUA 3KHXA 4F8ZA 5K8OA 2IMOA 1LOKA 2PJ2A 4UIBA 2JBKA 3N5FA 3PFOA 1VHEA 3FEEA 4X2TA 5LRKA 1KWMA 2Q4ZA 4P44A 2RB7A 4C9EA 2CTBA 4A94A 2EK9A 2CF4A 2PVVA 5LYDA 1HDQA 3V7ZA 4O23A 1ZLHA 3IIBA 3SJXA 4BD9A 4P4DA 2AFWA 1ARMA 4TNUA 2ZEHA 1TKHA 4EMEA 4IHMA 4PXEA 3NH5A 2EK8A 4MCRA 4NGTA 2ZEOA 4P4JA 3NFZA 4IK2A 2POKA 1CPXA 2AFSA 1BAVA 2NYQA 3S9NA 4NFRA 3D4UA 3CT9A 2BO9A 4ZI6A 2CIJA 5F09A 4CDKA 4C84A 2GLFA 4UIAA 3D67A 2OOTA 2AFUA 3KQZA 1FNOA 1IGBA 3FVLA 4OC5A 3NH8A 5HVHA 4P45A 2AFMA 4DYOA 3BXMA 3D7HA 2PJ7A 4A37A 3ISXA 3B3SA 4FAIA 4P4EA 3KZWA 4OIWA 4PXCA 2V8DA 3BHXA 4UEZA 4WJBA 2PRQA 3KR4A 3KGQA 3B7IA 2JEWA 3PRTA 1CP7A 2ZEGA 3WC6A 4F9UA 1XFOA 1BLLE 2ZENA 4H2KA 3HUVA 1LANA 2WZNA 4OIDA 1DTDA 4CDJA 4ONWA 4P10A 4C8AA 3L2NA 4YN3A 4C99A 3B3CA 3WC5A 3IO1A 4FWUA 5LRJA 4R6TA 1ZG8A 2ZOGA 4C9UA 1TF8A 3FECA 3PBBA 3S9LA 2GLJA 1CP6A 2VL1A 3B2YA 2PIYA
chains in the Genus database with same CATH superfamily
4XNHC 4OADA 3I3GA 5G1ZA 1V6CA 2H5MA 1QSRA 1KUXA 4JD6A 5F5XA 2ZW6A 2ANPA 2DLAA 3LD2A 2OZUA 2EZBA 2AJ6A 4K3NA 1Y0YA 4UFXA 1ZRSA 2HWGA 3FMCA 4NGSA 3F8KA 4GS4A 3C8OA 3H8FA 1IYKA 5J8CA 4C86A 3BI1A 3D7DA 3NOJA 4MRIA 1QQ9A 3VTAA 5LYFA 1GYTA 3CDXA 2EZAA 4NGRA 4PK3A 4TJXA 3HPHE 4P4IA 4UEEA 4M85A 4BPUB 3QB8A 5H84A 1TXRA 3PT1A 2VZYA 3B3TA 2KCWA 3BLNA 4CPAA 3T05A 1NSAA 3GY9A 3GB0A 2V8GA 5JPHA 4RS2A 4CRZB 4MFKA 4C9VA 2P6GA 4C68A 2BEIA 2CNTA 3H8GA 4JLYA 5JGFA 4ONUA 3H8EA 3CZXA 3JUWA 1IU8A 4BBHA 1M44A 3OP0A 4W9YA 2IQ6A 2DIKA 3VRNA 3DDDA 3PBEA 2RFHA 1S60A 4F9VA 4LUAA 4R87A 3QAHA 4NSQA 3SI1A 2B5GB 2YNCA 1R57A 3ZJ0A 4MHPA 2YGWA 4C8TA 1XRYA 3KQXA 4KZTA 4UCMA 3G3SA 5K8PA 2P6FA 1YW6A 2Q51A 3P2FA 3EIFA 1Y7EA 3MRUA 1LRZA 2G3TA 4MFLA 4C7HA 4NJRA 4NCZA 1XBUA 2QECA 3TT2A 2YJTA 4CAXA 1L0CA 1YSJA 4MHYA 3ZNIA 1JDBC 3EFAA 1RO5A 5A28A 4K30A 4IAVA 2BCOA 2X0SA 2G3AA 1VI4A 1XOVA 1Z8WA 3OB1B 3WR7A 2PDOA 4Q7AA 1VHOA 3LMSA 3LODA 3FEDA 5ELYA 4HKFA 3PLFB 2I00A 2GIVA 1YVHA 1U6MA 2QJ8A 4H6ZA 4M6IA 2J9AA 3VH9A 4QBJA 1PYTB 2CXAA 1FT7A 3FH4A 4PXDA 1ZG9A 1CS0B 2R8VA 4OKOA 4CGNA 1TIQA 3CXSA 3VROA 1WVMA 4LX9A 4YU9A 2HROA 4AXVA 2D0OA 3TLCA 4B5PB 5HVGA 5HKZA 4Z65A 4EFDA 2WUUA 2C6GA 3PB9X 4CYQA 4EWTA 4B10A 2ATRA 2VZZA 4OP4A 3IWGA 2QIRA 3VARA 1IIDA 4R8FA 4R76A 4A38A 5IV0A 3OWCA 5LYIA 2PJ5A 3I6SA 1WJTA 3GLJA 2C27A 3TLGB 5HKWA 4C9AA 1CPSA 5HVFA 4AVCA 4H6UA 3ISZA 4P6YA 4MXUA 2ZOFA 2BOAA 5JM6A 3EZEA 3SJEA 3DR8A 3NA6A 4Q38A 3RO0A 3K2KA 1QSTA 3B35A 3BJ7A 4PSXA 4X5KA 5J1QA 4H89A 4ZY1A 3SHPA 5IR2A 2WYRA 3D2PA 2B4BA 1XJOA 2PJ1A 3PB6X 3EC4A 5CPAA 3BUNB 1PUAA 4DJLA 1ELLP 1KZFA 3WT4A 2XPOA 4ZX8A 3TLEA 4KOWA 3CPAA 3QNVA 3H5ZA 3IFEA 3DNSA 1Z4EA 4L89A 4LQ6A 3TOAA 1ELMP 5F13A 5K8MA 4KVOE 3TLYA 4CRYB 1Q2DA 1MJBA 2PJBA 2WPWA 5JVLA 2Z10A 3NE8A 3PFVA 1ZLIA 2XEFA 2B4DB 4FD7A 4CYOA 2PIZA 3IWWA 1QSMA 2Z3MA 5LYLA 1JDEA 1A9XB 4C8CA 1MJ9A 4MFJA 5J3XA 1YMEA 3K9TA 4BTFA 4A30A 4ZY2A 1YQEA 5G20A 1P0HA 3BUWB 2VQYA 4OMEA 1ZYMA 3WABA 2ZEPA 4MY0A 2F7VA 3D3SA 4MFPA 5E96A 3HLPA 3UY5A 2OB0A 3D68A 1GHEA 5C82A 4IIYA 4G1PA 4PV6A 5AG4A 2DEAA 5JYBA 3FRMA 3PEIA 4MY3A 4E0AA 4KOUA 2Q4VA 5AXIA 3JRUA 4TWEA 2XEGA 3SJFA 3V38A 1VIXA 3TLBA 5F49A 4B14A 2ARHA 2B58A 2ZW7A 5KTDA 4P4BA 2AFXA 2JLMA 3KL9A 4PPZA 3SI0A 3RAMA 1Z9EA 2CBLA 2UV8G 1BO4A 1F2OA 1V0CA 2Q04A 1AUGA 2QYVA 2REEA 2C1CA 5G21A 3F9KC 4YWYA 4KSIA 3IWEA 3D7GA 1VGYA 5DWNA 1NSLA 4NJQA 3W6SA 4C7IA 5AG5A 2B3UA 3T07A 4COBA 3HMJG 2YNCC 3R9EA 2C5QA 1QSOA 4E94A 4MCSA 1SQHA 1YVOA 1Y9ZA 4KSAA 3TC8A 3VATA 3D7FA 2PJ9A 3B3WA 4MJXA 1Z8LA 1ZO0A 4M6GA 1BOBA 3S6FA 1EZBA 3DLJA 4I49A 1XF8A 1OBRA 2HQYA 4R7MA 1UWYA 2VI7A 1ZG7A 2DPTA 3H4QA 2FSRA 1XMBA 5HH1A 4NF1A 3ZZIA 2BL1A 4C8PA 4X3RA 1VKCA 3K9UA 2PR1A 3PB4X 2ZEMA 4E5SA 1AMPA 4P4FA 2GU2A 1M4DA 2PQ8A 4XNHB 4J3GA 4UF4A 5FVJA 4UBRA 2CY2A 3JTKA 2C6CA 4E2AA 2V8HA 2ZEFA 4NGMA 4M3SA 1WWZA 2I3CA 1DE4C 5JH9A 4PXBA 4FD5A 2HV2A 4BPWB 3KHZA 1R3NA 2PE3A 4PK2A 3T0TA 4KORA 4JVOA 5IB9A 2FCKA 1CE8B 3I1UA 1CX8A 3RZAA 4A32A 3D66A 2Z3KA 2RC4A 1H8LA 1JQGA 5EBVA 3SI2A 1P4NA 2YNEA 1EZAA 1LCPA 3LWUA 4M8DA 2HB6A 1GGOA 4PQAA 3FX6A 4KLVA 1R43A 2AFZA 1QSNA 3CPXA 1UFHA 3P2HA 1S7FA 5THWA 1J3LA 1HEEA 1XEBA 1S5KA 4L8AA 5DS0A 2WPXA 3NE7A 3I74A 4C9RA 3U88C 5K99A 2NMTA 5D8NA 4AVAA 3ICUA 4R57A 4CS0B 2PR8A 2B4DA 4JYWA 4M6HA 4UEFA 4OC1A 2O53A 5EMIA 2JBJA 2K5TA 5G22A 2XPLA 4A4CA 3VRQA 4CZ1A 2VXKA 1B6BA 4KNGE 2CNSA 2EO8A 2ZEDA 3R9FA 3GUXA 2PJ4A 3V8IA 2R98A 4H1HA 1S7LA 2GE3A 2AFOA 2OH1A 2PC1A 3KI9A 5I0CA 3FXTA 4ORFA 4FBEA 1CM0A 1Q7LA 1CBXA 2Y1MA 4MCPA 1XE4A 2PJ3A 5F47A 4NGQA 2OR4A 3F5BA 4BPXB 2EUIA 3N7ZA 4MI4A 4NXYA 4AG9A 3FF3A 2PRBA 1KBLA 4C8UA 5J8FA 5D29A 2Y0MA 2EWBA 4KOVA 3S9MA 3IJ3A 3TTHA 1Q2YA 4OAEA 3D8PA 4A39A 3SJGA 1DIKA 3IU1A 3IEHA 5F48A 3TE4A 4IIXA 2G0BA 4Y49B 3FB3A 1QMUA 3BUXB 3HPGG 4HNWB 4B6ZA 4EVYA 8CPAA 3NFQA 1ZL0A 4CAWA 1Q2CA 1IOFA 4NGNA 3KR5A 3S6KA 2P6EA 4B11A 2F5IA 2NSMA 2F8HA 1I12A 1X10A 2PJ6A 1TF9A 1TKFA 1JWQA 2ZPAA 1XF1A 4CAEA 1NMTA 2V77A 2OZGA 1LAPA 4CYPA 4TJVA 3SR3A 3EZBA 4HNYB 4UWIA 4DUKA 3MGDA 4JZ0A 2EVNA 2PCUA 4JXQA 3B3VA 4UWJA 4DNCA 2AUNA 6CPAA 1F57A 4EYSA 3D2MA 1BPMA 2PCNA 2I79A 2ABZA 1AYEA 4BMHA 4OLLA 2IL4A 2YJVA 2Z3LA 3QAYA 4LQGA 3S6HA 4GM5A 2HI6A 3EZAA 2E28A 2C6PA 3OB2B 3JVNA 3OAKA 3FYNA 2ZELA 3KASA 4F0XA 4NGPA 3K4IA 2GREA 4CGPA 2ZXVA 3SXNA 5I4MA 4CYNA 4OC2A 4RR2B 1B87A 2N3AB 3BUOB 1ON0A 2HC9A 1TKJA 1Y0RA 4ZYQA 2PJ0A 1LAMA 2B3VA 2R82A 3PFEA 1KEEB 3T8WA 4KOYA 4U5YA 4MFQA 1VBHA 1KUVA 2CTCA 3IC1A 1IY7A 3C26A 4ZX9A 1NBWA 2QMLA 2XPPA 1XMTA 1R61A 4QB9A 2EBJA 2FT0A 2MP0A 4MCQA 3VGOA 1S3ZA 3EY5A 3SXOA 4WWVA 4FUUA 5C88A 4C8FA 4X8IA 4XPDB 4J0NA 7CPAA 1ARLA 2Q44A 1F2PA 4R3KA 1M4LA 1Z2LA 4YRHA 3PB7X 2Z3OA 5KTAA 2FL4A 1EO0A 1Z5RA 2IJZA 1J4JA 1YLOA 2J8MA 3NH4A 4UCPA 3TX8A 3TO6A 2Y1NA 4MHZA 2Q43A 4OC0A 3BI0A 2Q4YA 2QVPA 4QVTA 4XPKA 2PJAA 2WSAA 4RN7A 4KOXA 3I9SA 2PJCA 4CAVA 3LACA 3R1KA 5HXDA 1RXTA 4A4BA 1FY7A 3G8WA 3VRPA 1PCAA 2PVWA 5CBMA 1CG2A 1RTQA 2XEIA 1LFWA 2Z11A 2HUZA 4B13A 2ZW5A 2D0PA 3MN8A 5H86A 3RBUA 3PB8X 1YGHA 4ZY0A 2ODFA 2V8VA 3PZJA 5K8NA 1M4GA 2Z3NA 4MFZA 4B12A 3T90A 1YK3A 4KUBA 1Z4RA 2DXQA 2O4HA 4KUAA 3WC7A 1S7KA 2GFQA 2VEZA 2CNMA 3TYXA 4MMOA 2PJ8A 2ZEEA 4UFVA 3CXPA 4RUHA 2Q7SA 2XPNA 2XEJA 1EE3P 4MHNA 3VWDA 3BUMB 1BPNA 1IICA 4U9ZA 5IB0A 3U1BA 3DGVA 4OC4A 2G9DA 2X7BA 2REFA 1YW4A 3FJUA 4UA3A 4CAFA 4OC3A 5LRGA 2FVGA 1HDUA 4FD6A 3KHXA 5HKYA 4F8ZA 5K8OA 1BXRB 2IMOA 1MJAA 4HNXB 3W6XA 2JEVA 1LOKA 2PJ2A 4A2ZA 3PP9A 3VRRA 1N71A 4UIBA 2JBKA 4B5PA 4C85A 3N5FA 2YNDA 1S7NA 4JWPA 2B5GA 3PFOA 4MBUA 4KOSA 1KC7A 1NXJA 2GANA 1Y7RA 1VHEA 1X12A 3FEEA 4X2TA 1Y9KA 4QC6A 5AG7A 3A9LA 5LRKA 1IYLA 4F6AA 3CXQA 1KWMA 4JJXA 2Q4ZA 4CGOA 4P44A 3IU2A 2OU2A 5CNPA 2RB7A 4C9EA 2CTBA 4KVME 4A94A 1IB1E 2EK9A 1T36B 2CF4A 2PVVA 4MHDA 5LYDA 2Q7BA 5BWAB 3R9GA 1Q5XA 5F9MA 4E8OA 3RYOA 4YFJA 1HDQA 3V7ZA 4O23A 4RI1A 4ZBGA 1YX0A 1ZLHA 3B8GA 3IIBA 3SJXA 4BD9A 4P4DA 2AFWA 1ARMA 1I1DA 4TNUA 2ZEHA 1TKHA 1B47A 4EMEA 4IUSA 3VWEA 4IHMA 3S6GA 4PXEA 1M1DA 3NH5A 2EK8A 4XPLA 1NE9A 4MCRA 2P0WA 4NGTA 4MJ8A 2ZEOA 1WK4A 2FS5A 4CGMA 4P4JA 3FNCA 2Z3PA 2JDDA 3NFZA 2POKA 2Z0ZA 4IK2A 3TOBA 5A27A 4KOTA 3IGRA 3GJZA 1CPXA 2AFSA 5BY0A 3R95A 3DSBA 3TLAA 2OLSA 3E0KA 1BAVA 3GIUA 3R96A 4A95A 1Z8TA 1Z8XA 4KVXA 4BINA 2NYQA 3S9NA 4R3LA 4KLWA 3D4UA 1PU9A 1I21A 4NFRA 4JXRA 4Q36A 3CT9A 2BO9A 4AB7A 4AVBA 4AG7A 4ZI6A 5IX3A 2AUMA 1YLEA 2CIJA 2B0AA 5F09A 2BSWA 1YREA 3DR6A 2FM4A 5EC4A 4ZGYB 3KRVA 4CDKA 3TO9A 5F46A 1CJWA 2GLFA 4FD4A 4UIAA 4Y49C 3D67A 4C2YA 4C84A 2J8NA 2OOTA 2OZHA 3PGPA 4COGA 2AFUA 3KKWA 3KQZA 3FIXA 1FNOA 1XIXA 2O28A 4NEXA 4CGLA 1IGBA 3FVLA 1Z9UA 4OC5A 5GCNA 3NH8A 3TFYA 5HVHA 4P45A 2AFMA 4DYOA 3BXMA 1FBVA 3D7HA 1M4IA 2FE7A 2PJ7A 3EO4A 3RNZA 4A37A 3O8ZA 4R9MA 4II9A 3TLZA 3ISXA 3B3SA 4FAIA 4P4EA 3GYAA 5DWMA 3KZWA 4OIWA 4GPLB 2V8DA 4PXCA 3BHXA 4UEZA 3FBUA 2FXFA 4WJBA 1C30B 2PRQA 5FD8A 2GP4A 1YR0A 2FIWA 4GXHA 2VKZG 3KR4A 4INJA 4CO9A 4QUSA 3KGQA 5JQ4A 3TO7A 3B7IA 1YVKA 2VBQA 2JEWA 2PSWA 3PRTA 1CP7A 4U9YA 3T5MA 2B4JC 2ZEGA 4MI1A 4CDJA 3WC6A 1Y9WA 4F9UA 4KS9A 5KTCA 1K4JA 1XFOA 1BLLE 2A4NA 2ZENA 4H2KA 4C2XA 3HUVA 1IOIA 1LANA 3EXNA 1M6VB 4UFWA 2BUEA 2R1IA 1DTDA 2WZNA 4OIDA 2ZW4A 4PSWA 5F1YA 3TLGA 4ONWA 4P10A 2DF5A 2FIAA 4KSFA 4C8AA 3L2NA 4HPSA 4UCNA 4YN3A 4C99A 3BJ8A 3B3CA 3WC5A 4F0YA 2Q0YA 3IO1A 2R7HA 4FWUA 4IF5A 2AE6A 5LRJA 2DPSA 3TCVA 4R6TA 3W91A 4A31A 1KUYA 3F0AA 4A33A 4C2ZA 4YGOA 5ISVA 3T9YA 5AGEA 5HMNA 2D4PA 1ZG8A 2JDCA 2ZOGA 4B5OA 1VBGA 4C9UA 1VHSA 1TF8A 2EZCA 1A2ZA 3FECA 3PBBA 3S9LA 2GLJA 1C3OB 3GKRA 4XPDC 1CP6A 2D4OA 2VL1A 3B2YA 1MK4A 5AG6A 1OZPA 2J8RA 3G23A 2PIYA
chains in the Genus database with same CATH topology
1V6CA 2ANPA 4K3NA 1Y0YA 3FMCA 4NGSA 3H8FA 4C86A 3BI1A 3D7DA 4MRIA 1QQ9A 3VTAA 1GYTA 3CDXA 4NGRA 4TJXA 4P4IA 4UEEA 1TXRA 3B3TA 4CPAA 1NSAA 3GB0A 2V8GA 4C9VA 3H8GA 5JGFA 3H8EA 4W9YA 2IQ6A 3PBEA 2RFHA 4F9VA 3SI1A 4MHPA 4C8TA 1XRYA 3KQXA 5K8PA 1YW6A 2Q51A 3EIFA 1Y7EA 3MRUA 4NJRA 1XBUA 1YSJA 4MHYA 4IAVA 2BCOA 4Q7AA 1VHOA 3LMSA 3FEDA 5ELYA 2QJ8A 2J9AA 3VH9A 1PYTB 1FT7A 3FH4A 4PXDA 1ZG9A 4OKOA 1WVMA 4YU9A 4AXVA 5HVGA 4Z65A 4EFDA 3PB9X 2C6GA 4EWTA 5LYFA 4OP4A 3VARA 4A38A 4C85A 4R8FA 4R76A 5LYIA 3I6SA 2PJ5A 3GLJA 4C9AA 1CPSA 5HVFA 3ISZA 4P6YA 4MXUA 2ZOFA 2BOAA 5JM6A 3SJEA 3NA6A 3K2KA 3B35A 5J1QA 4ZY1A 5IR2A 2WYRA 2PJ1A 1XJOA 3PB6X 5CPAA 4DJLA 1ELLP 3WT4A 4ZX8A 3CPAA 3QNVA 3IFEA 1ELMP 5K8MA 2PJBA 1ZLIA 2XEFA 2PIZA 3IWWA 5LYLA 4C8CA 1YMEA 3K9TA 4ZY2A 4OMEA 3WABA 2ZEPA 2F7VA 3HLPA 3D68A 4G1PA 2DEAA 3PEIA 3JRUA 4TWEA 2XEGA 3SJFA 3V38A 1VIXA 4P4BA 2AFXA 3KL9A 4PPZA 3SI0A 3RAMA 1F2OA 2QYVA 2C1CA 4YWYA 4KSIA 3D7GA 1VGYA 4NJQA 2C5QA 4MCSA 1Y9ZA 3TC8A 3VATA 3D7FA 2PJ9A 3B3WA 1Z8LA 3DLJA 1OBRA 4R7MA 1UWYA 1ZG7A 1XMBA 4C8PA 4X3RA 3PB4X 2ZEMA 1AMPA 4P4FA 2GU2A 4UF4A 2C6CA 2V8HA 2ZEFA 4NGMA 2I3CA 1DE4C 5JH9A 4PXBA 3KHZA 1R3NA 2PE3A 5IB9A 3I1UA 1CX8A 3RZAA 3D66A 3SI2A 1H8LA 1JQGA 1LCPA 3LWUA 2HB6A 4PQAA 3FX6A 1R43A 2AFZA 3CPXA 5THWA 1HEEA 5DS0A 4C9RA 3I74A 5D8NA 4JYWA 4UEFA 4OC1A 2O53A 2JBJA 4KNGE 2ZEDA 3GUXA 2PJ4A 3KI9A 2AFOA 4FBEA 1Q7LA 1CBXA 2PJ3A 4MCPA 4NGQA 2OR4A 3FF3A 4C8UA 5D29A 2EWBA 3S9MA 3IJ3A 4A39A 3SJGA 3IEHA 1QMUA 4B6ZA 8CPAA 4NGNA 3KR5A 2NSMA 2F8HA 2PJ6A 1TF9A 1TKFA 1XF1A 2V77A 1LAPA 4TJVA 4DUKA 3ICUA 4JZ0A 2PCUA 3B3VA 6CPAA 1F57A 1BPMA 2ABZA 1AYEA 4LQGA 4GM5A 2C6PA 2ZELA 3KASA 4NGPA 2GREA 5I4MA 4OC2A 2HC9A 1TKJA 1Y0RA 4ZYQA 2PJ0A 1LAMA 3PFEA 3T8WA 2CTCA 3IC1A 1IY7A 4ZX9A 4MCQA 4WWVA 4FUUA 4C8FA 4X8IA 7CPAA 1ARLA 1F2PA 1M4LA 1Z2LA 3PB7X 1Z5RA 2IJZA 1YLOA 3NH4A 3TX8A 4MHZA 2Q43A 4OC0A 3BI0A 2QVPA 2PJAA 2PJCA 5HXDA 1PCAA 2PVWA 5CBMA 1CG2A 1RTQA 2XEIA 1LFWA 3MN8A 3RBUA 3PB8X 4ZY0A 2V8VA 5K8NA 2O4HA 3WC7A 4MMOA 2PJ8A 2ZEEA 4RUHA 2XEJA 1EE3P 4MHNA 1BPNA 3DGVA 4OC4A 2G9DA 1YW4A 3FJUA 4OC3A 5LRGA 2FVGA 1HDUA 3KHXA 4F8ZA 5K8OA 2IMOA 1LOKA 2PJ2A 4UIBA 2JBKA 3N5FA 3PFOA 1VHEA 3FEEA 4X2TA 5LRKA 1KWMA 2Q4ZA 4P44A 2RB7A 4C9EA 2CTBA 4A94A 2EK9A 2CF4A 2PVVA 5LYDA 1HDQA 3V7ZA 4O23A 1ZLHA 3IIBA 3SJXA 4BD9A 4P4DA 2AFWA 1ARMA 4TNUA 2ZEHA 1TKHA 4EMEA 4IHMA 4PXEA 3NH5A 2EK8A 4MCRA 4NGTA 2ZEOA 4P4JA 3NFZA 4IK2A 2POKA 1CPXA 2AFSA 1BAVA 2NYQA 3S9NA 4NFRA 3D4UA 3CT9A 2BO9A 4ZI6A 2CIJA 5F09A 4CDKA 4C84A 2GLFA 4UIAA 3D67A 2OOTA 2AFUA 3KQZA 1FNOA 1IGBA 3FVLA 4OC5A 3NH8A 5HVHA 4P45A 2AFMA 4DYOA 3BXMA 3D7HA 2PJ7A 4A37A 3ISXA 3B3SA 4FAIA 4P4EA 3KZWA 4OIWA 4PXCA 2V8DA 3BHXA 4UEZA 4WJBA 2PRQA 2GP4A 3KR4A 3KGQA 3B7IA 2JEWA 3PRTA 1CP7A 2ZEGA 3WC6A 4F9UA 1XFOA 1BLLE 2ZENA 4H2KA 3HUVA 1LANA 2WZNA 4OIDA 1DTDA 4CDJA 4ONWA 4P10A 4C8AA 3L2NA 4YN3A 4C99A 3B3CA 3WC5A 3IO1A 4FWUA 5LRJA 4R6TA 1ZG8A 2ZOGA 4C9UA 1TF8A 3FECA 3PBBA 3S9LA 2GLJA 1CP6A 2VL1A 3B2YA 2PIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6C A;  2ANP A;  4K3N A;  1Y0Y A;  3FMC A;  4NGS A;  3H8F A;  4C86 A;  3BI1 A;  3D7D A;  4MRI A;  1QQ9 A;  3VTA A;  1GYT A;  3CDX A;  4NGR A;  4TJX A;  4P4I A;  4UEE A;  1TXR A;  3B3T A;  4CPA A;  1NSA A;  3GB0 A;  2V8G A;  4C9V A;  3H8G A;  5JGF A;  3H8E A;  4W9Y A;  2IQ6 A;  3PBE A;  2RFH A;  4F9V A;  3SI1 A;  4MHP A;  4C8T A;  1XRY A;  3KQX A;  5K8P A;  1YW6 A;  2Q51 A;  3EIF A;  1Y7E A;  3MRU A;  4NJR A;  1XBU A;  1YSJ A;  4MHY A;  4IAV A;  2BCO A;  4Q7A A;  1VHO A;  3LMS A;  3FED A;  5ELY A;  2QJ8 A;  2J9A A;  3VH9 A;  1PYT B;  1FT7 A;  3FH4 A;  4PXD A;  1ZG9 A;  4OKO A;  1WVM A;  4YU9 A;  4AXV A;  5HVG A;  4Z65 A;  4EFD A;  3PB9 X;  2C6G A;  4EWT A;  5LYF A;  4OP4 A;  3VAR A;  4A38 A;  4C85 A;  4R8F A;  4R76 A;  5LYI A;  3I6S A;  2PJ5 A;  3GLJ A;  4C9A A;  1CPS A;  5HVF A;  3ISZ A;  4P6Y A;  4MXU A;  2ZOF A;  2BOA A;  5JM6 A;  3SJE A;  3NA6 A;  3K2K A;  3B35 A;  5J1Q A;  4ZY1 A;  2WYR A;  2PJ1 A;  1XJO A;  3PB6 X;  5CPA A;  4DJL A;  1ELL P;  3WT4 A;  4ZX8 A;  3CPA A;  3QNV A;  3IFE A;  1ELM P;  5K8M A;  2PJB A;  1ZLI A;  2XEF A;  2PIZ A;  3IWW A;  5LYL A;  4C8C A;  1YME A;  3K9T A;  4ZY2 A;  4OME A;  3WAB A;  2ZEP A;  2F7V A;  3HLP A;  3D68 A;  4G1P A;  2DEA A;  3PEI A;  3JRU A;  4TWE A;  2XEG A;  3SJF A;  3V38 A;  1VIX A;  4P4B A;  2AFX A;  3KL9 A;  4PPZ A;  3SI0 A;  3RAM A;  1F2O A;  2QYV A;  2C1C A;  4YWY A;  4KSI A;  3D7G A;  1VGY A;  4NJQ A;  4MCS A;  1Y9Z A;  3TC8 A;  3VAT A;  3D7F A;  2PJ9 A;  3B3W A;  1Z8L A;  3DLJ A;  1OBR A;  4R7M A;  1UWY A;  1ZG7 A;  1XMB A;  4C8P A;  4X3R A;  3PB4 X;  2ZEM A;  1AMP A;  4P4F A;  2GU2 A;  4UF4 A;  2C6C A;  2V8H A;  2ZEF A;  4NGM A;  2I3C A;  1DE4 C;  5JH9 A;  4PXB A;  3KHZ A;  1R3N A;  2PE3 A;  5IB9 A;  3I1U A;  1CX8 A;  3RZA A;  3D66 A;  3SI2 A;  1H8L A;  1JQG A;  1LCP A;  3LWU A;  2HB6 A;  4PQA A;  3FX6 A;  1R43 A;  2AFZ A;  3CPX A;  5THW A;  1HEE A;  5DS0 A;  4C9R A;  3I74 A;  5D8N A;  4JYW A;  4UEF A;  4OC1 A;  2O53 A;  2JBJ A;  4KNG E;  2ZED A;  3GUX A;  2PJ4 A;  3KI9 A;  2AFO A;  4FBE A;  1Q7L A;  1CBX A;  2PJ3 A;  4MCP A;  4NGQ A;  2OR4 A;  3FF3 A;  4C8U A;  5D29 A;  2EWB A;  3S9M A;  3IJ3 A;  4A39 A;  3SJG A;  3IEH A;  1QMU A;  4B6Z A;  8CPA A;  4NGN A;  3KR5 A;  2NSM A;  2F8H A;  2PJ6 A;  1TF9 A;  1TKF A;  1XF1 A;  2V77 A;  1LAP A;  4TJV A;  4DUK A;  3ICU A;  4JZ0 A;  2PCU A;  3B3V A;  6CPA A;  1F57 A;  1BPM A;  2ABZ A;  1AYE A;  4LQG A;  4GM5 A;  2C6P A;  2ZEL A;  3KAS A;  4NGP A;  2GRE A;  5I4M A;  4OC2 A;  2HC9 A;  1TKJ A;  1Y0R A;  4ZYQ A;  2PJ0 A;  1LAM A;  3PFE A;  3T8W A;  2CTC A;  3IC1 A;  1IY7 A;  4ZX9 A;  4MCQ A;  4WWV A;  4FUU A;  4C8F A;  4X8I A;  7CPA A;  1ARL A;  1F2P A;  1M4L A;  1Z2L A;  3PB7 X;  1Z5R A;  2IJZ A;  1YLO A;  3NH4 A;  3TX8 A;  4MHZ A;  2Q43 A;  4OC0 A;  3BI0 A;  2QVP A;  2PJA A;  2PJC A;  5HXD A;  1PCA A;  2PVW A;  5CBM A;  1CG2 A;  1RTQ A;  2XEI A;  1LFW A;  3MN8 A;  3RBU A;  3PB8 X;  4ZY0 A;  2V8V A;  5K8N A;  2O4H A;  3WC7 A;  4MMO A;  2PJ8 A;  2ZEE A;  4RUH A;  2XEJ A;  1EE3 P;  4MHN A;  1BPN A;  3DGV A;  4OC4 A;  2G9D A;  1YW4 A;  3FJU A;  4OC3 A;  5LRG A;  2FVG A;  1HDU A;  3KHX A;  4F8Z A;  5K8O A;  2IMO A;  1LOK A;  2PJ2 A;  4UIB A;  2JBK A;  3N5F A;  3PFO A;  1VHE A;  3FEE A;  4X2T A;  5LRK A;  1KWM A;  2Q4Z A;  4P44 A;  2RB7 A;  4C9E A;  2CTB A;  4A94 A;  2EK9 A;  2CF4 A;  2PVV A;  5LYD A;  1HDQ A;  3V7Z A;  4O23 A;  1ZLH A;  3IIB A;  3SJX A;  4BD9 A;  4P4D A;  2AFW A;  1ARM A;  4TNU A;  2ZEH A;  1TKH A;  4EME A;  4IHM A;  4PXE A;  3NH5 A;  2EK8 A;  4MCR A;  4NGT A;  2ZEO A;  4P4J A;  3NFZ A;  4IK2 A;  2POK A;  1CPX A;  2AFS A;  1BAV A;  2NYQ A;  3S9N A;  4NFR A;  3D4U A;  3CT9 A;  2BO9 A;  4ZI6 A;  2CIJ A;  5F09 A;  4CDK A;  4C84 A;  2GLF A;  4UIA A;  3D67 A;  2OOT A;  2AFU A;  3KQZ A;  1FNO A;  1IGB A;  3FVL A;  4OC5 A;  3NH8 A;  5HVH A;  4P45 A;  2AFM A;  4DYO A;  3BXM A;  3D7H A;  2PJ7 A;  4A37 A;  3ISX A;  3B3S A;  4FAI A;  4P4E A;  3KZW A;  4OIW A;  4PXC A;  2V8D A;  3BHX A;  4UEZ A;  4WJB A;  2PRQ A;  3KR4 A;  3KGQ A;  3B7I A;  2JEW A;  3PRT A;  1CP7 A;  2ZEG A;  3WC6 A;  4F9U A;  1XFO A;  1BLL E;  2ZEN A;  4H2K A;  3HUV A;  1LAN A;  2WZN A;  4OID A;  1DTD A;  4CDJ A;  4ONW A;  4P10 A;  4C8A A;  3L2N A;  4YN3 A;  4C99 A;  3B3C A;  3WC5 A;  3IO1 A;  4FWU A;  5LRJ A;  4R6T A;  1ZG8 A;  2ZOG A;  4C9U A;  1TF8 A;  3FEC A;  3PBB A;  3S9L A;  2GLJ A;  1CP6 A;  2VL1 A;  3B2Y A;  2PIY A; 
#chains in the Genus database with same CATH topology
 4XNH C;  4OAD A;  3I3G A;  5G1Z A;  1V6C A;  2H5M A;  1QSR A;  1KUX A;  4JD6 A;  5F5X A;  2ZW6 A;  2ANP A;  2DLA A;  3LD2 A;  2OZU A;  2EZB A;  2AJ6 A;  4K3N A;  1Y0Y A;  4UFX A;  1ZRS A;  2HWG A;  3FMC A;  4NGS A;  3F8K A;  4GS4 A;  3C8O A;  3H8F A;  1IYK A;  5J8C A;  4C86 A;  3BI1 A;  3D7D A;  3NOJ A;  4MRI A;  1QQ9 A;  3VTA A;  5LYF A;  1GYT A;  3CDX A;  2EZA A;  4NGR A;  4PK3 A;  4TJX A;  3HPH E;  4P4I A;  4UEE A;  4M85 A;  4BPU B;  3QB8 A;  5H84 A;  1TXR A;  3PT1 A;  2VZY A;  3B3T A;  2KCW A;  3BLN A;  4CPA A;  3T05 A;  1NSA A;  3GY9 A;  3GB0 A;  2V8G A;  5JPH A;  4RS2 A;  4CRZ B;  4MFK A;  4C9V A;  2P6G A;  4C68 A;  2BEI A;  2CNT A;  3H8G A;  4JLY A;  5JGF A;  4ONU A;  3H8E A;  3CZX A;  3JUW A;  1IU8 A;  4BBH A;  1M44 A;  3OP0 A;  4W9Y A;  2IQ6 A;  2DIK A;  3VRN A;  3DDD A;  3PBE A;  2RFH A;  1S60 A;  4F9V A;  4LUA A;  4R87 A;  3QAH A;  4NSQ A;  3SI1 A;  2B5G B;  2YNC A;  1R57 A;  3ZJ0 A;  4MHP A;  2YGW A;  4C8T A;  1XRY A;  3KQX A;  4KZT A;  4UCM A;  3G3S A;  5K8P A;  2P6F A;  1YW6 A;  2Q51 A;  3P2F A;  3EIF A;  1Y7E A;  3MRU A;  1LRZ A;  2G3T A;  4MFL A;  4C7H A;  4NJR A;  4NCZ A;  1XBU A;  2QEC A;  3TT2 A;  2YJT A;  4CAX A;  1L0C A;  1YSJ A;  4MHY A;  3ZNI A;  1JDB C;  3EFA A;  1RO5 A;  5A28 A;  4K30 A;  4IAV A;  2BCO A;  2X0S A;  2G3A A;  1VI4 A;  1XOV A;  1Z8W A;  3OB1 B;  3WR7 A;  2PDO A;  4Q7A A;  1VHO A;  3LMS A;  3LOD A;  3FED A;  5ELY A;  4HKF A;  3PLF B;  2I00 A;  2GIV A;  1YVH A;  1U6M A;  2QJ8 A;  4H6Z A;  4M6I A;  2J9A A;  3VH9 A;  4QBJ A;  1PYT B;  2CXA A;  1FT7 A;  3FH4 A;  4PXD A;  1ZG9 A;  1CS0 B;  2R8V A;  4OKO A;  4CGN A;  1TIQ A;  3CXS A;  3VRO A;  1WVM A;  4LX9 A;  4YU9 A;  2HRO A;  4AXV A;  2D0O A;  3TLC A;  4B5P B;  5HVG A;  5HKZ A;  4Z65 A;  4EFD A;  2WUU A;  2C6G A;  3PB9 X;  4CYQ A;  4EWT A;  4B10 A;  2ATR A;  2VZZ A;  4OP4 A;  3IWG A;  2QIR A;  3VAR A;  1IID A;  4R8F A;  4R76 A;  4A38 A;  5IV0 A;  3OWC A;  5LYI A;  2PJ5 A;  3I6S A;  1WJT A;  3GLJ A;  2C27 A;  3TLG B;  5HKW A;  4C9A A;  1CPS A;  5HVF A;  4AVC A;  4H6U A;  3ISZ A;  4P6Y A;  4MXU A;  2ZOF A;  2BOA A;  5JM6 A;  3EZE A;  3SJE A;  3DR8 A;  3NA6 A;  4Q38 A;  3RO0 A;  3K2K A;  1QST A;  3B35 A;  3BJ7 A;  4PSX A;  4X5K A;  5J1Q A;  4H89 A;  4ZY1 A;  3SHP A;  5IR2 A;  2WYR A;  3D2P A;  2B4B A;  1XJO A;  2PJ1 A;  3PB6 X;  3EC4 A;  5CPA A;  3BUN B;  1PUA A;  4DJL A;  1ELL P;  1KZF A;  3WT4 A;  2XPO A;  4ZX8 A;  3TLE A;  4KOW A;  3CPA A;  3QNV A;  3H5Z A;  3IFE A;  3DNS A;  1Z4E A;  4L89 A;  4LQ6 A;  3TOA A;  1ELM P;  5F13 A;  5K8M A;  4KVO E;  3TLY A;  4CRY B;  1Q2D A;  1MJB A;  2PJB A;  2WPW A;  5JVL A;  2Z10 A;  3NE8 A;  3PFV A;  1ZLI A;  2XEF A;  2B4D B;  4FD7 A;  4CYO A;  2PIZ A;  3IWW A;  1QSM A;  2Z3M A;  5LYL A;  1JDE A;  1A9X B;  4C8C A;  1MJ9 A;  4MFJ A;  5J3X A;  1YME A;  3K9T A;  4BTF A;  4A30 A;  4ZY2 A;  1YQE A;  5G20 A;  1P0H A;  3BUW B;  2VQY A;  4OME A;  1ZYM A;  3WAB A;  2ZEP A;  4MY0 A;  2F7V A;  3D3S A;  4MFP A;  5E96 A;  3HLP A;  3UY5 A;  2OB0 A;  3D68 A;  1GHE A;  5C82 A;  4IIY A;  4G1P A;  4PV6 A;  5AG4 A;  2DEA A;  5JYB A;  3FRM A;  3PEI A;  4MY3 A;  4E0A A;  4KOU A;  2Q4V A;  5AXI A;  3JRU A;  4TWE A;  2XEG A;  3SJF A;  3V38 A;  1VIX A;  3TLB A;  5F49 A;  4B14 A;  2ARH A;  2B58 A;  2ZW7 A;  5KTD A;  4P4B A;  2AFX A;  2JLM A;  3KL9 A;  4PPZ A;  3SI0 A;  3RAM A;  1Z9E A;  2CBL A;  2UV8 G;  1BO4 A;  1F2O A;  1V0C A;  2Q04 A;  1AUG A;  2QYV A;  2REE A;  2C1C A;  5G21 A;  3F9K C;  4YWY A;  4KSI A;  3IWE A;  3D7G A;  1VGY A;  5DWN A;  1NSL A;  4NJQ A;  3W6S A;  4C7I A;  5AG5 A;  2B3U A;  3T07 A;  4COB A;  3HMJ G;  2YNC C;  3R9E A;  2C5Q A;  1QSO A;  4E94 A;  4MCS A;  1SQH A;  1YVO A;  1Y9Z A;  4KSA A;  3TC8 A;  3VAT A;  3D7F A;  2PJ9 A;  3B3W A;  4MJX A;  1Z8L A;  1ZO0 A;  4M6G A;  1BOB A;  3S6F A;  1EZB A;  3DLJ A;  4I49 A;  1XF8 A;  1OBR A;  2HQY A;  4R7M A;  1UWY A;  2VI7 A;  1ZG7 A;  2DPT A;  3H4Q A;  2FSR A;  1XMB A;  5HH1 A;  4NF1 A;  3ZZI A;  2BL1 A;  4C8P A;  4X3R A;  1VKC A;  3K9U A;  2PR1 A;  3PB4 X;  2ZEM A;  4E5S A;  1AMP A;  4P4F A;  2GU2 A;  1M4D A;  2PQ8 A;  4XNH B;  4J3G A;  4UF4 A;  5FVJ A;  4UBR A;  2CY2 A;  3JTK A;  2C6C A;  4E2A A;  2V8H A;  2ZEF A;  4NGM A;  4M3S A;  1WWZ A;  2I3C A;  1DE4 C;  5JH9 A;  4PXB A;  4FD5 A;  2HV2 A;  4BPW B;  3KHZ A;  1R3N A;  2PE3 A;  4PK2 A;  3T0T A;  4KOR A;  4JVO A;  5IB9 A;  2FCK A;  1CE8 B;  3I1U A;  1CX8 A;  3RZA A;  4A32 A;  3D66 A;  2Z3K A;  2RC4 A;  1H8L A;  1JQG A;  5EBV A;  3SI2 A;  1P4N A;  2YNE A;  1EZA A;  1LCP A;  3LWU A;  4M8D A;  2HB6 A;  1GGO A;  4PQA A;  3FX6 A;  4KLV A;  1R43 A;  2AFZ A;  1QSN A;  3CPX A;  1UFH A;  3P2H A;  1S7F A;  5THW A;  1J3L A;  1HEE A;  1XEB A;  1S5K A;  4L8A A;  5DS0 A;  2WPX A;  3NE7 A;  3I74 A;  4C9R A;  3U88 C;  5K99 A;  2NMT A;  5D8N A;  4AVA A;  3ICU A;  4R57 A;  4CS0 B;  2PR8 A;  2B4D A;  4JYW A;  4M6H A;  4UEF A;  4OC1 A;  2O53 A;  5EMI A;  2JBJ A;  2K5T A;  5G22 A;  2XPL A;  4A4C A;  3VRQ A;  4CZ1 A;  2VXK A;  1B6B A;  4KNG E;  2CNS A;  2EO8 A;  2ZED A;  3R9F A;  3GUX A;  2PJ4 A;  3V8I A;  2R98 A;  4H1H A;  1S7L A;  2GE3 A;  2AFO A;  2OH1 A;  2PC1 A;  3KI9 A;  5I0C A;  3FXT A;  4ORF A;  4FBE A;  1CM0 A;  1Q7L A;  1CBX A;  2Y1M A;  4MCP A;  1XE4 A;  2PJ3 A;  5F47 A;  4NGQ A;  2OR4 A;  3F5B A;  4BPX B;  2EUI A;  3N7Z A;  4MI4 A;  4NXY A;  4AG9 A;  3FF3 A;  2PRB A;  1KBL A;  4C8U A;  5J8F A;  5D29 A;  2Y0M A;  2EWB A;  4KOV A;  3S9M A;  3IJ3 A;  3TTH A;  1Q2Y A;  4OAE A;  3D8P A;  4A39 A;  3SJG A;  1DIK A;  3IU1 A;  3IEH A;  5F48 A;  3TE4 A;  4IIX A;  2G0B A;  4Y49 B;  3FB3 A;  1QMU A;  3BUX B;  3HPG G;  4HNW B;  4B6Z A;  4EVY A;  8CPA A;  3NFQ A;  1ZL0 A;  4CAW A;  1Q2C A;  1IOF A;  4NGN A;  3KR5 A;  3S6K A;  2P6E A;  4B11 A;  2F5I A;  2NSM A;  2F8H A;  1I12 A;  1X10 A;  2PJ6 A;  1TF9 A;  1TKF A;  1JWQ A;  2ZPA A;  1XF1 A;  4CAE A;  1NMT A;  2V77 A;  2OZG A;  1LAP A;  4CYP A;  4TJV A;  3SR3 A;  3EZB A;  4HNY B;  4UWI A;  4DUK A;  3MGD A;  4JZ0 A;  2EVN A;  2PCU A;  4JXQ A;  3B3V A;  4UWJ A;  4DNC A;  2AUN A;  6CPA A;  1F57 A;  4EYS A;  3D2M A;  1BPM A;  2PCN A;  2I79 A;  2ABZ A;  1AYE A;  4BMH A;  4OLL A;  2IL4 A;  2YJV A;  2Z3L A;  3QAY A;  4LQG A;  3S6H A;  4GM5 A;  2HI6 A;  3EZA A;  2E28 A;  2C6P A;  3OB2 B;  3JVN A;  3OAK A;  3FYN A;  2ZEL A;  3KAS A;  4F0X A;  4NGP A;  3K4I A;  2GRE A;  4CGP A;  2ZXV A;  3SXN A;  5I4M A;  4CYN A;  4OC2 A;  4RR2 B;  1B87 A;  2N3A B;  3BUO B;  1ON0 A;  2HC9 A;  1TKJ A;  1Y0R A;  4ZYQ A;  2PJ0 A;  1LAM A;  2B3V A;  2R82 A;  3PFE A;  1KEE B;  3T8W A;  4KOY A;  4U5Y A;  4MFQ A;  1VBH A;  1KUV A;  2CTC A;  3IC1 A;  1IY7 A;  3C26 A;  4ZX9 A;  1NBW A;  2QML A;  2XPP A;  1XMT A;  1R61 A;  4QB9 A;  2EBJ A;  2FT0 A;  2MP0 A;  4MCQ A;  3VGO A;  1S3Z A;  3EY5 A;  3SXO A;  4WWV A;  4FUU A;  5C88 A;  4C8F A;  4X8I A;  4XPD B;  4J0N A;  7CPA A;  1ARL A;  2Q44 A;  1F2P A;  4R3K A;  1M4L A;  1Z2L A;  4YRH A;  3PB7 X;  2Z3O A;  5KTA A;  2FL4 A;  1EO0 A;  1Z5R A;  2IJZ A;  1J4J A;  1YLO A;  2J8M A;  3NH4 A;  4UCP A;  3TX8 A;  3TO6 A;  2Y1N A;  4MHZ A;  2Q43 A;  4OC0 A;  3BI0 A;  2Q4Y A;  2QVP A;  4QVT A;  4XPK A;  2PJA A;  2WSA A;  4RN7 A;  4KOX A;  3I9S A;  2PJC A;  4CAV A;  3LAC A;  3R1K A;  5HXD A;  1RXT A;  4A4B A;  1FY7 A;  3G8W A;  3VRP A;  1PCA A;  2PVW A;  5CBM A;  1CG2 A;  1RTQ A;  2XEI A;  1LFW A;  2Z11 A;  2HUZ A;  4B13 A;  2ZW5 A;  2D0P A;  3MN8 A;  5H86 A;  3RBU A;  3PB8 X;  1YGH A;  4ZY0 A;  2ODF A;  2V8V A;  3PZJ A;  5K8N A;  1M4G A;  2Z3N A;  4MFZ A;  4B12 A;  3T90 A;  1YK3 A;  4KUB A;  1Z4R A;  2DXQ A;  2O4H A;  4KUA A;  3WC7 A;  1S7K A;  2GFQ A;  2VEZ A;  2CNM A;  3TYX A;  4MMO A;  2PJ8 A;  2ZEE A;  4UFV A;  3CXP A;  4RUH A;  2Q7S A;  2XPN A;  2XEJ A;  1EE3 P;  4MHN A;  3VWD A;  3BUM B;  1BPN A;  1IIC A;  4U9Z A;  5IB0 A;  3U1B A;  3DGV A;  4OC4 A;  2G9D A;  2X7B A;  2REF A;  1YW4 A;  3FJU A;  4UA3 A;  4CAF A;  4OC3 A;  5LRG A;  2FVG A;  1HDU A;  4FD6 A;  3KHX A;  5HKY A;  4F8Z A;  5K8O A;  1BXR B;  2IMO A;  1MJA A;  4HNX B;  3W6X A;  2JEV A;  1LOK A;  2PJ2 A;  4A2Z A;  3PP9 A;  3VRR A;  1N71 A;  4UIB A;  2JBK A;  4B5P A;  4C85 A;  3N5F A;  2YND A;  1S7N A;  4JWP A;  2B5G A;  3PFO A;  4MBU A;  4KOS A;  1KC7 A;  1NXJ A;  2GAN A;  1Y7R A;  1VHE A;  1X12 A;  3FEE A;  4X2T A;  1Y9K A;  4QC6 A;  5AG7 A;  3A9L A;  5LRK A;  1IYL A;  4F6A A;  3CXQ A;  1KWM A;  4JJX A;  2Q4Z A;  4CGO A;  4P44 A;  3IU2 A;  2OU2 A;  5CNP A;  2RB7 A;  4C9E A;  2CTB A;  4KVM E;  4A94 A;  1IB1 E;  2EK9 A;  1T36 B;  2CF4 A;  2PVV A;  4MHD A;  5LYD A;  2Q7B A;  5BWA B;  3R9G A;  1Q5X A;  5F9M A;  4E8O A;  3RYO A;  4YFJ A;  1HDQ A;  3V7Z A;  4O23 A;  4RI1 A;  4ZBG A;  1YX0 A;  1ZLH A;  3B8G A;  3IIB A;  3SJX A;  4BD9 A;  4P4D A;  2AFW A;  1ARM A;  1I1D A;  4TNU A;  2ZEH A;  1TKH A;  1B47 A;  4EME A;  4IUS A;  3VWE A;  4IHM A;  3S6G A;  4PXE A;  1M1D A;  3NH5 A;  2EK8 A;  4XPL A;  1NE9 A;  4MCR A;  2P0W A;  4NGT A;  4MJ8 A;  2ZEO A;  1WK4 A;  2FS5 A;  4CGM A;  4P4J A;  3FNC A;  2Z3P A;  2JDD A;  3NFZ A;  2POK A;  2Z0Z A;  4IK2 A;  3TOB A;  5A27 A;  4KOT A;  3IGR A;  3GJZ A;  1CPX A;  2AFS A;  5BY0 A;  3R95 A;  3DSB A;  3TLA A;  2OLS A;  3E0K A;  1BAV A;  3GIU A;  3R96 A;  4A95 A;  1Z8T A;  1Z8X A;  4KVX A;  4BIN A;  2NYQ A;  3S9N A;  4R3L A;  4KLW A;  3D4U A;  1PU9 A;  1I21 A;  4NFR A;  4JXR A;  4Q36 A;  3CT9 A;  2BO9 A;  4AB7 A;  4AVB A;  4AG7 A;  4ZI6 A;  5IX3 A;  2AUM A;  1YLE A;  2CIJ A;  2B0A A;  5F09 A;  2BSW A;  1YRE A;  3DR6 A;  2FM4 A;  5EC4 A;  4ZGY B;  3KRV A;  4CDK A;  3TO9 A;  5F46 A;  1CJW A;  2GLF A;  4FD4 A;  4UIA A;  4Y49 C;  3D67 A;  4C2Y A;  4C84 A;  2J8N A;  2OOT A;  2OZH A;  3PGP A;  4COG A;  2AFU A;  3KKW A;  3KQZ A;  3FIX A;  1FNO A;  1XIX A;  2O28 A;  4NEX A;  4CGL A;  1IGB A;  3FVL A;  1Z9U A;  4OC5 A;  5GCN A;  3NH8 A;  3TFY A;  5HVH A;  4P45 A;  2AFM A;  4DYO A;  3BXM A;  1FBV A;  3D7H A;  1M4I A;  2FE7 A;  2PJ7 A;  3EO4 A;  3RNZ A;  4A37 A;  3O8Z A;  4R9M A;  4II9 A;  3TLZ A;  3ISX A;  3B3S A;  4FAI A;  4P4E A;  3GYA A;  5DWM A;  3KZW A;  4OIW A;  4GPL B;  2V8D A;  4PXC A;  3BHX A;  4UEZ A;  3FBU A;  2FXF A;  4WJB A;  1C30 B;  2PRQ A;  5FD8 A;  2GP4 A;  1YR0 A;  2FIW A;  4GXH A;  2VKZ G;  3KR4 A;  4INJ A;  4CO9 A;  4QUS A;  3KGQ A;  5JQ4 A;  3TO7 A;  3B7I A;  1YVK A;  2VBQ A;  2JEW A;  2PSW A;  3PRT A;  1CP7 A;  4U9Y A;  3T5M A;  2B4J C;  2ZEG A;  4MI1 A;  4CDJ A;  3WC6 A;  1Y9W A;  4F9U A;  4KS9 A;  5KTC A;  1K4J A;  1XFO A;  1BLL E;  2A4N A;  2ZEN A;  4H2K A;  4C2X A;  3HUV A;  1IOI A;  1LAN A;  3EXN A;  1M6V B;  4UFW A;  2BUE A;  2R1I A;  1DTD A;  2WZN A;  4OID A;  2ZW4 A;  4PSW A;  5F1Y A;  3TLG A;  4ONW A;  4P10 A;  2DF5 A;  2FIA A;  4KSF A;  4C8A A;  3L2N A;  4HPS A;  4UCN A;  4YN3 A;  4C99 A;  3BJ8 A;  3B3C A;  3WC5 A;  4F0Y A;  2Q0Y A;  3IO1 A;  2R7H A;  4FWU A;  4IF5 A;  2AE6 A;  5LRJ A;  2DPS A;  3TCV A;  4R6T A;  3W91 A;  4A31 A;  1KUY A;  3F0A A;  4A33 A;  4C2Z A;  4YGO A;  5ISV A;  3T9Y A;  5AGE A;  5HMN A;  2D4P A;  1ZG8 A;  2JDC A;  2ZOG A;  4B5O A;  1VBG A;  4C9U A;  1VHS A;  1TF8 A;  2EZC A;  1A2Z A;  3FEC A;  3PBB A;  3S9L A;  2GLJ A;  1C3O B;  3GKR A;  4XPD C;  1CP6 A;  2D4O A;  2VL1 A;  3B2Y A;  1MK4 A;  5AG6 A;  1OZP A;  2J8R A;  3G23 A;  2PIY A; 
#chains in the Genus database with same CATH homology
 1V6C A;  2ANP A;  4K3N A;  1Y0Y A;  3FMC A;  4NGS A;  3H8F A;  4C86 A;  3BI1 A;  3D7D A;  4MRI A;  1QQ9 A;  3VTA A;  1GYT A;  3CDX A;  4NGR A;  4TJX A;  4P4I A;  4UEE A;  1TXR A;  3B3T A;  4CPA A;  1NSA A;  3GB0 A;  2V8G A;  4C9V A;  3H8G A;  5JGF A;  3H8E A;  4W9Y A;  2IQ6 A;  3PBE A;  2RFH A;  4F9V A;  3SI1 A;  4MHP A;  4C8T A;  1XRY A;  3KQX A;  5K8P A;  1YW6 A;  2Q51 A;  3EIF A;  1Y7E A;  3MRU A;  4NJR A;  1XBU A;  1YSJ A;  4MHY A;  4IAV A;  2BCO A;  4Q7A A;  1VHO A;  3LMS A;  3FED A;  5ELY A;  2QJ8 A;  2J9A A;  3VH9 A;  1PYT B;  1FT7 A;  3FH4 A;  4PXD A;  1ZG9 A;  4OKO A;  1WVM A;  4YU9 A;  4AXV A;  5HVG A;  4Z65 A;  4EFD A;  3PB9 X;  2C6G A;  4EWT A;  5LYF A;  4OP4 A;  3VAR A;  4A38 A;  4C85 A;  4R8F A;  4R76 A;  5LYI A;  3I6S A;  2PJ5 A;  3GLJ A;  4C9A A;  1CPS A;  5HVF A;  3ISZ A;  4P6Y A;  4MXU A;  2ZOF A;  2BOA A;  5JM6 A;  3SJE A;  3NA6 A;  3K2K A;  3B35 A;  5J1Q A;  4ZY1 A;  5IR2 A;  2WYR A;  2PJ1 A;  1XJO A;  3PB6 X;  5CPA A;  4DJL A;  1ELL P;  3WT4 A;  4ZX8 A;  3CPA A;  3QNV A;  3IFE A;  1ELM P;  5K8M A;  2PJB A;  1ZLI A;  2XEF A;  2PIZ A;  3IWW A;  5LYL A;  4C8C A;  1YME A;  3K9T A;  4ZY2 A;  4OME A;  3WAB A;  2ZEP A;  2F7V A;  3HLP A;  3D68 A;  4G1P A;  2DEA A;  3PEI A;  3JRU A;  4TWE A;  2XEG A;  3SJF A;  3V38 A;  1VIX A;  4P4B A;  2AFX A;  3KL9 A;  4PPZ A;  3SI0 A;  3RAM A;  1F2O A;  2QYV A;  2C1C A;  4YWY A;  4KSI A;  3D7G A;  1VGY A;  4NJQ A;  2C5Q A;  4MCS A;  1Y9Z A;  3TC8 A;  3VAT A;  3D7F A;  2PJ9 A;  3B3W A;  1Z8L A;  3DLJ A;  1OBR A;  4R7M A;  1UWY A;  1ZG7 A;  1XMB A;  4C8P A;  4X3R A;  3PB4 X;  2ZEM A;  1AMP A;  4P4F A;  2GU2 A;  4UF4 A;  2C6C A;  2V8H A;  2ZEF A;  4NGM A;  2I3C A;  1DE4 C;  5JH9 A;  4PXB A;  3KHZ A;  1R3N A;  2PE3 A;  5IB9 A;  3I1U A;  1CX8 A;  3RZA A;  3D66 A;  3SI2 A;  1H8L A;  1JQG A;  1LCP A;  3LWU A;  2HB6 A;  4PQA A;  3FX6 A;  1R43 A;  2AFZ A;  3CPX A;  5THW A;  1HEE A;  5DS0 A;  4C9R A;  3I74 A;  5D8N A;  4JYW A;  4UEF A;  4OC1 A;  2O53 A;  2JBJ A;  4KNG E;  2ZED A;  3GUX A;  2PJ4 A;  3KI9 A;  2AFO A;  4FBE A;  1Q7L A;  1CBX A;  2PJ3 A;  4MCP A;  4NGQ A;  2OR4 A;  3FF3 A;  4C8U A;  5D29 A;  2EWB A;  3S9M A;  3IJ3 A;  4A39 A;  3SJG A;  3IEH A;  1QMU A;  4B6Z A;  8CPA A;  4NGN A;  3KR5 A;  2NSM A;  2F8H A;  2PJ6 A;  1TF9 A;  1TKF A;  1XF1 A;  2V77 A;  1LAP A;  4TJV A;  4DUK A;  3ICU A;  4JZ0 A;  2PCU A;  3B3V A;  6CPA A;  1F57 A;  1BPM A;  2ABZ A;  1AYE A;  4LQG A;  4GM5 A;  2C6P A;  2ZEL A;  3KAS A;  4NGP A;  2GRE A;  5I4M A;  4OC2 A;  2HC9 A;  1TKJ A;  1Y0R A;  4ZYQ A;  2PJ0 A;  1LAM A;  3PFE A;  3T8W A;  2CTC A;  3IC1 A;  1IY7 A;  4ZX9 A;  4MCQ A;  4WWV A;  4FUU A;  4C8F A;  4X8I A;  7CPA A;  1ARL A;  1F2P A;  1M4L A;  1Z2L A;  3PB7 X;  1Z5R A;  2IJZ A;  1YLO A;  3NH4 A;  3TX8 A;  4MHZ A;  2Q43 A;  4OC0 A;  3BI0 A;  2QVP A;  2PJA A;  2PJC A;  5HXD A;  1PCA A;  2PVW A;  5CBM A;  1CG2 A;  1RTQ A;  2XEI A;  1LFW A;  3MN8 A;  3RBU A;  3PB8 X;  4ZY0 A;  2V8V A;  5K8N A;  2O4H A;  3WC7 A;  4MMO A;  2PJ8 A;  2ZEE A;  4RUH A;  2XEJ A;  1EE3 P;  4MHN A;  1BPN A;  3DGV A;  4OC4 A;  2G9D A;  1YW4 A;  3FJU A;  4OC3 A;  5LRG A;  2FVG A;  1HDU A;  3KHX A;  4F8Z A;  5K8O A;  2IMO A;  1LOK A;  2PJ2 A;  4UIB A;  2JBK A;  3N5F A;  3PFO A;  1VHE A;  3FEE A;  4X2T A;  5LRK A;  1KWM A;  2Q4Z A;  4P44 A;  2RB7 A;  4C9E A;  2CTB A;  4A94 A;  2EK9 A;  2CF4 A;  2PVV A;  5LYD A;  1HDQ A;  3V7Z A;  4O23 A;  1ZLH A;  3IIB A;  3SJX A;  4BD9 A;  4P4D A;  2AFW A;  1ARM A;  4TNU A;  2ZEH A;  1TKH A;  4EME A;  4IHM A;  4PXE A;  3NH5 A;  2EK8 A;  4MCR A;  4NGT A;  2ZEO A;  4P4J A;  3NFZ A;  4IK2 A;  2POK A;  1CPX A;  2AFS A;  1BAV A;  2NYQ A;  3S9N A;  4NFR A;  3D4U A;  3CT9 A;  2BO9 A;  4ZI6 A;  2CIJ A;  5F09 A;  4CDK A;  4C84 A;  2GLF A;  4UIA A;  3D67 A;  2OOT A;  2AFU A;  3KQZ A;  1FNO A;  1IGB A;  3FVL A;  4OC5 A;  3NH8 A;  5HVH A;  4P45 A;  2AFM A;  4DYO A;  3BXM A;  3D7H A;  2PJ7 A;  4A37 A;  3ISX A;  3B3S A;  4FAI A;  4P4E A;  3KZW A;  4OIW A;  4PXC A;  2V8D A;  3BHX A;  4UEZ A;  4WJB A;  2PRQ A;  2GP4 A;  3KR4 A;  3KGQ A;  3B7I A;  2JEW A;  3PRT A;  1CP7 A;  2ZEG A;  3WC6 A;  4F9U A;  1XFO A;  1BLL E;  2ZEN A;  4H2K A;  3HUV A;  1LAN A;  2WZN A;  4OID A;  1DTD A;  4CDJ A;  4ONW A;  4P10 A;  4C8A A;  3L2N A;  4YN3 A;  4C99 A;  3B3C A;  3WC5 A;  3IO1 A;  4FWU A;  5LRJ A;  4R6T A;  1ZG8 A;  2ZOG A;  4C9U A;  1TF8 A;  3FEC A;  3PBB A;  3S9L A;  2GLJ A;  1CP6 A;  2VL1 A;  3B2Y A;  2PIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...