4OC1A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with coibzl, a urea-based inhibitor (2s)-2-[({(1s)-1-carboxy-2-[(2s)-oxiran-2-yl]ethyl}carbamoyl)amino]-6-[(4-iodobenzoyl)amino]hexanoic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc1A02
1CPSA 4KSIA 4MCRA 1XFOA 4P44A 1YSJA 3V7ZA 2AFMA 4ZX8A 4C9UA 1UWYA 3SJEA 1H8LA 4CDKA 3WC7A 3KZWA 2CIJA 5CPAA 1ELMP 1VHOA 2PJ2A 1CP7A 4C9EA 1CG2A 4C9RA 2V8DA 2VL1A 1DTDA 3CDXA 4ZI6A 5I4MA 3RAMA 3D7GA 1OBRA 2PE3A 5LYDA 3KI9A 3NA6A 2RB7A 1M4LA 5LRGA 2F7VA 3SJXA 3FVLA 2V77A 3PBEA 1QMUA 4X2TA 3GUXA 4G1PA 3VH9A 1LAMA 5HVHA 4NJRA 4OC1A 4OC5A 4C84A 3KR4A 2C6GA 1TKFA 4UEFA 1Y7EA 4A37A 4FWUA 3BHXA 3QNVA 2Q51A 4F9UA 4YWYA 1TKHA 4DUKA 1XMBA 3H8GA 2PJ5A 4UEEA 3WABA 2GU2A 4NJQA 4EMEA 4MCSA 2ANPA 2IQ6A 4IAVA 3BI0A 4UIAA 2O4HA 2ABZA 3H8EA 4Z65A 7CPAA 3NFZA 2PJCA 4FUUA 3PB8X 2ZENA 5LYLA 3D4UA 1HEEA 1LOKA 2ZOFA 3SI0A 2F8HA 4C9VA 5K8NA 2PJ9A 3PFOA 4BD9A 4PXCA 1ZG9A 4FBEA 2GLJA 2O53A 3SJGA 4YU9A 4P4DA 1F57A 1TF9A 4IK2A 2XEFA 3ICUA 3NH4A 2C6PA 1WVMA 5D8NA 1VGYA 2CF4A 4MXUA 2XEJA 4C99A 2NYQA 4PXBA 5K8PA 2AFZA 3ISZA 5LRJA 3NH8A 1CPXA 5K8OA 4PXEA 4OC3A 3SI1A 3DLJA 4ZY1A 1Z2LA 5THWA 1BLLE 2CTCA 4NGMA 4CPAA 2G9DA 3V38A 3S9NA 4LQGA 4R6TA 5ELYA 1GYTA 3KQZA 4R7MA 4CDJA 3B3WA 3PRTA 1QQ9A 4K3NA 2DEAA 3IWWA 4TJVA 3JRUA 4TJXA 4GM5A 1CP6A 1BAVA 1NSAA 1F2OA 5CBMA 1KWMA 1YLOA 2C1CA 3N5FA 3MN8A 3FECA 4MRIA 3IJ3A 3PB7X 2WZNA 4WWVA 4ZX9A 3KQXA 4OIDA 3FF3A 5HVFA 1XRYA 2PVWA 2PJ4A 1R43A 1CBXA 2JEWA 4X8IA 1Z5RA 3PFEA 3KL9A 3K2KA 1XBUA 3SI2A 2GREA 4OP4A 1TXRA 3L2NA 2QJ8A 3NH5A 3S9LA 4C8AA 2OR4A 2RFHA 2QVPA 3HLPA 5J1QA 4P6YA 3KASA 1EE3P 4O23A 4P4EA 3TX8A 3VATA 2OOTA 2JBKA 4A94A 5HXDA 4A39A 1Q7LA 4NFRA 2PJ0A 2Q43A 2ZEEA 1HDUA 2AFXA 8CPAA 2ZEFA 1Y0YA 4C8TA 4H2KA 5D29A 4F9VA 2WYRA 3K9TA 4TNUA 5DS0A 2V8GA 4IHMA 1AMPA 2PJ7A 3IIBA 1F2PA 3VTAA 2QYVA 4R8FA 4OC4A 2CTBA 4X3RA 3CT9A 4ONWA 3WC6A 4YN3A 3SJFA 3B3CA 4C85A 5LYIA 1CX8A 2BOAA 4B6ZA 2V8VA 1Y0RA 3FJUA 2XEIA 2J9AA 3EIFA 2BCOA 4MHPA 3CPXA 2JBJA 1BPNA 2PVVA 2AFWA 2PJ3A 3PB9X 3ISXA 2IJZA 4P4BA 1ELLP 4PQAA 2ZEOA 4C8UA 4ZY0A 4AXVA 4DYOA 3FMCA 2GLFA 1DE4C 2C6CA 4EWTA 1ARMA 3D7HA 4DJLA 4C9AA 4C8CA 4C8FA 3D67A 2AFSA 1LFWA 4NGNA 1ZLIA 1BPMA 3KHXA 1AYEA 2Q4ZA 3PBBA 3IO1A 1YMEA 3HUVA 3FEDA 4ZYQA 5JH9A 4OKOA 3FH4A 2AFOA 3IEHA 3T8WA 4TWEA 4MCQA 1FNOA 3KHZA 4MHYA 3I1UA 3LWUA 2PIYA 4UF4A 3CPAA 3PB6X 3TC8A 6CPAA 3H8FA 1PCAA 3FX6A 4A38A 3I6SA 4ZY2A 4UEZA 1Z8LA 1IGBA 3BXMA 3RZAA 4P4FA 1JQGA 3B35A 4P4IA 3KR5A 3PB4X 3B2YA 5JGFA 1LANA 3WC5A 3GB0A 1ZG8A 2ZEHA 1XF1A 4OC2A 2XEGA 2EK8A 3KGQA 4NGTA 2POKA 2PCUA 5HVGA 4NGQA 2IMOA 4C8PA 1ARLA 3D68A 4Q7AA 2ZEDA 1VIXA 2HB6A 4KNGE 1TF8A 3IC1A 4PXDA 5LYFA 1LCPA 1IY7A 2PRQA 4EFDA 1TKJA 2PJ1A 4OC0A 1XJOA 5LRKA 2PJBA 4PPZA 4P45A 4JZ0A 1ZG7A 3B3SA 2HC9A 3FEEA 1R3NA 4NGRA 2AFUA 4R76A 4OMEA 4UIBA 2PJ8A 4NGPA 1HDQA 1PYTB 1FT7A 4C86A 3PEIA 3LMSA 3MRUA 5IB9A 1Y9ZA 2I3CA 4W9YA 4OIWA 2EK9A 5JM6A 4JYWA 3D66A 2NSMA 2BO9A 4RUHA 4MHZA 3DGVA 4F8ZA 2ZEPA 5K8MA 3S9MA 3VARA 3B7IA 4P4JA 2PJ6A 1RTQA 1V6CA 2ZEMA 2ZOGA 4NGSA 4MCPA 2PJAA 1VHEA 3RBUA 1YW6A 1ZLHA 2V8HA 2ZEGA 4MMOA 2PIZA 3B3VA 3WT4A 3BI1A 4P10A 5F09A 4MHNA 2ZELA 1LAPA 4WJBA 3B3TA 3D7FA 3IFEA 3GLJA 3I74A 1YW4A 3D7DA 2FVGA 2EWBA 4FAIA
chains in the Genus database with same CATH superfamily
2Q7SA 3PLFB 1CPSA 3GKRA 2REFA 4KSIA 4NCZA 3VROA 4MCRA 1XFOA 4P44A 1YSJA 2VQYA 2AFMA 3V7ZA 4ZX8A 3BUOB 4JLYA 1UWYA 1CS0B 1ZYMA 1TIQA 1Y9WA 3T05A 4C9UA 1Z9UA 2ODFA 3BJ8A 3SJEA 4M6HA 1H8LA 2D4PA 1B6BA 3KZWA 3WC7A 2CIJA 5AXIA 3VRPA 5CPAA 1NXJA 2PCNA 1ELMP 1VHOA 2PJ2A 1CP7A 1A9XB 4C9EA 1CG2A 1YQEA 2B4BA 4C9RA 2V8DA 4C2YA 2VL1A 1DTDA 3CDXA 3JVNA 4ZI6A 3RAMA 2Z3MA 5I4MA 4COGA 4HNXB 3D7GA 1OBRA 2R82A 5HKZA 1QSMA 2PE3A 4XPDC 5LYDA 2R1IA 3ZZIA 4HNWB 3KI9A 4A4BA 4M8DA 3NA6A 3P2HA 2RB7A 1M4LA 1PUAA 5LRGA 2F7VA 4C2ZA 2F5IA 4ONUA 4H6UA 3T5MA 3SJXA 3C8OA 1VBGA 2N3AB 2B3UA 3FVLA 1I12A 2BEIA 2Z11A 4IIXA 2V77A 4CDKA 3PBEA 2OZHA 1QMUA 4E8OA 3TOAA 4X2TA 3GUXA 4G1PA 3VH9A 1IIDA 1LAMA 5HVHA 5KTCA 4NJRA 4OC1A 3TLEA 2GIVA 2WUUA 4KOYA 2YJTA 4OC5A 2Q4VA 3EO4A 5FVJA 3KR4A 4C84A 1ZO0A 1PU9A 2GP4A 1KZFA 2C6GA 4YGOA 1MJAA 3C26A 1TKFA 2GANA 4UEFA 2B5GA 4H89A 4B5PA 1S3ZA 4JVOA 1Y7EA 4A37A 1EZAA 2HWGA 4KZTA 1VHSA 1CM0A 4FWUA 4JJXA 3BHXA 3D3SA 3QNVA 2Q51A 4MFPA 1ON0A 1TKHA 2EVNA 4YWYA 1XMBA 4DUKA 3H8GA 4F9UA 2YNCA 1S60A 3LODA 4CGOA 2PJ5A 1BOBA 1IB1E 1QSRA 3IWEA 4KOXA 4UEEA 2Q4YA 3WABA 2CY2A 3K4IA 3S6GA 4QBJA 2Q7BA 2OU2A 3TLGA 2GU2A 1Z8XA 2XPPA 2OH1A 4NJQA 2FCKA 2AE6A 4EMEA 3TLAA 4MCSA 4CAWA 4UFXA 1Y9KA 1T36B 2D0PA 2ANPA 2HUZA 4FD4A 2CNMA 1YREA 2IQ6A 1UFHA 1Q5XA 4IAVA 3BI0A 4UIAA 2EZAA 4KOSA 4MFZA 2O4HA 3OB2B 2ABZA 3H8EA 3SXNA 4Z65A 4F0YA 5C88A 7CPAA 4RR2B 2J8NA 4J3GA 4E5SA 2J8RA 2PRBA 3NFZA 2PSWA 4COBA 2PJCA 4FUUA 3VWDA 3EZAA 4BBHA 4OAEA 3PB8X 2PC1A 2ZENA 5LYLA 4QC6A 4HPSA 4R9MA 3D4UA 1HEEA 5G20A 4II9A 5BY0A 1LOKA 2ZOFA 3SI0A 3TE4A 3R9EA 4A33A 4PK3A 2F8HA 2G3AA 4C9VA 1GHEA 5K8NA 4KSAA 2PJ9A 1QSNA 2ARHA 2BSWA 3PFVA 3PFOA 3KRVA 2FIAA 1C3OB 5A28A 3BUWB 5H84A 4XNHB 4BD9A 4CGMA 3R95A 5J8FA 4PXCA 2AUNA 1ZG9A 4FBEA 2GLJA 2O53A 2EO8A 1KC7A 3SJGA 1QSTA 4CZ1A 4YU9A 3S6HA 4P4DA 1F57A 1TF9A 3FNCA 3H5ZA 4IK2A 2XEFA 4A30A 3ICUA 3NH4A 2B5GB 3GYAA 1MJBA 2C6PA 1CE8B 4B5PB 2Z3NA 1U6MA 4UCMA 1RXTA 1WVMA 5D8NA 4E94A 1VGYA 1YK3A 2CF4A 2KCWA 4MXUA 4PSWA 3CXSA 1I1DA 2XEJA 2DXQA 4C99A 3JUWA 4NF1A 4CYPA 2NYQA 4ZBGA 4EYSA 4PXBA 5K8PA 2AFZA 2PQ8A 2DLAA 3ISZA 4LX9A 5LRJA 3VRNA 3NH8A 3TLGB 1CPXA 1FBVA 2Z0ZA 3WR7A 5K8OA 3IWGA 4PXEA 1ZRSA 3BJ7A 2J8MA 3R9GA 5BWAB 4OC3A 3T9YA 3SI1A 3TYXA 1KUYA 5E96A 3DLJA 4ZY1A 1Z2LA 5THWA 1BLLE 3IU2A 5IV0A 2CTCA 4NGMA 1NE9A 2G9DA 2FXFA 3CXQA 3S9NA 3TCVA 3V38A 4CPAA 4LQGA 2B58A 5IR2A 4R6TA 5ELYA 2FIWA 3A9LA 1GYTA 2FL4A 1S7KA 3D2PA 4CAFA 5K99A 1XMTA 3DNSA 3KQZA 4R7MA 2PR8A 2CNSA 3G8WA 4B5OA 4CDJA 4GPLB 2A4NA 3B3WA 3PRTA 2R8VA 1S7NA 1QQ9A 4K3NA 2DEAA 2MP0A 3IWWA 4JXRA 4TJVA 3JRUA 5J3XA 4QUSA 4TJXA 4GM5A 1CP6A 1VI4A 4NSQA 4M85A 2NMTA 2Y1NA 4PSXA 4J0NA 3ZNIA 3W6SA 1BAVA 1NSAA 4A95A 4CGNA 3G23A 1JDBC 1F2OA 4HKFA 3TT2A 4CGPA 5CBMA 4BPWB 3EXNA 1JWQA 4LUAA 5AGEA 2JDDA 3EZEA 1KWMA 4MI1A 1YLOA 2C1CA 3QAYA 3N5FA 3MN8A 3FECA 1Q2DA 3IJ3A 3PB7X 1XEBA 2OZGA 2WZNA 4KOTA 3LD2A 4MRIA 1MK4A 2Y1MA 2JEVA 4WWVA 2VZYA 4ZX9A 3KQXA 2Z3LA 4OIDA 3FF3A 2ZPAA 4C68A 5HVFA 4C8TA 4LQ6A 1XRYA 4AVCA 2PVWA 2PJ4A 1R43A 1CBXA 2JEWA 4X8IA 3TOBA 4NXYA 4XPKA 4KSFA 1Z5RA 3PFEA 4X5KA 3KL9A 3K2KA 4R3KA 5A27A 1XBUA 3VRQA 2D0OA 4KORA 2FT0A 3SI2A 1X10A 2GREA 4OP4A 1IICA 1TXRA 3L2NA 3RO0A 2VXKA 5IX3A 5KTAA 3BUXB 2QJ8A 2DIKA 3NH5A 3S9LA 1L0CA 3LACA 5IB0A 2OR4A 2RFHA 3I3GA 2QVPA 4C8AA 3HLPA 2Q04A 1KUXA 4E2AA 5J1QA 4P6YA 3KASA 1EE3P 4BPXB 4O23A 4P4EA 1RO5A 3TX8A 3VATA 4B10A 2OOTA 1R57A 5FD8A 2JBKA 2VKZG 2GFQA 4A94A 5HXDA 3BLNA 2E28A 1M4IA 4A39A 1M1DA 2AUMA 3OB1B 1Q7LA 3DR8A 3EY5A 4MHDA 4NFRA 5AG6A 5EMIA 1LRZA 2PJ0A 4IUSA 2Q43A 2Z3KA 2ZEEA 5C82A 1HDUA 4CRZB 5F46A 5HH1A 1KUVA 2AFXA 4MFJA 4B14A 2QIRA 1GGOA 8CPAA 3D2MA 4DNCA 1J4JA 2ZEFA 1VBHA 3BUMB 4BMHA 1WJTA 2QMLA 1Y0YA 3TLYA 5F13A 1X12A 1I21A 4R57A 4UWJA 4YFJA 1XF8A 4H2KA 5D29A 5G21A 3CZXA 3W91A 4F9VA 2WYRA 4RS2A 3K9TA 1XOVA 3RNZA 2Q44A 4A31A 2GE3A 4H1HA 4TNUA 5DS0A 4Y49B 2V8GA 4IHMA 4KOUA 1AMPA 4MI4A 2FE7A 1N71A 2PJ7A 3IIBA 1F2PA 4AG9A 3VTAA 5ISVA 3HPHE 2ATRA 5HKYA 3NOJA 2QYVA 3HMJG 3OWCA 4R8FA 4OC4A 2CTBA 4X3RA 3CT9A 4ONWA 3WC6A 4YN3A 3SJFA 3B3CA 2C5QA 3CXPA 3SR3A 4C85A 5HMNA 2FSRA 4CAEA 5LYIA 5JPHA 1CX8A 1YLEA 2BOAA 4Q36A 3QAHA 4ORFA 4B6ZA 4CRYB 1Z4RA 3TFYA 2YNDA 1YGHA 2V8VA 3VWEA 1Y0RA 2ZW7A 3FJUA 2XEIA 3HPGG 4GS4A 2J9AA 4YRHA 3TLCA 1M44A 1Z4EA 3DSBA 3EIFA 2HQYA 2BCOA 4MHPA 3CPXA 4MY0A 5I0CA 4IIYA 2JBJA 1BPNA 2PVVA 2AFWA 2PJ3A 3PP9A 4B11A 5KTDA 2EUIA 3PB9X 4GXHA 4E0AA 4AVBA 2R98A 1SQHA 3ISXA 2IJZA 4K30A 1B47A 4P4BA 1ELLP 4PQAA 5JYBA 1M4GA 2ZEOA 4BPUB 4C8UA 4ZY0A 4AXVA 2Z3PA 2DPTA 3GIUA 3FMCA 4DYOA 3RYOA 1C30B 2GLFA 1DE4C 2BL1A 4XNHC 2C6CA 2G0BA 3S6FA 3T90A 4FD6A 4MJ8A 2P6FA 2EZBA 5JQ4A 4EWTA 1ARMA 1Z8TA 2G3TA 3D7HA 2O28A 2R7HA 4KVOE 2ZW5A 1V0CA 4DJLA 1M4DA 4Q38A 4C2XA 4C9AA 4C8CA 1WWZA 4C8FA 3D67A 2AFSA 1LFWA 1P0HA 3IGRA 4NGNA 4MFKA 3SHPA 4C7HA 1ZLIA 1BPMA 3KHXA 1AYEA 4FD5A 4UWIA 4OLLA 4F0XA 1FY7A 2Q4ZA 3PBBA 4U9YA 2YNCC 5EBVA 3IO1A 1YMEA 4B12A 4MJXA 3HUVA 3FEDA 4ZYQA 5AG7A 3O8ZA 5JH9A 1YVHA 4OKOA 3FH4A 4L89A 2AFOA 3TLBA 2WPXA 2DF5A 3IEHA 4MY3A 4TWEA 3T8WA 2I79A 4XPDB 4MCQA 3DDDA 3FRMA 3W6XA 1FNOA 3KHZA 3VGOA 4MHYA 2EZCA 2YGWA 4NEXA 4KVXA 3IU1A 4MFLA 3G3SA 4KOVA 4M6IA 1S5KA 3I1UA 4RI1A 3LWUA 1EO0A 2PIYA 4UF4A 3QB8A 2DPSA 3K9UA 1IU8A 2X0SA 3V8IA 3CPAA 3PB6X 3NFQA 4UA3A 4UBRA 3TC8A 6CPAA 1DIKA 4U5YA 3H8FA 4KS9A 2CXAA 2EBJA 1PCAA 3PGPA 1IYKA 2YNEA 3FX6A 4KUBA 4A38A 3FIXA 2OB0A 4PK2A 1ZL0A 3I6SA 4ZGYB 5J8CA 4CYQA 4ZY2A 3F8KA 2Y0MA 1Q2YA 4UEZA 3PT1A 1Z8LA 2JDCA 4C7IA 4IF5A 1IGBA 3BXMA 1YX0A 3RZAA 3EC4A 4P4FA 2B4JC 3GY9A 3GJZA 2D4OA 3JTKA 3DR6A 1JQGA 3B35A 4RN7A 1NSLA 4P4IA 1BO4A 3KR5A 3B2YA 3PB4X 5GCNA 5JGFA 1J3LA 5F9MA 1LANA 4FD7A 3WC5A 5F1YA 3GB0A 1ZG8A 2ZEHA 3FXTA 1XF1A 4OC2A 2XEGA 1YVKA 2EK8A 2HI6A 3KGQA 2B3VA 4MBUA 4NGTA 3I9SA 4HNYB 1S7FA 2POKA 2PCUA 2B4DA 4MFQA 1YR0A 5HVGA 2PR1A 1IOFA 1XE4A 2PDOA 3R96A 2AJ6A 3TO7A 2FM4A 2Q0YA 4NGQA 2IMOA 3TO9A 1ARLA 4C8PA 1IOIA 3D68A 1KEEB 4Q7AA 2ZEDA 2K5TA 3TO6A 1VIXA 4M6GA 2HB6A 4KNGE 2JLMA 4A2ZA 4KOWA 2ZW6A 2P0WA 1TF8A 2ZXVA 1Z9EA 2XPOA 3T0TA 2H5MA 3IC1A 4JWPA 4H6ZA 4PV6A 1VKCA 4PXDA 5LYFA 1LCPA 4UFVA 1Q2CA 1IY7A 3P2FA 2PRQA 4JD6A 4XPLA 5F47A 4EFDA 1TKJA 2BUEA 3FB3A 3E0KA 2PJ1A 4I49A 1AUGA 2P6EA 2I00A 5F48A 2Z10A 4KLWA 2XPLA 4B13A 4OC0A 4KLVA 4CO9A 1XJOA 5LRKA 1Z8WA 4UCPA 2PJBA 4AB7A 4PPZA 3N7ZA 2C27A 4P45A 5F5XA 4R3LA 4JZ0A 1WK4A 1ZG7A 4R87A 3U1BA 3U88C 3B3SA 2YJVA 2P6GA 3TLZA 2HC9A 5AG5A 4BTFA 3R1KA 1Y7RA 2HROA 3T07A 1OZPA 3SXOA 3VRRA 1P4NA 4AG7A 3FEEA 1R3NA 4NGRA 2AFUA 3ZJ0A 4EVYA 4R76A 4OMEA 2FS5A 4UIBA 2PJ8A 4QB9A 3NE7A 2HV2A 1MJ9A 4NGPA 1HDQA 3B8GA 3KKWA 5EC4A 3S6KA 1QSOA 1K4JA 1FT7A 1PYTB 4CYOA 4KUAA 1NBWA 2X7BA 3FBUA 3EFAA 4U9ZA 4UFWA 5DWNA 3PZJA 1BXRB 4C86A 1YVOA 3PEIA 4OADA 3LMSA 3MRUA 1CJWA 5IB9A 1EZBA 3OAKA 4CAVA 1Y9ZA 2I3CA 4W9YA 4Y49C 5G1ZA 3NE8A 4OIWA 1A2ZA 1B87A 1S7LA 1JDEA 3TTHA 2EK9A 4BINA 5JM6A 4JYWA 4INJA 3F9KC 2NSMA 3D66A 2BO9A 4JXQA 3EZBA 3MGDA 4A32A 4RUHA 4L8AA 2QECA 2B4DB 3BUNB 4MHZA 2OLSA 3DGVA 3F0AA 4F8ZA 2RC4A 2ZEPA 4CAXA 5K8MA 3S9MA 2VZZA 5H86A 1KBLA 5DWMA 3VARA 2WPWA 5HKWA 2REEA 2Z3OA 3B7IA 4P4JA 2PJ6A 4UCNA 5JVLA 1RTQA 1V6CA 2WSAA 4F6AA 2ZEMA 2UV8G 2ZOGA 4NGSA 4MCPA 2CNTA 2PJAA 2ZW4A 1VHEA 5F49A 4CGLA 5AG4A 3RBUA 3F5BA 1NMTA 1YW6A 1ZLHA 3OP0A 2V8HA 3FYNA 4M3SA 2ZEGA 4MMOA 2PIZA 3B3VA 3R9FA 1IYLA 3WT4A 2XPNA 3BI1A 4P10A 5F09A 3H4QA 1M6VB 4A4CA 4MHNA 2ZELA 1LAPA 4QVTA 4WJBA 5G22A 3UY5A 1XIXA 5CNPA 3B3TA 4CYNA 2OZUA 3D7FA 4CS0B 1R61A 3IFEA 2VEZA 4KVME 3GLJA 3I74A 1YW4A 2B0AA 3D7DA 2FVGA 2VBQA 4AVAA 2VI7A 2EWBA 3D8PA 2IL4A 4FAIA 2CBLA
chains in the Genus database with same CATH topology
1CPSA 4KSIA 4MCRA 1XFOA 4P44A 1YSJA 3V7ZA 2AFMA 4ZX8A 4C9UA 1UWYA 3SJEA 1H8LA 4CDKA 3WC7A 3KZWA 2CIJA 5CPAA 1ELMP 1VHOA 2PJ2A 1CP7A 4C9EA 1CG2A 4C9RA 2V8DA 2VL1A 1DTDA 3CDXA 4ZI6A 5I4MA 3RAMA 3D7GA 1OBRA 2PE3A 5LYDA 3KI9A 3NA6A 2RB7A 1M4LA 5LRGA 2F7VA 3SJXA 3FVLA 2V77A 3PBEA 1QMUA 4X2TA 3GUXA 4G1PA 3VH9A 1LAMA 5HVHA 4NJRA 4OC1A 4OC5A 4C84A 3KR4A 2GP4A 2C6GA 1TKFA 4UEFA 1Y7EA 4A37A 4FWUA 3BHXA 3QNVA 2Q51A 4F9UA 4YWYA 1TKHA 4DUKA 1XMBA 3H8GA 2PJ5A 4UEEA 3WABA 2GU2A 4NJQA 4EMEA 4MCSA 2ANPA 2IQ6A 4IAVA 3BI0A 4UIAA 2O4HA 2ABZA 3H8EA 4Z65A 7CPAA 3NFZA 2PJCA 4FUUA 3PB8X 2ZENA 5LYLA 3D4UA 1HEEA 1LOKA 2ZOFA 3SI0A 2F8HA 4C9VA 5K8NA 2PJ9A 3PFOA 4BD9A 4PXCA 1ZG9A 4FBEA 2GLJA 2O53A 3SJGA 4YU9A 4P4DA 1F57A 1TF9A 4IK2A 2XEFA 3ICUA 3NH4A 2C6PA 1WVMA 5D8NA 1VGYA 2CF4A 4MXUA 2XEJA 4C99A 2NYQA 4PXBA 5K8PA 2AFZA 3ISZA 5LRJA 3NH8A 1CPXA 5K8OA 4PXEA 4OC3A 3SI1A 3DLJA 4ZY1A 1Z2LA 5THWA 1BLLE 2CTCA 4NGMA 4CPAA 2G9DA 5IR2A 3V38A 3S9NA 4LQGA 4R6TA 5ELYA 1GYTA 3KQZA 4R7MA 4CDJA 3B3WA 3PRTA 1QQ9A 4K3NA 2DEAA 3IWWA 4TJVA 3JRUA 4TJXA 4GM5A 1CP6A 1BAVA 1NSAA 1F2OA 5CBMA 1KWMA 1YLOA 2C1CA 3N5FA 3MN8A 3FECA 4MRIA 3IJ3A 3PB7X 2WZNA 4WWVA 4ZX9A 3KQXA 4OIDA 3FF3A 5HVFA 1XRYA 2PVWA 2PJ4A 1R43A 1CBXA 2JEWA 4X8IA 1Z5RA 3PFEA 3KL9A 3K2KA 1XBUA 3SI2A 2GREA 4OP4A 1TXRA 3L2NA 2QJ8A 3NH5A 3S9LA 4C8AA 2OR4A 2RFHA 2QVPA 3HLPA 5J1QA 4P6YA 3KASA 1EE3P 4O23A 4P4EA 3TX8A 3VATA 2OOTA 2JBKA 4A94A 5HXDA 4A39A 1Q7LA 4NFRA 2PJ0A 2Q43A 2ZEEA 1HDUA 2AFXA 8CPAA 2ZEFA 1Y0YA 4C8TA 4H2KA 5D29A 4F9VA 2WYRA 3K9TA 4TNUA 5DS0A 2V8GA 4IHMA 1AMPA 2PJ7A 3IIBA 1F2PA 3VTAA 2QYVA 4R8FA 4OC4A 2CTBA 4X3RA 3CT9A 4ONWA 3WC6A 4YN3A 3SJFA 3B3CA 2C5QA 4C85A 5LYIA 1CX8A 2BOAA 4B6ZA 2V8VA 1Y0RA 3FJUA 2XEIA 2J9AA 3EIFA 2BCOA 4MHPA 3CPXA 2JBJA 1BPNA 2PVVA 2AFWA 2PJ3A 3PB9X 3ISXA 2IJZA 4P4BA 1ELLP 4PQAA 2ZEOA 4C8UA 4ZY0A 4AXVA 4DYOA 3FMCA 2GLFA 1DE4C 2C6CA 4EWTA 1ARMA 3D7HA 4DJLA 4C9AA 4C8CA 4C8FA 3D67A 2AFSA 1LFWA 4NGNA 1ZLIA 1BPMA 3KHXA 1AYEA 2Q4ZA 3PBBA 3IO1A 1YMEA 3HUVA 3FEDA 4ZYQA 5JH9A 4OKOA 3FH4A 2AFOA 3IEHA 3T8WA 4TWEA 4MCQA 1FNOA 3KHZA 4MHYA 3I1UA 3LWUA 2PIYA 4UF4A 3CPAA 3PB6X 3TC8A 6CPAA 3H8FA 1PCAA 3FX6A 4A38A 3I6SA 4ZY2A 4UEZA 1Z8LA 1IGBA 3BXMA 3RZAA 4P4FA 1JQGA 3B35A 4P4IA 3KR5A 3PB4X 3B2YA 5JGFA 1LANA 3WC5A 3GB0A 1ZG8A 2ZEHA 1XF1A 4OC2A 2XEGA 2EK8A 3KGQA 4NGTA 2POKA 2PCUA 5HVGA 4NGQA 2IMOA 4C8PA 1ARLA 3D68A 4Q7AA 2ZEDA 1VIXA 2HB6A 4KNGE 1TF8A 3IC1A 4PXDA 5LYFA 1LCPA 1IY7A 2PRQA 4EFDA 1TKJA 2PJ1A 4OC0A 1XJOA 5LRKA 2PJBA 4PPZA 4P45A 4JZ0A 1ZG7A 3B3SA 2HC9A 3FEEA 1R3NA 4NGRA 2AFUA 4R76A 4OMEA 4UIBA 2PJ8A 4NGPA 1HDQA 1PYTB 1FT7A 4C86A 3PEIA 3LMSA 3MRUA 5IB9A 1Y9ZA 2I3CA 4W9YA 4OIWA 2EK9A 5JM6A 4JYWA 3D66A 2NSMA 2BO9A 4RUHA 4MHZA 3DGVA 4F8ZA 2ZEPA 5K8MA 3S9MA 3VARA 3B7IA 4P4JA 2PJ6A 1RTQA 1V6CA 2ZEMA 2ZOGA 4NGSA 4MCPA 2PJAA 1VHEA 3RBUA 1YW6A 1ZLHA 2V8HA 2ZEGA 4MMOA 2PIZA 3B3VA 3WT4A 3BI1A 4P10A 5F09A 4MHNA 2ZELA 1LAPA 4WJBA 3B3TA 3D7FA 3IFEA 3GLJA 3I74A 1YW4A 3D7DA 2FVGA 2EWBA 4FAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPS A;  4KSI A;  4MCR A;  1XFO A;  4P44 A;  1YSJ A;  3V7Z A;  2AFM A;  4ZX8 A;  4C9U A;  1UWY A;  3SJE A;  1H8L A;  4CDK A;  3WC7 A;  3KZW A;  2CIJ A;  5CPA A;  1ELM P;  1VHO A;  2PJ2 A;  1CP7 A;  4C9E A;  1CG2 A;  4C9R A;  2V8D A;  2VL1 A;  1DTD A;  3CDX A;  4ZI6 A;  5I4M A;  3RAM A;  3D7G A;  1OBR A;  2PE3 A;  5LYD A;  3KI9 A;  3NA6 A;  2RB7 A;  1M4L A;  5LRG A;  2F7V A;  3SJX A;  3FVL A;  2V77 A;  3PBE A;  1QMU A;  4X2T A;  3GUX A;  4G1P A;  3VH9 A;  1LAM A;  5HVH A;  4NJR A;  4OC1 A;  4OC5 A;  4C84 A;  3KR4 A;  2C6G A;  1TKF A;  4UEF A;  1Y7E A;  4A37 A;  4FWU A;  3BHX A;  3QNV A;  2Q51 A;  4F9U A;  4YWY A;  1TKH A;  4DUK A;  1XMB A;  3H8G A;  2PJ5 A;  4UEE A;  3WAB A;  2GU2 A;  4NJQ A;  4EME A;  4MCS A;  2ANP A;  2IQ6 A;  4IAV A;  3BI0 A;  4UIA A;  2O4H A;  2ABZ A;  3H8E A;  4Z65 A;  7CPA A;  3NFZ A;  2PJC A;  4FUU A;  3PB8 X;  2ZEN A;  5LYL A;  3D4U A;  1HEE A;  1LOK A;  2ZOF A;  3SI0 A;  2F8H A;  4C9V A;  5K8N A;  2PJ9 A;  3PFO A;  4BD9 A;  4PXC A;  1ZG9 A;  4FBE A;  2GLJ A;  2O53 A;  3SJG A;  4YU9 A;  4P4D A;  1F57 A;  1TF9 A;  4IK2 A;  2XEF A;  3ICU A;  3NH4 A;  2C6P A;  1WVM A;  5D8N A;  1VGY A;  2CF4 A;  4MXU A;  2XEJ A;  4C99 A;  2NYQ A;  4PXB A;  5K8P A;  2AFZ A;  3ISZ A;  5LRJ A;  3NH8 A;  1CPX A;  5K8O A;  4PXE A;  4OC3 A;  3SI1 A;  3DLJ A;  4ZY1 A;  1Z2L A;  5THW A;  1BLL E;  2CTC A;  4NGM A;  4CPA A;  2G9D A;  3V38 A;  3S9N A;  4LQG A;  4R6T A;  5ELY A;  1GYT A;  3KQZ A;  4R7M A;  4CDJ A;  3B3W A;  3PRT A;  1QQ9 A;  4K3N A;  2DEA A;  3IWW A;  4TJV A;  3JRU A;  4TJX A;  4GM5 A;  1CP6 A;  1BAV A;  1NSA A;  1F2O A;  5CBM A;  1KWM A;  1YLO A;  2C1C A;  3N5F A;  3MN8 A;  3FEC A;  4MRI A;  3IJ3 A;  3PB7 X;  2WZN A;  4WWV A;  4ZX9 A;  3KQX A;  4OID A;  3FF3 A;  5HVF A;  1XRY A;  2PVW A;  2PJ4 A;  1R43 A;  1CBX A;  2JEW A;  4X8I A;  1Z5R A;  3PFE A;  3KL9 A;  3K2K A;  1XBU A;  3SI2 A;  2GRE A;  4OP4 A;  1TXR A;  3L2N A;  2QJ8 A;  3NH5 A;  3S9L A;  4C8A A;  2OR4 A;  2RFH A;  2QVP A;  3HLP A;  5J1Q A;  4P6Y A;  3KAS A;  1EE3 P;  4O23 A;  4P4E A;  3TX8 A;  3VAT A;  2OOT A;  2JBK A;  4A94 A;  5HXD A;  4A39 A;  1Q7L A;  4NFR A;  2PJ0 A;  2Q43 A;  2ZEE A;  1HDU A;  2AFX A;  8CPA A;  2ZEF A;  1Y0Y A;  4C8T A;  4H2K A;  5D29 A;  4F9V A;  2WYR A;  3K9T A;  4TNU A;  5DS0 A;  2V8G A;  4IHM A;  1AMP A;  2PJ7 A;  3IIB A;  1F2P A;  3VTA A;  2QYV A;  4R8F A;  4OC4 A;  2CTB A;  4X3R A;  3CT9 A;  4ONW A;  3WC6 A;  4YN3 A;  3SJF A;  3B3C A;  4C85 A;  5LYI A;  1CX8 A;  2BOA A;  4B6Z A;  2V8V A;  1Y0R A;  3FJU A;  2XEI A;  2J9A A;  3EIF A;  2BCO A;  4MHP A;  3CPX A;  2JBJ A;  1BPN A;  2PVV A;  2AFW A;  2PJ3 A;  3PB9 X;  3ISX A;  2IJZ A;  4P4B A;  1ELL P;  4PQA A;  2ZEO A;  4C8U A;  4ZY0 A;  4AXV A;  4DYO A;  3FMC A;  2GLF A;  1DE4 C;  2C6C A;  4EWT A;  1ARM A;  3D7H A;  4DJL A;  4C9A A;  4C8C A;  4C8F A;  3D67 A;  2AFS A;  1LFW A;  4NGN A;  1ZLI A;  1BPM A;  3KHX A;  1AYE A;  2Q4Z A;  3PBB A;  3IO1 A;  1YME A;  3HUV A;  3FED A;  4ZYQ A;  5JH9 A;  4OKO A;  3FH4 A;  2AFO A;  3IEH A;  3T8W A;  4TWE A;  4MCQ A;  1FNO A;  3KHZ A;  4MHY A;  3I1U A;  3LWU A;  2PIY A;  4UF4 A;  3CPA A;  3PB6 X;  3TC8 A;  6CPA A;  3H8F A;  1PCA A;  3FX6 A;  4A38 A;  3I6S A;  4ZY2 A;  4UEZ A;  1Z8L A;  1IGB A;  3BXM A;  3RZA A;  4P4F A;  1JQG A;  3B35 A;  4P4I A;  3KR5 A;  3PB4 X;  3B2Y A;  5JGF A;  1LAN A;  3WC5 A;  3GB0 A;  1ZG8 A;  2ZEH A;  1XF1 A;  4OC2 A;  2XEG A;  2EK8 A;  3KGQ A;  4NGT A;  2POK A;  2PCU A;  5HVG A;  4NGQ A;  2IMO A;  4C8P A;  1ARL A;  3D68 A;  4Q7A A;  2ZED A;  1VIX A;  2HB6 A;  4KNG E;  1TF8 A;  3IC1 A;  4PXD A;  5LYF A;  1LCP A;  1IY7 A;  2PRQ A;  4EFD A;  1TKJ A;  2PJ1 A;  4OC0 A;  1XJO A;  5LRK A;  2PJB A;  4PPZ A;  4P45 A;  4JZ0 A;  1ZG7 A;  3B3S A;  2HC9 A;  3FEE A;  1R3N A;  4NGR A;  2AFU A;  4R76 A;  4OME A;  4UIB A;  2PJ8 A;  4NGP A;  1HDQ A;  1PYT B;  1FT7 A;  4C86 A;  3PEI A;  3LMS A;  3MRU A;  5IB9 A;  1Y9Z A;  2I3C A;  4W9Y A;  4OIW A;  2EK9 A;  5JM6 A;  4JYW A;  3D66 A;  2NSM A;  2BO9 A;  4RUH A;  4MHZ A;  3DGV A;  4F8Z A;  2ZEP A;  5K8M A;  3S9M A;  3VAR A;  3B7I A;  4P4J A;  2PJ6 A;  1RTQ A;  1V6C A;  2ZEM A;  2ZOG A;  4NGS A;  4MCP A;  2PJA A;  1VHE A;  3RBU A;  1YW6 A;  1ZLH A;  2V8H A;  2ZEG A;  4MMO A;  2PIZ A;  3B3V A;  3WT4 A;  3BI1 A;  4P10 A;  5F09 A;  4MHN A;  2ZEL A;  1LAP A;  4WJB A;  3B3T A;  3D7F A;  3IFE A;  3GLJ A;  3I74 A;  1YW4 A;  3D7D A;  2FVG A;  2EWB A;  4FAI A; 
#chains in the Genus database with same CATH topology
 2Q7S A;  3PLF B;  1CPS A;  3GKR A;  2REF A;  4KSI A;  4NCZ A;  3VRO A;  4MCR A;  1XFO A;  4P44 A;  1YSJ A;  2VQY A;  2AFM A;  3V7Z A;  4ZX8 A;  3BUO B;  4JLY A;  1UWY A;  1CS0 B;  1ZYM A;  1TIQ A;  1Y9W A;  3T05 A;  4C9U A;  1Z9U A;  2ODF A;  3BJ8 A;  3SJE A;  4M6H A;  1H8L A;  2D4P A;  1B6B A;  3KZW A;  3WC7 A;  2CIJ A;  5AXI A;  3VRP A;  5CPA A;  1NXJ A;  2PCN A;  1ELM P;  1VHO A;  2PJ2 A;  1CP7 A;  1A9X B;  4C9E A;  1CG2 A;  1YQE A;  2B4B A;  4C9R A;  2V8D A;  4C2Y A;  2VL1 A;  1DTD A;  3CDX A;  3JVN A;  4ZI6 A;  3RAM A;  2Z3M A;  5I4M A;  4COG A;  4HNX B;  3D7G A;  1OBR A;  2R82 A;  5HKZ A;  1QSM A;  2PE3 A;  4XPD C;  5LYD A;  2R1I A;  3ZZI A;  4HNW B;  3KI9 A;  4A4B A;  4M8D A;  3NA6 A;  3P2H A;  2RB7 A;  1M4L A;  1PUA A;  5LRG A;  2F7V A;  4C2Z A;  2F5I A;  4ONU A;  4H6U A;  3T5M A;  3SJX A;  3C8O A;  1VBG A;  2N3A B;  2B3U A;  3FVL A;  1I12 A;  2BEI A;  2Z11 A;  4IIX A;  2V77 A;  4CDK A;  3PBE A;  2OZH A;  1QMU A;  4E8O A;  3TOA A;  4X2T A;  3GUX A;  4G1P A;  3VH9 A;  1IID A;  1LAM A;  5HVH A;  5KTC A;  4NJR A;  4OC1 A;  3TLE A;  2GIV A;  2WUU A;  4KOY A;  2YJT A;  4OC5 A;  2Q4V A;  3EO4 A;  5FVJ A;  3KR4 A;  4C84 A;  1ZO0 A;  1PU9 A;  2GP4 A;  1KZF A;  2C6G A;  4YGO A;  1MJA A;  3C26 A;  1TKF A;  2GAN A;  4UEF A;  2B5G A;  4H89 A;  4B5P A;  1S3Z A;  4JVO A;  1Y7E A;  4A37 A;  1EZA A;  2HWG A;  4KZT A;  1VHS A;  1CM0 A;  4FWU A;  4JJX A;  3BHX A;  3D3S A;  3QNV A;  2Q51 A;  4MFP A;  1ON0 A;  1TKH A;  2EVN A;  4YWY A;  1XMB A;  4DUK A;  3H8G A;  4F9U A;  2YNC A;  1S60 A;  3LOD A;  4CGO A;  2PJ5 A;  1BOB A;  1IB1 E;  1QSR A;  3IWE A;  4KOX A;  4UEE A;  2Q4Y A;  3WAB A;  2CY2 A;  3K4I A;  3S6G A;  4QBJ A;  2Q7B A;  2OU2 A;  3TLG A;  2GU2 A;  1Z8X A;  2XPP A;  2OH1 A;  4NJQ A;  2FCK A;  2AE6 A;  4EME A;  3TLA A;  4MCS A;  4CAW A;  4UFX A;  1Y9K A;  1T36 B;  2D0P A;  2ANP A;  2HUZ A;  4FD4 A;  2CNM A;  1YRE A;  2IQ6 A;  1UFH A;  1Q5X A;  4IAV A;  3BI0 A;  4UIA A;  2EZA A;  4KOS A;  4MFZ A;  2O4H A;  3OB2 B;  2ABZ A;  3H8E A;  3SXN A;  4Z65 A;  4F0Y A;  5C88 A;  7CPA A;  4RR2 B;  2J8N A;  4J3G A;  4E5S A;  2J8R A;  2PRB A;  3NFZ A;  2PSW A;  4COB A;  2PJC A;  4FUU A;  3VWD A;  3EZA A;  4BBH A;  4OAE A;  3PB8 X;  2PC1 A;  2ZEN A;  5LYL A;  4QC6 A;  4HPS A;  4R9M A;  3D4U A;  1HEE A;  5G20 A;  4II9 A;  5BY0 A;  1LOK A;  2ZOF A;  3SI0 A;  3TE4 A;  3R9E A;  4A33 A;  4PK3 A;  2F8H A;  2G3A A;  4C9V A;  1GHE A;  5K8N A;  4KSA A;  2PJ9 A;  1QSN A;  2ARH A;  2BSW A;  3PFV A;  3PFO A;  3KRV A;  2FIA A;  1C3O B;  5A28 A;  3BUW B;  5H84 A;  4XNH B;  4BD9 A;  4CGM A;  3R95 A;  5J8F A;  4PXC A;  2AUN A;  1ZG9 A;  4FBE A;  2GLJ A;  2O53 A;  2EO8 A;  1KC7 A;  3SJG A;  1QST A;  4CZ1 A;  4YU9 A;  3S6H A;  4P4D A;  1F57 A;  1TF9 A;  3FNC A;  3H5Z A;  4IK2 A;  2XEF A;  4A30 A;  3ICU A;  3NH4 A;  2B5G B;  3GYA A;  1MJB A;  2C6P A;  1CE8 B;  4B5P B;  2Z3N A;  1U6M A;  4UCM A;  1RXT A;  1WVM A;  5D8N A;  4E94 A;  1VGY A;  1YK3 A;  2CF4 A;  2KCW A;  4MXU A;  4PSW A;  3CXS A;  1I1D A;  2XEJ A;  2DXQ A;  4C99 A;  3JUW A;  4NF1 A;  4CYP A;  2NYQ A;  4ZBG A;  4EYS A;  4PXB A;  5K8P A;  2AFZ A;  2PQ8 A;  2DLA A;  3ISZ A;  4LX9 A;  5LRJ A;  3VRN A;  3NH8 A;  3TLG B;  1CPX A;  1FBV A;  2Z0Z A;  3WR7 A;  5K8O A;  3IWG A;  4PXE A;  1ZRS A;  3BJ7 A;  2J8M A;  3R9G A;  5BWA B;  4OC3 A;  3T9Y A;  3SI1 A;  3TYX A;  1KUY A;  5E96 A;  3DLJ A;  4ZY1 A;  1Z2L A;  5THW A;  1BLL E;  3IU2 A;  5IV0 A;  2CTC A;  4NGM A;  1NE9 A;  2G9D A;  2FXF A;  3CXQ A;  3S9N A;  3TCV A;  3V38 A;  4CPA A;  4LQG A;  2B58 A;  5IR2 A;  4R6T A;  5ELY A;  2FIW A;  3A9L A;  1GYT A;  2FL4 A;  1S7K A;  3D2P A;  4CAF A;  5K99 A;  1XMT A;  3DNS A;  3KQZ A;  4R7M A;  2PR8 A;  2CNS A;  3G8W A;  4B5O A;  4CDJ A;  4GPL B;  2A4N A;  3B3W A;  3PRT A;  2R8V A;  1S7N A;  1QQ9 A;  4K3N A;  2DEA A;  2MP0 A;  3IWW A;  4JXR A;  4TJV A;  3JRU A;  5J3X A;  4QUS A;  4TJX A;  4GM5 A;  1CP6 A;  1VI4 A;  4NSQ A;  4M85 A;  2NMT A;  2Y1N A;  4PSX A;  4J0N A;  3ZNI A;  3W6S A;  1BAV A;  1NSA A;  4A95 A;  4CGN A;  3G23 A;  1JDB C;  1F2O A;  4HKF A;  3TT2 A;  4CGP A;  5CBM A;  4BPW B;  3EXN A;  1JWQ A;  4LUA A;  5AGE A;  2JDD A;  3EZE A;  1KWM A;  4MI1 A;  1YLO A;  2C1C A;  3QAY A;  3N5F A;  3MN8 A;  3FEC A;  1Q2D A;  3IJ3 A;  3PB7 X;  1XEB A;  2OZG A;  2WZN A;  4KOT A;  3LD2 A;  4MRI A;  1MK4 A;  2Y1M A;  2JEV A;  4WWV A;  2VZY A;  4ZX9 A;  3KQX A;  2Z3L A;  4OID A;  3FF3 A;  2ZPA A;  4C68 A;  5HVF A;  4C8T A;  4LQ6 A;  1XRY A;  4AVC A;  2PVW A;  2PJ4 A;  1R43 A;  1CBX A;  2JEW A;  4X8I A;  3TOB A;  4NXY A;  4XPK A;  4KSF A;  1Z5R A;  3PFE A;  4X5K A;  3KL9 A;  3K2K A;  4R3K A;  5A27 A;  1XBU A;  3VRQ A;  2D0O A;  4KOR A;  2FT0 A;  3SI2 A;  1X10 A;  2GRE A;  4OP4 A;  1IIC A;  1TXR A;  3L2N A;  3RO0 A;  2VXK A;  5IX3 A;  5KTA A;  3BUX B;  2QJ8 A;  2DIK A;  3NH5 A;  3S9L A;  1L0C A;  3LAC A;  5IB0 A;  2OR4 A;  2RFH A;  3I3G A;  2QVP A;  4C8A A;  3HLP A;  2Q04 A;  1KUX A;  4E2A A;  5J1Q A;  4P6Y A;  3KAS A;  1EE3 P;  4BPX B;  4O23 A;  4P4E A;  1RO5 A;  3TX8 A;  3VAT A;  4B10 A;  2OOT A;  1R57 A;  5FD8 A;  2JBK A;  2VKZ G;  2GFQ A;  4A94 A;  5HXD A;  3BLN A;  2E28 A;  1M4I A;  4A39 A;  1M1D A;  2AUM A;  3OB1 B;  1Q7L A;  3DR8 A;  3EY5 A;  4MHD A;  4NFR A;  5AG6 A;  5EMI A;  1LRZ A;  2PJ0 A;  4IUS A;  2Q43 A;  2Z3K A;  2ZEE A;  5C82 A;  1HDU A;  4CRZ B;  5F46 A;  5HH1 A;  1KUV A;  2AFX A;  4MFJ A;  4B14 A;  2QIR A;  1GGO A;  8CPA A;  3D2M A;  4DNC A;  1J4J A;  2ZEF A;  1VBH A;  3BUM B;  4BMH A;  1WJT A;  2QML A;  1Y0Y A;  3TLY A;  5F13 A;  1X12 A;  1I21 A;  4R57 A;  4UWJ A;  4YFJ A;  1XF8 A;  4H2K A;  5D29 A;  5G21 A;  3CZX A;  3W91 A;  4F9V A;  2WYR A;  4RS2 A;  3K9T A;  1XOV A;  3RNZ A;  2Q44 A;  4A31 A;  2GE3 A;  4H1H A;  4TNU A;  5DS0 A;  4Y49 B;  2V8G A;  4IHM A;  4KOU A;  1AMP A;  4MI4 A;  2FE7 A;  1N71 A;  2PJ7 A;  3IIB A;  1F2P A;  4AG9 A;  3VTA A;  5ISV A;  3HPH E;  2ATR A;  5HKY A;  3NOJ A;  2QYV A;  3HMJ G;  3OWC A;  4R8F A;  4OC4 A;  2CTB A;  4X3R A;  3CT9 A;  4ONW A;  3WC6 A;  4YN3 A;  3SJF A;  3B3C A;  2C5Q A;  3CXP A;  3SR3 A;  4C85 A;  5HMN A;  2FSR A;  4CAE A;  5LYI A;  5JPH A;  1CX8 A;  1YLE A;  2BOA A;  4Q36 A;  3QAH A;  4ORF A;  4B6Z A;  4CRY B;  1Z4R A;  3TFY A;  2YND A;  1YGH A;  2V8V A;  3VWE A;  1Y0R A;  2ZW7 A;  3FJU A;  2XEI A;  3HPG G;  4GS4 A;  2J9A A;  4YRH A;  3TLC A;  1M44 A;  1Z4E A;  3DSB A;  3EIF A;  2HQY A;  2BCO A;  4MHP A;  3CPX A;  4MY0 A;  5I0C A;  4IIY A;  2JBJ A;  1BPN A;  2PVV A;  2AFW A;  2PJ3 A;  3PP9 A;  4B11 A;  5KTD A;  2EUI A;  3PB9 X;  4GXH A;  4E0A A;  4AVB A;  2R98 A;  1SQH A;  3ISX A;  2IJZ A;  4K30 A;  1B47 A;  4P4B A;  1ELL P;  4PQA A;  5JYB A;  1M4G A;  2ZEO A;  4BPU B;  4C8U A;  4ZY0 A;  4AXV A;  2Z3P A;  2DPT A;  3GIU A;  3FMC A;  4DYO A;  3RYO A;  1C30 B;  2GLF A;  1DE4 C;  2BL1 A;  4XNH C;  2C6C A;  2G0B A;  3S6F A;  3T90 A;  4FD6 A;  4MJ8 A;  2P6F A;  2EZB A;  5JQ4 A;  4EWT A;  1ARM A;  1Z8T A;  2G3T A;  3D7H A;  2O28 A;  2R7H A;  4KVO E;  2ZW5 A;  1V0C A;  4DJL A;  1M4D A;  4Q38 A;  4C2X A;  4C9A A;  4C8C A;  1WWZ A;  4C8F A;  3D67 A;  2AFS A;  1LFW A;  1P0H A;  3IGR A;  4NGN A;  4MFK A;  3SHP A;  4C7H A;  1ZLI A;  1BPM A;  3KHX A;  1AYE A;  4FD5 A;  4UWI A;  4OLL A;  4F0X A;  1FY7 A;  2Q4Z A;  3PBB A;  4U9Y A;  2YNC C;  5EBV A;  3IO1 A;  1YME A;  4B12 A;  4MJX A;  3HUV A;  3FED A;  4ZYQ A;  5AG7 A;  3O8Z A;  5JH9 A;  1YVH A;  4OKO A;  3FH4 A;  4L89 A;  2AFO A;  3TLB A;  2WPX A;  2DF5 A;  3IEH A;  4MY3 A;  4TWE A;  3T8W A;  2I79 A;  4XPD B;  4MCQ A;  3DDD A;  3FRM A;  3W6X A;  1FNO A;  3KHZ A;  3VGO A;  4MHY A;  2EZC A;  2YGW A;  4NEX A;  4KVX A;  3IU1 A;  4MFL A;  3G3S A;  4KOV A;  4M6I A;  1S5K A;  3I1U A;  4RI1 A;  3LWU A;  1EO0 A;  2PIY A;  4UF4 A;  3QB8 A;  2DPS A;  3K9U A;  1IU8 A;  2X0S A;  3V8I A;  3CPA A;  3PB6 X;  3NFQ A;  4UA3 A;  4UBR A;  3TC8 A;  6CPA A;  1DIK A;  4U5Y A;  3H8F A;  4KS9 A;  2CXA A;  2EBJ A;  1PCA A;  3PGP A;  1IYK A;  2YNE A;  3FX6 A;  4KUB A;  4A38 A;  3FIX A;  2OB0 A;  4PK2 A;  1ZL0 A;  3I6S A;  4ZGY B;  5J8C A;  4CYQ A;  4ZY2 A;  3F8K A;  2Y0M A;  1Q2Y A;  4UEZ A;  3PT1 A;  1Z8L A;  2JDC A;  4C7I A;  4IF5 A;  1IGB A;  3BXM A;  1YX0 A;  3RZA A;  3EC4 A;  4P4F A;  2B4J C;  3GY9 A;  3GJZ A;  2D4O A;  3JTK A;  3DR6 A;  1JQG A;  3B35 A;  4RN7 A;  1NSL A;  4P4I A;  1BO4 A;  3KR5 A;  3B2Y A;  3PB4 X;  5GCN A;  5JGF A;  1J3L A;  5F9M A;  1LAN A;  4FD7 A;  3WC5 A;  5F1Y A;  3GB0 A;  1ZG8 A;  2ZEH A;  3FXT A;  1XF1 A;  4OC2 A;  2XEG A;  1YVK A;  2EK8 A;  2HI6 A;  3KGQ A;  2B3V A;  4MBU A;  4NGT A;  3I9S A;  4HNY B;  1S7F A;  2POK A;  2PCU A;  2B4D A;  4MFQ A;  1YR0 A;  5HVG A;  2PR1 A;  1IOF A;  1XE4 A;  2PDO A;  3R96 A;  2AJ6 A;  3TO7 A;  2FM4 A;  2Q0Y A;  4NGQ A;  2IMO A;  3TO9 A;  1ARL A;  4C8P A;  1IOI A;  3D68 A;  1KEE B;  4Q7A A;  2ZED A;  2K5T A;  3TO6 A;  1VIX A;  4M6G A;  2HB6 A;  4KNG E;  2JLM A;  4A2Z A;  4KOW A;  2ZW6 A;  2P0W A;  1TF8 A;  2ZXV A;  1Z9E A;  2XPO A;  3T0T A;  2H5M A;  3IC1 A;  4JWP A;  4H6Z A;  4PV6 A;  1VKC A;  4PXD A;  5LYF A;  1LCP A;  4UFV A;  1Q2C A;  1IY7 A;  3P2F A;  2PRQ A;  4JD6 A;  4XPL A;  5F47 A;  4EFD A;  1TKJ A;  2BUE A;  3FB3 A;  3E0K A;  2PJ1 A;  4I49 A;  1AUG A;  2P6E A;  2I00 A;  5F48 A;  2Z10 A;  4KLW A;  2XPL A;  4B13 A;  4OC0 A;  4KLV A;  4CO9 A;  1XJO A;  5LRK A;  1Z8W A;  4UCP A;  2PJB A;  4AB7 A;  4PPZ A;  3N7Z A;  2C27 A;  4P45 A;  5F5X A;  4R3L A;  4JZ0 A;  1WK4 A;  1ZG7 A;  4R87 A;  3U1B A;  3U88 C;  3B3S A;  2YJV A;  2P6G A;  3TLZ A;  2HC9 A;  5AG5 A;  4BTF A;  3R1K A;  1Y7R A;  2HRO A;  3T07 A;  1OZP A;  3SXO A;  3VRR A;  1P4N A;  4AG7 A;  3FEE A;  1R3N A;  4NGR A;  2AFU A;  3ZJ0 A;  4EVY A;  4R76 A;  4OME A;  2FS5 A;  4UIB A;  2PJ8 A;  4QB9 A;  3NE7 A;  2HV2 A;  1MJ9 A;  4NGP A;  1HDQ A;  3B8G A;  3KKW A;  5EC4 A;  3S6K A;  1QSO A;  1K4J A;  1FT7 A;  1PYT B;  4CYO A;  4KUA A;  1NBW A;  2X7B A;  3FBU A;  3EFA A;  4U9Z A;  4UFW A;  5DWN A;  3PZJ A;  1BXR B;  4C86 A;  1YVO A;  3PEI A;  4OAD A;  3LMS A;  3MRU A;  1CJW A;  5IB9 A;  1EZB A;  3OAK A;  4CAV A;  1Y9Z A;  2I3C A;  4W9Y A;  4Y49 C;  5G1Z A;  3NE8 A;  4OIW A;  1A2Z A;  1B87 A;  1S7L A;  1JDE A;  3TTH A;  2EK9 A;  4BIN A;  5JM6 A;  4JYW A;  4INJ A;  3F9K C;  2NSM A;  3D66 A;  2BO9 A;  4JXQ A;  3EZB A;  3MGD A;  4A32 A;  4RUH A;  4L8A A;  2QEC A;  2B4D B;  3BUN B;  4MHZ A;  2OLS A;  3DGV A;  3F0A A;  4F8Z A;  2RC4 A;  2ZEP A;  4CAX A;  5K8M A;  3S9M A;  2VZZ A;  5H86 A;  1KBL A;  5DWM A;  3VAR A;  2WPW A;  5HKW A;  2REE A;  2Z3O A;  3B7I A;  4P4J A;  2PJ6 A;  4UCN A;  5JVL A;  1RTQ A;  1V6C A;  2WSA A;  4F6A A;  2ZEM A;  2UV8 G;  2ZOG A;  4NGS A;  4MCP A;  2CNT A;  2PJA A;  2ZW4 A;  1VHE A;  5F49 A;  4CGL A;  5AG4 A;  3RBU A;  3F5B A;  1NMT A;  1YW6 A;  1ZLH A;  3OP0 A;  2V8H A;  3FYN A;  4M3S A;  2ZEG A;  4MMO A;  2PIZ A;  3B3V A;  3R9F A;  1IYL A;  3WT4 A;  2XPN A;  3BI1 A;  4P10 A;  5F09 A;  3H4Q A;  1M6V B;  4A4C A;  4MHN A;  2ZEL A;  1LAP A;  4QVT A;  4WJB A;  5G22 A;  3UY5 A;  1XIX A;  5CNP A;  3B3T A;  4CYN A;  2OZU A;  3D7F A;  4CS0 B;  1R61 A;  3IFE A;  2VEZ A;  4KVM E;  3GLJ A;  3I74 A;  1YW4 A;  2B0A A;  3D7D A;  2FVG A;  2VBQ A;  4AVA A;  2VI7 A;  2EWB A;  3D8P A;  2IL4 A;  4FAI A;  2CBL A; 
#chains in the Genus database with same CATH homology
 1CPS A;  4KSI A;  4MCR A;  1XFO A;  4P44 A;  1YSJ A;  3V7Z A;  2AFM A;  4ZX8 A;  4C9U A;  1UWY A;  3SJE A;  1H8L A;  4CDK A;  3WC7 A;  3KZW A;  2CIJ A;  5CPA A;  1ELM P;  1VHO A;  2PJ2 A;  1CP7 A;  4C9E A;  1CG2 A;  4C9R A;  2V8D A;  2VL1 A;  1DTD A;  3CDX A;  4ZI6 A;  5I4M A;  3RAM A;  3D7G A;  1OBR A;  2PE3 A;  5LYD A;  3KI9 A;  3NA6 A;  2RB7 A;  1M4L A;  5LRG A;  2F7V A;  3SJX A;  3FVL A;  2V77 A;  3PBE A;  1QMU A;  4X2T A;  3GUX A;  4G1P A;  3VH9 A;  1LAM A;  5HVH A;  4NJR A;  4OC1 A;  4OC5 A;  4C84 A;  3KR4 A;  2GP4 A;  2C6G A;  1TKF A;  4UEF A;  1Y7E A;  4A37 A;  4FWU A;  3BHX A;  3QNV A;  2Q51 A;  4F9U A;  4YWY A;  1TKH A;  4DUK A;  1XMB A;  3H8G A;  2PJ5 A;  4UEE A;  3WAB A;  2GU2 A;  4NJQ A;  4EME A;  4MCS A;  2ANP A;  2IQ6 A;  4IAV A;  3BI0 A;  4UIA A;  2O4H A;  2ABZ A;  3H8E A;  4Z65 A;  7CPA A;  3NFZ A;  2PJC A;  4FUU A;  3PB8 X;  2ZEN A;  5LYL A;  3D4U A;  1HEE A;  1LOK A;  2ZOF A;  3SI0 A;  2F8H A;  4C9V A;  5K8N A;  2PJ9 A;  3PFO A;  4BD9 A;  4PXC A;  1ZG9 A;  4FBE A;  2GLJ A;  2O53 A;  3SJG A;  4YU9 A;  4P4D A;  1F57 A;  1TF9 A;  4IK2 A;  2XEF A;  3ICU A;  3NH4 A;  2C6P A;  1WVM A;  5D8N A;  1VGY A;  2CF4 A;  4MXU A;  2XEJ A;  4C99 A;  2NYQ A;  4PXB A;  5K8P A;  2AFZ A;  3ISZ A;  5LRJ A;  3NH8 A;  1CPX A;  5K8O A;  4PXE A;  4OC3 A;  3SI1 A;  3DLJ A;  4ZY1 A;  1Z2L A;  5THW A;  1BLL E;  2CTC A;  4NGM A;  4CPA A;  2G9D A;  5IR2 A;  3V38 A;  3S9N A;  4LQG A;  4R6T A;  5ELY A;  1GYT A;  3KQZ A;  4R7M A;  4CDJ A;  3B3W A;  3PRT A;  1QQ9 A;  4K3N A;  2DEA A;  3IWW A;  4TJV A;  3JRU A;  4TJX A;  4GM5 A;  1CP6 A;  1BAV A;  1NSA A;  1F2O A;  5CBM A;  1KWM A;  1YLO A;  2C1C A;  3N5F A;  3MN8 A;  3FEC A;  4MRI A;  3IJ3 A;  3PB7 X;  2WZN A;  4WWV A;  4ZX9 A;  3KQX A;  4OID A;  3FF3 A;  5HVF A;  1XRY A;  2PVW A;  2PJ4 A;  1R43 A;  1CBX A;  2JEW A;  4X8I A;  1Z5R A;  3PFE A;  3KL9 A;  3K2K A;  1XBU A;  3SI2 A;  2GRE A;  4OP4 A;  1TXR A;  3L2N A;  2QJ8 A;  3NH5 A;  3S9L A;  4C8A A;  2OR4 A;  2RFH A;  2QVP A;  3HLP A;  5J1Q A;  4P6Y A;  3KAS A;  1EE3 P;  4O23 A;  4P4E A;  3TX8 A;  3VAT A;  2OOT A;  2JBK A;  4A94 A;  5HXD A;  4A39 A;  1Q7L A;  4NFR A;  2PJ0 A;  2Q43 A;  2ZEE A;  1HDU A;  2AFX A;  8CPA A;  2ZEF A;  1Y0Y A;  4C8T A;  4H2K A;  5D29 A;  4F9V A;  2WYR A;  3K9T A;  4TNU A;  5DS0 A;  2V8G A;  4IHM A;  1AMP A;  2PJ7 A;  3IIB A;  1F2P A;  3VTA A;  2QYV A;  4R8F A;  4OC4 A;  2CTB A;  4X3R A;  3CT9 A;  4ONW A;  3WC6 A;  4YN3 A;  3SJF A;  3B3C A;  2C5Q A;  4C85 A;  5LYI A;  1CX8 A;  2BOA A;  4B6Z A;  2V8V A;  1Y0R A;  3FJU A;  2XEI A;  2J9A A;  3EIF A;  2BCO A;  4MHP A;  3CPX A;  2JBJ A;  1BPN A;  2PVV A;  2AFW A;  2PJ3 A;  3PB9 X;  3ISX A;  2IJZ A;  4P4B A;  1ELL P;  4PQA A;  2ZEO A;  4C8U A;  4ZY0 A;  4AXV A;  4DYO A;  3FMC A;  2GLF A;  1DE4 C;  2C6C A;  4EWT A;  1ARM A;  3D7H A;  4DJL A;  4C9A A;  4C8C A;  4C8F A;  3D67 A;  2AFS A;  1LFW A;  4NGN A;  1ZLI A;  1BPM A;  3KHX A;  1AYE A;  2Q4Z A;  3PBB A;  3IO1 A;  1YME A;  3HUV A;  3FED A;  4ZYQ A;  5JH9 A;  4OKO A;  3FH4 A;  2AFO A;  3IEH A;  3T8W A;  4TWE A;  4MCQ A;  1FNO A;  3KHZ A;  4MHY A;  3I1U A;  3LWU A;  2PIY A;  4UF4 A;  3CPA A;  3PB6 X;  3TC8 A;  6CPA A;  3H8F A;  1PCA A;  3FX6 A;  4A38 A;  3I6S A;  4ZY2 A;  4UEZ A;  1Z8L A;  1IGB A;  3BXM A;  3RZA A;  4P4F A;  1JQG A;  3B35 A;  4P4I A;  3KR5 A;  3PB4 X;  3B2Y A;  5JGF A;  1LAN A;  3WC5 A;  3GB0 A;  1ZG8 A;  2ZEH A;  1XF1 A;  4OC2 A;  2XEG A;  2EK8 A;  3KGQ A;  4NGT A;  2POK A;  2PCU A;  5HVG A;  4NGQ A;  2IMO A;  4C8P A;  1ARL A;  3D68 A;  4Q7A A;  2ZED A;  1VIX A;  2HB6 A;  4KNG E;  1TF8 A;  3IC1 A;  4PXD A;  5LYF A;  1LCP A;  1IY7 A;  2PRQ A;  4EFD A;  1TKJ A;  2PJ1 A;  4OC0 A;  1XJO A;  5LRK A;  2PJB A;  4PPZ A;  4P45 A;  4JZ0 A;  1ZG7 A;  3B3S A;  2HC9 A;  3FEE A;  1R3N A;  4NGR A;  2AFU A;  4R76 A;  4OME A;  4UIB A;  2PJ8 A;  4NGP A;  1HDQ A;  1PYT B;  1FT7 A;  4C86 A;  3PEI A;  3LMS A;  3MRU A;  5IB9 A;  1Y9Z A;  2I3C A;  4W9Y A;  4OIW A;  2EK9 A;  5JM6 A;  4JYW A;  3D66 A;  2NSM A;  2BO9 A;  4RUH A;  4MHZ A;  3DGV A;  4F8Z A;  2ZEP A;  5K8M A;  3S9M A;  3VAR A;  3B7I A;  4P4J A;  2PJ6 A;  1RTQ A;  1V6C A;  2ZEM A;  2ZOG A;  4NGS A;  4MCP A;  2PJA A;  1VHE A;  3RBU A;  1YW6 A;  1ZLH A;  2V8H A;  2ZEG A;  4MMO A;  2PIZ A;  3B3V A;  3WT4 A;  3BI1 A;  4P10 A;  5F09 A;  4MHN A;  2ZEL A;  1LAP A;  4WJB A;  3B3T A;  3D7F A;  3IFE A;  3GLJ A;  3I74 A;  1YW4 A;  3D7D A;  2FVG A;  2EWB A;  4FAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...