4OC1A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with coibzl, a urea-based inhibitor (2s)-2-[({(1s)-1-carboxy-2-[(2s)-oxiran-2-yl]ethyl}carbamoyl)amino]-6-[(4-iodobenzoyl)amino]hexanoic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc1A02
3FVLA 5HXDA 1CPSA 3PB8X 4UEZA 1FNOA 1XBUA 4MCQA 4YU9A 4MHYA 4R8FA 4C9UA 4P4EA 2ZENA 3NH4A 1TXRA 3PB7X 1CBXA 1Z8LA 2RB7A 1EE3P 1TF9A 1ELLP 4NFRA 2G9DA 3CT9A 3S9LA 2PJ8A 4P4JA 4EFDA 1BPNA 4OC5A 5K8NA 1YMEA 3FMCA 3BXMA 4G1PA 5K8MA 4X8IA 4C8CA 2V8HA 2POKA 4ZX9A 4C9EA 2CIJA 2XEGA 4NGNA 4NGSA 4A39A 3VTAA 3KHXA 5LRKA 2V8DA 2ZEMA 4MXUA 3H8GA 3GUXA 2V8VA 2ZEOA 1BAVA 6CPAA 1LANA 4CDJA 1KWMA 2ZOGA 4C84A 2F8HA 2AFWA 3DLJA 2PJCA 1CPXA 2XEIA 2Q51A 1VHOA 3JRUA 3B3TA 3WABA 1RTQA 4MMOA 2ZEFA 2RFHA 3IEHA 1ZLIA 1YLOA 3B3WA 2EK9A 3NH5A 4O23A 2QJ8A 4WJBA 2OR4A 1Z2LA 1LAPA 4ONWA 2PJ9A 4P4FA 4LQGA 4PXBA 4TWEA 2OOTA 3LWUA 2CTBA 2C6GA 3DGVA 4UEFA 1HDQA 4TNUA 2NYQA 3FEDA 4NGQA 3IC1A 2AFMA 3SJGA 2EWBA 4ZY0A 4EWTA 1F57A 1Q7LA 1PCAA 2JBKA 1ARLA 3KASA 3H8FA 5D29A 5F09A 2IJZA 1DE4C 1H8LA 4C9RA 3VH9A 3RAMA 4NGTA 3I1UA 4FUUA 3SI2A 3PRTA 5JGFA 3NA6A 1ELMP 4C8AA 8CPAA 3D67A 1BPMA 4NGMA 3TC8A 1BLLE 5DS0A 3NH8A 4OMEA 2F7VA 2PIYA 4C8UA 5ELYA 1QMUA 5LRJA 4A37A 3PFOA 3EIFA 3RZAA 3KZWA 5I4MA 4K3NA 2PE3A 2AFZA 2V8GA 2J9AA 1GYTA 3D68A 3PB9X 2C1CA 1CX8A 1ZG8A 1F2OA 3KHZA 3D7FA 2XEFA 2PJ4A 3ICUA 2HC9A 4ZY1A 2AFSA 2I3CA 2ZEEA 3IIBA 3L2NA 3B3CA 1V6CA 1IY7A 2ZEGA 2PJ1A 3WT4A 2DEAA 2QVPA 3T8WA 4MHNA 2CTCA 4C9VA 3HLPA 4R76A 5CBMA 4F9VA 3TX8A 4OC0A 1AYEA 4P4DA 2GREA 3WC7A 4KSIA 3KR4A 4NGRA 3B35A 4OC4A 2PJ0A 5LRGA 4CDKA 3IFEA 5D8NA 2VL1A 1XRYA 2NSMA 2EK8A 4NJRA 3VARA 4F8ZA 3PFEA 3KQXA 4OKOA 2GLJA 2Q4ZA 3FJUA 1XFOA 5K8OA 2FVGA 1TKFA 4DJLA 3IJ3A 3PB4X 2O4HA 4ZX8A 1YSJA 4PPZA 1XJOA 4C85A 2JBJA 1ZG9A 2Q43A 3SI0A 1UWYA 2ZOFA 4C86A 1ZLHA 4UF4A 4C8FA 4P10A 1XF1A 4Z65A 2PJ5A 4JZ0A 5J1QA 1Z5RA 2BCOA 2PVWA 5HVGA 4FWUA 2ZEHA 3KQZA 4TJXA 3FF3A 3IWWA 1HDUA 1LOKA 3SI1A 1DTDA 1HEEA 2PVVA 2V77A 4PQAA 1AMPA 4Q7AA 2HB6A 3KI9A 1TKJA 3NFZA 3H8EA 1YW4A 4MHZA 2ZEPA 4MCPA 2PJBA 1OBRA 4P6YA 3V7ZA 3D7DA 3B3SA 1CP6A 3S9NA 4PXEA 2PJ7A 5LYLA 4NJQA 3CPXA 1Y0RA 5CPAA 5JH9A 2IQ6A 2WZNA 2PJ2A 3FX6A 4PXCA 1M4LA 4OC2A 1F2PA 5THWA 1CP7A 1IGBA 1VHEA 2C6PA 4P44A 1YW6A 4PXDA 1XMBA 3D4UA 4NGPA 3B3VA 1LAMA 3PB6X 4H2KA 1VGYA 3K2KA 3BI0A 5LYDA 1ZG7A 3CPAA 4DUKA 4OIDA 2AFXA 3QNVA 4OP4A 1Y0YA 2O53A 1PYTB 2PCUA 3LMSA 4F9UA 5K8PA 4DYOA 4UEEA 4TJVA 4FBEA 4MCSA 4MRIA 3PBEA 4YN3A 4B6ZA 3D7GA 4W9YA 3RBUA 4FAIA 2GLFA 3HUVA 3FH4A 3K9TA 4KNGE 3N5FA 5IB9A 1WVMA 3SJXA 4OC1A 3MN8A 2AFUA 4EMEA 4MHPA 2BO9A 4R6TA 3GB0A 2ZELA 1Y9ZA 4YWYA 3KGQA 1LFWA 1VIXA 1LCPA 3ISZA 4CPAA 4C8TA 3BI1A 2GU2A 4UIBA 2ZEDA 4OIWA 2QYVA 3S9MA 4C9AA 3IO1A 2BOAA 4P4BA 4IK2A 2WYRA 3SJEA 3PBBA 2PRQA 4A94A 1Y7EA 5LYFA 3SJFA 3KL9A 4MCRA 1JQGA 3MRUA 1QQ9A 5HVHA 2PJ3A 1CG2A 3B2YA 2AFOA 5LYIA 4WWVA 3KR5A 4A38A 4X3RA 4X2TA 4ZY2A 3VATA 2XEJA 4P4IA 4P45A 3D66A 4RUHA 1FT7A 3I6SA 4IHMA 4C8PA 3B7IA 3WC5A 2ANPA 5JM6A 2PJ6A 3FEEA 1TKHA 3WC6A 3V38A 2IMOA 7CPAA 1R3NA 3D7HA 2JEWA 2CF4A 1TF8A 2PJAA 4JYWA 1R43A 3BHXA 5HVFA 4BD9A 3CDXA 4AXVA 1ARMA 2PIZA 4GM5A 4ZYQA 3GLJA 3PEIA 3FECA 3I74A 2C6CA 4R7MA 1NSAA 4ZI6A 4OC3A 2ABZA 3ISXA 4UIAA 4C99A 4IAVA
chains in the Genus database with same CATH superfamily
4KOUA 2WPXA 5ISVA 3JTKA 1ZO0A 5G20A 3KRVA 3NE7A 5FVJA 2OH1A 3FVLA 5HXDA 2B5GA 1CPSA 1Q5XA 3FIXA 3PB8X 2ODFA 4UEZA 3EC4A 1FNOA 1XBUA 4MCQA 4YU9A 2PRBA 4MHYA 4C2XA 1YR0A 4R8FA 4C9UA 4P4EA 4CYQA 2ZENA 3W91A 3NH4A 3VROA 5F1YA 1IICA 1TXRA 1CBXA 2REEA 3PB7X 1Z8LA 4KVOE 2EUIA 2PC1A 2RB7A 3FXTA 1EE3P 1TF9A 1ELLP 2HQYA 1K4JA 4KLWA 2G9DA 3CT9A 4H89A 3S9LA 2GIVA 4NFRA 2PJ8A 4KZTA 4P4JA 3LD2A 4EFDA 1BPNA 4OC5A 4XPKA 4A30A 5K8NA 1MJAA 1YMEA 3FMCA 3MGDA 4B5OA 4YFJA 3BXMA 2PSWA 4XNHB 4CGNA 4G1PA 5K8MA 4LX9A 4X8IA 4NEXA 2CNTA 1S3ZA 4C8CA 1PU9A 2V8HA 1EZAA 2FXFA 2POKA 4ZX9A 4C9EA 3PGPA 3FBUA 4UBRA 2B4DA 2CIJA 2XEGA 1S7KA 2D0PA 4NGNA 1M4IA 4NGSA 2MP0A 1AUGA 4A39A 2AUNA 4F0XA 3VTAA 2REFA 3KHXA 4F6AA 2G0BA 5LRKA 4U5YA 2V8DA 2ZEMA 4MXUA 4FD7A 3H8GA 4BPUB 2Y1NA 1I1DA 5JYBA 3GUXA 2V8VA 2ZEOA 2Z3MA 3U1BA 2Y1MA 4XNHC 2ZW5A 3TO9A 4M8DA 1QSNA 1BAVA 3I74A 6CPAA 2ATRA 2B4BA 1LANA 2D4OA 4B5PB 1S7LA 4CDJA 1KWMA 2ZOGA 4C84A 2F8HA 4AB7A 2P6GA 2Z3PA 2ZPAA 2AFWA 3IGRA 3R96A 2XPPA 5HKYA 3DLJA 4UWJA 2PJCA 2YGWA 3GIUA 1CPXA 2GANA 5IB0A 3VRNA 1X12A 2XEIA 1M4DA 2Q51A 2Q7BA 2J8RA 4CGLA 1VHOA 3JRUA 3B3TA 4MFJA 3TFYA 3QAHA 1MK4A 1RO5A 3WABA 3BLNA 1RTQA 1T36B 5FD8A 4MMOA 2ZEFA 2RFHA 3IEHA 1ZLIA 2WUUA 3I3GA 1ZRSA 2Q04A 2AUMA 1YLOA 3OP0A 4NXYA 3B3WA 2EK9A 3NH5A 4O23A 2QJ8A 3PLFB 4WJBA 2OR4A 1Z4RA 2Q44A 3JVNA 1Z2LA 4UFVA 1LAPA 4YGOA 3VWDA 4ONWA 4MY0A 3D2PA 5E96A 2QECA 2PJ9A 4P4FA 1QSRA 4LQGA 3LODA 3DNSA 4PXBA 4TWEA 2OOTA 3TOAA 3IWEA 2G3TA 1M1DA 3LWUA 1Q2CA 4OAEA 4E94A 2CTBA 2PR8A 2C6GA 2VZZA 3DGVA 4UEFA 1HDQA 1X10A 1YREA 2NYQA 4KOSA 5BY0A 2B58A 2B5GB 3FEDA 1VHSA 1FBVA 3H4QA 4NGQA 3IC1A 2AFMA 3SJGA 2EWBA 4ZY0A 4QB9A 4EWTA 3D8PA 2N3AB 1F57A 1Q7LA 4I49A 4BTFA 1YQEA 2Q0YA 1NSLA 4CO9A 1PCAA 2VI7A 4M6GA 4C2ZA 4EYSA 2JBKA 1ARLA 3TT2A 3D2MA 3DSBA 3T07A 2I00A 3T90A 3KASA 1IU8A 1NE9A 4PV6A 3FYNA 3H8FA 2YJVA 2G3AA 5D29A 5F09A 3CZXA 4GS4A 5IR2A 2IJZA 4QBJA 2K5TA 3QAYA 1DE4C 1H8LA 4FD4A 4M6HA 3TLYA 4C9RA 4YRHA 3BUWB 1NXJA 4M6IA 1VKCA 3A9LA 3VH9A 1A9XB 5KTCA 1KUYA 3RAMA 2B4DB 5G22A 2YNCC 3SR3A 3R9EA 2BEIA 4AG9A 4UFWA 1WK4A 1TIQA 4NGTA 3I1UA 4FUUA 3SI2A 3PRTA 4MI1A 5JGFA 4MFQA 2C27A 2FL4A 1IOFA 3NA6A 4RS2A 2H5MA 4J0NA 1ELMP 4MY3A 4C8AA 8CPAA 3D67A 5H86A 1BPMA 4NGMA 3EZEA 4ORFA 1S5KA 3TC8A 1BLLE 2B4JC 4CAXA 1V0CA 5DS0A 3NH8A 1WJTA 4OMEA 3VRPA 2F7VA 2PIYA 5ELYA 1QMUA 5LRJA 4A37A 1VBHA 2X0SA 3PFOA 4C8UA 4C68A 3EIFA 4KOWA 3RZAA 3KZWA 2FIAA 4MFKA 5I4MA 1P4NA 4K3NA 4ZBGA 3CXQA 2PE3A 4BPWB 3IWGA 3U88C 2AFZA 2V8GA 3PZJA 4CGOA 2J9AA 1IB1E 4KOTA 3CXSA 2ZW6A 2XPOA 3KKWA 4CGPA 1GYTA 3D68A 3PB9X 2YNCA 3IU2A 2CBLA 2C1CA 1R57A 4A95A 1CX8A 4AVCA 3VRRA 4NSQA 3G3SA 3IU1A 1ZG8A 3JUWA 1F2OA 3KHZA 3D7FA 1EO0A 2XEFA 1M44A 2PJ4A 3ICUA 2B3VA 2HC9A 3EZBA 4ZY1A 2AFSA 2Z3KA 2FM4A 2EVNA 2XPLA 3D3SA 2I3CA 2ZEEA 1OZPA 1MJ9A 3BUOB 3IIBA 3L2NA 4FD5A 4JD6A 4QVTA 5EMIA 1JWQA 1EZBA 2OB0A 1DIKA 1YVHA 3B3CA 3G23A 1V6CA 1IY7A 2ZEGA 3T0TA 3TO6A 3TCVA 3EO4A 1Q2YA 2PJ1A 3K9UA 4M85A 2RC4A 4UCNA 3BJ8A 3WT4A 2DEAA 4B12A 2DF5A 2QVPA 1SQHA 1Z8XA 4KORA 3O8ZA 2D4PA 1CM0A 3T8WA 4A32A 3R9FA 1I21A 4MHNA 2GP4A 4E5SA 2CTCA 2VQYA 4C9VA 3VRQA 2ARHA 3HLPA 2Z10A 1JDEA 4JXQA 3HPHE 4R76A 5CBMA 4F9VA 3TX8A 3BUMB 3F5BA 4OC0A 3N7ZA 1AYEA 4P4DA 5IV0A 4HNYB 2DPTA 2GREA 5CNPA 3WC7A 2HWGA 4KSIA 3T5MA 3FNCA 2Q4VA 3KR4A 4NGRA 3B35A 4RR2B 4L8AA 4UWIA 5AG7A 1U6MA 4OC4A 4IIYA 3PP9A 3TE4A 4BINA 2PJ0A 5LRGA 4IIXA 4CDKA 1MJBA 3IFEA 4TNUA 2FIWA 2GFQA 4JLYA 3BJ7A 2UV8G 5F49A 2VZYA 3TO7A 5D8NA 4INJA 2VL1A 1XRYA 2NSMA 4KS9A 2EK8A 4KSFA 1BO4A 4MHDA 4NJRA 4R9MA 3VARA 4CAFA 4F8ZA 2YJTA 3TLZA 3PFEA 5I0CA 3KQXA 4OKOA 2GLJA 2Q4ZA 2JLMA 1NBWA 3FJUA 1XFOA 2P6EA 4ONUA 5K8OA 2FVGA 1TKFA 4IUSA 1YVOA 4DJLA 5F13A 3IJ3A 2BSWA 1YGHA 3PB4X 2O4HA 2FCKA 5HH1A 4ZX8A 1CS0B 1YSJA 4PPZA 5G1ZA 1YLEA 1XJOA 4C85A 2JBJA 1IYLA 1ZG9A 4R3LA 2Q43A 4X5KA 3CXPA 3SI0A 4CAWA 1P0HA 1UWYA 4MBUA 2DPSA 2ZOFA 4RI1A 1B87A 5A28A 4C86A 1ZLHA 3SXNA 1GGOA 3RNZA 1L0CA 1Y9WA 2PR1A 2JEVA 4CYNA 3GKRA 4UF4A 2JDCA 4P10A 4CRYB 1XF1A 4C8FA 4Z65A 3C26A 2OU2A 2PJ5A 2Z3NA 1IIDA 4UA3A 4JZ0A 5J1QA 1Z5RA 4NCZA 3P2FA 4L89A 2J8MA 2BCOA 4MJ8A 4UCMA 1XIXA 2PVWA 4ZGYB 5HVGA 4FWUA 1KC7A 3W6XA 4R3KA 2ZEHA 5IX3A 2O28A 3KQZA 1Z4EA 4U9YA 4TJXA 4COBA 3FF3A 3IWWA 1HDUA 3RO0A 3UY5A 3OB2B 1LOKA 2QIRA 3SI1A 5J8CA 5HKZA 1DTDA 2HUZA 1HEEA 2JDDA 2D0OA 2PVVA 2V77A 1Z8WA 4PK3A 5EBVA 4C99A 4PQAA 1KEEB 1NMTA 4MFZA 5F9MA 5AG6A 4R87A 1C3OB 1AMPA 2OZHA 5DWNA 4OLLA 4Q7AA 3TLAA 2HB6A 5K99A 5H84A 1BOBA 3KI9A 1TKJA 1CE8B 4AVBA 3HMJG 1GHEA 3H8EA 1YW4A 3NFZA 5F47A 2OLSA 4MHZA 4COGA 1M4GA 2ZEPA 2R8VA 3NE8A 4MCPA 4UCPA 4CYOA 2PJBA 3C8OA 1OBRA 3OWCA 4P6YA 3V7ZA 3TOBA 4E8OA 4HKFA 2B0AA 3D7DA 3B3SA 2BUEA 1CP6A 5HMNA 3S9NA 4KSAA 5HKWA 4PXEA 2PJ7A 4B10A 5LYLA 3H5ZA 4NJQA 2PCNA 3CPXA 1Y0RA 4MFPA 4R57A 3K4IA 5CPAA 5DWMA 3ZZIA 5JH9A 4B13A 4PK2A 4B11A 4GPLB 3FRMA 2E28A 1UFHA 2IQ6A 2WZNA 4QUSA 2DLAA 2PJ2A 2OZUA 3PT1A 3FX6A 4PXCA 4MFLA 1M4LA 4U9ZA 1Z9UA 5EC4A 2VEZA 1YVKA 1YK3A 1B47A 2QMLA 2P0WA 1ZL0A 4OC2A 1Y7RA 1F2PA 2EBJA 3EY5A 4C7HA 5THWA 3WR7A 3RYOA 2R82A 1CP7A 1IGBA 1VHEA 3EXNA 3G8WA 4H6ZA 5F48A 3TLBA 2C6PA 4MI4A 3LACA 1JDBC 4OADA 4P44A 3TLEA 1YX0A 4FD6A 1YW6A 4PXDA 1XMBA 4CAEA 3S6KA 4KVME 3D4UA 4NGPA 1IOIA 3T9YA 4Q36A 4B14A 3B3VA 3GJZA 1LAMA 3PB6X 4H2KA 4XPLA 2Q7SA 1VGYA 5G21A 3K2KA 2IL4A 4F0YA 3BI0A 5LYDA 4AG7A 1ZG7A 4CGMA 3R9GA 2Q4YA 2PDOA 2Y0MA 2Z3LA 3BUNB 3CPAA 4PSXA 1XMTA 2WSAA 4DUKA 4OIDA 4A33A 1VI4A 2AFXA 2R1IA 3QNVA 4OP4A 1Y0YA 2VXKA 2O53A 3QB8A 4A31A 2BL1A 1PYTB 2FSRA 2PCUA 1XF8A 1B6BA 4M3SA 3LMSA 4Y49B 4F9UA 4AVAA 5K8PA 4DNCA 5JVLA 3DDDA 4CYPA 4UEEA 4DYOA 4TJVA 4JXRA 1BXRB 1Y9KA 4FBEA 3ZNIA 4MCSA 4MRIA 1XOVA 1KZFA 3PBEA 4CAVA 5BWAB 3NOJA 4YN3A 4B6ZA 3F9KC 3D7GA 4W9YA 3RBUA 3R95A 4FAIA 4MJXA 2OZGA 2YNDA 3S6GA 2EO8A 4QC6A 4KOVA 2GLFA 1PUAA 3HUVA 4KOXA 4CRZB 5JQ4A 3FH4A 4HNXB 1VBGA 3V8IA 3K9TA 3SHPA 5KTDA 2PQ8A 4C2YA 4Y49C 4KNGE 3PFVA 4XPDB 3N5FA 3E0KA 5IB9A 1WVMA 3SJXA 3TLGB 4OC1A 3MN8A 2AFUA 2J8NA 5C82A 2YNEA 3S6HA 4Q38A 4MHPA 4EMEA 2BO9A 4R6TA 4II9A 1ZYMA 3GB0A 4JJXA 3W6SA 3EFAA 2HI6A 2ZELA 4C7IA 3P2HA 2Z0ZA 2CNMA 2DXQA 3KGQA 4YWYA 1FY7A 1LFWA 1VIXA 2F5IA 1Y9ZA 4JVOA 3TLCA 1LCPA 2Z3OA 3ISZA 5GCNA 4CPAA 2KCWA 4C8TA 3BI1A 2GU2A 4UIBA 4XPDC 1N71A 2ZEDA 1I12A 2QYVA 3S9MA 1QSOA 1Z8TA 4GXHA 4OIWA 4PSWA 1CJWA 3IO1A 4NF1A 4C9AA 4BPXB 2BOAA 2NMTA 2R98A 4P4BA 4IK2A 1C30B 1M6VB 3OAKA 2ZW4A 2WYRA 4LUAA 2FS5A 3SJEA 3PBBA 2PRQA 2AJ6A 4J3GA 5AG5A 2C5QA 3F0AA 3GY9A 1A2ZA 2FT0A 4A94A 2ZW7A 1Y7EA 5LYFA 3GYAA 3SJFA 4KUBA 1KBLA 4JWPA 4KUAA 3KL9A 2R7HA 4IF5A 2HROA 2XPNA 1QSMA 2B3UA 3ZJ0A 3I9SA 3F8KA 4MCRA 1JQGA 2HV2A 3MRUA 3NFQA 1QQ9A 2VKZG 5HVHA 2PJ3A 1CG2A 5J3XA 2X7BA 4E0AA 3B2YA 1XEBA 2AFOA 1LRZA 5LYIA 4WWVA 2AE6A 3KR5A 4A38A 1ON0A 3BUXB 5F5XA 1KUVA 2A4NA 4X3RA 2GE3A 4X2TA 2EZBA 4ZY2A 2DIKA 3VATA 3DR8A 2XEJA 4HNWB 4P4IA 3HPGG 4P45A 1QSTA 3D66A 5J8FA 3S6FA 3TLGA 1S7FA 4A4BA 3B8GA 4RUHA 1FT7A 3I6SA 4IHMA 4C8PA 2ZXVA 1WWZA 1S7NA 4BMHA 2VBQA 3DR6A 2P6FA 3B7IA 3R1KA 4A2ZA 4H6UA 1XE4A 3WC5A 3T05A 2EZCA 2CNSA 2ANPA 1KUXA 5AGEA 4B5PA 4E2AA 5JM6A 2PJ6A 3VGOA 3FEEA 1TKHA 2WPWA 3WC6A 4RN7A 1J3LA 4HPSA 3V38A 2IMOA 7CPAA 2EZAA 4KVXA 1R3NA 4KLVA 4KOYA 3D7HA 2JEWA 5F46A 2CF4A 4UFXA 1TF8A 2I79A 3TYXA 2PJAA 4JYWA 1R43A 4EVYA 3BHXA 4K30A 3SXOA 5C88A 1RXTA 4LQ6A 5HVFA 3CDXA 5AXIA 1Q2DA 4BD9A 5AG4A 3EZAA 4H1HA 4CZ1A 4AXVA 1ARMA 1J4JA 2PIZA 2CXAA 4GM5A 3GLJA 3PEIA 3FECA 2FE7A 4BBHA 4ZYQA 2C6CA 1IYKA 3FB3A 4R7MA 3OB1B 2CY2A 4CS0B 1NSAA 4ZI6A 5JPHA 1Z9EA 4OC3A 3VWEA 2ABZA 1R61A 3ISXA 4A4CA 1S60A 4UIAA 2Z11A 5A27A 3TTHA 4IAVA 5KTAA
chains in the Genus database with same CATH topology
3FVLA 5HXDA 1CPSA 3PB8X 4UEZA 1FNOA 1XBUA 4MCQA 4YU9A 4MHYA 4R8FA 4C9UA 4P4EA 2ZENA 3NH4A 1TXRA 3PB7X 1CBXA 1Z8LA 2RB7A 1EE3P 1TF9A 1ELLP 4NFRA 2G9DA 3CT9A 3S9LA 2PJ8A 4P4JA 4EFDA 1BPNA 4OC5A 5K8NA 1YMEA 3FMCA 3BXMA 4G1PA 5K8MA 4X8IA 4C8CA 2V8HA 2POKA 4ZX9A 4C9EA 2CIJA 2XEGA 4NGNA 4NGSA 4A39A 3VTAA 3KHXA 5LRKA 2V8DA 2ZEMA 4MXUA 3H8GA 3GUXA 2V8VA 2ZEOA 1BAVA 6CPAA 1LANA 4CDJA 1KWMA 2ZOGA 4C84A 2F8HA 2AFWA 3DLJA 2PJCA 1CPXA 2XEIA 2Q51A 1VHOA 3JRUA 3B3TA 3WABA 1RTQA 4MMOA 2ZEFA 2RFHA 3IEHA 1ZLIA 1YLOA 3B3WA 2EK9A 3NH5A 4O23A 2QJ8A 4WJBA 2OR4A 1Z2LA 1LAPA 4ONWA 2PJ9A 4P4FA 4LQGA 4PXBA 4TWEA 2OOTA 3LWUA 2CTBA 2C6GA 3DGVA 4UEFA 1HDQA 4TNUA 2NYQA 3FEDA 4NGQA 3IC1A 2AFMA 3SJGA 2EWBA 4ZY0A 4EWTA 1F57A 1Q7LA 1PCAA 2JBKA 1ARLA 3KASA 3H8FA 5D29A 5F09A 5IR2A 2IJZA 1DE4C 1H8LA 4C9RA 3VH9A 3RAMA 4NGTA 3I1UA 4FUUA 3SI2A 3PRTA 5JGFA 3NA6A 1ELMP 4C8AA 8CPAA 3D67A 1BPMA 4NGMA 3TC8A 1BLLE 5DS0A 3NH8A 4OMEA 2F7VA 2PIYA 4C8UA 5ELYA 1QMUA 5LRJA 4A37A 3PFOA 3EIFA 3RZAA 3KZWA 5I4MA 4K3NA 2PE3A 2AFZA 2V8GA 2J9AA 1GYTA 3D68A 3PB9X 2C1CA 1CX8A 1ZG8A 1F2OA 3KHZA 3D7FA 2XEFA 2PJ4A 3ICUA 2HC9A 4ZY1A 2AFSA 2I3CA 2ZEEA 3IIBA 3L2NA 3B3CA 1V6CA 1IY7A 2ZEGA 2PJ1A 3WT4A 2DEAA 2QVPA 3T8WA 2GP4A 4MHNA 2CTCA 4C9VA 3HLPA 4R76A 5CBMA 4F9VA 3TX8A 4OC0A 1AYEA 4P4DA 2GREA 3WC7A 4KSIA 3KR4A 4NGRA 3B35A 4OC4A 2PJ0A 5LRGA 4CDKA 3IFEA 5D8NA 2VL1A 1XRYA 2NSMA 2EK8A 4NJRA 3VARA 4F8ZA 3PFEA 3KQXA 4OKOA 2GLJA 2Q4ZA 3FJUA 1XFOA 5K8OA 2FVGA 1TKFA 4DJLA 3IJ3A 3PB4X 2O4HA 4ZX8A 1YSJA 4PPZA 1XJOA 4C85A 2JBJA 1ZG9A 2Q43A 3SI0A 1UWYA 2ZOFA 4C86A 1ZLHA 4UF4A 4C8FA 4P10A 1XF1A 4Z65A 2PJ5A 4JZ0A 5J1QA 1Z5RA 2BCOA 2PVWA 5HVGA 4FWUA 2ZEHA 3KQZA 4TJXA 3FF3A 3IWWA 1HDUA 1LOKA 3SI1A 1DTDA 1HEEA 2PVVA 2V77A 4PQAA 1AMPA 4Q7AA 2HB6A 3KI9A 1TKJA 3NFZA 3H8EA 1YW4A 4MHZA 2ZEPA 4MCPA 2PJBA 1OBRA 4P6YA 3V7ZA 3D7DA 3B3SA 1CP6A 3S9NA 4PXEA 2PJ7A 5LYLA 4NJQA 3CPXA 1Y0RA 5CPAA 5JH9A 2IQ6A 2WZNA 2PJ2A 3FX6A 4PXCA 1M4LA 4OC2A 1F2PA 5THWA 1CP7A 1IGBA 1VHEA 2C6PA 4P44A 1YW6A 4PXDA 1XMBA 3D4UA 4NGPA 3B3VA 1LAMA 3PB6X 4H2KA 1VGYA 3K2KA 3BI0A 5LYDA 1ZG7A 3CPAA 4DUKA 4OIDA 2AFXA 3QNVA 4OP4A 1Y0YA 2O53A 1PYTB 2PCUA 3LMSA 4F9UA 5K8PA 4DYOA 4UEEA 4TJVA 4FBEA 4MCSA 4MRIA 3PBEA 4YN3A 4B6ZA 3D7GA 4W9YA 3RBUA 4FAIA 2GLFA 3HUVA 3FH4A 3K9TA 4KNGE 3N5FA 5IB9A 1WVMA 3SJXA 4OC1A 3MN8A 2AFUA 4EMEA 4MHPA 2BO9A 4R6TA 3GB0A 2ZELA 1Y9ZA 4YWYA 3KGQA 1LFWA 1VIXA 1LCPA 3ISZA 4CPAA 4C8TA 3BI1A 2GU2A 4UIBA 2ZEDA 4OIWA 2QYVA 3S9MA 4C9AA 3IO1A 2BOAA 4P4BA 4IK2A 2WYRA 3SJEA 3PBBA 2PRQA 2C5QA 4A94A 1Y7EA 5LYFA 3SJFA 3KL9A 4MCRA 1JQGA 3MRUA 1QQ9A 5HVHA 2PJ3A 1CG2A 3B2YA 2AFOA 5LYIA 4WWVA 3KR5A 4A38A 4X3RA 4X2TA 4ZY2A 3VATA 2XEJA 4P4IA 4P45A 3D66A 4RUHA 1FT7A 3I6SA 4IHMA 4C8PA 3B7IA 3WC5A 2ANPA 5JM6A 2PJ6A 3FEEA 1TKHA 3WC6A 3V38A 2IMOA 7CPAA 1R3NA 3D7HA 2JEWA 2CF4A 1TF8A 2PJAA 4JYWA 1R43A 3BHXA 5HVFA 4BD9A 3CDXA 4AXVA 1ARMA 2PIZA 4GM5A 4ZYQA 3GLJA 3PEIA 3FECA 3I74A 2C6CA 4R7MA 1NSAA 4ZI6A 4OC3A 2ABZA 3ISXA 4UIAA 4C99A 4IAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVL A;  5HXD A;  1CPS A;  3PB8 X;  4UEZ A;  1FNO A;  1XBU A;  4MCQ A;  4YU9 A;  4MHY A;  4R8F A;  4C9U A;  4P4E A;  2ZEN A;  3NH4 A;  1TXR A;  3PB7 X;  1CBX A;  1Z8L A;  2RB7 A;  1EE3 P;  1TF9 A;  1ELL P;  4NFR A;  2G9D A;  3CT9 A;  3S9L A;  2PJ8 A;  4P4J A;  4EFD A;  1BPN A;  4OC5 A;  5K8N A;  1YME A;  3FMC A;  3BXM A;  4G1P A;  5K8M A;  4X8I A;  4C8C A;  2V8H A;  2POK A;  4ZX9 A;  4C9E A;  2CIJ A;  2XEG A;  4NGN A;  4NGS A;  4A39 A;  3VTA A;  3KHX A;  5LRK A;  2V8D A;  2ZEM A;  4MXU A;  3H8G A;  3GUX A;  2V8V A;  2ZEO A;  1BAV A;  6CPA A;  1LAN A;  4CDJ A;  1KWM A;  2ZOG A;  4C84 A;  2F8H A;  2AFW A;  3DLJ A;  2PJC A;  1CPX A;  2XEI A;  2Q51 A;  1VHO A;  3JRU A;  3B3T A;  3WAB A;  1RTQ A;  4MMO A;  2ZEF A;  2RFH A;  3IEH A;  1ZLI A;  1YLO A;  3B3W A;  2EK9 A;  3NH5 A;  4O23 A;  2QJ8 A;  4WJB A;  2OR4 A;  1Z2L A;  1LAP A;  4ONW A;  2PJ9 A;  4P4F A;  4LQG A;  4PXB A;  4TWE A;  2OOT A;  3LWU A;  2CTB A;  2C6G A;  3DGV A;  4UEF A;  1HDQ A;  4TNU A;  2NYQ A;  3FED A;  4NGQ A;  3IC1 A;  2AFM A;  3SJG A;  2EWB A;  4ZY0 A;  4EWT A;  1F57 A;  1Q7L A;  1PCA A;  2JBK A;  1ARL A;  3KAS A;  3H8F A;  5D29 A;  5F09 A;  2IJZ A;  1DE4 C;  1H8L A;  4C9R A;  3VH9 A;  3RAM A;  4NGT A;  3I1U A;  4FUU A;  3SI2 A;  3PRT A;  5JGF A;  3NA6 A;  1ELM P;  4C8A A;  8CPA A;  3D67 A;  1BPM A;  4NGM A;  3TC8 A;  1BLL E;  5DS0 A;  3NH8 A;  4OME A;  2F7V A;  2PIY A;  4C8U A;  5ELY A;  1QMU A;  5LRJ A;  4A37 A;  3PFO A;  3EIF A;  3RZA A;  3KZW A;  5I4M A;  4K3N A;  2PE3 A;  2AFZ A;  2V8G A;  2J9A A;  1GYT A;  3D68 A;  3PB9 X;  2C1C A;  1CX8 A;  1ZG8 A;  1F2O A;  3KHZ A;  3D7F A;  2XEF A;  2PJ4 A;  3ICU A;  2HC9 A;  4ZY1 A;  2AFS A;  2I3C A;  2ZEE A;  3IIB A;  3L2N A;  3B3C A;  1V6C A;  1IY7 A;  2ZEG A;  2PJ1 A;  3WT4 A;  2DEA A;  2QVP A;  3T8W A;  4MHN A;  2CTC A;  4C9V A;  3HLP A;  4R76 A;  5CBM A;  4F9V A;  3TX8 A;  4OC0 A;  1AYE A;  4P4D A;  2GRE A;  3WC7 A;  4KSI A;  3KR4 A;  4NGR A;  3B35 A;  4OC4 A;  2PJ0 A;  5LRG A;  4CDK A;  3IFE A;  5D8N A;  2VL1 A;  1XRY A;  2NSM A;  2EK8 A;  4NJR A;  3VAR A;  4F8Z A;  3PFE A;  3KQX A;  4OKO A;  2GLJ A;  2Q4Z A;  3FJU A;  1XFO A;  5K8O A;  2FVG A;  1TKF A;  4DJL A;  3IJ3 A;  3PB4 X;  2O4H A;  4ZX8 A;  1YSJ A;  4PPZ A;  1XJO A;  4C85 A;  2JBJ A;  1ZG9 A;  2Q43 A;  3SI0 A;  1UWY A;  2ZOF A;  4C86 A;  1ZLH A;  4UF4 A;  4C8F A;  4P10 A;  1XF1 A;  4Z65 A;  2PJ5 A;  4JZ0 A;  5J1Q A;  1Z5R A;  2BCO A;  2PVW A;  5HVG A;  4FWU A;  2ZEH A;  3KQZ A;  4TJX A;  3FF3 A;  3IWW A;  1HDU A;  1LOK A;  3SI1 A;  1DTD A;  1HEE A;  2PVV A;  2V77 A;  4PQA A;  1AMP A;  4Q7A A;  2HB6 A;  3KI9 A;  1TKJ A;  3NFZ A;  3H8E A;  1YW4 A;  4MHZ A;  2ZEP A;  4MCP A;  2PJB A;  1OBR A;  4P6Y A;  3V7Z A;  3D7D A;  3B3S A;  1CP6 A;  3S9N A;  4PXE A;  2PJ7 A;  5LYL A;  4NJQ A;  3CPX A;  1Y0R A;  5CPA A;  5JH9 A;  2IQ6 A;  2WZN A;  2PJ2 A;  3FX6 A;  4PXC A;  1M4L A;  4OC2 A;  1F2P A;  5THW A;  1CP7 A;  1IGB A;  1VHE A;  2C6P A;  4P44 A;  1YW6 A;  4PXD A;  1XMB A;  3D4U A;  4NGP A;  3B3V A;  1LAM A;  3PB6 X;  4H2K A;  1VGY A;  3K2K A;  3BI0 A;  5LYD A;  1ZG7 A;  3CPA A;  4DUK A;  4OID A;  2AFX A;  3QNV A;  4OP4 A;  1Y0Y A;  2O53 A;  1PYT B;  2PCU A;  3LMS A;  4F9U A;  5K8P A;  4DYO A;  4UEE A;  4TJV A;  4FBE A;  4MCS A;  4MRI A;  3PBE A;  4YN3 A;  4B6Z A;  3D7G A;  4W9Y A;  3RBU A;  4FAI A;  2GLF A;  3HUV A;  3FH4 A;  3K9T A;  4KNG E;  3N5F A;  5IB9 A;  1WVM A;  3SJX A;  4OC1 A;  3MN8 A;  2AFU A;  4EME A;  4MHP A;  2BO9 A;  4R6T A;  3GB0 A;  2ZEL A;  1Y9Z A;  4YWY A;  3KGQ A;  1LFW A;  1VIX A;  1LCP A;  3ISZ A;  4CPA A;  4C8T A;  3BI1 A;  2GU2 A;  4UIB A;  2ZED A;  4OIW A;  2QYV A;  3S9M A;  4C9A A;  3IO1 A;  2BOA A;  4P4B A;  4IK2 A;  2WYR A;  3SJE A;  3PBB A;  2PRQ A;  4A94 A;  1Y7E A;  5LYF A;  3SJF A;  3KL9 A;  4MCR A;  1JQG A;  3MRU A;  1QQ9 A;  5HVH A;  2PJ3 A;  1CG2 A;  3B2Y A;  2AFO A;  5LYI A;  4WWV A;  3KR5 A;  4A38 A;  4X3R A;  4X2T A;  4ZY2 A;  3VAT A;  2XEJ A;  4P4I A;  4P45 A;  3D66 A;  4RUH A;  1FT7 A;  3I6S A;  4IHM A;  4C8P A;  3B7I A;  3WC5 A;  2ANP A;  5JM6 A;  2PJ6 A;  3FEE A;  1TKH A;  3WC6 A;  3V38 A;  2IMO A;  7CPA A;  1R3N A;  3D7H A;  2JEW A;  2CF4 A;  1TF8 A;  2PJA A;  4JYW A;  1R43 A;  3BHX A;  5HVF A;  4BD9 A;  3CDX A;  4AXV A;  1ARM A;  2PIZ A;  4GM5 A;  4ZYQ A;  3GLJ A;  3PEI A;  3FEC A;  3I74 A;  2C6C A;  4R7M A;  1NSA A;  4ZI6 A;  4OC3 A;  2ABZ A;  3ISX A;  4UIA A;  4C99 A;  4IAV A; 
#chains in the Genus database with same CATH topology
 4KOU A;  2WPX A;  5ISV A;  3JTK A;  1ZO0 A;  5G20 A;  3KRV A;  3NE7 A;  5FVJ A;  2OH1 A;  3FVL A;  5HXD A;  2B5G A;  1CPS A;  1Q5X A;  3FIX A;  3PB8 X;  2ODF A;  4UEZ A;  3EC4 A;  1FNO A;  1XBU A;  4MCQ A;  4YU9 A;  2PRB A;  4MHY A;  4C2X A;  1YR0 A;  4R8F A;  4C9U A;  4P4E A;  4CYQ A;  2ZEN A;  3W91 A;  3NH4 A;  3VRO A;  5F1Y A;  1IIC A;  1TXR A;  1CBX A;  2REE A;  3PB7 X;  1Z8L A;  4KVO E;  2EUI A;  2PC1 A;  2RB7 A;  3FXT A;  1EE3 P;  1TF9 A;  1ELL P;  2HQY A;  1K4J A;  4KLW A;  2G9D A;  3CT9 A;  4H89 A;  3S9L A;  2GIV A;  4NFR A;  2PJ8 A;  4KZT A;  4P4J A;  3LD2 A;  4EFD A;  1BPN A;  4OC5 A;  4XPK A;  4A30 A;  5K8N A;  1MJA A;  1YME A;  3FMC A;  3MGD A;  4B5O A;  4YFJ A;  3BXM A;  2PSW A;  4XNH B;  4CGN A;  4G1P A;  5K8M A;  4LX9 A;  4X8I A;  4NEX A;  2CNT A;  1S3Z A;  4C8C A;  1PU9 A;  2V8H A;  1EZA A;  2FXF A;  2POK A;  4ZX9 A;  4C9E A;  3PGP A;  3FBU A;  4UBR A;  2B4D A;  2CIJ A;  2XEG A;  1S7K A;  2D0P A;  4NGN A;  1M4I A;  4NGS A;  2MP0 A;  1AUG A;  4A39 A;  2AUN A;  4F0X A;  3VTA A;  2REF A;  3KHX A;  4F6A A;  2G0B A;  5LRK A;  4U5Y A;  2V8D A;  2ZEM A;  4MXU A;  4FD7 A;  3H8G A;  4BPU B;  2Y1N A;  1I1D A;  5JYB A;  3GUX A;  2V8V A;  2ZEO A;  2Z3M A;  3U1B A;  2Y1M A;  4XNH C;  2ZW5 A;  3TO9 A;  4M8D A;  1QSN A;  1BAV A;  3I74 A;  6CPA A;  2ATR A;  2B4B A;  1LAN A;  2D4O A;  4B5P B;  1S7L A;  4CDJ A;  1KWM A;  2ZOG A;  4C84 A;  2F8H A;  4AB7 A;  2P6G A;  2Z3P A;  2ZPA A;  2AFW A;  3IGR A;  3R96 A;  2XPP A;  5HKY A;  3DLJ A;  4UWJ A;  2PJC A;  2YGW A;  3GIU A;  1CPX A;  2GAN A;  5IB0 A;  3VRN A;  1X12 A;  2XEI A;  1M4D A;  2Q51 A;  2Q7B A;  2J8R A;  4CGL A;  1VHO A;  3JRU A;  3B3T A;  4MFJ A;  3TFY A;  3QAH A;  1MK4 A;  1RO5 A;  3WAB A;  3BLN A;  1RTQ A;  1T36 B;  5FD8 A;  4MMO A;  2ZEF A;  2RFH A;  3IEH A;  1ZLI A;  2WUU A;  3I3G A;  1ZRS A;  2Q04 A;  2AUM A;  1YLO A;  3OP0 A;  4NXY A;  3B3W A;  2EK9 A;  3NH5 A;  4O23 A;  2QJ8 A;  3PLF B;  4WJB A;  2OR4 A;  1Z4R A;  2Q44 A;  3JVN A;  1Z2L A;  4UFV A;  1LAP A;  4YGO A;  3VWD A;  4ONW A;  4MY0 A;  3D2P A;  5E96 A;  2QEC A;  2PJ9 A;  4P4F A;  1QSR A;  4LQG A;  3LOD A;  3DNS A;  4PXB A;  4TWE A;  2OOT A;  3TOA A;  3IWE A;  2G3T A;  1M1D A;  3LWU A;  1Q2C A;  4OAE A;  4E94 A;  2CTB A;  2PR8 A;  2C6G A;  2VZZ A;  3DGV A;  4UEF A;  1HDQ A;  1X10 A;  1YRE A;  2NYQ A;  4KOS A;  5BY0 A;  2B58 A;  2B5G B;  3FED A;  1VHS A;  1FBV A;  3H4Q A;  4NGQ A;  3IC1 A;  2AFM A;  3SJG A;  2EWB A;  4ZY0 A;  4QB9 A;  4EWT A;  3D8P A;  2N3A B;  1F57 A;  1Q7L A;  4I49 A;  4BTF A;  1YQE A;  2Q0Y A;  1NSL A;  4CO9 A;  1PCA A;  2VI7 A;  4M6G A;  4C2Z A;  4EYS A;  2JBK A;  1ARL A;  3TT2 A;  3D2M A;  3DSB A;  3T07 A;  2I00 A;  3T90 A;  3KAS A;  1IU8 A;  1NE9 A;  4PV6 A;  3FYN A;  3H8F A;  2YJV A;  2G3A A;  5D29 A;  5F09 A;  3CZX A;  4GS4 A;  5IR2 A;  2IJZ A;  4QBJ A;  2K5T A;  3QAY A;  1DE4 C;  1H8L A;  4FD4 A;  4M6H A;  3TLY A;  4C9R A;  4YRH A;  3BUW B;  1NXJ A;  4M6I A;  1VKC A;  3A9L A;  3VH9 A;  1A9X B;  5KTC A;  1KUY A;  3RAM A;  2B4D B;  5G22 A;  2YNC C;  3SR3 A;  3R9E A;  2BEI A;  4AG9 A;  4UFW A;  1WK4 A;  1TIQ A;  4NGT A;  3I1U A;  4FUU A;  3SI2 A;  3PRT A;  4MI1 A;  5JGF A;  4MFQ A;  2C27 A;  2FL4 A;  1IOF A;  3NA6 A;  4RS2 A;  2H5M A;  4J0N A;  1ELM P;  4MY3 A;  4C8A A;  8CPA A;  3D67 A;  5H86 A;  1BPM A;  4NGM A;  3EZE A;  4ORF A;  1S5K A;  3TC8 A;  1BLL E;  2B4J C;  4CAX A;  1V0C A;  5DS0 A;  3NH8 A;  1WJT A;  4OME A;  3VRP A;  2F7V A;  2PIY A;  5ELY A;  1QMU A;  5LRJ A;  4A37 A;  1VBH A;  2X0S A;  3PFO A;  4C8U A;  4C68 A;  3EIF A;  4KOW A;  3RZA A;  3KZW A;  2FIA A;  4MFK A;  5I4M A;  1P4N A;  4K3N A;  4ZBG A;  3CXQ A;  2PE3 A;  4BPW B;  3IWG A;  3U88 C;  2AFZ A;  2V8G A;  3PZJ A;  4CGO A;  2J9A A;  1IB1 E;  4KOT A;  3CXS A;  2ZW6 A;  2XPO A;  3KKW A;  4CGP A;  1GYT A;  3D68 A;  3PB9 X;  2YNC A;  3IU2 A;  2CBL A;  2C1C A;  1R57 A;  4A95 A;  1CX8 A;  4AVC A;  3VRR A;  4NSQ A;  3G3S A;  3IU1 A;  1ZG8 A;  3JUW A;  1F2O A;  3KHZ A;  3D7F A;  1EO0 A;  2XEF A;  1M44 A;  2PJ4 A;  3ICU A;  2B3V A;  2HC9 A;  3EZB A;  4ZY1 A;  2AFS A;  2Z3K A;  2FM4 A;  2EVN A;  2XPL A;  3D3S A;  2I3C A;  2ZEE A;  1OZP A;  1MJ9 A;  3BUO B;  3IIB A;  3L2N A;  4FD5 A;  4JD6 A;  4QVT A;  5EMI A;  1JWQ A;  1EZB A;  2OB0 A;  1DIK A;  1YVH A;  3B3C A;  3G23 A;  1V6C A;  1IY7 A;  2ZEG A;  3T0T A;  3TO6 A;  3TCV A;  3EO4 A;  1Q2Y A;  2PJ1 A;  3K9U A;  4M85 A;  2RC4 A;  4UCN A;  3BJ8 A;  3WT4 A;  2DEA A;  4B12 A;  2DF5 A;  2QVP A;  1SQH A;  1Z8X A;  4KOR A;  3O8Z A;  2D4P A;  1CM0 A;  3T8W A;  4A32 A;  3R9F A;  1I21 A;  4MHN A;  2GP4 A;  4E5S A;  2CTC A;  2VQY A;  4C9V A;  3VRQ A;  2ARH A;  3HLP A;  2Z10 A;  1JDE A;  4JXQ A;  3HPH E;  4R76 A;  5CBM A;  4F9V A;  3TX8 A;  3BUM B;  3F5B A;  4OC0 A;  3N7Z A;  1AYE A;  4P4D A;  5IV0 A;  4HNY B;  2DPT A;  2GRE A;  5CNP A;  3WC7 A;  2HWG A;  4KSI A;  3T5M A;  3FNC A;  2Q4V A;  3KR4 A;  4NGR A;  3B35 A;  4RR2 B;  4L8A A;  4UWI A;  5AG7 A;  1U6M A;  4OC4 A;  4IIY A;  3PP9 A;  3TE4 A;  4BIN A;  2PJ0 A;  5LRG A;  4IIX A;  4CDK A;  1MJB A;  3IFE A;  4TNU A;  2FIW A;  2GFQ A;  4JLY A;  3BJ7 A;  2UV8 G;  5F49 A;  2VZY A;  3TO7 A;  5D8N A;  4INJ A;  2VL1 A;  1XRY A;  2NSM A;  4KS9 A;  2EK8 A;  4KSF A;  1BO4 A;  4MHD A;  4NJR A;  4R9M A;  3VAR A;  4CAF A;  4F8Z A;  2YJT A;  3TLZ A;  3PFE A;  5I0C A;  3KQX A;  4OKO A;  2GLJ A;  2Q4Z A;  2JLM A;  1NBW A;  3FJU A;  1XFO A;  2P6E A;  4ONU A;  5K8O A;  2FVG A;  1TKF A;  4IUS A;  1YVO A;  4DJL A;  5F13 A;  3IJ3 A;  2BSW A;  1YGH A;  3PB4 X;  2O4H A;  2FCK A;  5HH1 A;  4ZX8 A;  1CS0 B;  1YSJ A;  4PPZ A;  5G1Z A;  1YLE A;  1XJO A;  4C85 A;  2JBJ A;  1IYL A;  1ZG9 A;  4R3L A;  2Q43 A;  4X5K A;  3CXP A;  3SI0 A;  4CAW A;  1P0H A;  1UWY A;  4MBU A;  2DPS A;  2ZOF A;  4RI1 A;  1B87 A;  5A28 A;  4C86 A;  1ZLH A;  3SXN A;  1GGO A;  3RNZ A;  1L0C A;  1Y9W A;  2PR1 A;  2JEV A;  4CYN A;  3GKR A;  4UF4 A;  2JDC A;  4P10 A;  4CRY B;  1XF1 A;  4C8F A;  4Z65 A;  3C26 A;  2OU2 A;  2PJ5 A;  2Z3N A;  1IID A;  4UA3 A;  4JZ0 A;  5J1Q A;  1Z5R A;  4NCZ A;  3P2F A;  4L89 A;  2J8M A;  2BCO A;  4MJ8 A;  4UCM A;  1XIX A;  2PVW A;  4ZGY B;  5HVG A;  4FWU A;  1KC7 A;  3W6X A;  4R3K A;  2ZEH A;  5IX3 A;  2O28 A;  3KQZ A;  1Z4E A;  4U9Y A;  4TJX A;  4COB A;  3FF3 A;  3IWW A;  1HDU A;  3RO0 A;  3UY5 A;  3OB2 B;  1LOK A;  2QIR A;  3SI1 A;  5J8C A;  5HKZ A;  1DTD A;  2HUZ A;  1HEE A;  2JDD A;  2D0O A;  2PVV A;  2V77 A;  1Z8W A;  4PK3 A;  5EBV A;  4C99 A;  4PQA A;  1KEE B;  1NMT A;  4MFZ A;  5F9M A;  5AG6 A;  4R87 A;  1C3O B;  1AMP A;  2OZH A;  5DWN A;  4OLL A;  4Q7A A;  3TLA A;  2HB6 A;  5K99 A;  5H84 A;  1BOB A;  3KI9 A;  1TKJ A;  1CE8 B;  4AVB A;  3HMJ G;  1GHE A;  3H8E A;  1YW4 A;  3NFZ A;  5F47 A;  2OLS A;  4MHZ A;  4COG A;  1M4G A;  2ZEP A;  2R8V A;  3NE8 A;  4MCP A;  4UCP A;  4CYO A;  2PJB A;  3C8O A;  1OBR A;  3OWC A;  4P6Y A;  3V7Z A;  3TOB A;  4E8O A;  4HKF A;  2B0A A;  3D7D A;  3B3S A;  2BUE A;  1CP6 A;  5HMN A;  3S9N A;  4KSA A;  5HKW A;  4PXE A;  2PJ7 A;  4B10 A;  5LYL A;  3H5Z A;  4NJQ A;  2PCN A;  3CPX A;  1Y0R A;  4MFP A;  4R57 A;  3K4I A;  5CPA A;  5DWM A;  3ZZI A;  5JH9 A;  4B13 A;  4PK2 A;  4B11 A;  4GPL B;  3FRM A;  2E28 A;  1UFH A;  2IQ6 A;  2WZN A;  4QUS A;  2DLA A;  2PJ2 A;  2OZU A;  3PT1 A;  3FX6 A;  4PXC A;  4MFL A;  1M4L A;  4U9Z A;  1Z9U A;  5EC4 A;  2VEZ A;  1YVK A;  1YK3 A;  1B47 A;  2QML A;  2P0W A;  1ZL0 A;  4OC2 A;  1Y7R A;  1F2P A;  2EBJ A;  3EY5 A;  4C7H A;  5THW A;  3WR7 A;  3RYO A;  2R82 A;  1CP7 A;  1IGB A;  1VHE A;  3EXN A;  3G8W A;  4H6Z A;  5F48 A;  3TLB A;  2C6P A;  4MI4 A;  3LAC A;  1JDB C;  4OAD A;  4P44 A;  3TLE A;  1YX0 A;  4FD6 A;  1YW6 A;  4PXD A;  1XMB A;  4CAE A;  3S6K A;  4KVM E;  3D4U A;  4NGP A;  1IOI A;  3T9Y A;  4Q36 A;  4B14 A;  3B3V A;  3GJZ A;  1LAM A;  3PB6 X;  4H2K A;  4XPL A;  2Q7S A;  1VGY A;  5G21 A;  3K2K A;  2IL4 A;  4F0Y A;  3BI0 A;  5LYD A;  4AG7 A;  1ZG7 A;  4CGM A;  3R9G A;  2Q4Y A;  2PDO A;  2Y0M A;  2Z3L A;  3BUN B;  3CPA A;  4PSX A;  1XMT A;  2WSA A;  4DUK A;  4OID A;  4A33 A;  1VI4 A;  2AFX A;  2R1I A;  3QNV A;  4OP4 A;  1Y0Y A;  2VXK A;  2O53 A;  3QB8 A;  4A31 A;  2BL1 A;  1PYT B;  2FSR A;  2PCU A;  1XF8 A;  1B6B A;  4M3S A;  3LMS A;  4Y49 B;  4F9U A;  4AVA A;  5K8P A;  4DNC A;  5JVL A;  3DDD A;  4CYP A;  4UEE A;  4DYO A;  4TJV A;  4JXR A;  1BXR B;  1Y9K A;  4FBE A;  3ZNI A;  4MCS A;  4MRI A;  1XOV A;  1KZF A;  3PBE A;  4CAV A;  5BWA B;  3NOJ A;  4YN3 A;  4B6Z A;  3F9K C;  3D7G A;  4W9Y A;  3RBU A;  3R95 A;  4FAI A;  4MJX A;  2OZG A;  2YND A;  3S6G A;  2EO8 A;  4QC6 A;  4KOV A;  2GLF A;  1PUA A;  3HUV A;  4KOX A;  4CRZ B;  5JQ4 A;  3FH4 A;  4HNX B;  1VBG A;  3V8I A;  3K9T A;  3SHP A;  5KTD A;  2PQ8 A;  4C2Y A;  4Y49 C;  4KNG E;  3PFV A;  4XPD B;  3N5F A;  3E0K A;  5IB9 A;  1WVM A;  3SJX A;  3TLG B;  4OC1 A;  3MN8 A;  2AFU A;  2J8N A;  5C82 A;  2YNE A;  3S6H A;  4Q38 A;  4MHP A;  4EME A;  2BO9 A;  4R6T A;  4II9 A;  1ZYM A;  3GB0 A;  4JJX A;  3W6S A;  3EFA A;  2HI6 A;  2ZEL A;  4C7I A;  3P2H A;  2Z0Z A;  2CNM A;  2DXQ A;  3KGQ A;  4YWY A;  1FY7 A;  1LFW A;  1VIX A;  2F5I A;  1Y9Z A;  4JVO A;  3TLC A;  1LCP A;  2Z3O A;  3ISZ A;  5GCN A;  4CPA A;  2KCW A;  4C8T A;  3BI1 A;  2GU2 A;  4UIB A;  4XPD C;  1N71 A;  2ZED A;  1I12 A;  2QYV A;  3S9M A;  1QSO A;  1Z8T A;  4GXH A;  4OIW A;  4PSW A;  1CJW A;  3IO1 A;  4NF1 A;  4C9A A;  4BPX B;  2BOA A;  2NMT A;  2R98 A;  4P4B A;  4IK2 A;  1C30 B;  1M6V B;  3OAK A;  2ZW4 A;  2WYR A;  4LUA A;  2FS5 A;  3SJE A;  3PBB A;  2PRQ A;  2AJ6 A;  4J3G A;  5AG5 A;  2C5Q A;  3F0A A;  3GY9 A;  1A2Z A;  2FT0 A;  4A94 A;  2ZW7 A;  1Y7E A;  5LYF A;  3GYA A;  3SJF A;  4KUB A;  1KBL A;  4JWP A;  4KUA A;  3KL9 A;  2R7H A;  4IF5 A;  2HRO A;  2XPN A;  1QSM A;  2B3U A;  3ZJ0 A;  3I9S A;  3F8K A;  4MCR A;  1JQG A;  2HV2 A;  3MRU A;  3NFQ A;  1QQ9 A;  2VKZ G;  5HVH A;  2PJ3 A;  1CG2 A;  5J3X A;  2X7B A;  4E0A A;  3B2Y A;  1XEB A;  2AFO A;  1LRZ A;  5LYI A;  4WWV A;  2AE6 A;  3KR5 A;  4A38 A;  1ON0 A;  3BUX B;  5F5X A;  1KUV A;  2A4N A;  4X3R A;  2GE3 A;  4X2T A;  2EZB A;  4ZY2 A;  2DIK A;  3VAT A;  3DR8 A;  2XEJ A;  4HNW B;  4P4I A;  3HPG G;  4P45 A;  1QST A;  3D66 A;  5J8F A;  3S6F A;  3TLG A;  1S7F A;  4A4B A;  3B8G A;  4RUH A;  1FT7 A;  3I6S A;  4IHM A;  4C8P A;  2ZXV A;  1WWZ A;  1S7N A;  4BMH A;  2VBQ A;  3DR6 A;  2P6F A;  3B7I A;  3R1K A;  4A2Z A;  4H6U A;  1XE4 A;  3WC5 A;  3T05 A;  2EZC A;  2CNS A;  2ANP A;  1KUX A;  5AGE A;  4B5P A;  4E2A A;  5JM6 A;  2PJ6 A;  3VGO A;  3FEE A;  1TKH A;  2WPW A;  3WC6 A;  4RN7 A;  1J3L A;  4HPS A;  3V38 A;  2IMO A;  7CPA A;  2EZA A;  4KVX A;  1R3N A;  4KLV A;  4KOY A;  3D7H A;  2JEW A;  5F46 A;  2CF4 A;  4UFX A;  1TF8 A;  2I79 A;  3TYX A;  2PJA A;  4JYW A;  1R43 A;  4EVY A;  3BHX A;  4K30 A;  3SXO A;  5C88 A;  1RXT A;  4LQ6 A;  5HVF A;  3CDX A;  5AXI A;  1Q2D A;  4BD9 A;  5AG4 A;  3EZA A;  4H1H A;  4CZ1 A;  4AXV A;  1ARM A;  1J4J A;  2PIZ A;  2CXA A;  4GM5 A;  3GLJ A;  3PEI A;  3FEC A;  2FE7 A;  4BBH A;  4ZYQ A;  2C6C A;  1IYK A;  3FB3 A;  4R7M A;  3OB1 B;  2CY2 A;  4CS0 B;  1NSA A;  4ZI6 A;  5JPH A;  1Z9E A;  4OC3 A;  3VWE A;  2ABZ A;  1R61 A;  3ISX A;  4A4C A;  1S60 A;  4UIA A;  2Z11 A;  5A27 A;  3TTH A;  4IAV A;  5KTA A; 
#chains in the Genus database with same CATH homology
 3FVL A;  5HXD A;  1CPS A;  3PB8 X;  4UEZ A;  1FNO A;  1XBU A;  4MCQ A;  4YU9 A;  4MHY A;  4R8F A;  4C9U A;  4P4E A;  2ZEN A;  3NH4 A;  1TXR A;  3PB7 X;  1CBX A;  1Z8L A;  2RB7 A;  1EE3 P;  1TF9 A;  1ELL P;  4NFR A;  2G9D A;  3CT9 A;  3S9L A;  2PJ8 A;  4P4J A;  4EFD A;  1BPN A;  4OC5 A;  5K8N A;  1YME A;  3FMC A;  3BXM A;  4G1P A;  5K8M A;  4X8I A;  4C8C A;  2V8H A;  2POK A;  4ZX9 A;  4C9E A;  2CIJ A;  2XEG A;  4NGN A;  4NGS A;  4A39 A;  3VTA A;  3KHX A;  5LRK A;  2V8D A;  2ZEM A;  4MXU A;  3H8G A;  3GUX A;  2V8V A;  2ZEO A;  1BAV A;  6CPA A;  1LAN A;  4CDJ A;  1KWM A;  2ZOG A;  4C84 A;  2F8H A;  2AFW A;  3DLJ A;  2PJC A;  1CPX A;  2XEI A;  2Q51 A;  1VHO A;  3JRU A;  3B3T A;  3WAB A;  1RTQ A;  4MMO A;  2ZEF A;  2RFH A;  3IEH A;  1ZLI A;  1YLO A;  3B3W A;  2EK9 A;  3NH5 A;  4O23 A;  2QJ8 A;  4WJB A;  2OR4 A;  1Z2L A;  1LAP A;  4ONW A;  2PJ9 A;  4P4F A;  4LQG A;  4PXB A;  4TWE A;  2OOT A;  3LWU A;  2CTB A;  2C6G A;  3DGV A;  4UEF A;  1HDQ A;  4TNU A;  2NYQ A;  3FED A;  4NGQ A;  3IC1 A;  2AFM A;  3SJG A;  2EWB A;  4ZY0 A;  4EWT A;  1F57 A;  1Q7L A;  1PCA A;  2JBK A;  1ARL A;  3KAS A;  3H8F A;  5D29 A;  5F09 A;  5IR2 A;  2IJZ A;  1DE4 C;  1H8L A;  4C9R A;  3VH9 A;  3RAM A;  4NGT A;  3I1U A;  4FUU A;  3SI2 A;  3PRT A;  5JGF A;  3NA6 A;  1ELM P;  4C8A A;  8CPA A;  3D67 A;  1BPM A;  4NGM A;  3TC8 A;  1BLL E;  5DS0 A;  3NH8 A;  4OME A;  2F7V A;  2PIY A;  4C8U A;  5ELY A;  1QMU A;  5LRJ A;  4A37 A;  3PFO A;  3EIF A;  3RZA A;  3KZW A;  5I4M A;  4K3N A;  2PE3 A;  2AFZ A;  2V8G A;  2J9A A;  1GYT A;  3D68 A;  3PB9 X;  2C1C A;  1CX8 A;  1ZG8 A;  1F2O A;  3KHZ A;  3D7F A;  2XEF A;  2PJ4 A;  3ICU A;  2HC9 A;  4ZY1 A;  2AFS A;  2I3C A;  2ZEE A;  3IIB A;  3L2N A;  3B3C A;  1V6C A;  1IY7 A;  2ZEG A;  2PJ1 A;  3WT4 A;  2DEA A;  2QVP A;  3T8W A;  2GP4 A;  4MHN A;  2CTC A;  4C9V A;  3HLP A;  4R76 A;  5CBM A;  4F9V A;  3TX8 A;  4OC0 A;  1AYE A;  4P4D A;  2GRE A;  3WC7 A;  4KSI A;  3KR4 A;  4NGR A;  3B35 A;  4OC4 A;  2PJ0 A;  5LRG A;  4CDK A;  3IFE A;  5D8N A;  2VL1 A;  1XRY A;  2NSM A;  2EK8 A;  4NJR A;  3VAR A;  4F8Z A;  3PFE A;  3KQX A;  4OKO A;  2GLJ A;  2Q4Z A;  3FJU A;  1XFO A;  5K8O A;  2FVG A;  1TKF A;  4DJL A;  3IJ3 A;  3PB4 X;  2O4H A;  4ZX8 A;  1YSJ A;  4PPZ A;  1XJO A;  4C85 A;  2JBJ A;  1ZG9 A;  2Q43 A;  3SI0 A;  1UWY A;  2ZOF A;  4C86 A;  1ZLH A;  4UF4 A;  4C8F A;  4P10 A;  1XF1 A;  4Z65 A;  2PJ5 A;  4JZ0 A;  5J1Q A;  1Z5R A;  2BCO A;  2PVW A;  5HVG A;  4FWU A;  2ZEH A;  3KQZ A;  4TJX A;  3FF3 A;  3IWW A;  1HDU A;  1LOK A;  3SI1 A;  1DTD A;  1HEE A;  2PVV A;  2V77 A;  4PQA A;  1AMP A;  4Q7A A;  2HB6 A;  3KI9 A;  1TKJ A;  3NFZ A;  3H8E A;  1YW4 A;  4MHZ A;  2ZEP A;  4MCP A;  2PJB A;  1OBR A;  4P6Y A;  3V7Z A;  3D7D A;  3B3S A;  1CP6 A;  3S9N A;  4PXE A;  2PJ7 A;  5LYL A;  4NJQ A;  3CPX A;  1Y0R A;  5CPA A;  5JH9 A;  2IQ6 A;  2WZN A;  2PJ2 A;  3FX6 A;  4PXC A;  1M4L A;  4OC2 A;  1F2P A;  5THW A;  1CP7 A;  1IGB A;  1VHE A;  2C6P A;  4P44 A;  1YW6 A;  4PXD A;  1XMB A;  3D4U A;  4NGP A;  3B3V A;  1LAM A;  3PB6 X;  4H2K A;  1VGY A;  3K2K A;  3BI0 A;  5LYD A;  1ZG7 A;  3CPA A;  4DUK A;  4OID A;  2AFX A;  3QNV A;  4OP4 A;  1Y0Y A;  2O53 A;  1PYT B;  2PCU A;  3LMS A;  4F9U A;  5K8P A;  4DYO A;  4UEE A;  4TJV A;  4FBE A;  4MCS A;  4MRI A;  3PBE A;  4YN3 A;  4B6Z A;  3D7G A;  4W9Y A;  3RBU A;  4FAI A;  2GLF A;  3HUV A;  3FH4 A;  3K9T A;  4KNG E;  3N5F A;  5IB9 A;  1WVM A;  3SJX A;  4OC1 A;  3MN8 A;  2AFU A;  4EME A;  4MHP A;  2BO9 A;  4R6T A;  3GB0 A;  2ZEL A;  1Y9Z A;  4YWY A;  3KGQ A;  1LFW A;  1VIX A;  1LCP A;  3ISZ A;  4CPA A;  4C8T A;  3BI1 A;  2GU2 A;  4UIB A;  2ZED A;  4OIW A;  2QYV A;  3S9M A;  4C9A A;  3IO1 A;  2BOA A;  4P4B A;  4IK2 A;  2WYR A;  3SJE A;  3PBB A;  2PRQ A;  2C5Q A;  4A94 A;  1Y7E A;  5LYF A;  3SJF A;  3KL9 A;  4MCR A;  1JQG A;  3MRU A;  1QQ9 A;  5HVH A;  2PJ3 A;  1CG2 A;  3B2Y A;  2AFO A;  5LYI A;  4WWV A;  3KR5 A;  4A38 A;  4X3R A;  4X2T A;  4ZY2 A;  3VAT A;  2XEJ A;  4P4I A;  4P45 A;  3D66 A;  4RUH A;  1FT7 A;  3I6S A;  4IHM A;  4C8P A;  3B7I A;  3WC5 A;  2ANP A;  5JM6 A;  2PJ6 A;  3FEE A;  1TKH A;  3WC6 A;  3V38 A;  2IMO A;  7CPA A;  1R3N A;  3D7H A;  2JEW A;  2CF4 A;  1TF8 A;  2PJA A;  4JYW A;  1R43 A;  3BHX A;  5HVF A;  4BD9 A;  3CDX A;  4AXV A;  1ARM A;  2PIZ A;  4GM5 A;  4ZYQ A;  3GLJ A;  3PEI A;  3FEC A;  3I74 A;  2C6C A;  4R7M A;  1NSA A;  4ZI6 A;  4OC3 A;  2ABZ A;  3ISX A;  4UIA A;  4C99 A;  4IAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...