4OC2A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ceibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxybut-3-yn-1-yl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc2A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc2A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc2A02
4EFDA 2HC9A 4NGSA 4ZX8A 3I74A 2V8DA 1TF9A 4OC0A 6CPAA 4NFRA 4RUHA 2ZEEA 3RAMA 2RFHA 4P4FA 4OP4A 2EK9A 4KSIA 2PJ8A 3JRUA 4C8UA 3GUXA 4P4JA 3K9TA 3DLJA 2C6CA 4EWTA 3CT9A 3EIFA 4NJQA 3FEDA 3FX6A 4MHNA 2V8VA 3PEIA 2V77A 4NJRA 4P44A 4IAVA 4Q7AA 5HVHA 1ZG7A 3D4UA 3GB0A 3T8WA 2CF4A 2ZENA 2VL1A 1YW4A 3IFEA 3ISZA 2JEWA 1PCAA 4GM5A 3ICUA 4C9AA 2XEGA 4WWVA 4B6ZA 2PJ3A 2QJ8A 4PXCA 2RB7A 4A37A 1Z8LA 2V8GA 3KHXA 1Y0RA 4TWEA 4P4IA 3S9NA 2I3CA 4FUUA 1R43A 2EWBA 3VARA 3VATA 3PFEA 4NGMA 2GLFA 4C86A 2XEJA 1CX8A 4F9UA 4OC5A 1IGBA 4IHMA 5K8NA 4ZY0A 1ZG9A 4ZY1A 3SJEA 3PBEA 5JGFA 4PXDA 1DE4C 1QMUA 2EK8A 3B3VA 4F8ZA 3D67A 5LYIA 4OMEA 2AFXA 3S9LA 4IK2A 3CPXA 3SJFA 1Q7LA 4Z65A 4P10A 4C8PA 3BHXA 3FVLA 3IJ3A 4KNGE 1XF1A 3D7GA 2PCUA 3B35A 3NH4A 7CPAA 4CDJA 3VTAA 2IMOA 3FF3A 2QYVA 5D29A 2OR4A 4NGPA 1R3NA 2GREA 3D66A 3H8FA 3KGQA 2G9DA 1Y7EA 5K8OA 1BPNA 4O23A 4P6YA 2WZNA 1XBUA 2C6PA 2J9AA 4DUKA 3IWWA 3BXMA 2ZEOA 3NA6A 1LAMA 4TNUA 3KR5A 4ZI6A 2ZEMA 3FMCA 1LFWA 3I6SA 3KHZA 5JM6A 2OOTA 1XMBA 4OC2A 1YW6A 3CPAA 2ZEDA 1NSAA 2XEFA 3SI1A 2AFSA 4C99A 1DTDA 3FH4A 2PJ5A 2XEIA 2HB6A 2AFUA 3CDXA 3SJXA 3WC5A 4OIDA 2PVWA 2GU2A 4YU9A 1ZG8A 1BAVA 4X2TA 2PJ4A 5HVFA 3KL9A 2ABZA 1GYTA 4X8IA 4MHYA 1FT7A 3B2YA 4OIWA 5D8NA 5LYDA 1YLOA 5K8PA 2AFMA 1EE3P 2PJ7A 1CPSA 4NGTA 3I1UA 3PRTA 4ZY2A 1BPMA 1XRYA 3D68A 3NFZA 4P4DA 4C84A 2F7VA 3K2KA 1TKHA 4MRIA 1CP7A 3B7IA 5LYLA 4C9VA 4MCSA 3LWUA 4JYWA 2ZEFA 3BI0A 4ONWA 2Q43A 2O53A 2CTCA 2ZEPA 1TF8A 3B3TA 3S9MA 3PFOA 2PJ0A 1Y9ZA 5DS0A 4NGQA 3FEEA 1RTQA 4K3NA 5CPAA 1TKFA 2PE3A 3V38A 1QQ9A 1WVMA 3B3SA 4PPZA 2GLJA 2Q51A 3B3WA 4UIAA 1LANA 3PBBA 3TX8A 2NYQA 3KQXA 4UF4A 3HUVA 2ANPA 5CBMA 1VHEA 3KASA 2POKA 4C9RA 3KI9A 3NH8A 1JQGA 4CDKA 3D7DA 3KQZA 4C8FA 4P45A 3TC8A 2FVGA 4TJXA 5LYFA 2F8HA 4PXEA 3PB4X 4R6TA 4YWYA 3V7ZA 4OC4A 1ARLA 2C6GA 1PYTB 4A38A 3DGVA 5F09A 1ZLHA 1ZLIA 2PVVA 2JBKA 2PJ6A 3SI0A 3B3CA 4C9EA 2CTBA 2QVPA 3PB6X 2WYRA 4AXVA 2AFWA 1FNOA 4F9VA 3D7FA 4NGNA 1LOKA 4BD9A 1CBXA 5THWA 1F2OA 4G1PA 5HVGA 4EMEA 4JZ0A 2O4HA 2C1CA 3HLPA 1HEEA 3QNVA 1BLLE 2Q4ZA 5JH9A 5ELYA 4DYOA 2ZOFA 4FWUA 1H8LA 1Z2LA 3PB9X 3KR4A 2IJZA 4MCRA 1XJOA 3RBUA 1CG2A 4UEEA 4YN3A 1LAPA 4C85A 4C8CA 3H8GA 2PJBA 1Z5RA 4P4EA 4NGRA 1ARMA 1TXRA 2PJ1A 1ELMP 3WABA 1KWMA 8CPAA 1CP6A 3IC1A 1HDQA 2ZEHA 2BCOA 4C8AA 4MHPA 4UIBA 2ZEGA 4TJVA 2AFOA 4MXUA 1YMEA 3FJUA 5K8MA 4OC3A 2DEAA 4MCQA 3D7HA 2AFZA 2PJ9A 1VHOA 3PB7X 3SI2A 1V6CA 4CPAA 2ZELA 5IB9A 4MMOA 4FAIA 3IO1A 1HDUA 1F2PA 2PJ2A 3N5FA 4ZYQA 3L2NA 1AMPA 2PJCA 4ZX9A 2PIYA 2PJAA 4UEFA 3IIBA 1TKJA 2NSMA 4UEZA 3NH5A 3FECA 4C8TA 1OBRA 4FBEA 2PIZA 5LRJA 2JBJA 4MHZA 2IQ6A 4X3RA 4R8FA 4PQAA 1M4LA 3VH9A 4OKOA 3BI1A 3WT4A 4OC1A 5I4MA 4R76A 1AYEA 1CPXA 1F57A 1LCPA 2BOAA 3SJGA 4C9UA 2BO9A 3PB8X 3WC7A 3LMSA 1VIXA 1XFOA 3MN8A 3GLJA 4H2KA 4DJLA 4P4BA 3H8EA 4W9YA 1UWYA 1VGYA 4LQGA 4A94A 4MCPA 3KZWA 3MRUA 3WC6A 1YSJA 3RZAA 5HXDA 5LRGA 5LRKA 2PRQA 2V8HA 3IEHA 4WJBA 4A39A 4PXBA 4R7MA 2CIJA 2ZOGA 1ELLP 3ISXA 1IY7A 1Y0YA 5J1QA
chains in the Genus database with same CATH superfamily
1PUAA 2HC9A 4NGSA 4EFDA 4ZX8A 2JEVA 3I74A 5GCNA 2V8DA 4CYNA 3F5BA 1TF9A 3FYNA 4B12A 1VHSA 4OC0A 4MI4A 4BTFA 1BOBA 4NFRA 1M1DA 4UFVA 3R96A 4C7IA 4RUHA 1JWQA 2ZEEA 1TIQA 1YX0A 5IX3A 3T0TA 4OAEA 2ZXVA 3RAMA 2RFHA 4P4FA 1R61A 2ZW5A 4OP4A 3G23A 3EXNA 2EK9A 4UWIA 4COGA 4KSIA 5J1QA 1Q2YA 2PJ8A 3JRUA 2ARHA 4Q38A 4C8UA 3GUXA 5FD8A 4P4JA 2VI7A 3K9TA 3DLJA 2C6CA 4CRYB 3GKRA 4EVYA 4EWTA 3KKWA 3CT9A 3HPHE 4B5OA 3EIFA 3TO6A 4KUBA 4IUSA 2EO8A 4NJQA 3FEDA 4CGPA 5KTDA 3FX6A 4MHNA 2V8VA 3PEIA 2FL4A 3K4IA 2ZW7A 2V77A 4NJRA 4KSAA 4P44A 3HMJG 4IAVA 4Q7AA 5HVHA 4X5KA 2D0OA 1ZG7A 2B5GA 3D4UA 3GB0A 3T8WA 2Q7BA 2PDOA 2CF4A 2ZENA 5G1ZA 1Q5XA 1GGOA 4XPLA 2VL1A 3FNCA 5C88A 1YW4A 3IFEA 3DR6A 2VQYA 3ISZA 3TOAA 4J0NA 2CY2A 4MY0A 2JEWA 3S6KA 4CAEA 4QB9A 3RO0A 1SQHA 2D4OA 4JJXA 2Z11A 5F46A 2WPXA 1FBVA 3TE4A 1PCAA 2ZW4A 4GM5A 3TCVA 3ICUA 4GPLB 3BUWB 3LACA 4C9AA 4KUAA 5EC4A 2FIWA 2XEGA 2OZHA 1S7FA 1B87A 2Z3NA 4WWVA 4B6ZA 4YFJA 2B5GB 2PJ3A 3GYAA 2QJ8A 3P2FA 5H86A 2Z3OA 4PXCA 4B14A 2RB7A 4CO9A 3EC4A 3VRRA 4A37A 1Z8LA 2D4PA 2V8GA 3KHXA 1S7LA 1Y0RA 4TWEA 3MGDA 4P4IA 4IIYA 4MJXA 2H5MA 3S9NA 2I3CA 1ON0A 4FUUA 3RNZA 5K99A 1M4IA 5J8CA 1R43A 2EWBA 1DIKA 3S6GA 3VARA 4KOTA 3ZJ0A 1NMTA 3BLNA 4XPDC 2B4BA 3VATA 1CM0A 3PFEA 1QSOA 4NGMA 2I79A 2GLFA 1R57A 4UCMA 2OU2A 4C86A 2XEJA 1CX8A 1VKCA 4F9UA 4HKFA 4OC5A 4INJA 2ODFA 3A9LA 1IGBA 1KUXA 2A4NA 4BMHA 4F0XA 3S6FA 4M6IA 4R57A 4IHMA 2Y1NA 5K8NA 1QSTA 4ZY0A 1ZG9A 1IOFA 4ZY1A 3SJEA 2JDDA 3PBEA 5JGFA 4JWPA 4PXDA 1DE4C 1QMUA 2EK8A 5E96A 2EVNA 3B3VA 4F8ZA 2HI6A 4KOSA 3D67A 5LYIA 5F13A 4OMEA 2AFXA 3R1KA 2QECA 3S9LA 1OZPA 2G3AA 3EZEA 4IK2A 1MJAA 3CPXA 1Z9EA 5DWNA 3SJFA 3W91A 4MFKA 2J8MA 4C2ZA 1Q7LA 2Z3KA 4Z65A 4P10A 4C8PA 3BHXA 2P6EA 4ZY2A 4CYPA 1EO0A 2Z3PA 3FVLA 3IJ3A 4KNGE 3F0AA 3D7GA 2UV8G 1P0HA 2EBJA 2PCUA 2WUUA 3B35A 3FIXA 3NH4A 7CPAA 4CDJA 4YRHA 4F0YA 4KOWA 3VTAA 2IMOA 3FF3A 2QYVA 4QUSA 5D29A 2OR4A 4NGPA 1R3NA 4KOVA 1NSLA 1QSMA 2GREA 3CZXA 3D66A 3H8FA 3KGQA 2G9DA 1Y7EA 2XPPA 2Z3MA 1BPNA 2QMLA 3K9UA 4O23A 4P6YA 4RS2A 5K8OA 2WZNA 1XBUA 4NSQA 2C6PA 4R3LA 4ORFA 1VBHA 1IB1E 3R9GA 3E0KA 2J9AA 4CYQA 2BL1A 4DUKA 2B4JC 4NCZA 3IWWA 3BXMA 4A31A 2BUEA 3IU2A 4MFZA 2DLAA 2ZEOA 3NA6A 4GXHA 1LAMA 4OADA 3KR5A 4TNUA 2ZEMA 3OB2B 3FMCA 4ZI6A 4PK3A 3U88C 3F8KA 1LFWA 1QSRA 1Z8XA 3I6SA 4MBUA 3KHZA 5JM6A 2OOTA 1XMBA 6CPAA 4OC2A 4BPXB 1YW6A 3CPAA 2ZEDA 2VKZG 4UFXA 4A33A 5JPHA 2O28A 2IL4A 2KCWA 1IIDA 3C26A 4KS9A 1CE8B 3VRQA 4CZ1A 2GANA 5HMNA 3OB1B 1NSAA 2XEFA 3SI1A 2AFSA 1XEBA 1X10A 1DTDA 3D2MA 4HNWB 3T5MA 3FH4A 4KZTA 2PJ5A 4B5PB 2XEIA 3TFYA 2HB6A 1MJ9A 1KEEB 2AFUA 3CDXA 3SJXA 4IIXA 3WC5A 4JVOA 3NFQA 2FT0A 4OIDA 4R87A 1U6MA 4KLWA 3OP0A 4NF1A 1LRZA 2PVWA 1CS0B 3I9SA 2GU2A 2PRBA 3DNSA 4YU9A 1YGHA 1ZG8A 5HKWA 1BAVA 3QAYA 3TLGA 4X2TA 1T36B 5A27A 4JXRA 3SR3A 1C30B 2PJ4A 5HVFA 4A2ZA 3KL9A 2ABZA 3PP9A 1GYTA 4X8IA 4CAXA 2FS5A 2R82A 4M8DA 3T90A 4MHYA 4PSXA 3VWEA 5KTCA 1YLEA 1FT7A 2C5QA 2PQ8A 3B2YA 2RC4A 3JVNA 4OIWA 5D8NA 2B3UA 5LYDA 5C82A 1XIXA 4EMEA 1YLOA 3PLFB 5K8PA 1MJBA 2DF5A 3IGRA 2AFMA 3IWGA 1JDEA 3VRNA 2YNCA 3TLGB 1EE3P 2PJ7A 3FB3A 3FBUA 4C2XA 1CPSA 4NGTA 2R1IA 1YREA 3I1UA 3PRTA 1BPMA 4ONUA 1XRYA 3D68A 3NFZA 3NE7A 4RN7A 3JUWA 4P4DA 2OZGA 4AVCA 5F9MA 1M4GA 1KUVA 4MI1A 3TLEA 4C84A 3VRPA 3PGPA 4KSFA 2YNCC 3EZAA 4BPWB 1C3OB 2F7VA 3EO4A 3K2KA 1TKHA 5J8FA 1KZFA 3OAKA 3IU1A 4MRIA 3SHPA 1CP7A 3CXSA 4CYOA 2GP4A 3B7IA 5AG5A 5LYLA 4MCSA 3LWUA 1M4DA 4JLYA 4JYWA 4C9VA 1J3LA 1A2ZA 2ZEFA 3C8OA 5FVJA 2EZAA 4U5YA 4IF5A 3R9EA 4KVXA 3BI0A 4ONWA 1S60A 2C27A 4MFQA 4KORA 1VBGA 2Q43A 5ISVA 2O53A 3VROA 3LODA 4M3SA 2CTCA 2ZEPA 1TF8A 3B3TA 4UBRA 3S9MA 2EZCA 3PFOA 2PJ0A 1Y9ZA 5JYBA 5DS0A 1KC7A 2HROA 4NGQA 3TLZA 2AE6A 2HQYA 4AB7A 2GE3A 2P6GA 3FEEA 4XNHC 1WK4A 1RTQA 4Q36A 2YGWA 5DWMA 5IR2A 4FD6A 3DSBA 3NE8A 4K3NA 2B58A 2DXQA 4LX9A 4XPDB 5IV0A 5CPAA 2N3AB 2PR8A 4II9A 2D0PA 1TKFA 4C7HA 3H4QA 2PE3A 3V38A 1M6VB 3DR8A 1QQ9A 1WVMA 5F48A 5KTAA 4H1HA 4BINA 3B3SA 2HWGA 1YVOA 4PPZA 4ZBGA 2GLJA 1B6BA 2Q51A 4NXYA 3TYXA 1GHEA 2WSAA 1CJWA 1Q2CA 3D2PA 5G20A 4EYSA 3B3WA 2X7BA 4UIAA 3NOJA 1KBLA 2Z10A 1LANA 3PBBA 3D8PA 2NYQA 2REEA 3G8WA 3TX8A 3W6SA 3KQXA 4UF4A 3HUVA 4E5SA 2ANPA 5CBMA 1I12A 2AUMA 1VHEA 3KASA 2POKA 4C9RA 4UA3A 3KI9A 4J3GA 4UCPA 1IOIA 3WR7A 3NH8A 1JQGA 4CDKA 3SXOA 3D7DA 2HV2A 2OB0A 3KQZA 4C8FA 4P45A 4NEXA 3CXQA 2BSWA 3O8ZA 1N71A 2Q04A 2Z0ZA 5H84A 1YVKA 3TC8A 3HPGG 2FVGA 4B10A 1X12A 1MK4A 4CGOA 1K4JA 2G0BA 2Q4YA 4TJXA 1KUYA 1Z8WA 3H5ZA 2F8HA 4PXEA 3PB4X 4CRZB 5J3XA 3R9FA 5LYFA 3EY5A 4L8AA 3VGOA 4CGMA 3BUNB 1Z4RA 2AJ6A 4R6TA 1A9XB 3TOBA 4YWYA 2J8NA 3GJZA 1WWZA 3BUMB 2R7HA 4KVME 3V7ZA 4OC4A 1ARLA 2C6GA 2B4DA 1PYTB 2K5TA 4A38A 3DGVA 2PCNA 5F09A 1ZLHA 1ZLIA 1Z9UA 2CNSA 3U1BA 2PVVA 2JBKA 2Q7SA 2PJ6A 4C99A 5F47A 1XOVA 4CS0B 5JQ4A 3SI0A 3B3CA 4C9EA 3SXNA 1S7KA 2CTBA 1Y9KA 2PR1A 2QVPA 4HPSA 4JXQA 4CGNA 2VZYA 3TO9A 3RYOA 3PB6X 1ZRSA 1ZL0A 2WYRA 2FIAA 4U9ZA 2AFWA 2G3TA 3OWCA 4AXVA 1FNOA 1M44A 1IU8A 2JLMA 2QIRA 3D7FA 4NGNA 2P6FA 3I3GA 4R9MA 4F9VA 3PT1A 1LOKA 4BD9A 1Y9WA 1V0CA 1CBXA 5THWA 1F2OA 4COBA 3F9KC 2OZUA 4H89A 4AVAA 4C68A 4G1PA 5HVGA 2YNEA 4KVOE 4FD5A 3V8IA 4JZ0A 2O4HA 2C1CA 3HLPA 4B11A 1HEEA 4U9YA 3BUXB 1P4NA 2R8VA 5IB0A 3QNVA 4ZGYB 3BUOB 1BLLE 2Q4ZA 2Q0YA 5JH9A 2AUNA 3EZBA 2PSWA 4MFPA 5ELYA 2Q44A 4DYOA 2YJTA 4AVBA 1Z8TA 2ZOFA 3TTHA 5EBVA 3ZNIA 4FWUA 2VZZA 2CNMA 3KRVA 1H8LA 1Z2LA 3PB9X 1VI4A 3KR4A 2FM4A 2GIVA 2IJZA 4MCRA 1XJOA 3BJ7A 3RBUA 4KLVA 5AGEA 3TLBA 4Y49C 1CG2A 4UEEA 3S6HA 1IYLA 2CXAA 5AXIA 4YN3A 5EMIA 1LAPA 2CBLA 3VWDA 1NXJA 4C85A 3B8GA 4C8CA 1RO5A 4QC6A 3H8GA 2PJBA 1Z5RA 4P4EA 2ATRA 3QAHA 1XF8A 1YK3A 4Y49B 1NBWA 2YJVA 5BY0A 4NGRA 1ARMA 4UFWA 2B3VA 1TXRA 2PJ1A 4R3KA 1ELMP 3WABA 1KWMA 1L0CA 8CPAA 4XPKA 1XF1A 1CP6A 2X0SA 1Z4EA 4RI1A 3EFAA 2FE7A 3CXPA 3DDDA 3IC1A 4A95A 4CAVA 3T9YA 2MP0A 3T07A 1HDQA 4CAWA 2DIKA 3N7ZA 2ZEHA 5BWAB 2OLSA 2XPNA 2BCOA 5HKYA 4C8AA 4MHPA 1EZBA 1XE4A 3G3SA 4UIBA 1XMTA 1S3ZA 2F5IA 2ZEGA 4CAFA 4TJVA 2EUIA 4E2AA 3GIUA 2R98A 3R95A 3TLYA 2AFOA 1ZO0A 2XPLA 1YMEA 2VXKA 3FJUA 4MFJA 4MXUA 3TT2A 5JVLA 5K8MA 2XPOA 4OC3A 4MCQA 3D7HA 2DEAA 3T05A 1Y7RA 2AFZA 2PJ9A 3TLAA 1VHOA 1Q2DA 1RXTA 2VBQA 4MY3A 3PB7X 5HH1A 4CGLA 3SI2A 1V6CA 4CPAA 2EZBA 2Y1MA 1WJTA 3LD2A 4H6ZA 2ZELA 4AG7A 2DPTA 4XNHB 1YR0A 1I21A 3D3SA 4MMOA 5AG6A 5IB9A 4FAIA 4K30A 3IO1A 2GFQA 1HDUA 1F2PA 2PJ2A 3PFVA 3N5FA 4L89A 3L2NA 4ZYQA 2Q4VA 2REFA 1AMPA 1YVHA 1S7NA 1AUGA 2NMTA 2PJCA 2WPWA 2ZW6A 5G21A 4ZX9A 4B13A 2PIYA 2PJAA 4MFLA 4PV6A 4UEFA 4BBHA 3QB8A 3IIBA 3W6XA 5F1YA 4GS4A 1TKJA 2NSMA 5HKZA 4KOXA 1IYKA 4KOYA 4UWJA 2FXFA 3TLCA 4UEZA 1ZYMA 3NH5A 3FECA 2Y0MA 4FD7A 1S5KA 5CNPA 4C8TA 3UY5A 1PU9A 4RR2B 4AG9A 4DNCA 1OBRA 4FBEA 1YQEA 2PIZA 4E94A 5LRJA 2JBJA 4A30A 3IWEA 4MHZA 2FSRA 3JTKA 2IQ6A 4LQ6A 5F49A 1QSNA 4X3RA 4R8FA 4PK2A 3TO7A 5G22A 4PQAA 1M4LA 2DPSA 3VH9A 1JDBC 4OKOA 3BI1A 3WT4A 4OC1A 1FY7A 4R76A 1AYEA 5I4MA 1CPXA 2ZPAA 4UCNA 1F57A 1LCPA 2BOAA 4BPUB 2Z3LA 2J8RA 4M6GA 3SJGA 4A32A 4H6UA 4MHDA 4C9UA 2BO9A 3PB8X 3FXTA 5AG7A 1UFHA 3WC7A 4KOUA 2BEIA 3GY9A 5F5XA 4PSWA 3LMSA 5I0CA 4E0AA 1VIXA 1XFOA 2PC1A 3MN8A 4LUAA 4F6AA 1IICA 3GLJA 4H2KA 4DJLA 4QBJA 4P4BA 3H8EA 4W9YA 2I00A 4OLLA 1UWYA 1VGYA 4LQGA 4A94A 2FCKA 4E8OA 4MCPA 4I49A 4M6HA 1BO4A 1J4JA 3KZWA 2HUZA 3MRUA 3WC6A 2B0AA 2JDCA 4M85A 1YSJA 4FD4A 4HNXB 4HNYB 3RZAA 5HXDA 4B5PA 4A4BA 5LRGA 5LRKA 4JD6A 4A4CA 2YNDA 4C2YA 2PRQA 3P2HA 4QVTA 2V8HA 2B4DB 3IEHA 5AG4A 5A28A 3BJ8A 1I1DA 1NE9A 1BXRB 3PZJA 4YGOA 3ZZIA 1B47A 1EZAA 2OH1A 2E28A 4WJBA 4A39A 2CNTA 4PXBA 4R7MA 2CIJA 2ZOGA 1ELLP 3ISXA 2VEZA 1IY7A 1Y0YA 2P0WA 4MJ8A 3FRMA
chains in the Genus database with same CATH topology
4EFDA 2HC9A 4NGSA 4ZX8A 3I74A 2V8DA 1TF9A 4OC0A 5IR2A 6CPAA 4NFRA 4RUHA 2ZEEA 3RAMA 2RFHA 4P4FA 4OP4A 2EK9A 4KSIA 2PJ8A 3JRUA 4C8UA 3GUXA 4P4JA 3K9TA 3DLJA 2C6CA 4EWTA 3CT9A 3EIFA 4NJQA 3FEDA 3FX6A 4MHNA 2V8VA 3PEIA 2V77A 4NJRA 4P44A 4IAVA 4Q7AA 5HVHA 1ZG7A 3D4UA 3GB0A 3T8WA 2CF4A 2ZENA 2VL1A 1YW4A 3IFEA 3ISZA 2JEWA 1PCAA 4GM5A 3ICUA 4C9AA 2XEGA 4WWVA 4B6ZA 2PJ3A 2QJ8A 4PXCA 2RB7A 4A37A 1Z8LA 2V8GA 3KHXA 1Y0RA 4TWEA 4P4IA 3S9NA 2I3CA 4FUUA 1R43A 2EWBA 3VARA 3VATA 3PFEA 4NGMA 2GLFA 4C86A 2XEJA 1CX8A 4F9UA 4OC5A 1IGBA 4IHMA 5K8NA 4ZY0A 1ZG9A 4ZY1A 3SJEA 3PBEA 5JGFA 4PXDA 1DE4C 1QMUA 2EK8A 3B3VA 4F8ZA 3D67A 5LYIA 4OMEA 2AFXA 3S9LA 4IK2A 3CPXA 3SJFA 1Q7LA 4Z65A 4P10A 4C8PA 3BHXA 3FVLA 3IJ3A 4KNGE 1XF1A 3D7GA 2PCUA 3B35A 3NH4A 7CPAA 4CDJA 3VTAA 2IMOA 3FF3A 2QYVA 5D29A 2OR4A 4NGPA 1R3NA 2GREA 3D66A 3H8FA 3KGQA 2G9DA 1Y7EA 5K8OA 1BPNA 4O23A 4P6YA 2WZNA 1XBUA 2C6PA 2J9AA 4DUKA 3IWWA 3BXMA 2ZEOA 3NA6A 1LAMA 4TNUA 3KR5A 4ZI6A 2ZEMA 3FMCA 1LFWA 3I6SA 3KHZA 5JM6A 2OOTA 1XMBA 4OC2A 1YW6A 3CPAA 2ZEDA 1NSAA 2XEFA 3SI1A 2AFSA 4C99A 1DTDA 3FH4A 2PJ5A 2XEIA 2HB6A 2AFUA 3CDXA 3SJXA 3WC5A 4OIDA 2PVWA 2GU2A 4YU9A 1ZG8A 1BAVA 4X2TA 2PJ4A 5HVFA 3KL9A 2ABZA 1GYTA 4X8IA 4MHYA 2C5QA 1FT7A 3B2YA 4OIWA 5D8NA 5LYDA 1YLOA 5K8PA 2AFMA 1EE3P 2PJ7A 1CPSA 4NGTA 3I1UA 3PRTA 4ZY2A 1BPMA 1XRYA 3D68A 3NFZA 4P4DA 4C84A 2F7VA 3K2KA 1TKHA 4MRIA 1CP7A 2GP4A 3B7IA 5LYLA 4C9VA 4MCSA 3LWUA 4JYWA 2ZEFA 3BI0A 4ONWA 2Q43A 2O53A 2CTCA 2ZEPA 1TF8A 3B3TA 3S9MA 3PFOA 2PJ0A 1Y9ZA 5DS0A 4NGQA 3FEEA 1RTQA 4K3NA 5CPAA 1TKFA 2PE3A 3V38A 1QQ9A 1WVMA 3B3SA 4PPZA 2GLJA 2Q51A 3B3WA 4UIAA 1LANA 3PBBA 3TX8A 2NYQA 3KQXA 4UF4A 3HUVA 2ANPA 5CBMA 1VHEA 3KASA 2POKA 4C9RA 3KI9A 3NH8A 1JQGA 4CDKA 3D7DA 3KQZA 4C8FA 4P45A 3TC8A 2FVGA 4TJXA 5LYFA 2F8HA 4PXEA 3PB4X 4R6TA 4YWYA 3V7ZA 4OC4A 1ARLA 2C6GA 1PYTB 4A38A 3DGVA 5F09A 1ZLHA 1ZLIA 2PVVA 2JBKA 2PJ6A 3SI0A 3B3CA 4C9EA 2CTBA 2QVPA 3PB6X 2WYRA 4AXVA 2AFWA 1FNOA 4F9VA 3D7FA 4NGNA 1LOKA 4BD9A 1CBXA 5THWA 1F2OA 4G1PA 5HVGA 4EMEA 4JZ0A 2O4HA 2C1CA 3HLPA 1HEEA 3QNVA 1BLLE 2Q4ZA 5JH9A 5ELYA 4DYOA 2ZOFA 4FWUA 1H8LA 1Z2LA 3PB9X 3KR4A 2IJZA 4MCRA 1XJOA 3RBUA 1CG2A 4UEEA 4YN3A 1LAPA 4C85A 4C8CA 3H8GA 2PJBA 1Z5RA 4P4EA 4NGRA 1ARMA 1TXRA 2PJ1A 1ELMP 3WABA 1KWMA 8CPAA 1CP6A 3IC1A 1HDQA 2ZEHA 2BCOA 4C8AA 4MHPA 4UIBA 2ZEGA 4TJVA 2AFOA 4MXUA 1YMEA 3FJUA 5K8MA 4OC3A 2DEAA 4MCQA 3D7HA 2AFZA 2PJ9A 1VHOA 3PB7X 3SI2A 1V6CA 4CPAA 2ZELA 5IB9A 4MMOA 4FAIA 3IO1A 1HDUA 1F2PA 2PJ2A 3N5FA 4ZYQA 3L2NA 1AMPA 2PJCA 4ZX9A 2PIYA 2PJAA 4UEFA 3IIBA 1TKJA 2NSMA 4UEZA 3NH5A 3FECA 4C8TA 1OBRA 4FBEA 2PIZA 5LRJA 2JBJA 4MHZA 2IQ6A 4X3RA 4R8FA 4PQAA 1M4LA 3VH9A 4OKOA 3BI1A 3WT4A 4OC1A 5I4MA 4R76A 1AYEA 1CPXA 1F57A 1LCPA 2BOAA 3SJGA 4C9UA 2BO9A 3PB8X 3WC7A 3LMSA 1VIXA 1XFOA 3MN8A 3GLJA 4H2KA 4DJLA 4P4BA 3H8EA 4W9YA 1UWYA 1VGYA 4LQGA 4A94A 4MCPA 3KZWA 3MRUA 3WC6A 1YSJA 3RZAA 5HXDA 5LRGA 5LRKA 2PRQA 2V8HA 3IEHA 4WJBA 4A39A 4PXBA 4R7MA 2CIJA 2ZOGA 1ELLP 3ISXA 1IY7A 1Y0YA 5J1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFD A;  2HC9 A;  4NGS A;  4ZX8 A;  3I74 A;  2V8D A;  1TF9 A;  4OC0 A;  6CPA A;  4NFR A;  4RUH A;  2ZEE A;  3RAM A;  2RFH A;  4P4F A;  4OP4 A;  2EK9 A;  4KSI A;  2PJ8 A;  3JRU A;  4C8U A;  3GUX A;  4P4J A;  3K9T A;  3DLJ A;  2C6C A;  4EWT A;  3CT9 A;  3EIF A;  4NJQ A;  3FED A;  3FX6 A;  4MHN A;  2V8V A;  3PEI A;  2V77 A;  4NJR A;  4P44 A;  4IAV A;  4Q7A A;  5HVH A;  1ZG7 A;  3D4U A;  3GB0 A;  3T8W A;  2CF4 A;  2ZEN A;  2VL1 A;  1YW4 A;  3IFE A;  3ISZ A;  2JEW A;  1PCA A;  4GM5 A;  3ICU A;  4C9A A;  2XEG A;  4WWV A;  4B6Z A;  2PJ3 A;  2QJ8 A;  4PXC A;  2RB7 A;  4A37 A;  1Z8L A;  2V8G A;  3KHX A;  1Y0R A;  4TWE A;  4P4I A;  3S9N A;  2I3C A;  4FUU A;  1R43 A;  2EWB A;  3VAR A;  3VAT A;  3PFE A;  4NGM A;  2GLF A;  4C86 A;  2XEJ A;  1CX8 A;  4F9U A;  4OC5 A;  1IGB A;  4IHM A;  5K8N A;  4ZY0 A;  1ZG9 A;  4ZY1 A;  3SJE A;  3PBE A;  5JGF A;  4PXD A;  1DE4 C;  1QMU A;  2EK8 A;  3B3V A;  4F8Z A;  3D67 A;  5LYI A;  4OME A;  2AFX A;  3S9L A;  4IK2 A;  3CPX A;  3SJF A;  1Q7L A;  4Z65 A;  4P10 A;  4C8P A;  3BHX A;  3FVL A;  3IJ3 A;  4KNG E;  1XF1 A;  3D7G A;  2PCU A;  3B35 A;  3NH4 A;  7CPA A;  4CDJ A;  3VTA A;  2IMO A;  3FF3 A;  2QYV A;  5D29 A;  2OR4 A;  4NGP A;  1R3N A;  2GRE A;  3D66 A;  3H8F A;  3KGQ A;  2G9D A;  1Y7E A;  5K8O A;  1BPN A;  4O23 A;  4P6Y A;  2WZN A;  1XBU A;  2C6P A;  2J9A A;  4DUK A;  3IWW A;  3BXM A;  2ZEO A;  3NA6 A;  1LAM A;  4TNU A;  3KR5 A;  4ZI6 A;  2ZEM A;  3FMC A;  1LFW A;  3I6S A;  3KHZ A;  5JM6 A;  2OOT A;  1XMB A;  4OC2 A;  1YW6 A;  3CPA A;  2ZED A;  1NSA A;  2XEF A;  3SI1 A;  2AFS A;  4C99 A;  1DTD A;  3FH4 A;  2PJ5 A;  2XEI A;  2HB6 A;  2AFU A;  3CDX A;  3SJX A;  3WC5 A;  4OID A;  2PVW A;  2GU2 A;  4YU9 A;  1ZG8 A;  1BAV A;  4X2T A;  2PJ4 A;  5HVF A;  3KL9 A;  2ABZ A;  1GYT A;  4X8I A;  4MHY A;  1FT7 A;  3B2Y A;  4OIW A;  5D8N A;  5LYD A;  1YLO A;  5K8P A;  2AFM A;  1EE3 P;  2PJ7 A;  1CPS A;  4NGT A;  3I1U A;  3PRT A;  4ZY2 A;  1BPM A;  1XRY A;  3D68 A;  3NFZ A;  4P4D A;  4C84 A;  2F7V A;  3K2K A;  1TKH A;  4MRI A;  1CP7 A;  3B7I A;  5LYL A;  4C9V A;  4MCS A;  3LWU A;  4JYW A;  2ZEF A;  3BI0 A;  4ONW A;  2Q43 A;  2O53 A;  2CTC A;  2ZEP A;  1TF8 A;  3B3T A;  3S9M A;  3PFO A;  2PJ0 A;  1Y9Z A;  5DS0 A;  4NGQ A;  3FEE A;  1RTQ A;  4K3N A;  5CPA A;  1TKF A;  2PE3 A;  3V38 A;  1QQ9 A;  1WVM A;  3B3S A;  4PPZ A;  2GLJ A;  2Q51 A;  3B3W A;  4UIA A;  1LAN A;  3PBB A;  3TX8 A;  2NYQ A;  3KQX A;  4UF4 A;  3HUV A;  2ANP A;  5CBM A;  1VHE A;  3KAS A;  2POK A;  4C9R A;  3KI9 A;  3NH8 A;  1JQG A;  4CDK A;  3D7D A;  3KQZ A;  4C8F A;  4P45 A;  3TC8 A;  2FVG A;  4TJX A;  5LYF A;  2F8H A;  4PXE A;  3PB4 X;  4R6T A;  4YWY A;  3V7Z A;  4OC4 A;  1ARL A;  2C6G A;  1PYT B;  4A38 A;  3DGV A;  5F09 A;  1ZLH A;  1ZLI A;  2PVV A;  2JBK A;  2PJ6 A;  3SI0 A;  3B3C A;  4C9E A;  2CTB A;  2QVP A;  3PB6 X;  2WYR A;  4AXV A;  2AFW A;  1FNO A;  4F9V A;  3D7F A;  4NGN A;  1LOK A;  4BD9 A;  1CBX A;  5THW A;  1F2O A;  4G1P A;  5HVG A;  4EME A;  4JZ0 A;  2O4H A;  2C1C A;  3HLP A;  1HEE A;  3QNV A;  1BLL E;  2Q4Z A;  5JH9 A;  5ELY A;  4DYO A;  2ZOF A;  4FWU A;  1H8L A;  1Z2L A;  3PB9 X;  3KR4 A;  2IJZ A;  4MCR A;  1XJO A;  3RBU A;  1CG2 A;  4UEE A;  4YN3 A;  1LAP A;  4C85 A;  4C8C A;  3H8G A;  2PJB A;  1Z5R A;  4P4E A;  4NGR A;  1ARM A;  1TXR A;  2PJ1 A;  1ELM P;  3WAB A;  1KWM A;  8CPA A;  1CP6 A;  3IC1 A;  1HDQ A;  2ZEH A;  2BCO A;  4C8A A;  4MHP A;  4UIB A;  2ZEG A;  4TJV A;  2AFO A;  4MXU A;  1YME A;  3FJU A;  5K8M A;  4OC3 A;  2DEA A;  4MCQ A;  3D7H A;  2AFZ A;  2PJ9 A;  1VHO A;  3PB7 X;  3SI2 A;  1V6C A;  4CPA A;  2ZEL A;  5IB9 A;  4MMO A;  4FAI A;  3IO1 A;  1HDU A;  1F2P A;  2PJ2 A;  3N5F A;  4ZYQ A;  3L2N A;  1AMP A;  2PJC A;  4ZX9 A;  2PIY A;  2PJA A;  4UEF A;  3IIB A;  1TKJ A;  2NSM A;  4UEZ A;  3NH5 A;  3FEC A;  4C8T A;  1OBR A;  4FBE A;  2PIZ A;  5LRJ A;  2JBJ A;  4MHZ A;  2IQ6 A;  4X3R A;  4R8F A;  4PQA A;  1M4L A;  3VH9 A;  4OKO A;  3BI1 A;  3WT4 A;  4OC1 A;  5I4M A;  4R76 A;  1AYE A;  1CPX A;  1F57 A;  1LCP A;  2BOA A;  3SJG A;  4C9U A;  2BO9 A;  3PB8 X;  3WC7 A;  3LMS A;  1VIX A;  1XFO A;  3MN8 A;  3GLJ A;  4H2K A;  4DJL A;  4P4B A;  3H8E A;  4W9Y A;  1UWY A;  1VGY A;  4LQG A;  4A94 A;  4MCP A;  3KZW A;  3MRU A;  3WC6 A;  1YSJ A;  3RZA A;  5HXD A;  5LRG A;  5LRK A;  2PRQ A;  2V8H A;  3IEH A;  4WJB A;  4A39 A;  4PXB A;  4R7M A;  2CIJ A;  2ZOG A;  1ELL P;  3ISX A;  1IY7 A;  1Y0Y A;  5J1Q A; 
#chains in the Genus database with same CATH topology
 1PUA A;  2HC9 A;  4NGS A;  4EFD A;  4ZX8 A;  2JEV A;  3I74 A;  5GCN A;  2V8D A;  4CYN A;  3F5B A;  1TF9 A;  3FYN A;  4B12 A;  1VHS A;  4OC0 A;  4MI4 A;  4BTF A;  1BOB A;  4NFR A;  1M1D A;  4UFV A;  3R96 A;  4C7I A;  4RUH A;  1JWQ A;  2ZEE A;  1TIQ A;  1YX0 A;  5IX3 A;  3T0T A;  4OAE A;  2ZXV A;  3RAM A;  2RFH A;  4P4F A;  1R61 A;  2ZW5 A;  4OP4 A;  3G23 A;  3EXN A;  2EK9 A;  4UWI A;  4COG A;  4KSI A;  5J1Q A;  1Q2Y A;  2PJ8 A;  3JRU A;  2ARH A;  4Q38 A;  4C8U A;  3GUX A;  5FD8 A;  4P4J A;  2VI7 A;  3K9T A;  3DLJ A;  2C6C A;  4CRY B;  3GKR A;  4EVY A;  4EWT A;  3KKW A;  3CT9 A;  3HPH E;  4B5O A;  3EIF A;  3TO6 A;  4KUB A;  4IUS A;  2EO8 A;  4NJQ A;  3FED A;  4CGP A;  5KTD A;  3FX6 A;  4MHN A;  2V8V A;  3PEI A;  2FL4 A;  3K4I A;  2ZW7 A;  2V77 A;  4NJR A;  4KSA A;  4P44 A;  3HMJ G;  4IAV A;  4Q7A A;  5HVH A;  4X5K A;  2D0O A;  1ZG7 A;  2B5G A;  3D4U A;  3GB0 A;  3T8W A;  2Q7B A;  2PDO A;  2CF4 A;  2ZEN A;  5G1Z A;  1Q5X A;  1GGO A;  4XPL A;  2VL1 A;  3FNC A;  5C88 A;  1YW4 A;  3IFE A;  3DR6 A;  2VQY A;  3ISZ A;  3TOA A;  4J0N A;  2CY2 A;  4MY0 A;  2JEW A;  3S6K A;  4CAE A;  4QB9 A;  3RO0 A;  1SQH A;  2D4O A;  4JJX A;  2Z11 A;  5F46 A;  2WPX A;  1FBV A;  3TE4 A;  1PCA A;  2ZW4 A;  4GM5 A;  3TCV A;  3ICU A;  4GPL B;  3BUW B;  3LAC A;  4C9A A;  4KUA A;  5EC4 A;  2FIW A;  2XEG A;  2OZH A;  1S7F A;  1B87 A;  2Z3N A;  4WWV A;  4B6Z A;  4YFJ A;  2B5G B;  2PJ3 A;  3GYA A;  2QJ8 A;  3P2F A;  5H86 A;  2Z3O A;  4PXC A;  4B14 A;  2RB7 A;  4CO9 A;  3EC4 A;  3VRR A;  4A37 A;  1Z8L A;  2D4P A;  2V8G A;  3KHX A;  1S7L A;  1Y0R A;  4TWE A;  3MGD A;  4P4I A;  4IIY A;  4MJX A;  2H5M A;  3S9N A;  2I3C A;  1ON0 A;  4FUU A;  3RNZ A;  5K99 A;  1M4I A;  5J8C A;  1R43 A;  2EWB A;  1DIK A;  3S6G A;  3VAR A;  4KOT A;  3ZJ0 A;  1NMT A;  3BLN A;  4XPD C;  2B4B A;  3VAT A;  1CM0 A;  3PFE A;  1QSO A;  4NGM A;  2I79 A;  2GLF A;  1R57 A;  4UCM A;  2OU2 A;  4C86 A;  2XEJ A;  1CX8 A;  1VKC A;  4F9U A;  4HKF A;  4OC5 A;  4INJ A;  2ODF A;  3A9L A;  1IGB A;  1KUX A;  2A4N A;  4BMH A;  4F0X A;  3S6F A;  4M6I A;  4R57 A;  4IHM A;  2Y1N A;  5K8N A;  1QST A;  4ZY0 A;  1ZG9 A;  1IOF A;  4ZY1 A;  3SJE A;  2JDD A;  3PBE A;  5JGF A;  4JWP A;  4PXD A;  1DE4 C;  1QMU A;  2EK8 A;  5E96 A;  2EVN A;  3B3V A;  4F8Z A;  2HI6 A;  4KOS A;  3D67 A;  5LYI A;  5F13 A;  4OME A;  2AFX A;  3R1K A;  2QEC A;  3S9L A;  1OZP A;  2G3A A;  3EZE A;  4IK2 A;  1MJA A;  3CPX A;  1Z9E A;  5DWN A;  3SJF A;  3W91 A;  4MFK A;  2J8M A;  4C2Z A;  1Q7L A;  2Z3K A;  4Z65 A;  4P10 A;  4C8P A;  3BHX A;  2P6E A;  4ZY2 A;  4CYP A;  1EO0 A;  2Z3P A;  3FVL A;  3IJ3 A;  4KNG E;  3F0A A;  3D7G A;  2UV8 G;  1P0H A;  2EBJ A;  2PCU A;  2WUU A;  3B35 A;  3FIX A;  3NH4 A;  7CPA A;  4CDJ A;  4YRH A;  4F0Y A;  4KOW A;  3VTA A;  2IMO A;  3FF3 A;  2QYV A;  4QUS A;  5D29 A;  2OR4 A;  4NGP A;  1R3N A;  4KOV A;  1NSL A;  1QSM A;  2GRE A;  3CZX A;  3D66 A;  3H8F A;  3KGQ A;  2G9D A;  1Y7E A;  2XPP A;  2Z3M A;  1BPN A;  2QML A;  3K9U A;  4O23 A;  4P6Y A;  4RS2 A;  5K8O A;  2WZN A;  1XBU A;  4NSQ A;  2C6P A;  4R3L A;  4ORF A;  1VBH A;  1IB1 E;  3R9G A;  3E0K A;  2J9A A;  4CYQ A;  2BL1 A;  4DUK A;  2B4J C;  4NCZ A;  3IWW A;  3BXM A;  4A31 A;  2BUE A;  3IU2 A;  4MFZ A;  2DLA A;  2ZEO A;  3NA6 A;  4GXH A;  1LAM A;  4OAD A;  3KR5 A;  4TNU A;  2ZEM A;  3OB2 B;  3FMC A;  4ZI6 A;  4PK3 A;  3U88 C;  3F8K A;  1LFW A;  1QSR A;  1Z8X A;  3I6S A;  4MBU A;  3KHZ A;  5JM6 A;  2OOT A;  1XMB A;  6CPA A;  4OC2 A;  4BPX B;  1YW6 A;  3CPA A;  2ZED A;  2VKZ G;  4UFX A;  4A33 A;  5JPH A;  2O28 A;  2IL4 A;  2KCW A;  1IID A;  3C26 A;  4KS9 A;  1CE8 B;  3VRQ A;  4CZ1 A;  2GAN A;  5HMN A;  3OB1 B;  1NSA A;  2XEF A;  3SI1 A;  2AFS A;  1XEB A;  1X10 A;  1DTD A;  3D2M A;  4HNW B;  3T5M A;  3FH4 A;  4KZT A;  2PJ5 A;  4B5P B;  2XEI A;  3TFY A;  2HB6 A;  1MJ9 A;  1KEE B;  2AFU A;  3CDX A;  3SJX A;  4IIX A;  3WC5 A;  4JVO A;  3NFQ A;  2FT0 A;  4OID A;  4R87 A;  1U6M A;  4KLW A;  3OP0 A;  4NF1 A;  1LRZ A;  2PVW A;  1CS0 B;  3I9S A;  2GU2 A;  2PRB A;  3DNS A;  4YU9 A;  1YGH A;  1ZG8 A;  5HKW A;  1BAV A;  3QAY A;  3TLG A;  4X2T A;  1T36 B;  5A27 A;  4JXR A;  3SR3 A;  1C30 B;  2PJ4 A;  5HVF A;  4A2Z A;  3KL9 A;  2ABZ A;  3PP9 A;  1GYT A;  4X8I A;  4CAX A;  2FS5 A;  2R82 A;  4M8D A;  3T90 A;  4MHY A;  4PSX A;  3VWE A;  5KTC A;  1YLE A;  1FT7 A;  2C5Q A;  2PQ8 A;  3B2Y A;  2RC4 A;  3JVN A;  4OIW A;  5D8N A;  2B3U A;  5LYD A;  5C82 A;  1XIX A;  4EME A;  1YLO A;  3PLF B;  5K8P A;  1MJB A;  2DF5 A;  3IGR A;  2AFM A;  3IWG A;  1JDE A;  3VRN A;  2YNC A;  3TLG B;  1EE3 P;  2PJ7 A;  3FB3 A;  3FBU A;  4C2X A;  1CPS A;  4NGT A;  2R1I A;  1YRE A;  3I1U A;  3PRT A;  1BPM A;  4ONU A;  1XRY A;  3D68 A;  3NFZ A;  3NE7 A;  4RN7 A;  3JUW A;  4P4D A;  2OZG A;  4AVC A;  5F9M A;  1M4G A;  1KUV A;  4MI1 A;  3TLE A;  4C84 A;  3VRP A;  3PGP A;  4KSF A;  2YNC C;  3EZA A;  4BPW B;  1C3O B;  2F7V A;  3EO4 A;  3K2K A;  1TKH A;  5J8F A;  1KZF A;  3OAK A;  3IU1 A;  4MRI A;  3SHP A;  1CP7 A;  3CXS A;  4CYO A;  2GP4 A;  3B7I A;  5AG5 A;  5LYL A;  4MCS A;  3LWU A;  1M4D A;  4JLY A;  4JYW A;  4C9V A;  1J3L A;  1A2Z A;  2ZEF A;  3C8O A;  5FVJ A;  2EZA A;  4U5Y A;  4IF5 A;  3R9E A;  4KVX A;  3BI0 A;  4ONW A;  1S60 A;  2C27 A;  4MFQ A;  4KOR A;  1VBG A;  2Q43 A;  5ISV A;  2O53 A;  3VRO A;  3LOD A;  4M3S A;  2CTC A;  2ZEP A;  1TF8 A;  3B3T A;  4UBR A;  3S9M A;  2EZC A;  3PFO A;  2PJ0 A;  1Y9Z A;  5JYB A;  5DS0 A;  1KC7 A;  2HRO A;  4NGQ A;  3TLZ A;  2AE6 A;  2HQY A;  4AB7 A;  2GE3 A;  2P6G A;  3FEE A;  4XNH C;  1WK4 A;  1RTQ A;  4Q36 A;  2YGW A;  5DWM A;  5IR2 A;  4FD6 A;  3DSB A;  3NE8 A;  4K3N A;  2B58 A;  2DXQ A;  4LX9 A;  4XPD B;  5IV0 A;  5CPA A;  2N3A B;  2PR8 A;  4II9 A;  2D0P A;  1TKF A;  4C7H A;  3H4Q A;  2PE3 A;  3V38 A;  1M6V B;  3DR8 A;  1QQ9 A;  1WVM A;  5F48 A;  5KTA A;  4H1H A;  4BIN A;  3B3S A;  2HWG A;  1YVO A;  4PPZ A;  4ZBG A;  2GLJ A;  1B6B A;  2Q51 A;  4NXY A;  3TYX A;  1GHE A;  2WSA A;  1CJW A;  1Q2C A;  3D2P A;  5G20 A;  4EYS A;  3B3W A;  2X7B A;  4UIA A;  3NOJ A;  1KBL A;  2Z10 A;  1LAN A;  3PBB A;  3D8P A;  2NYQ A;  2REE A;  3G8W A;  3TX8 A;  3W6S A;  3KQX A;  4UF4 A;  3HUV A;  4E5S A;  2ANP A;  5CBM A;  1I12 A;  2AUM A;  1VHE A;  3KAS A;  2POK A;  4C9R A;  4UA3 A;  3KI9 A;  4J3G A;  4UCP A;  1IOI A;  3WR7 A;  3NH8 A;  1JQG A;  4CDK A;  3SXO A;  3D7D A;  2HV2 A;  2OB0 A;  3KQZ A;  4C8F A;  4P45 A;  4NEX A;  3CXQ A;  2BSW A;  3O8Z A;  1N71 A;  2Q04 A;  2Z0Z A;  5H84 A;  1YVK A;  3TC8 A;  3HPG G;  2FVG A;  4B10 A;  1X12 A;  1MK4 A;  4CGO A;  1K4J A;  2G0B A;  2Q4Y A;  4TJX A;  1KUY A;  1Z8W A;  3H5Z A;  2F8H A;  4PXE A;  3PB4 X;  4CRZ B;  5J3X A;  3R9F A;  5LYF A;  3EY5 A;  4L8A A;  3VGO A;  4CGM A;  3BUN B;  1Z4R A;  2AJ6 A;  4R6T A;  1A9X B;  3TOB A;  4YWY A;  2J8N A;  3GJZ A;  1WWZ A;  3BUM B;  2R7H A;  4KVM E;  3V7Z A;  4OC4 A;  1ARL A;  2C6G A;  2B4D A;  1PYT B;  2K5T A;  4A38 A;  3DGV A;  2PCN A;  5F09 A;  1ZLH A;  1ZLI A;  1Z9U A;  2CNS A;  3U1B A;  2PVV A;  2JBK A;  2Q7S A;  2PJ6 A;  4C99 A;  5F47 A;  1XOV A;  4CS0 B;  5JQ4 A;  3SI0 A;  3B3C A;  4C9E A;  3SXN A;  1S7K A;  2CTB A;  1Y9K A;  2PR1 A;  2QVP A;  4HPS A;  4JXQ A;  4CGN A;  2VZY A;  3TO9 A;  3RYO A;  3PB6 X;  1ZRS A;  1ZL0 A;  2WYR A;  2FIA A;  4U9Z A;  2AFW A;  2G3T A;  3OWC A;  4AXV A;  1FNO A;  1M44 A;  1IU8 A;  2JLM A;  2QIR A;  3D7F A;  4NGN A;  2P6F A;  3I3G A;  4R9M A;  4F9V A;  3PT1 A;  1LOK A;  4BD9 A;  1Y9W A;  1V0C A;  1CBX A;  5THW A;  1F2O A;  4COB A;  3F9K C;  2OZU A;  4H89 A;  4AVA A;  4C68 A;  4G1P A;  5HVG A;  2YNE A;  4KVO E;  4FD5 A;  3V8I A;  4JZ0 A;  2O4H A;  2C1C A;  3HLP A;  4B11 A;  1HEE A;  4U9Y A;  3BUX B;  1P4N A;  2R8V A;  5IB0 A;  3QNV A;  4ZGY B;  3BUO B;  1BLL E;  2Q4Z A;  2Q0Y A;  5JH9 A;  2AUN A;  3EZB A;  2PSW A;  4MFP A;  5ELY A;  2Q44 A;  4DYO A;  2YJT A;  4AVB A;  1Z8T A;  2ZOF A;  3TTH A;  5EBV A;  3ZNI A;  4FWU A;  2VZZ A;  2CNM A;  3KRV A;  1H8L A;  1Z2L A;  3PB9 X;  1VI4 A;  3KR4 A;  2FM4 A;  2GIV A;  2IJZ A;  4MCR A;  1XJO A;  3BJ7 A;  3RBU A;  4KLV A;  5AGE A;  3TLB A;  4Y49 C;  1CG2 A;  4UEE A;  3S6H A;  1IYL A;  2CXA A;  5AXI A;  4YN3 A;  5EMI A;  1LAP A;  2CBL A;  3VWD A;  1NXJ A;  4C85 A;  3B8G A;  4C8C A;  1RO5 A;  4QC6 A;  3H8G A;  2PJB A;  1Z5R A;  4P4E A;  2ATR A;  3QAH A;  1XF8 A;  1YK3 A;  4Y49 B;  1NBW A;  2YJV A;  5BY0 A;  4NGR A;  1ARM A;  4UFW A;  2B3V A;  1TXR A;  2PJ1 A;  4R3K A;  1ELM P;  3WAB A;  1KWM A;  1L0C A;  8CPA A;  4XPK A;  1XF1 A;  1CP6 A;  2X0S A;  1Z4E A;  4RI1 A;  3EFA A;  2FE7 A;  3CXP A;  3DDD A;  3IC1 A;  4A95 A;  4CAV A;  3T9Y A;  2MP0 A;  3T07 A;  1HDQ A;  4CAW A;  2DIK A;  3N7Z A;  2ZEH A;  5BWA B;  2OLS A;  2XPN A;  2BCO A;  5HKY A;  4C8A A;  4MHP A;  1EZB A;  1XE4 A;  3G3S A;  4UIB A;  1XMT A;  1S3Z A;  2F5I A;  2ZEG A;  4CAF A;  4TJV A;  2EUI A;  4E2A A;  3GIU A;  2R98 A;  3R95 A;  3TLY A;  2AFO A;  1ZO0 A;  2XPL A;  1YME A;  2VXK A;  3FJU A;  4MFJ A;  4MXU A;  3TT2 A;  5JVL A;  5K8M A;  2XPO A;  4OC3 A;  4MCQ A;  3D7H A;  2DEA A;  3T05 A;  1Y7R A;  2AFZ A;  2PJ9 A;  3TLA A;  1VHO A;  1Q2D A;  1RXT A;  2VBQ A;  4MY3 A;  3PB7 X;  5HH1 A;  4CGL A;  3SI2 A;  1V6C A;  4CPA A;  2EZB A;  2Y1M A;  1WJT A;  3LD2 A;  4H6Z A;  2ZEL A;  4AG7 A;  2DPT A;  4XNH B;  1YR0 A;  1I21 A;  3D3S A;  4MMO A;  5AG6 A;  5IB9 A;  4FAI A;  4K30 A;  3IO1 A;  2GFQ A;  1HDU A;  1F2P A;  2PJ2 A;  3PFV A;  3N5F A;  4L89 A;  3L2N A;  4ZYQ A;  2Q4V A;  2REF A;  1AMP A;  1YVH A;  1S7N A;  1AUG A;  2NMT A;  2PJC A;  2WPW A;  2ZW6 A;  5G21 A;  4ZX9 A;  4B13 A;  2PIY A;  2PJA A;  4MFL A;  4PV6 A;  4UEF A;  4BBH A;  3QB8 A;  3IIB A;  3W6X A;  5F1Y A;  4GS4 A;  1TKJ A;  2NSM A;  5HKZ A;  4KOX A;  1IYK A;  4KOY A;  4UWJ A;  2FXF A;  3TLC A;  4UEZ A;  1ZYM A;  3NH5 A;  3FEC A;  2Y0M A;  4FD7 A;  1S5K A;  5CNP A;  4C8T A;  3UY5 A;  1PU9 A;  4RR2 B;  4AG9 A;  4DNC A;  1OBR A;  4FBE A;  1YQE A;  2PIZ A;  4E94 A;  5LRJ A;  2JBJ A;  4A30 A;  3IWE A;  4MHZ A;  2FSR A;  3JTK A;  2IQ6 A;  4LQ6 A;  5F49 A;  1QSN A;  4X3R A;  4R8F A;  4PK2 A;  3TO7 A;  5G22 A;  4PQA A;  1M4L A;  2DPS A;  3VH9 A;  1JDB C;  4OKO A;  3BI1 A;  3WT4 A;  4OC1 A;  1FY7 A;  4R76 A;  1AYE A;  5I4M A;  1CPX A;  2ZPA A;  4UCN A;  1F57 A;  1LCP A;  2BOA A;  4BPU B;  2Z3L A;  2J8R A;  4M6G A;  3SJG A;  4A32 A;  4H6U A;  4MHD A;  4C9U A;  2BO9 A;  3PB8 X;  3FXT A;  5AG7 A;  1UFH A;  3WC7 A;  4KOU A;  2BEI A;  3GY9 A;  5F5X A;  4PSW A;  3LMS A;  5I0C A;  4E0A A;  1VIX A;  1XFO A;  2PC1 A;  3MN8 A;  4LUA A;  4F6A A;  1IIC A;  3GLJ A;  4H2K A;  4DJL A;  4QBJ A;  4P4B A;  3H8E A;  4W9Y A;  2I00 A;  4OLL A;  1UWY A;  1VGY A;  4LQG A;  4A94 A;  2FCK A;  4E8O A;  4MCP A;  4I49 A;  4M6H A;  1BO4 A;  1J4J A;  3KZW A;  2HUZ A;  3MRU A;  3WC6 A;  2B0A A;  2JDC A;  4M85 A;  1YSJ A;  4FD4 A;  4HNX B;  4HNY B;  3RZA A;  5HXD A;  4B5P A;  4A4B A;  5LRG A;  5LRK A;  4JD6 A;  4A4C A;  2YND A;  4C2Y A;  2PRQ A;  3P2H A;  4QVT A;  2V8H A;  2B4D B;  3IEH A;  5AG4 A;  5A28 A;  3BJ8 A;  1I1D A;  1NE9 A;  1BXR B;  3PZJ A;  4YGO A;  3ZZI A;  1B47 A;  1EZA A;  2OH1 A;  2E28 A;  4WJB A;  4A39 A;  2CNT A;  4PXB A;  4R7M A;  2CIJ A;  2ZOG A;  1ELL P;  3ISX A;  2VEZ A;  1IY7 A;  1Y0Y A;  2P0W A;  4MJ8 A;  3FRM A; 
#chains in the Genus database with same CATH homology
 4EFD A;  2HC9 A;  4NGS A;  4ZX8 A;  3I74 A;  2V8D A;  1TF9 A;  4OC0 A;  5IR2 A;  6CPA A;  4NFR A;  4RUH A;  2ZEE A;  3RAM A;  2RFH A;  4P4F A;  4OP4 A;  2EK9 A;  4KSI A;  2PJ8 A;  3JRU A;  4C8U A;  3GUX A;  4P4J A;  3K9T A;  3DLJ A;  2C6C A;  4EWT A;  3CT9 A;  3EIF A;  4NJQ A;  3FED A;  3FX6 A;  4MHN A;  2V8V A;  3PEI A;  2V77 A;  4NJR A;  4P44 A;  4IAV A;  4Q7A A;  5HVH A;  1ZG7 A;  3D4U A;  3GB0 A;  3T8W A;  2CF4 A;  2ZEN A;  2VL1 A;  1YW4 A;  3IFE A;  3ISZ A;  2JEW A;  1PCA A;  4GM5 A;  3ICU A;  4C9A A;  2XEG A;  4WWV A;  4B6Z A;  2PJ3 A;  2QJ8 A;  4PXC A;  2RB7 A;  4A37 A;  1Z8L A;  2V8G A;  3KHX A;  1Y0R A;  4TWE A;  4P4I A;  3S9N A;  2I3C A;  4FUU A;  1R43 A;  2EWB A;  3VAR A;  3VAT A;  3PFE A;  4NGM A;  2GLF A;  4C86 A;  2XEJ A;  1CX8 A;  4F9U A;  4OC5 A;  1IGB A;  4IHM A;  5K8N A;  4ZY0 A;  1ZG9 A;  4ZY1 A;  3SJE A;  3PBE A;  5JGF A;  4PXD A;  1DE4 C;  1QMU A;  2EK8 A;  3B3V A;  4F8Z A;  3D67 A;  5LYI A;  4OME A;  2AFX A;  3S9L A;  4IK2 A;  3CPX A;  3SJF A;  1Q7L A;  4Z65 A;  4P10 A;  4C8P A;  3BHX A;  3FVL A;  3IJ3 A;  4KNG E;  1XF1 A;  3D7G A;  2PCU A;  3B35 A;  3NH4 A;  7CPA A;  4CDJ A;  3VTA A;  2IMO A;  3FF3 A;  2QYV A;  5D29 A;  2OR4 A;  4NGP A;  1R3N A;  2GRE A;  3D66 A;  3H8F A;  3KGQ A;  2G9D A;  1Y7E A;  5K8O A;  1BPN A;  4O23 A;  4P6Y A;  2WZN A;  1XBU A;  2C6P A;  2J9A A;  4DUK A;  3IWW A;  3BXM A;  2ZEO A;  3NA6 A;  1LAM A;  4TNU A;  3KR5 A;  4ZI6 A;  2ZEM A;  3FMC A;  1LFW A;  3I6S A;  3KHZ A;  5JM6 A;  2OOT A;  1XMB A;  4OC2 A;  1YW6 A;  3CPA A;  2ZED A;  1NSA A;  2XEF A;  3SI1 A;  2AFS A;  4C99 A;  1DTD A;  3FH4 A;  2PJ5 A;  2XEI A;  2HB6 A;  2AFU A;  3CDX A;  3SJX A;  3WC5 A;  4OID A;  2PVW A;  2GU2 A;  4YU9 A;  1ZG8 A;  1BAV A;  4X2T A;  2PJ4 A;  5HVF A;  3KL9 A;  2ABZ A;  1GYT A;  4X8I A;  4MHY A;  2C5Q A;  1FT7 A;  3B2Y A;  4OIW A;  5D8N A;  5LYD A;  1YLO A;  5K8P A;  2AFM A;  1EE3 P;  2PJ7 A;  1CPS A;  4NGT A;  3I1U A;  3PRT A;  4ZY2 A;  1BPM A;  1XRY A;  3D68 A;  3NFZ A;  4P4D A;  4C84 A;  2F7V A;  3K2K A;  1TKH A;  4MRI A;  1CP7 A;  2GP4 A;  3B7I A;  5LYL A;  4C9V A;  4MCS A;  3LWU A;  4JYW A;  2ZEF A;  3BI0 A;  4ONW A;  2Q43 A;  2O53 A;  2CTC A;  2ZEP A;  1TF8 A;  3B3T A;  3S9M A;  3PFO A;  2PJ0 A;  1Y9Z A;  5DS0 A;  4NGQ A;  3FEE A;  1RTQ A;  4K3N A;  5CPA A;  1TKF A;  2PE3 A;  3V38 A;  1QQ9 A;  1WVM A;  3B3S A;  4PPZ A;  2GLJ A;  2Q51 A;  3B3W A;  4UIA A;  1LAN A;  3PBB A;  3TX8 A;  2NYQ A;  3KQX A;  4UF4 A;  3HUV A;  2ANP A;  5CBM A;  1VHE A;  3KAS A;  2POK A;  4C9R A;  3KI9 A;  3NH8 A;  1JQG A;  4CDK A;  3D7D A;  3KQZ A;  4C8F A;  4P45 A;  3TC8 A;  2FVG A;  4TJX A;  5LYF A;  2F8H A;  4PXE A;  3PB4 X;  4R6T A;  4YWY A;  3V7Z A;  4OC4 A;  1ARL A;  2C6G A;  1PYT B;  4A38 A;  3DGV A;  5F09 A;  1ZLH A;  1ZLI A;  2PVV A;  2JBK A;  2PJ6 A;  3SI0 A;  3B3C A;  4C9E A;  2CTB A;  2QVP A;  3PB6 X;  2WYR A;  4AXV A;  2AFW A;  1FNO A;  4F9V A;  3D7F A;  4NGN A;  1LOK A;  4BD9 A;  1CBX A;  5THW A;  1F2O A;  4G1P A;  5HVG A;  4EME A;  4JZ0 A;  2O4H A;  2C1C A;  3HLP A;  1HEE A;  3QNV A;  1BLL E;  2Q4Z A;  5JH9 A;  5ELY A;  4DYO A;  2ZOF A;  4FWU A;  1H8L A;  1Z2L A;  3PB9 X;  3KR4 A;  2IJZ A;  4MCR A;  1XJO A;  3RBU A;  1CG2 A;  4UEE A;  4YN3 A;  1LAP A;  4C85 A;  4C8C A;  3H8G A;  2PJB A;  1Z5R A;  4P4E A;  4NGR A;  1ARM A;  1TXR A;  2PJ1 A;  1ELM P;  3WAB A;  1KWM A;  8CPA A;  1CP6 A;  3IC1 A;  1HDQ A;  2ZEH A;  2BCO A;  4C8A A;  4MHP A;  4UIB A;  2ZEG A;  4TJV A;  2AFO A;  4MXU A;  1YME A;  3FJU A;  5K8M A;  4OC3 A;  2DEA A;  4MCQ A;  3D7H A;  2AFZ A;  2PJ9 A;  1VHO A;  3PB7 X;  3SI2 A;  1V6C A;  4CPA A;  2ZEL A;  5IB9 A;  4MMO A;  4FAI A;  3IO1 A;  1HDU A;  1F2P A;  2PJ2 A;  3N5F A;  4ZYQ A;  3L2N A;  1AMP A;  2PJC A;  4ZX9 A;  2PIY A;  2PJA A;  4UEF A;  3IIB A;  1TKJ A;  2NSM A;  4UEZ A;  3NH5 A;  3FEC A;  4C8T A;  1OBR A;  4FBE A;  2PIZ A;  5LRJ A;  2JBJ A;  4MHZ A;  2IQ6 A;  4X3R A;  4R8F A;  4PQA A;  1M4L A;  3VH9 A;  4OKO A;  3BI1 A;  3WT4 A;  4OC1 A;  5I4M A;  4R76 A;  1AYE A;  1CPX A;  1F57 A;  1LCP A;  2BOA A;  3SJG A;  4C9U A;  2BO9 A;  3PB8 X;  3WC7 A;  3LMS A;  1VIX A;  1XFO A;  3MN8 A;  3GLJ A;  4H2K A;  4DJL A;  4P4B A;  3H8E A;  4W9Y A;  1UWY A;  1VGY A;  4LQG A;  4A94 A;  4MCP A;  3KZW A;  3MRU A;  3WC6 A;  1YSJ A;  3RZA A;  5HXD A;  5LRG A;  5LRK A;  2PRQ A;  2V8H A;  3IEH A;  4WJB A;  4A39 A;  4PXB A;  4R7M A;  2CIJ A;  2ZOG A;  1ELL P;  3ISX A;  1IY7 A;  1Y0Y A;  5J1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...