4OC1A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with coibzl, a urea-based inhibitor (2s)-2-[({(1s)-1-carboxy-2-[(2s)-oxiran-2-yl]ethyl}carbamoyl)amino]-6-[(4-iodobenzoyl)amino]hexanoic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc1A02
2XEFA 4P4IA 3N5FA 2XEGA 4MCRA 3K2KA 1XF1A 4C8FA 1VHEA 2ABZA 5THWA 3NA6A 3VARA 3SJFA 1Y9ZA 1LCPA 4P45A 3BI0A 4C85A 4K3NA 3FH4A 4KNGE 2PIYA 1IGBA 2C6CA 4JYWA 2WYRA 1DTDA 3WT4A 4C8UA 5JGFA 4X3RA 1YLOA 2BO9A 2NSMA 3KGQA 5D8NA 3B3WA 1CPSA 4NJQA 4X2TA 2AFOA 1LFWA 3H8EA 4X8IA 3SJXA 4NGMA 4OC5A 3JRUA 3B3CA 3FECA 1ZG7A 3IO1A 1GYTA 3L2NA 4A37A 2RB7A 3QNVA 1JQGA 4A94A 1ELMP 3CDXA 4OC4A 4DJLA 3HLPA 4C99A 4OC0A 2AFSA 4A39A 5CBMA 4UIBA 4EMEA 2QYVA 4F9UA 4NGRA 3GB0A 3FJUA 1Y0YA 3SJGA 1QQ9A 2CIJA 1LANA 1F57A 4YN3A 4O23A 4PPZA 2O4HA 4UIAA 2AFWA 3D7GA 2CTBA 3VTAA 3B3TA 4F8ZA 4C9RA 4H2KA 3B3VA 3RZAA 4Z65A 4MHZA 2ZEMA 3LWUA 4UEZA 1YW4A 1YMEA 4MHPA 3D67A 6CPAA 4TJXA 4EWTA 5DS0A 3FVLA 4P10A 3PFOA 1TF9A 3FEEA 1PYTB 3GUXA 3MRUA 4ZY2A 3WABA 2EWBA 4PXDA 3BXMA 3ISZA 2OR4A 2HC9A 2Q43A 5IB9A 2JEWA 4MCPA 1R43A 2I3CA 2G9DA 2HB6A 2JBKA 1CP7A 4C9VA 2V77A 1FNOA 4AXVA 1Z5RA 2WZNA 4MCQA 3SI2A 3KQZA 4DYOA 3DLJA 2BCOA 5I4MA 4IHMA 5ELYA 3CT9A 3TX8A 4OC1A 2IJZA 3DGVA 1KWMA 3NH4A 2PJBA 2F8HA 4MHYA 2ZEGA 3B2YA 3FF3A 4FBEA 1ZLIA 3NH8A 2C6PA 2GU2A 2PJAA 5HXDA 1TKJA 1WVMA 4FAIA 2GREA 3KI9A 1XRYA 3PB6X 1BAVA 1ARMA 1RTQA 2AFUA 3H8GA 1BPNA 5K8PA 5LRGA 5K8MA 2V8DA 4OC3A 3LMSA 3CPAA 4LQGA 1TF8A 5HVGA 1XBUA 5LRJA 1Y0RA 3TC8A 4NGNA 3NH5A 4TNUA 4CPAA 2ZEPA 2PE3A 2AFXA 2Q51A 2PJ7A 3B3SA 2POKA 3MN8A 1UWYA 5K8OA 2CTCA 3PRTA 2PJ0A 5HVHA 1CPXA 3D4UA 5HVFA 4FUUA 4MMOA 3K9TA 3I74A 4P4DA 4WWVA 2QVPA 1FT7A 3SJEA 4PXEA 2PJ4A 4PXBA 2ZELA 4NFRA 4DUKA 1XMBA 4ZX9A 2PJ1A 3KR4A 2ZEFA 4OKOA 2PJ6A 4ZX8A 4ZYQA 4CDJA 5F09A 1YW6A 3IEHA 4P4EA 3SI0A 2OOTA 5JH9A 1EE3P 2IMOA 1ZG9A 2Q4ZA 1VIXA 2PJCA 8CPAA 4MCSA 4B6ZA 4C8CA 5J1QA 2FVGA 3D7DA 2DEAA 2XEIA 4UF4A 2PJ5A 3S9MA 2ZOFA 3WC7A 4OMEA 5LRKA 1CG2A 3D7HA 3FMCA 3SI1A 2V8GA 4NGSA 2ANPA 2F7VA 4R8FA 1R3NA 2GLFA 1YSJA 5K8NA 4OP4A 3IFEA 2GLJA 4C9UA 4G1PA 2XEJA 4JZ0A 4NGTA 4TJVA 4UEFA 4IAVA 1OBRA 3D66A 3PB8X 3V7ZA 4ZI6A 3EIFA 3VATA 2QJ8A 7CPAA 3I1UA 3FX6A 1LOKA 3V38A 4NGPA 1CX8A 2BOAA 1HEEA 5LYLA 3PB9X 1ARLA 4PQAA 5LYIA 4WJBA 2PRQA 2IQ6A 1TKFA 4CDKA 4RUHA 4OIDA 1BLLE 4PXCA 4R76A 5JM6A 1V6CA 2ZOGA 2PIZA 1F2PA 3RAMA 4UEEA 3NFZA 3I6SA 4ONWA 1NSAA 2CF4A 2RFHA 2AFZA 2ZEEA 4P4FA 4C9AA 4IK2A 4C8AA 3FEDA 4EFDA 1HDUA 3S9LA 4C86A 2PJ8A 2PJ3A 1AYEA 4MRIA 1H8LA 1XJOA 3KHZA 4P4BA 3RBUA 1Z2LA 4C8PA 4F9VA 3PBBA 3B35A 3CPXA 3IWWA 1CP6A 4NJRA 1AMPA 3BI1A 2JBJA 4FWUA 3H8FA 1F2OA 1QMUA 4W9YA 1ELLP 3PBEA 4P4JA 2V8VA 4NGQA 4P44A 3KZWA 3ICUA 1VHOA 3IIBA 2C6GA 3WC5A 2EK8A 3BHXA 2PJ9A 2PVVA 5D29A 4OIWA 2VL1A 4YU9A 1TXRA 3S9NA 4A38A 2ZENA 4C84A 4ZY1A 3D68A 3PB4X 2ZEOA 5LYDA 3HUVA 4C8TA 3KQXA 1PCAA 1VGYA 5CPAA 3KHXA 4YWYA 5LYFA 3IC1A 1ZLHA 2EK9A 4OC2A 3KR5A 1Z8LA 1Q7LA 1LAMA 3PFEA 4BD9A 1HDQA 4MHNA 1XFOA 4ZY0A 3IJ3A 1BPMA 2J9AA 4GM5A 3PB7X 2ZEHA 3KASA 2C1CA 3ISXA 3KL9A 2AFMA 2V8HA 2PCUA 1Y7EA 1M4LA 3D7FA 2PJ2A 4KSIA 4C9EA 4R7MA 3VH9A 1LAPA 2ZEDA 1ZG8A 2NYQA 2PVWA 1IY7A 3WC6A 4P6YA 3PEIA 1DE4C 4Q7AA 4R6TA 4TWEA 3GLJA 1TKHA 3B7IA 3T8WA 4MXUA 1CBXA 2O53A
chains in the Genus database with same CATH superfamily
2XEFA 4P4IA 1IICA 2B4BA 2GANA 2XEGA 4MCRA 3N5FA 4R3LA 4UCMA 3BUXB 3K2KA 4KOWA 1XF1A 4C8FA 2B5GA 1VHEA 1S7KA 1XE4A 2ABZA 4YRHA 5THWA 3NA6A 3DR8A 5CNPA 4H6UA 4LQ6A 3IGRA 3VARA 3SJFA 1Y9ZA 4OADA 4CS0B 1LCPA 1R61A 4P45A 3A9LA 3BI0A 4PK2A 4C85A 3VWDA 4KUAA 4J3GA 2I00A 3TLGA 4BBHA 3DSBA 2C5QA 3T05A 4JVOA 1C30B 4K3NA 4UWJA 3GY9A 4ORFA 3FH4A 1IU8A 4KNGE 2PIYA 1IGBA 2EZCA 3MGDA 2C6CA 4J0NA 4JYWA 2WYRA 1DTDA 5AG7A 1TIQA 5EC4A 3O8ZA 4MY0A 3WT4A 2ZW6A 1SQHA 4FD6A 4C8UA 4ONUA 5JGFA 3R9EA 4X3RA 1YLOA 2BO9A 2Z3KA 3H5ZA 2NSMA 3KGQA 5D8NA 3B3WA 1CPSA 1NE9A 2PR1A 4NJQA 4MFPA 4L8AA 4UFWA 4X2TA 4R57A 1YX0A 4MI1A 1EZBA 2AFOA 5C88A 1X12A 1LFWA 3H8EA 4X8IA 4KORA 3SJXA 4QC6A 4NGMA 3P2FA 2BEIA 2QMLA 4NF1A 4NXYA 2B4DA 1IB1E 3RO0A 4H6ZA 4KUBA 4OC5A 1JDBC 3JRUA 4AB7A 3B3CA 3FECA 4BPUB 1ZG7A 2DPTA 2QIRA 2CNMA 2RC4A 3IO1A 4C2XA 2OU2A 2FCKA 1GYTA 3L2NA 4A37A 4CGPA 2O28A 3N7ZA 3S6KA 2RB7A 5JVLA 2R1IA 3QNVA 1JQGA 4A94A 3DNSA 1ELMP 3CDXA 2EZAA 4OC4A 3OAKA 2Z11A 4L89A 1Y9WA 4DJLA 5BY0A 3HLPA 3F0AA 4C99A 2VZZA 1QSNA 4OC0A 4MXUA 1XIXA 4CAVA 4R87A 2X0SA 2AFSA 4A39A 4IUSA 5CBMA 4UIBA 4XPDB 2QYVA 4C2ZA 4EMEA 4F9UA 3NFQA 3TLZA 4KOVA 4F0YA 2JEVA 2VBQA 1KC7A 4C2YA 3LACA 3S6FA 4NGRA 3GB0A 4KSFA 3FJUA 1Y0YA 3TOBA 3SJGA 1QQ9A 2R7HA 1S60A 3QAYA 2CIJA 1I21A 1F57A 1LANA 3RNZA 4BINA 4A95A 4YN3A 2ODFA 4O23A 4PPZA 2O4HA 3BUOB 2XPOA 2ATRA 2Y0MA 4UIAA 3DR6A 2D4PA 3C8OA 2AFWA 3D7GA 2P6EA 4E0AA 5F13A 2CTBA 3VTAA 1M4DA 3IU1A 3B3TA 1VBHA 4F8ZA 1J3LA 1WK4A 2PDOA 3VWEA 1S7FA 4KLVA 4C9RA 4B10A 4H2KA 2C27A 3B3VA 3RZAA 3TCVA 4Z65A 4MHZA 1KZFA 4C7IA 2ZEMA 3HMJG 3LWUA 3F8KA 4UEZA 1CM0A 3SHPA 4CGOA 4CAEA 1YW4A 3TE4A 3G23A 2Z3LA 1YMEA 2WPXA 4MJ8A 4MHPA 4CRYB 4NCZA 3D67A 6CPAA 4KOXA 4EWTA 4TJXA 2D4OA 2Q7SA 5DS0A 3FVLA 3R96A 4P10A 1IYKA 3PFOA 1TF9A 5G20A 3FEEA 1Z8WA 2ARHA 2VQYA 1PYTB 3FBUA 3GUXA 3MRUA 5KTCA 4IIXA 4ZY2A 3WABA 2EWBA 4M6GA 3W6XA 3VROA 1IIDA 4PXDA 3BXMA 2E28A 1PU9A 4A4CA 2OR4A 1YGHA 2HC9A 3U88C 2I79A 2Q04A 3OB1B 3ISZA 2P6FA 2Q43A 5DWNA 1NMTA 5IB9A 3ZNIA 2JEWA 5FD8A 3OB2B 4MCPA 1R43A 2I3CA 2G9DA 1I1DA 3E0KA 3GKRA 2HB6A 2JBKA 1CP7A 4K30A 5JPHA 4C9VA 2V77A 1YK3A 1FNOA 2AE6A 2CBLA 1Z5RA 2WZNA 4AXVA 5HKYA 5AGEA 4E5SA 1IOIA 4MCQA 2VEZA 1XMTA 3SI2A 3KQZA 3TO6A 4DYOA 3DLJA 2BCOA 2OZGA 4OAEA 4R9MA 4IHMA 5I4MA 5ELYA 3CT9A 2PRBA 4OC1A 1KUVA 3TX8A 4EVYA 4RR2B 2WPWA 2WUUA 4MY3A 4CAXA 2FSRA 4JJXA 2DPSA 3EC4A 3SR3A 1RXTA 2IJZA 4B13A 3DGVA 3T9YA 1KWMA 3NH4A 1NSLA 4CAWA 1Y7RA 2CNSA 2PJBA 2D0PA 2F8HA 4MI4A 4MHYA 2ZEGA 3B2YA 3FF3A 3HPHE 4FBEA 1ZLIA 3NH8A 2C6PA 3IU2A 2QECA 2GU2A 2PJAA 4UCPA 1M4IA 1Q2YA 3JVNA 5EBVA 1TKJA 2PC1A 5HXDA 1WVMA 5JQ4A 3OP0A 1IYLA 1ZYMA 2DXQA 4PSXA 4U9ZA 2Z3NA 1Q5XA 1KBLA 4KVOE 4FAIA 4CYNA 2GREA 3KI9A 1XRYA 2F5IA 2G3AA 3PB6X 1RTQA 1BAVA 1ARMA 1M44A 4QBJA 2AFUA 3H8GA 1Z4RA 1BPNA 1ZL0A 4KOSA 5DWMA 5LRGA 5K8PA 3EZEA 3U1BA 3BUNB 5K8MA 1Y9KA 2V8DA 3K4IA 4E94A 4OC3A 4BPXB 1GHEA 3C26A 3LMSA 3PT1A 2FE7A 4E2AA 3KRVA 1EZAA 4LQGA 1TF8A 2G3TA 3CPAA 3D2PA 1XBUA 5HVGA 2A4NA 5LRJA 1UFHA 2GFQA 1Y0RA 2Z3OA 3PGPA 3TC8A 2Y1NA 1ZO0A 4NGNA 3NH5A 4TNUA 4CPAA 2ZEPA 2PE3A 2AFXA 2Q51A 2ZXVA 4PK3A 1N71A 2FXFA 3P2HA 1JWQA 2PJ7A 3B3SA 2POKA 3MN8A 1UWYA 3T07A 2BL1A 5K8OA 1RO5A 2CTCA 3EXNA 2PJ0A 3PRTA 4R3KA 2Q4YA 3PLFB 3DDDA 4CYPA 1CPXA 5HVHA 1M4GA 4KSAA 3D4UA 5HVFA 4FUUA 5IX3A 4MMOA 1M6VB 3K9TA 2H5MA 4Q36A 3I74A 2YGWA 2ZW5A 5F47A 4P4DA 2OH1A 4XNHC 4WWVA 3R95A 1YR0A 4OLLA 2QVPA 3R9FA 1FT7A 4QB9A 2OZUA 4KVXA 3EFAA 4JXRA 3SJEA 3FYNA 2HWGA 4KZTA 5F48A 3W6SA 4PXEA 2R98A 5IR2A 2PJ4A 4MJXA 3TO9A 3QAHA 4E8OA 1L0CA 5GCNA 4AVCA 2EZBA 4PXBA 1CJWA 1QSMA 2ZELA 3G3SA 2HV2A 4CYOA 3D3SA 1ZRSA 1MJBA 3QB8A 4RN7A 4CGNA 1AUGA 4NEXA 4NFRA 4DUKA 1XMBA 4UFXA 1R57A 2PJ1A 4Y49C 4ZX9A 3S6HA 2YNCC 3KR4A 3T0TA 4A4BA 2ZEFA 2PJ6A 1V0CA 4OKOA 4ZX8A 4AVAA 4ZYQA 1T36B 1NXJA 2HI6A 3WR7A 4CDJA 5F09A 5F5XA 1YW6A 5H84A 2XPNA 4BPWB 3IEHA 3EZAA 2FT0A 4UFVA 2VXKA 4P4EA 3VRNA 2EVNA 3SI0A 2OOTA 4A30A 4H1HA 5JH9A 4H89A 3RYOA 1EE3P 2IMOA 5C82A 5H86A 1ZG9A 3CXPA 2Q4ZA 1Z9EA 1XOVA 1VIXA 4QVTA 2PJCA 1BO4A 8CPAA 4MCSA 4B6ZA 1OZPA 1VHSA 5J1QA 2FVGA 3T90A 4C8CA 2FS5A 3D7DA 4YGOA 2Z3MA 3LODA 3CXQA 2DEAA 1MJAA 3V8IA 5BWAB 2XEIA 4UF4A 1Q2CA 1IOFA 1YVOA 2DLAA 2B3UA 2PJ5A 2PQ8A 3S9MA 2ZOFA 3VGOA 2VI7A 4NSQA 3WC7A 2YNEA 4OMEA 3R1KA 4KVME 3TLBA 2REEA 4U9YA 5LRKA 2CY2A 1CG2A 1XEBA 1J4JA 3D7HA 4JXQA 3ZZIA 3FMCA 4GXHA 3SI1A 2YJTA 2V8GA 4NGSA 2ANPA 3EY5A 2F7VA 5HMNA 2YNDA 4R8FA 1R3NA 3HPGG 1MJ9A 2GLFA 5K99A 1YSJA 5K8NA 3TLCA 4GPLB 2R8VA 3IFEA 4HKFA 4OP4A 5KTDA 2GLJA 2Q4VA 2HROA 4G1PA 4BMHA 4C9UA 4AG7A 2XEJA 1DIKA 3VRRA 4HNXB 2J8RA 3PP9A 2R82A 3G8WA 4JZ0A 1K4JA 4NGTA 1QSTA 2HUZA 4UEFA 3KKWA 4IAVA 5A27A 1B6BA 2EUIA 1OBRA 3OWCA 4GS4A 3S6GA 3B8GA 3D66A 3PB8X 3FRMA 4M3SA 3V7ZA 4ZI6A 3EIFA 3VATA 2QJ8A 7CPAA 4KOUA 2X7BA 3I1UA 4AG9A 1Q2DA 3FX6A 1LOKA 4LUAA 3V38A 4NGPA 1CX8A 1YLEA 2BOAA 2XPPA 1HEEA 5LYLA 3GYAA 4CZ1A 4A33A 2PSWA 3PB9X 1ARLA 4PQAA 5LYIA 4WJBA 2PRQA 2FL4A 5I0CA 2BUEA 2IQ6A 1TKFA 4CDKA 2VKZG 4I49A 4RUHA 4OIDA 1BLLE 2HQYA 1U6MA 4PXCA 4R76A 5JM6A 1V6CA 2Z3PA 2ZOGA 5AXIA 2PIZA 3TLYA 4M6IA 4COGA 1F2PA 3D8PA 3RAMA 4B14A 2K5TA 3NFZA 4UEEA 1Z8XA 1CE8B 3I6SA 3FNCA 2YNCA 1NSAA 1Z8TA 4ONWA 5AG4A 2CF4A 2RFHA 2AFZA 1PUAA 4P4FA 2ZEEA 3I3GA 2AUNA 5IB0A 1C3OB 3F9KC 4C9AA 4INJA 2UV8G 3LD2A 4IK2A 4C8AA 5JYBA 3FEDA 4CGMA 4EFDA 4F6AA 1HDUA 3S9LA 1ON0A 4IF5A 3R9GA 1FY7A 2PJ8A 3TT2A 2D0OA 3BUWB 4C86A 2PJ3A 3NE7A 1AYEA 2CXAA 4MRIA 3BUMB 2GIVA 1H8LA 5F9MA 1XJOA 1A9XB 2NMTA 3KHZA 4B5OA 4UCNA 4P4BA 3VRQA 1GGOA 4UWIA 1MK4A 4B5PB 3RBUA 4UA3A 1Z2LA 3IWEA 4C8PA 4F9VA 5HH1A 4XPLA 3F5BA 1P0HA 4BTFA 4A31A 4QUSA 1B87A 1S5KA 4C68A 3PBBA 1M1DA 3B35A 3CPXA 5IV0A 2Q0YA 5EMIA 4A32A 4MFQA 4II9A 3IWWA 4LX9A 4MHDA 1FBVA 2OZHA 3TTHA 2J8MA 3SXOA 1CP6A 4NJRA 2EBJA 1AMPA 1NBWA 3BI1A 4X5KA 2JBJA 4FWUA 3H8FA 1VBGA 1F2OA 1BOBA 1QMUA 2Q7BA 2B4JC 4W9YA 1ELLP 2PR8A 4MFJA 5HKZA 4KLWA 1XF8A 4RI1A 4A2ZA 5E96A 4CYQA 3FB3A 2G0BA 3PBEA 4XPDC 5FVJA 3W91A 4P4JA 2V8VA 2B0AA 4NGQA 4P44A 4ZGYB 2P0WA 3KZWA 2P6GA 4B12A 3ICUA 3TO7A 1YQEA 1LRZA 2Q44A 3NE8A 5G1ZA 1VHOA 2OLSA 2Z10A 2KCWA 3IIBA 2C6GA 2XPLA 4FD7A 4TJVA 3TFYA 3WC5A 4AVBA 2EK8A 3BLNA 3BHXA 3PFVA 2PJ9A 2PVVA 2JDCA 5D29A 3TYXA 4OIWA 2VL1A 3JTKA 4YU9A 4DNCA 1KEEB 2IL4A 1TXRA 2FIAA 4YFJA 4JLYA 2DF5A 3PZJA 3S9NA 3FIXA 5G21A 2Z0ZA 3FXTA 2ZENA 4XNHB 2JDDA 4A38A 2AJ6A 1S7NA 4C84A 1YVHA 4ZBGA 3TOAA 1CS0B 3H4QA 4MBUA 4CGLA 4ZY1A 2PCNA 3D68A 5AG6A 1JDEA 1X10A 2REFA 3PB4X 4MFKA 2ZEOA 2FIWA 2B3VA 5LYDA 4B5PA 3D2MA 3HUVA 4JWPA 4HPSA 2DIKA 4C8TA 4XPKA 3KQXA 4U5YA 4COBA 1PCAA 1VGYA 5CPAA 5HKWA 1QSRA 3KHXA 5G22A 4YWYA 3GIUA 5LYFA 2GP4A 2ZPAA 3I9SA 4KS9A 4Y49B 3T5MA 2N3AB 3IC1A 4KOYA 5ISVA 1S3ZA 4FD4A 1ZLHA 3CZXA 5J8CA 1YREA 2CNTA 2EK9A 1EO0A 2JLMA 3IWGA 4RS2A 2B5GB 1VKCA 4CO9A 4OC2A 1Z9UA 3UY5A 1WWZA 3GJZA 3KR5A 1Z8LA 3NOJA 2GE3A 4HNWB 5KTAA 2MP0A 4M8DA 1Q7LA 1LAMA 1I12A 3CXSA 3PFEA 1HDQA 4BD9A 5F46A 1VI4A 3TLAA 4MHNA 1XFOA 4ZY0A 2ZW7A 5J8FA 1BXRB 5J3XA 3IJ3A 3SXNA 1BPMA 2J9AA 1KUXA 4FD5A 4GM5A 4KOTA 5A28A 3PB7X 3TLGB 4EYSA 1P4NA 2ZEHA 4PSWA 1YVKA 2B58A 5AG5A 3KASA 2C1CA 2J8NA 3ISXA 3TLEA 2WSAA 3KL9A 2AFMA 2BSWA 3K9UA 3BJ7A 2OB0A 1WJTA 2V8HA 4M6HA 1KUYA 2EO8A 4F0XA 4CAFA 2PCUA 3EZBA 5F1YA 1Y7EA 1M4LA 3D7FA 3VRPA 2PJ2A 4KSIA 4C9EA 4R7MA 3BJ8A 3VH9A 1LAPA 2VZYA 4Q38A 2ZEDA 2Y1MA 4PV6A 4C7HA 1ZG8A 4IIYA 1S7LA 2NYQA 2PVWA 2B4DB 1Z4EA 4JD6A 2ZW4A 3ZJ0A 4UBRA 4MFLA 1IY7A 1A2ZA 3WC6A 4P6YA 3PEIA 1DE4C 4Q7AA 4R6TA 3JUWA 4MFZA 2AUMA 4M85A 4TWEA 3GLJA 1TKHA 2FM4A 4CRZB 3B7IA 3EO4A 2YJVA 5F49A 4HNYB 3T8WA 1QSOA 1B47A 1CBXA 2O53A 4B11A
chains in the Genus database with same CATH topology
2XEFA 4P4IA 3N5FA 2XEGA 4MCRA 3K2KA 1XF1A 4C8FA 1VHEA 2ABZA 5THWA 3NA6A 3VARA 3SJFA 1Y9ZA 1LCPA 4P45A 3BI0A 4C85A 2C5QA 4K3NA 3FH4A 4KNGE 2PIYA 1IGBA 2C6CA 4JYWA 2WYRA 1DTDA 3WT4A 4C8UA 5JGFA 4X3RA 1YLOA 2BO9A 2NSMA 3KGQA 5D8NA 3B3WA 1CPSA 4NJQA 4X2TA 2AFOA 1LFWA 3H8EA 4X8IA 3SJXA 4NGMA 4OC5A 3JRUA 3B3CA 3FECA 1ZG7A 3IO1A 1GYTA 3L2NA 4A37A 2RB7A 3QNVA 1JQGA 4A94A 1ELMP 3CDXA 4OC4A 4DJLA 3HLPA 4C99A 4OC0A 2AFSA 4A39A 5CBMA 4UIBA 4EMEA 2QYVA 4F9UA 4NGRA 3GB0A 3FJUA 1Y0YA 3SJGA 1QQ9A 2CIJA 1LANA 1F57A 4YN3A 4O23A 4PPZA 2O4HA 4UIAA 2AFWA 3D7GA 2CTBA 3VTAA 3B3TA 4F8ZA 4C9RA 4H2KA 3B3VA 3RZAA 4Z65A 4MHZA 2ZEMA 3LWUA 4UEZA 1YW4A 1YMEA 4MHPA 3D67A 6CPAA 4TJXA 4EWTA 5DS0A 3FVLA 4P10A 3PFOA 1TF9A 3FEEA 1PYTB 3GUXA 3MRUA 4ZY2A 3WABA 2EWBA 4PXDA 3BXMA 3ISZA 2OR4A 2HC9A 2Q43A 5IB9A 2JEWA 4MCPA 1R43A 2I3CA 2G9DA 2HB6A 2JBKA 1CP7A 4C9VA 2V77A 1FNOA 4AXVA 1Z5RA 2WZNA 4MCQA 3SI2A 3KQZA 4DYOA 3DLJA 2BCOA 5I4MA 4IHMA 5ELYA 3CT9A 3TX8A 4OC1A 2IJZA 3DGVA 1KWMA 3NH4A 2PJBA 2F8HA 4MHYA 2ZEGA 3B2YA 3FF3A 4FBEA 1ZLIA 3NH8A 2C6PA 2GU2A 2PJAA 5HXDA 1TKJA 1WVMA 4FAIA 2GREA 3KI9A 1XRYA 3PB6X 1BAVA 1ARMA 1RTQA 2AFUA 3H8GA 1BPNA 5K8PA 5LRGA 5K8MA 2V8DA 4OC3A 3LMSA 3CPAA 4LQGA 1TF8A 5HVGA 1XBUA 5LRJA 1Y0RA 3TC8A 4NGNA 3NH5A 4TNUA 4CPAA 2ZEPA 2PE3A 2AFXA 2Q51A 2PJ7A 3B3SA 2POKA 3MN8A 1UWYA 5K8OA 2CTCA 3PRTA 2PJ0A 5HVHA 1CPXA 3D4UA 5HVFA 4FUUA 4MMOA 3K9TA 3I74A 4P4DA 4WWVA 2QVPA 1FT7A 3SJEA 4PXEA 5IR2A 2PJ4A 4PXBA 2ZELA 4NFRA 4DUKA 1XMBA 4ZX9A 2PJ1A 3KR4A 2ZEFA 4OKOA 2PJ6A 4ZX8A 4ZYQA 4CDJA 5F09A 1YW6A 3IEHA 4P4EA 3SI0A 2OOTA 5JH9A 1EE3P 2IMOA 1ZG9A 2Q4ZA 1VIXA 2PJCA 8CPAA 4MCSA 4B6ZA 4C8CA 5J1QA 2FVGA 3D7DA 2DEAA 2XEIA 4UF4A 2PJ5A 3S9MA 2ZOFA 3WC7A 4OMEA 5LRKA 1CG2A 3D7HA 3FMCA 3SI1A 2V8GA 4NGSA 2ANPA 2F7VA 4R8FA 1R3NA 2GLFA 1YSJA 5K8NA 4OP4A 3IFEA 2GLJA 4C9UA 4G1PA 2XEJA 4JZ0A 4NGTA 4TJVA 4UEFA 4IAVA 1OBRA 3D66A 3PB8X 3V7ZA 4ZI6A 3EIFA 3VATA 2QJ8A 7CPAA 3I1UA 3FX6A 1LOKA 3V38A 4NGPA 1CX8A 2BOAA 1HEEA 5LYLA 3PB9X 1ARLA 4PQAA 5LYIA 4WJBA 2PRQA 2IQ6A 1TKFA 4CDKA 4RUHA 4OIDA 1BLLE 4PXCA 4R76A 5JM6A 1V6CA 2ZOGA 2PIZA 1F2PA 3RAMA 4UEEA 3NFZA 3I6SA 4ONWA 1NSAA 2CF4A 2RFHA 2AFZA 2ZEEA 4P4FA 4C9AA 4IK2A 4C8AA 3FEDA 4EFDA 1HDUA 3S9LA 4C86A 2PJ8A 2PJ3A 1AYEA 4MRIA 1H8LA 1XJOA 3KHZA 4P4BA 3RBUA 1Z2LA 4C8PA 4F9VA 3PBBA 3B35A 3CPXA 3IWWA 1CP6A 4NJRA 1AMPA 3BI1A 2JBJA 4FWUA 3H8FA 1F2OA 1QMUA 4W9YA 1ELLP 3PBEA 4P4JA 2V8VA 4NGQA 4P44A 3KZWA 3ICUA 1VHOA 3IIBA 2C6GA 3WC5A 2EK8A 3BHXA 2PJ9A 2PVVA 5D29A 4OIWA 2VL1A 4YU9A 1TXRA 3S9NA 4A38A 2ZENA 4C84A 4ZY1A 3D68A 3PB4X 2ZEOA 5LYDA 3HUVA 4C8TA 3KQXA 1PCAA 1VGYA 5CPAA 3KHXA 4YWYA 5LYFA 2GP4A 3IC1A 1ZLHA 2EK9A 4OC2A 3KR5A 1Z8LA 1Q7LA 1LAMA 3PFEA 4BD9A 1HDQA 4MHNA 1XFOA 4ZY0A 3IJ3A 1BPMA 2J9AA 4GM5A 3PB7X 2ZEHA 3KASA 2C1CA 3ISXA 3KL9A 2AFMA 2V8HA 2PCUA 1Y7EA 1M4LA 3D7FA 2PJ2A 4KSIA 4C9EA 4R7MA 3VH9A 1LAPA 2ZEDA 1ZG8A 2NYQA 2PVWA 1IY7A 3WC6A 4P6YA 3PEIA 1DE4C 4Q7AA 4R6TA 4TWEA 3GLJA 1TKHA 3B7IA 3T8WA 4MXUA 1CBXA 2O53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEF A;  4P4I A;  3N5F A;  2XEG A;  4MCR A;  3K2K A;  1XF1 A;  4C8F A;  1VHE A;  2ABZ A;  5THW A;  3NA6 A;  3VAR A;  3SJF A;  1Y9Z A;  1LCP A;  4P45 A;  3BI0 A;  4C85 A;  4K3N A;  3FH4 A;  4KNG E;  2PIY A;  1IGB A;  2C6C A;  4JYW A;  2WYR A;  1DTD A;  3WT4 A;  4C8U A;  5JGF A;  4X3R A;  1YLO A;  2BO9 A;  2NSM A;  3KGQ A;  5D8N A;  3B3W A;  1CPS A;  4NJQ A;  4X2T A;  2AFO A;  1LFW A;  3H8E A;  4X8I A;  3SJX A;  4NGM A;  4OC5 A;  3JRU A;  3B3C A;  3FEC A;  1ZG7 A;  3IO1 A;  1GYT A;  3L2N A;  4A37 A;  2RB7 A;  3QNV A;  1JQG A;  4A94 A;  1ELM P;  3CDX A;  4OC4 A;  4DJL A;  3HLP A;  4C99 A;  4OC0 A;  2AFS A;  4A39 A;  5CBM A;  4UIB A;  4EME A;  2QYV A;  4F9U A;  4NGR A;  3GB0 A;  3FJU A;  1Y0Y A;  3SJG A;  1QQ9 A;  2CIJ A;  1LAN A;  1F57 A;  4YN3 A;  4O23 A;  4PPZ A;  2O4H A;  4UIA A;  2AFW A;  3D7G A;  2CTB A;  3VTA A;  3B3T A;  4F8Z A;  4C9R A;  4H2K A;  3B3V A;  3RZA A;  4Z65 A;  4MHZ A;  2ZEM A;  3LWU A;  4UEZ A;  1YW4 A;  1YME A;  4MHP A;  3D67 A;  6CPA A;  4TJX A;  4EWT A;  5DS0 A;  3FVL A;  4P10 A;  3PFO A;  1TF9 A;  3FEE A;  1PYT B;  3GUX A;  3MRU A;  4ZY2 A;  3WAB A;  2EWB A;  4PXD A;  3BXM A;  3ISZ A;  2OR4 A;  2HC9 A;  2Q43 A;  5IB9 A;  2JEW A;  4MCP A;  1R43 A;  2I3C A;  2G9D A;  2HB6 A;  2JBK A;  1CP7 A;  4C9V A;  2V77 A;  1FNO A;  4AXV A;  1Z5R A;  2WZN A;  4MCQ A;  3SI2 A;  3KQZ A;  4DYO A;  3DLJ A;  2BCO A;  5I4M A;  4IHM A;  5ELY A;  3CT9 A;  3TX8 A;  4OC1 A;  2IJZ A;  3DGV A;  1KWM A;  3NH4 A;  2PJB A;  2F8H A;  4MHY A;  2ZEG A;  3B2Y A;  3FF3 A;  4FBE A;  1ZLI A;  3NH8 A;  2C6P A;  2GU2 A;  2PJA A;  5HXD A;  1TKJ A;  1WVM A;  4FAI A;  2GRE A;  3KI9 A;  1XRY A;  3PB6 X;  1BAV A;  1ARM A;  1RTQ A;  2AFU A;  3H8G A;  1BPN A;  5K8P A;  5LRG A;  5K8M A;  2V8D A;  4OC3 A;  3LMS A;  3CPA A;  4LQG A;  1TF8 A;  5HVG A;  1XBU A;  5LRJ A;  1Y0R A;  3TC8 A;  4NGN A;  3NH5 A;  4TNU A;  4CPA A;  2ZEP A;  2PE3 A;  2AFX A;  2Q51 A;  2PJ7 A;  3B3S A;  2POK A;  3MN8 A;  1UWY A;  5K8O A;  2CTC A;  3PRT A;  2PJ0 A;  5HVH A;  1CPX A;  3D4U A;  5HVF A;  4FUU A;  4MMO A;  3K9T A;  3I74 A;  4P4D A;  4WWV A;  2QVP A;  1FT7 A;  3SJE A;  4PXE A;  2PJ4 A;  4PXB A;  2ZEL A;  4NFR A;  4DUK A;  1XMB A;  4ZX9 A;  2PJ1 A;  3KR4 A;  2ZEF A;  4OKO A;  2PJ6 A;  4ZX8 A;  4ZYQ A;  4CDJ A;  5F09 A;  1YW6 A;  3IEH A;  4P4E A;  3SI0 A;  2OOT A;  5JH9 A;  1EE3 P;  2IMO A;  1ZG9 A;  2Q4Z A;  1VIX A;  2PJC A;  8CPA A;  4MCS A;  4B6Z A;  4C8C A;  5J1Q A;  2FVG A;  3D7D A;  2DEA A;  2XEI A;  4UF4 A;  2PJ5 A;  3S9M A;  2ZOF A;  3WC7 A;  4OME A;  5LRK A;  1CG2 A;  3D7H A;  3FMC A;  3SI1 A;  2V8G A;  4NGS A;  2ANP A;  2F7V A;  4R8F A;  1R3N A;  2GLF A;  1YSJ A;  5K8N A;  4OP4 A;  3IFE A;  2GLJ A;  4C9U A;  4G1P A;  2XEJ A;  4JZ0 A;  4NGT A;  4TJV A;  4UEF A;  4IAV A;  1OBR A;  3D66 A;  3PB8 X;  3V7Z A;  4ZI6 A;  3EIF A;  3VAT A;  2QJ8 A;  7CPA A;  3I1U A;  3FX6 A;  1LOK A;  3V38 A;  4NGP A;  1CX8 A;  2BOA A;  1HEE A;  5LYL A;  3PB9 X;  1ARL A;  4PQA A;  5LYI A;  4WJB A;  2PRQ A;  2IQ6 A;  1TKF A;  4CDK A;  4RUH A;  4OID A;  1BLL E;  4PXC A;  4R76 A;  5JM6 A;  1V6C A;  2ZOG A;  2PIZ A;  1F2P A;  3RAM A;  4UEE A;  3NFZ A;  3I6S A;  4ONW A;  1NSA A;  2CF4 A;  2RFH A;  2AFZ A;  2ZEE A;  4P4F A;  4C9A A;  4IK2 A;  4C8A A;  3FED A;  4EFD A;  1HDU A;  3S9L A;  4C86 A;  2PJ8 A;  2PJ3 A;  1AYE A;  4MRI A;  1H8L A;  1XJO A;  3KHZ A;  4P4B A;  3RBU A;  1Z2L A;  4C8P A;  4F9V A;  3PBB A;  3B35 A;  3CPX A;  3IWW A;  1CP6 A;  4NJR A;  1AMP A;  3BI1 A;  2JBJ A;  4FWU A;  3H8F A;  1F2O A;  1QMU A;  4W9Y A;  1ELL P;  3PBE A;  4P4J A;  2V8V A;  4NGQ A;  4P44 A;  3KZW A;  3ICU A;  1VHO A;  3IIB A;  2C6G A;  3WC5 A;  2EK8 A;  3BHX A;  2PJ9 A;  2PVV A;  5D29 A;  4OIW A;  2VL1 A;  4YU9 A;  1TXR A;  3S9N A;  4A38 A;  2ZEN A;  4C84 A;  4ZY1 A;  3D68 A;  3PB4 X;  2ZEO A;  5LYD A;  3HUV A;  4C8T A;  3KQX A;  1PCA A;  1VGY A;  5CPA A;  3KHX A;  4YWY A;  5LYF A;  3IC1 A;  1ZLH A;  2EK9 A;  4OC2 A;  3KR5 A;  1Z8L A;  1Q7L A;  1LAM A;  3PFE A;  4BD9 A;  1HDQ A;  4MHN A;  1XFO A;  4ZY0 A;  3IJ3 A;  1BPM A;  2J9A A;  4GM5 A;  3PB7 X;  2ZEH A;  3KAS A;  2C1C A;  3ISX A;  3KL9 A;  2AFM A;  2V8H A;  2PCU A;  1Y7E A;  1M4L A;  3D7F A;  2PJ2 A;  4KSI A;  4C9E A;  4R7M A;  3VH9 A;  1LAP A;  2ZED A;  1ZG8 A;  2NYQ A;  2PVW A;  1IY7 A;  3WC6 A;  4P6Y A;  3PEI A;  1DE4 C;  4Q7A A;  4R6T A;  4TWE A;  3GLJ A;  1TKH A;  3B7I A;  3T8W A;  4MXU A;  1CBX A;  2O53 A; 
#chains in the Genus database with same CATH topology
 2XEF A;  4P4I A;  1IIC A;  2B4B A;  2GAN A;  2XEG A;  4MCR A;  3N5F A;  4R3L A;  4UCM A;  3BUX B;  3K2K A;  4KOW A;  1XF1 A;  4C8F A;  2B5G A;  1VHE A;  1S7K A;  1XE4 A;  2ABZ A;  4YRH A;  5THW A;  3NA6 A;  3DR8 A;  5CNP A;  4H6U A;  4LQ6 A;  3IGR A;  3VAR A;  3SJF A;  1Y9Z A;  4OAD A;  4CS0 B;  1LCP A;  1R61 A;  4P45 A;  3A9L A;  3BI0 A;  4PK2 A;  4C85 A;  3VWD A;  4KUA A;  4J3G A;  2I00 A;  3TLG A;  4BBH A;  3DSB A;  2C5Q A;  3T05 A;  4JVO A;  1C30 B;  4K3N A;  4UWJ A;  3GY9 A;  4ORF A;  3FH4 A;  1IU8 A;  4KNG E;  2PIY A;  1IGB A;  2EZC A;  3MGD A;  2C6C A;  4J0N A;  4JYW A;  2WYR A;  1DTD A;  5AG7 A;  1TIQ A;  5EC4 A;  3O8Z A;  4MY0 A;  3WT4 A;  2ZW6 A;  1SQH A;  4FD6 A;  4C8U A;  4ONU A;  5JGF A;  3R9E A;  4X3R A;  1YLO A;  2BO9 A;  2Z3K A;  3H5Z A;  2NSM A;  3KGQ A;  5D8N A;  3B3W A;  1CPS A;  1NE9 A;  2PR1 A;  4NJQ A;  4MFP A;  4L8A A;  4UFW A;  4X2T A;  4R57 A;  1YX0 A;  4MI1 A;  1EZB A;  2AFO A;  5C88 A;  1X12 A;  1LFW A;  3H8E A;  4X8I A;  4KOR A;  3SJX A;  4QC6 A;  4NGM A;  3P2F A;  2BEI A;  2QML A;  4NF1 A;  4NXY A;  2B4D A;  1IB1 E;  3RO0 A;  4H6Z A;  4KUB A;  4OC5 A;  1JDB C;  3JRU A;  4AB7 A;  3B3C A;  3FEC A;  4BPU B;  1ZG7 A;  2DPT A;  2QIR A;  2CNM A;  2RC4 A;  3IO1 A;  4C2X A;  2OU2 A;  2FCK A;  1GYT A;  3L2N A;  4A37 A;  4CGP A;  2O28 A;  3N7Z A;  3S6K A;  2RB7 A;  5JVL A;  2R1I A;  3QNV A;  1JQG A;  4A94 A;  3DNS A;  1ELM P;  3CDX A;  2EZA A;  4OC4 A;  3OAK A;  2Z11 A;  4L89 A;  1Y9W A;  4DJL A;  5BY0 A;  3HLP A;  3F0A A;  4C99 A;  2VZZ A;  1QSN A;  4OC0 A;  4MXU A;  1XIX A;  4CAV A;  4R87 A;  2X0S A;  2AFS A;  4A39 A;  4IUS A;  5CBM A;  4UIB A;  4XPD B;  2QYV A;  4C2Z A;  4EME A;  4F9U A;  3NFQ A;  3TLZ A;  4KOV A;  4F0Y A;  2JEV A;  2VBQ A;  1KC7 A;  4C2Y A;  3LAC A;  3S6F A;  4NGR A;  3GB0 A;  4KSF A;  3FJU A;  1Y0Y A;  3TOB A;  3SJG A;  1QQ9 A;  2R7H A;  1S60 A;  3QAY A;  2CIJ A;  1I21 A;  1F57 A;  1LAN A;  3RNZ A;  4BIN A;  4A95 A;  4YN3 A;  2ODF A;  4O23 A;  4PPZ A;  2O4H A;  3BUO B;  2XPO A;  2ATR A;  2Y0M A;  4UIA A;  3DR6 A;  2D4P A;  3C8O A;  2AFW A;  3D7G A;  2P6E A;  4E0A A;  5F13 A;  2CTB A;  3VTA A;  1M4D A;  3IU1 A;  3B3T A;  1VBH A;  4F8Z A;  1J3L A;  1WK4 A;  2PDO A;  3VWE A;  1S7F A;  4KLV A;  4C9R A;  4B10 A;  4H2K A;  2C27 A;  3B3V A;  3RZA A;  3TCV A;  4Z65 A;  4MHZ A;  1KZF A;  4C7I A;  2ZEM A;  3HMJ G;  3LWU A;  3F8K A;  4UEZ A;  1CM0 A;  3SHP A;  4CGO A;  4CAE A;  1YW4 A;  3TE4 A;  3G23 A;  2Z3L A;  1YME A;  2WPX A;  4MJ8 A;  4MHP A;  4CRY B;  4NCZ A;  3D67 A;  6CPA A;  4KOX A;  4EWT A;  4TJX A;  2D4O A;  2Q7S A;  5DS0 A;  3FVL A;  3R96 A;  4P10 A;  1IYK A;  3PFO A;  1TF9 A;  5G20 A;  3FEE A;  1Z8W A;  2ARH A;  2VQY A;  1PYT B;  3FBU A;  3GUX A;  3MRU A;  5KTC A;  4IIX A;  4ZY2 A;  3WAB A;  2EWB A;  4M6G A;  3W6X A;  3VRO A;  1IID A;  4PXD A;  3BXM A;  2E28 A;  1PU9 A;  4A4C A;  2OR4 A;  1YGH A;  2HC9 A;  3U88 C;  2I79 A;  2Q04 A;  3OB1 B;  3ISZ A;  2P6F A;  2Q43 A;  5DWN A;  1NMT A;  5IB9 A;  3ZNI A;  2JEW A;  5FD8 A;  3OB2 B;  4MCP A;  1R43 A;  2I3C A;  2G9D A;  1I1D A;  3E0K A;  3GKR A;  2HB6 A;  2JBK A;  1CP7 A;  4K30 A;  5JPH A;  4C9V A;  2V77 A;  1YK3 A;  1FNO A;  2AE6 A;  2CBL A;  1Z5R A;  2WZN A;  4AXV A;  5HKY A;  5AGE A;  4E5S A;  1IOI A;  4MCQ A;  2VEZ A;  1XMT A;  3SI2 A;  3KQZ A;  3TO6 A;  4DYO A;  3DLJ A;  2BCO A;  2OZG A;  4OAE A;  4R9M A;  4IHM A;  5I4M A;  5ELY A;  3CT9 A;  2PRB A;  4OC1 A;  1KUV A;  3TX8 A;  4EVY A;  4RR2 B;  2WPW A;  2WUU A;  4MY3 A;  4CAX A;  2FSR A;  4JJX A;  2DPS A;  3EC4 A;  3SR3 A;  1RXT A;  2IJZ A;  4B13 A;  3DGV A;  3T9Y A;  1KWM A;  3NH4 A;  1NSL A;  4CAW A;  1Y7R A;  2CNS A;  2PJB A;  2D0P A;  2F8H A;  4MI4 A;  4MHY A;  2ZEG A;  3B2Y A;  3FF3 A;  3HPH E;  4FBE A;  1ZLI A;  3NH8 A;  2C6P A;  3IU2 A;  2QEC A;  2GU2 A;  2PJA A;  4UCP A;  1M4I A;  1Q2Y A;  3JVN A;  5EBV A;  1TKJ A;  2PC1 A;  5HXD A;  1WVM A;  5JQ4 A;  3OP0 A;  1IYL A;  1ZYM A;  2DXQ A;  4PSX A;  4U9Z A;  2Z3N A;  1Q5X A;  1KBL A;  4KVO E;  4FAI A;  4CYN A;  2GRE A;  3KI9 A;  1XRY A;  2F5I A;  2G3A A;  3PB6 X;  1RTQ A;  1BAV A;  1ARM A;  1M44 A;  4QBJ A;  2AFU A;  3H8G A;  1Z4R A;  1BPN A;  1ZL0 A;  4KOS A;  5DWM A;  5LRG A;  5K8P A;  3EZE A;  3U1B A;  3BUN B;  5K8M A;  1Y9K A;  2V8D A;  3K4I A;  4E94 A;  4OC3 A;  4BPX B;  1GHE A;  3C26 A;  3LMS A;  3PT1 A;  2FE7 A;  4E2A A;  3KRV A;  1EZA A;  4LQG A;  1TF8 A;  2G3T A;  3CPA A;  3D2P A;  1XBU A;  5HVG A;  2A4N A;  5LRJ A;  1UFH A;  2GFQ A;  1Y0R A;  2Z3O A;  3PGP A;  3TC8 A;  2Y1N A;  1ZO0 A;  4NGN A;  3NH5 A;  4TNU A;  4CPA A;  2ZEP A;  2PE3 A;  2AFX A;  2Q51 A;  2ZXV A;  4PK3 A;  1N71 A;  2FXF A;  3P2H A;  1JWQ A;  2PJ7 A;  3B3S A;  2POK A;  3MN8 A;  1UWY A;  3T07 A;  2BL1 A;  5K8O A;  1RO5 A;  2CTC A;  3EXN A;  2PJ0 A;  3PRT A;  4R3K A;  2Q4Y A;  3PLF B;  3DDD A;  4CYP A;  1CPX A;  5HVH A;  1M4G A;  4KSA A;  3D4U A;  5HVF A;  4FUU A;  5IX3 A;  4MMO A;  1M6V B;  3K9T A;  2H5M A;  4Q36 A;  3I74 A;  2YGW A;  2ZW5 A;  5F47 A;  4P4D A;  2OH1 A;  4XNH C;  4WWV A;  3R95 A;  1YR0 A;  4OLL A;  2QVP A;  3R9F A;  1FT7 A;  4QB9 A;  2OZU A;  4KVX A;  3EFA A;  4JXR A;  3SJE A;  3FYN A;  2HWG A;  4KZT A;  5F48 A;  3W6S A;  4PXE A;  2R98 A;  5IR2 A;  2PJ4 A;  4MJX A;  3TO9 A;  3QAH A;  4E8O A;  1L0C A;  5GCN A;  4AVC A;  2EZB A;  4PXB A;  1CJW A;  1QSM A;  2ZEL A;  3G3S A;  2HV2 A;  4CYO A;  3D3S A;  1ZRS A;  1MJB A;  3QB8 A;  4RN7 A;  4CGN A;  1AUG A;  4NEX A;  4NFR A;  4DUK A;  1XMB A;  4UFX A;  1R57 A;  2PJ1 A;  4Y49 C;  4ZX9 A;  3S6H A;  2YNC C;  3KR4 A;  3T0T A;  4A4B A;  2ZEF A;  2PJ6 A;  1V0C A;  4OKO A;  4ZX8 A;  4AVA A;  4ZYQ A;  1T36 B;  1NXJ A;  2HI6 A;  3WR7 A;  4CDJ A;  5F09 A;  5F5X A;  1YW6 A;  5H84 A;  2XPN A;  4BPW B;  3IEH A;  3EZA A;  2FT0 A;  4UFV A;  2VXK A;  4P4E A;  3VRN A;  2EVN A;  3SI0 A;  2OOT A;  4A30 A;  4H1H A;  5JH9 A;  4H89 A;  3RYO A;  1EE3 P;  2IMO A;  5C82 A;  5H86 A;  1ZG9 A;  3CXP A;  2Q4Z A;  1Z9E A;  1XOV A;  1VIX A;  4QVT A;  2PJC A;  1BO4 A;  8CPA A;  4MCS A;  4B6Z A;  1OZP A;  1VHS A;  5J1Q A;  2FVG A;  3T90 A;  4C8C A;  2FS5 A;  3D7D A;  4YGO A;  2Z3M A;  3LOD A;  3CXQ A;  2DEA A;  1MJA A;  3V8I A;  5BWA B;  2XEI A;  4UF4 A;  1Q2C A;  1IOF A;  1YVO A;  2DLA A;  2B3U A;  2PJ5 A;  2PQ8 A;  3S9M A;  2ZOF A;  3VGO A;  2VI7 A;  4NSQ A;  3WC7 A;  2YNE A;  4OME A;  3R1K A;  4KVM E;  3TLB A;  2REE A;  4U9Y A;  5LRK A;  2CY2 A;  1CG2 A;  1XEB A;  1J4J A;  3D7H A;  4JXQ A;  3ZZI A;  3FMC A;  4GXH A;  3SI1 A;  2YJT A;  2V8G A;  4NGS A;  2ANP A;  3EY5 A;  2F7V A;  5HMN A;  2YND A;  4R8F A;  1R3N A;  3HPG G;  1MJ9 A;  2GLF A;  5K99 A;  1YSJ A;  5K8N A;  3TLC A;  4GPL B;  2R8V A;  3IFE A;  4HKF A;  4OP4 A;  5KTD A;  2GLJ A;  2Q4V A;  2HRO A;  4G1P A;  4BMH A;  4C9U A;  4AG7 A;  2XEJ A;  1DIK A;  3VRR A;  4HNX B;  2J8R A;  3PP9 A;  2R82 A;  3G8W A;  4JZ0 A;  1K4J A;  4NGT A;  1QST A;  2HUZ A;  4UEF A;  3KKW A;  4IAV A;  5A27 A;  1B6B A;  2EUI A;  1OBR A;  3OWC A;  4GS4 A;  3S6G A;  3B8G A;  3D66 A;  3PB8 X;  3FRM A;  4M3S A;  3V7Z A;  4ZI6 A;  3EIF A;  3VAT A;  2QJ8 A;  7CPA A;  4KOU A;  2X7B A;  3I1U A;  4AG9 A;  1Q2D A;  3FX6 A;  1LOK A;  4LUA A;  3V38 A;  4NGP A;  1CX8 A;  1YLE A;  2BOA A;  2XPP A;  1HEE A;  5LYL A;  3GYA A;  4CZ1 A;  4A33 A;  2PSW A;  3PB9 X;  1ARL A;  4PQA A;  5LYI A;  4WJB A;  2PRQ A;  2FL4 A;  5I0C A;  2BUE A;  2IQ6 A;  1TKF A;  4CDK A;  2VKZ G;  4I49 A;  4RUH A;  4OID A;  1BLL E;  2HQY A;  1U6M A;  4PXC A;  4R76 A;  5JM6 A;  1V6C A;  2Z3P A;  2ZOG A;  5AXI A;  2PIZ A;  3TLY A;  4M6I A;  4COG A;  1F2P A;  3D8P A;  3RAM A;  4B14 A;  2K5T A;  3NFZ A;  4UEE A;  1Z8X A;  1CE8 B;  3I6S A;  3FNC A;  2YNC A;  1NSA A;  1Z8T A;  4ONW A;  5AG4 A;  2CF4 A;  2RFH A;  2AFZ A;  1PUA A;  4P4F A;  2ZEE A;  3I3G A;  2AUN A;  5IB0 A;  1C3O B;  3F9K C;  4C9A A;  4INJ A;  2UV8 G;  3LD2 A;  4IK2 A;  4C8A A;  5JYB A;  3FED A;  4CGM A;  4EFD A;  4F6A A;  1HDU A;  3S9L A;  1ON0 A;  4IF5 A;  3R9G A;  1FY7 A;  2PJ8 A;  3TT2 A;  2D0O A;  3BUW B;  4C86 A;  2PJ3 A;  3NE7 A;  1AYE A;  2CXA A;  4MRI A;  3BUM B;  2GIV A;  1H8L A;  5F9M A;  1XJO A;  1A9X B;  2NMT A;  3KHZ A;  4B5O A;  4UCN A;  4P4B A;  3VRQ A;  1GGO A;  4UWI A;  1MK4 A;  4B5P B;  3RBU A;  4UA3 A;  1Z2L A;  3IWE A;  4C8P A;  4F9V A;  5HH1 A;  4XPL A;  3F5B A;  1P0H A;  4BTF A;  4A31 A;  4QUS A;  1B87 A;  1S5K A;  4C68 A;  3PBB A;  1M1D A;  3B35 A;  3CPX A;  5IV0 A;  2Q0Y A;  5EMI A;  4A32 A;  4MFQ A;  4II9 A;  3IWW A;  4LX9 A;  4MHD A;  1FBV A;  2OZH A;  3TTH A;  2J8M A;  3SXO A;  1CP6 A;  4NJR A;  2EBJ A;  1AMP A;  1NBW A;  3BI1 A;  4X5K A;  2JBJ A;  4FWU A;  3H8F A;  1VBG A;  1F2O A;  1BOB A;  1QMU A;  2Q7B A;  2B4J C;  4W9Y A;  1ELL P;  2PR8 A;  4MFJ A;  5HKZ A;  4KLW A;  1XF8 A;  4RI1 A;  4A2Z A;  5E96 A;  4CYQ A;  3FB3 A;  2G0B A;  3PBE A;  4XPD C;  5FVJ A;  3W91 A;  4P4J A;  2V8V A;  2B0A A;  4NGQ A;  4P44 A;  4ZGY B;  2P0W A;  3KZW A;  2P6G A;  4B12 A;  3ICU A;  3TO7 A;  1YQE A;  1LRZ A;  2Q44 A;  3NE8 A;  5G1Z A;  1VHO A;  2OLS A;  2Z10 A;  2KCW A;  3IIB A;  2C6G A;  2XPL A;  4FD7 A;  4TJV A;  3TFY A;  3WC5 A;  4AVB A;  2EK8 A;  3BLN A;  3BHX A;  3PFV A;  2PJ9 A;  2PVV A;  2JDC A;  5D29 A;  3TYX A;  4OIW A;  2VL1 A;  3JTK A;  4YU9 A;  4DNC A;  1KEE B;  2IL4 A;  1TXR A;  2FIA A;  4YFJ A;  4JLY A;  2DF5 A;  3PZJ A;  3S9N A;  3FIX A;  5G21 A;  2Z0Z A;  3FXT A;  2ZEN A;  4XNH B;  2JDD A;  4A38 A;  2AJ6 A;  1S7N A;  4C84 A;  1YVH A;  4ZBG A;  3TOA A;  1CS0 B;  3H4Q A;  4MBU A;  4CGL A;  4ZY1 A;  2PCN A;  3D68 A;  5AG6 A;  1JDE A;  1X10 A;  2REF A;  3PB4 X;  4MFK A;  2ZEO A;  2FIW A;  2B3V A;  5LYD A;  4B5P A;  3D2M A;  3HUV A;  4JWP A;  4HPS A;  2DIK A;  4C8T A;  4XPK A;  3KQX A;  4U5Y A;  4COB A;  1PCA A;  1VGY A;  5CPA A;  5HKW A;  1QSR A;  3KHX A;  5G22 A;  4YWY A;  3GIU A;  5LYF A;  2GP4 A;  2ZPA A;  3I9S A;  4KS9 A;  4Y49 B;  3T5M A;  2N3A B;  3IC1 A;  4KOY A;  5ISV A;  1S3Z A;  4FD4 A;  1ZLH A;  3CZX A;  5J8C A;  1YRE A;  2CNT A;  2EK9 A;  1EO0 A;  2JLM A;  3IWG A;  4RS2 A;  2B5G B;  1VKC A;  4CO9 A;  4OC2 A;  1Z9U A;  3UY5 A;  1WWZ A;  3GJZ A;  3KR5 A;  1Z8L A;  3NOJ A;  2GE3 A;  4HNW B;  5KTA A;  2MP0 A;  4M8D A;  1Q7L A;  1LAM A;  1I12 A;  3CXS A;  3PFE A;  1HDQ A;  4BD9 A;  5F46 A;  1VI4 A;  3TLA A;  4MHN A;  1XFO A;  4ZY0 A;  2ZW7 A;  5J8F A;  1BXR B;  5J3X A;  3IJ3 A;  3SXN A;  1BPM A;  2J9A A;  1KUX A;  4FD5 A;  4GM5 A;  4KOT A;  5A28 A;  3PB7 X;  3TLG B;  4EYS A;  1P4N A;  2ZEH A;  4PSW A;  1YVK A;  2B58 A;  5AG5 A;  3KAS A;  2C1C A;  2J8N A;  3ISX A;  3TLE A;  2WSA A;  3KL9 A;  2AFM A;  2BSW A;  3K9U A;  3BJ7 A;  2OB0 A;  1WJT A;  2V8H A;  4M6H A;  1KUY A;  2EO8 A;  4F0X A;  4CAF A;  2PCU A;  3EZB A;  5F1Y A;  1Y7E A;  1M4L A;  3D7F A;  3VRP A;  2PJ2 A;  4KSI A;  4C9E A;  4R7M A;  3BJ8 A;  3VH9 A;  1LAP A;  2VZY A;  4Q38 A;  2ZED A;  2Y1M A;  4PV6 A;  4C7H A;  1ZG8 A;  4IIY A;  1S7L A;  2NYQ A;  2PVW A;  2B4D B;  1Z4E A;  4JD6 A;  2ZW4 A;  3ZJ0 A;  4UBR A;  4MFL A;  1IY7 A;  1A2Z A;  3WC6 A;  4P6Y A;  3PEI A;  1DE4 C;  4Q7A A;  4R6T A;  3JUW A;  4MFZ A;  2AUM A;  4M85 A;  4TWE A;  3GLJ A;  1TKH A;  2FM4 A;  4CRZ B;  3B7I A;  3EO4 A;  2YJV A;  5F49 A;  4HNY B;  3T8W A;  1QSO A;  1B47 A;  1CBX A;  2O53 A;  4B11 A; 
#chains in the Genus database with same CATH homology
 2XEF A;  4P4I A;  3N5F A;  2XEG A;  4MCR A;  3K2K A;  1XF1 A;  4C8F A;  1VHE A;  2ABZ A;  5THW A;  3NA6 A;  3VAR A;  3SJF A;  1Y9Z A;  1LCP A;  4P45 A;  3BI0 A;  4C85 A;  2C5Q A;  4K3N A;  3FH4 A;  4KNG E;  2PIY A;  1IGB A;  2C6C A;  4JYW A;  2WYR A;  1DTD A;  3WT4 A;  4C8U A;  5JGF A;  4X3R A;  1YLO A;  2BO9 A;  2NSM A;  3KGQ A;  5D8N A;  3B3W A;  1CPS A;  4NJQ A;  4X2T A;  2AFO A;  1LFW A;  3H8E A;  4X8I A;  3SJX A;  4NGM A;  4OC5 A;  3JRU A;  3B3C A;  3FEC A;  1ZG7 A;  3IO1 A;  1GYT A;  3L2N A;  4A37 A;  2RB7 A;  3QNV A;  1JQG A;  4A94 A;  1ELM P;  3CDX A;  4OC4 A;  4DJL A;  3HLP A;  4C99 A;  4OC0 A;  2AFS A;  4A39 A;  5CBM A;  4UIB A;  4EME A;  2QYV A;  4F9U A;  4NGR A;  3GB0 A;  3FJU A;  1Y0Y A;  3SJG A;  1QQ9 A;  2CIJ A;  1LAN A;  1F57 A;  4YN3 A;  4O23 A;  4PPZ A;  2O4H A;  4UIA A;  2AFW A;  3D7G A;  2CTB A;  3VTA A;  3B3T A;  4F8Z A;  4C9R A;  4H2K A;  3B3V A;  3RZA A;  4Z65 A;  4MHZ A;  2ZEM A;  3LWU A;  4UEZ A;  1YW4 A;  1YME A;  4MHP A;  3D67 A;  6CPA A;  4TJX A;  4EWT A;  5DS0 A;  3FVL A;  4P10 A;  3PFO A;  1TF9 A;  3FEE A;  1PYT B;  3GUX A;  3MRU A;  4ZY2 A;  3WAB A;  2EWB A;  4PXD A;  3BXM A;  3ISZ A;  2OR4 A;  2HC9 A;  2Q43 A;  5IB9 A;  2JEW A;  4MCP A;  1R43 A;  2I3C A;  2G9D A;  2HB6 A;  2JBK A;  1CP7 A;  4C9V A;  2V77 A;  1FNO A;  4AXV A;  1Z5R A;  2WZN A;  4MCQ A;  3SI2 A;  3KQZ A;  4DYO A;  3DLJ A;  2BCO A;  5I4M A;  4IHM A;  5ELY A;  3CT9 A;  3TX8 A;  4OC1 A;  2IJZ A;  3DGV A;  1KWM A;  3NH4 A;  2PJB A;  2F8H A;  4MHY A;  2ZEG A;  3B2Y A;  3FF3 A;  4FBE A;  1ZLI A;  3NH8 A;  2C6P A;  2GU2 A;  2PJA A;  5HXD A;  1TKJ A;  1WVM A;  4FAI A;  2GRE A;  3KI9 A;  1XRY A;  3PB6 X;  1BAV A;  1ARM A;  1RTQ A;  2AFU A;  3H8G A;  1BPN A;  5K8P A;  5LRG A;  5K8M A;  2V8D A;  4OC3 A;  3LMS A;  3CPA A;  4LQG A;  1TF8 A;  5HVG A;  1XBU A;  5LRJ A;  1Y0R A;  3TC8 A;  4NGN A;  3NH5 A;  4TNU A;  4CPA A;  2ZEP A;  2PE3 A;  2AFX A;  2Q51 A;  2PJ7 A;  3B3S A;  2POK A;  3MN8 A;  1UWY A;  5K8O A;  2CTC A;  3PRT A;  2PJ0 A;  5HVH A;  1CPX A;  3D4U A;  5HVF A;  4FUU A;  4MMO A;  3K9T A;  3I74 A;  4P4D A;  4WWV A;  2QVP A;  1FT7 A;  3SJE A;  4PXE A;  5IR2 A;  2PJ4 A;  4PXB A;  2ZEL A;  4NFR A;  4DUK A;  1XMB A;  4ZX9 A;  2PJ1 A;  3KR4 A;  2ZEF A;  4OKO A;  2PJ6 A;  4ZX8 A;  4ZYQ A;  4CDJ A;  5F09 A;  1YW6 A;  3IEH A;  4P4E A;  3SI0 A;  2OOT A;  5JH9 A;  1EE3 P;  2IMO A;  1ZG9 A;  2Q4Z A;  1VIX A;  2PJC A;  8CPA A;  4MCS A;  4B6Z A;  4C8C A;  5J1Q A;  2FVG A;  3D7D A;  2DEA A;  2XEI A;  4UF4 A;  2PJ5 A;  3S9M A;  2ZOF A;  3WC7 A;  4OME A;  5LRK A;  1CG2 A;  3D7H A;  3FMC A;  3SI1 A;  2V8G A;  4NGS A;  2ANP A;  2F7V A;  4R8F A;  1R3N A;  2GLF A;  1YSJ A;  5K8N A;  4OP4 A;  3IFE A;  2GLJ A;  4C9U A;  4G1P A;  2XEJ A;  4JZ0 A;  4NGT A;  4TJV A;  4UEF A;  4IAV A;  1OBR A;  3D66 A;  3PB8 X;  3V7Z A;  4ZI6 A;  3EIF A;  3VAT A;  2QJ8 A;  7CPA A;  3I1U A;  3FX6 A;  1LOK A;  3V38 A;  4NGP A;  1CX8 A;  2BOA A;  1HEE A;  5LYL A;  3PB9 X;  1ARL A;  4PQA A;  5LYI A;  4WJB A;  2PRQ A;  2IQ6 A;  1TKF A;  4CDK A;  4RUH A;  4OID A;  1BLL E;  4PXC A;  4R76 A;  5JM6 A;  1V6C A;  2ZOG A;  2PIZ A;  1F2P A;  3RAM A;  4UEE A;  3NFZ A;  3I6S A;  4ONW A;  1NSA A;  2CF4 A;  2RFH A;  2AFZ A;  2ZEE A;  4P4F A;  4C9A A;  4IK2 A;  4C8A A;  3FED A;  4EFD A;  1HDU A;  3S9L A;  4C86 A;  2PJ8 A;  2PJ3 A;  1AYE A;  4MRI A;  1H8L A;  1XJO A;  3KHZ A;  4P4B A;  3RBU A;  1Z2L A;  4C8P A;  4F9V A;  3PBB A;  3B35 A;  3CPX A;  3IWW A;  1CP6 A;  4NJR A;  1AMP A;  3BI1 A;  2JBJ A;  4FWU A;  3H8F A;  1F2O A;  1QMU A;  4W9Y A;  1ELL P;  3PBE A;  4P4J A;  2V8V A;  4NGQ A;  4P44 A;  3KZW A;  3ICU A;  1VHO A;  3IIB A;  2C6G A;  3WC5 A;  2EK8 A;  3BHX A;  2PJ9 A;  2PVV A;  5D29 A;  4OIW A;  2VL1 A;  4YU9 A;  1TXR A;  3S9N A;  4A38 A;  2ZEN A;  4C84 A;  4ZY1 A;  3D68 A;  3PB4 X;  2ZEO A;  5LYD A;  3HUV A;  4C8T A;  3KQX A;  1PCA A;  1VGY A;  5CPA A;  3KHX A;  4YWY A;  5LYF A;  2GP4 A;  3IC1 A;  1ZLH A;  2EK9 A;  4OC2 A;  3KR5 A;  1Z8L A;  1Q7L A;  1LAM A;  3PFE A;  4BD9 A;  1HDQ A;  4MHN A;  1XFO A;  4ZY0 A;  3IJ3 A;  1BPM A;  2J9A A;  4GM5 A;  3PB7 X;  2ZEH A;  3KAS A;  2C1C A;  3ISX A;  3KL9 A;  2AFM A;  2V8H A;  2PCU A;  1Y7E A;  1M4L A;  3D7F A;  2PJ2 A;  4KSI A;  4C9E A;  4R7M A;  3VH9 A;  1LAP A;  2ZED A;  1ZG8 A;  2NYQ A;  2PVW A;  1IY7 A;  3WC6 A;  4P6Y A;  3PEI A;  1DE4 C;  4Q7A A;  4R6T A;  4TWE A;  3GLJ A;  1TKH A;  3B7I A;  3T8W A;  4MXU A;  1CBX A;  2O53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...