4OC2A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ceibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxybut-3-yn-1-yl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc2A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc2A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc2A02
2GLFA 1ZLHA 4UIBA 4EFDA 4IK2A 3EIFA 3KQXA 2Q51A 2CTBA 4MCSA 4NFRA 2PJ3A 3KR5A 1QQ9A 4BD9A 2ZOFA 2PVWA 4LQGA 4NGQA 3D68A 1ARLA 4C9AA 2XEJA 1FT7A 2V8DA 4UEEA 1TKHA 3FEEA 3CPAA 3SI1A 3KASA 3FH4A 5K8OA 4DJLA 5K8PA 4UEFA 1Z5RA 4UIAA 3FECA 1CP6A 4P4BA 2BO9A 4P44A 4NGRA 4PXEA 4C99A 2PE3A 4MCPA 4ZI6A 5ELYA 4C8CA 4C85A 3VTAA 2NYQA 2AFMA 4ZY1A 3IO1A 3BI1A 1LOKA 2WZNA 4H2KA 3SJEA 4OIDA 4O23A 2QVPA 3B3SA 2F7VA 2IQ6A 2O4HA 4KSIA 2HC9A 3H8EA 2PCUA 1VHEA 4OC5A 4OC4A 4IHMA 3D66A 3LMSA 4R8FA 4F9UA 1KWMA 2PIYA 4OMEA 1NSAA 5LYDA 2V8GA 3PB8X 5D29A 3KL9A 2AFZA 3MRUA 1YW4A 3SI0A 2ZEHA 4X2TA 3IJ3A 4ZYQA 4PXCA 1ELLP 5F09A 3PB4X 1V6CA 1YLOA 4B6ZA 4C8PA 3WABA 1WVMA 3GUXA 1DTDA 5JM6A 2BCOA 4ZX9A 1FNOA 3D7FA 2PJ2A 3HLPA 4Q7AA 5HXDA 3PB9X 2EK9A 3H8FA 1Y0YA 4EWTA 4NJRA 1F2PA 7CPAA 4CDJA 4C9VA 2C1CA 3D7GA 1YMEA 4JYWA 1TKFA 1Y7EA 1LAMA 1Z2LA 1ELMP 2V8HA 2FVGA 5IB9A 5I4MA 1H8LA 3IEHA 1F2OA 3DLJA 2ZENA 3S9LA 3B3TA 3SI2A 2ZEFA 1HDQA 4NGMA 3FMCA 2IMOA 1DE4C 3IWWA 2QYVA 2PJAA 4OIWA 1R3NA 3FJUA 3CT9A 5JGFA 3B2YA 3BI0A 5LYLA 2PJ0A 4YWYA 1VGYA 4G1PA 1XFOA 4C9EA 4A39A 4PQAA 3S9NA 1YSJA 2RB7A 3B3CA 2AFOA 4A94A 3V38A 1XBUA 1XMBA 3PRTA 2GU2A 4C86A 5JH9A 2EK8A 2XEGA 3I74A 3WC7A 3I1UA 2POKA 4MHYA 5LRKA 2JEWA 2BOAA 1Z8LA 5D8NA 3LWUA 4K3NA 3KQZA 4UEZA 5HVHA 2PJ1A 4OP4A 3ICUA 2EWBA 1M4LA 3BHXA 3GLJA 5THWA 5HVFA 3FF3A 2AFWA 3WC5A 3B7IA 4PXDA 4C8AA 1VIXA 4WJBA 1RTQA 4CDKA 4MRIA 3VARA 3K2KA 3NH8A 3D67A 4YU9A 1LCPA 2DEAA 3NFZA 2AFUA 4P4FA 2F8HA 1CX8A 5LRJA 4NJQA 5LYFA 2CTCA 2ZEDA 5CBMA 3HUVA 2C6CA 1HDUA 1CBXA 2PJ6A 4W9YA 1R43A 4P6YA 3FVLA 2WYRA 4P4IA 3KGQA 3KR4A 4WWVA 2ZEEA 1CPSA 2ZEMA 3DGVA 1LFWA 3B35A 2OR4A 2Q4ZA 4F8ZA 1AMPA 1OBRA 4PXBA 3B3WA 3ISXA 3WC6A 3SJXA 4ONWA 3V7ZA 3PFEA 4CPAA 3BXMA 2CF4A 3KHZA 2V8VA 4A38A 2ANPA 4MHPA 4C8UA 1JQGA 4MXUA 2V77A 1YW6A 2PJ8A 3SJGA 1LAPA 2ABZA 4F9VA 1BLLE 4C8TA 1Y0RA 3TX8A 2OOTA 2GLJA 4P10A 5J1QA 3B3VA 4OKOA 3N5FA 3RBUA 3KZWA 4AXVA 2AFXA 3L2NA 4OC2A 4X3RA 2ZELA 3MN8A 3VATA 4OC1A 4C9UA 2NSMA 2PJ9A 4FBEA 4TNUA 4R7MA 3KI9A 1F57A 5LYIA 2ZEPA 4FWUA 1TF9A 3WT4A 4C8FA 4P45A 1TF8A 4ZX8A 1ARMA 5K8NA 3JRUA 2GREA 2AFSA 4OC0A 4NGSA 3PBBA 1UWYA 4R6TA 8CPAA 5HVGA 2PJ5A 1ZG8A 3NA6A 4RUHA 2PJ7A 5CPAA 3PB7X 2O53A 3D4UA 1VHOA 5K8MA 4Z65A 4MCQA 1XF1A 1CPXA 2JBKA 4NGPA 4TJXA 2Q43A 3RZAA 1LANA 4P4EA 3NH5A 2VL1A 3PB6X 3VH9A 1HEEA 2JBJA 1BAVA 4P4JA 2RFHA 4A37A 5DS0A 4IAVA 3GB0A 4ZY2A 6CPAA 3D7DA 3ISZA 1ZLIA 4ZY0A 3KHXA 2PJ4A 2PRQA 1CP7A 4MCRA 4OC3A 4KNGE 3FEDA 2I3CA 2ZEOA 3H8GA 4MMOA 1ZG7A 4NGTA 1GYTA 3CPXA 4MHZA 3TC8A 1BPMA 4YN3A 3QNVA 4UF4A 3FX6A 1TXRA 2PIZA 4X8IA 2PVVA 2ZOGA 2XEFA 1ZG9A 4TWEA 1IY7A 1Y9ZA 2PJCA 3NH4A 1PCAA 4C9RA 4TJVA 2XEIA 4P4DA 1CG2A 2C6GA 4R76A 4FAIA 3IFEA 4GM5A 1TKJA 3PBEA 2G9DA 2QJ8A 4PPZA 2J9AA 1EE3P 4NGNA 1XJOA 3IIBA 2CIJA 1Q7LA 4DUKA 2PJBA 4JZ0A 4MHNA 3T8WA 1AYEA 2C6PA 1QMUA 2IJZA 4EMEA 3SJFA 3PFOA 3S9MA 2ZEGA 3IC1A 1BPNA 3RAMA 3D7HA 3I6SA 4C84A 1XRYA 3PEIA 3K9TA 5LRGA 1PYTB 2HB6A 3CDXA 4DYOA 4FUUA 1IGBA
chains in the Genus database with same CATH superfamily
1B6BA 2GLFA 1IIDA 1ZLHA 4MFJA 4M3SA 4UIBA 3NFQA 1VBGA 4CS0B 4EFDA 4IK2A 3EIFA 4MY3A 3KQXA 2GE3A 4COBA 2Q51A 2X7BA 4BPUB 4BPWB 3VRPA 4MCSA 2CTBA 3OWCA 4NFRA 4INJA 1I12A 2PJ3A 3KR5A 1QQ9A 3EZEA 4MI4A 1V0CA 1NSLA 2HV2A 4BD9A 1AUGA 2ZOFA 4IF5A 3PLFB 3IU2A 2PVWA 4LQGA 4NGQA 3D68A 1S5KA 1ARLA 2DF5A 4C9AA 2B5GA 2G3AA 2P6EA 2GFQA 2XEJA 1YK3A 3MGDA 1FT7A 2EZCA 2V8DA 4UEEA 1TKHA 2HROA 3FEEA 4A4BA 1XF8A 3CPAA 3KASA 3FH4A 3SI1A 5K8OA 2ATRA 4KS9A 4DJLA 3EZBA 1QSRA 2B4DB 2NMTA 3UY5A 5K8PA 2RC4A 4JXQA 2FIWA 4UEFA 4CAXA 5G1ZA 2WPXA 3R9EA 1BXRB 1NXJA 1Z5RA 3VWDA 1S3ZA 5C82A 1EZBA 4UIAA 4CYNA 5J8CA 3FECA 1CP6A 4P4BA 4KUBA 2BO9A 2Q4YA 1VHSA 1WJTA 4P44A 1CJWA 4NGRA 4UWIA 4FD6A 4OLLA 4PXEA 4C99A 2VZZA 2PE3A 4MCPA 4ZI6A 5H86A 3TFYA 5ELYA 4M6GA 1Z4RA 2FE7A 4QC6A 3TOAA 1DIKA 4Q36A 2D0OA 3TLGB 1Z9UA 4C85A 3VTAA 4KSFA 2NYQA 2AFMA 3JUWA 3RO0A 4ZGYB 4ZY1A 5BWAB 4XPKA 3IO1A 5IV0A 3BI1A 1LOKA 2B58A 2D4OA 3DR8A 4HNYB 2FM4A 1JWQA 2HI6A 4E8OA 2WZNA 4H2KA 3SJEA 4FD7A 2BSWA 4OIDA 4O23A 2QVPA 2REFA 3B3SA 2EBJA 2F7VA 4UFXA 2IQ6A 2O4HA 4JXRA 4KSIA 4R3LA 2HC9A 4KLVA 3BUWB 3H8EA 3VGOA 3I3GA 1M4GA 2PCUA 4PV6A 1VHEA 4OC5A 3KKWA 2Z3PA 3SXNA 4OC4A 4AB7A 2ZPAA 2VXKA 3D66A 4IHMA 2PR1A 3LMSA 4R8FA 3HPHE 4F9UA 1KWMA 2PIYA 1U6MA 4OMEA 1X12A 1NSAA 3TLGA 4UFWA 4KOWA 2XPLA 2YNCA 2Z3OA 3TO9A 4PK2A 3JTKA 5LYDA 2V8GA 2Z10A 3PB8X 4GPLB 2JLMA 2BUEA 4KSAA 3TLYA 5D29A 1BOBA 2AFZA 3KL9A 4B11A 3MRUA 3S6FA 2AUNA 1YW4A 3SI0A 5A28A 4CAFA 2PDOA 2ZEHA 2YNEA 2EZBA 4X2TA 2FL4A 3IJ3A 4BPXB 4BMHA 4ZYQA 3O8ZA 4IUSA 4PXCA 1ELLP 2PSWA 5F09A 4B5PB 2QMLA 2OB0A 3TCVA 2VKZG 1CS0B 3ZJ0A 5F1YA 3PB4X 1V6CA 2QIRA 3TO7A 4UA3A 4MJ8A 1YLOA 3DSBA 4B6ZA 2ZW7A 4C8PA 5F13A 3WABA 4UBRA 2CNMA 2D4PA 2I79A 1WVMA 3TLZA 3GUXA 1DTDA 5JM6A 5G20A 2Y0MA 2BCOA 2EUIA 5IB0A 3P2HA 2PCNA 4E94A 2HQYA 3E0KA 1FNOA 2PR8A 4GXHA 3D7FA 2PJ2A 2R7HA 3HLPA 4Q7AA 5JPHA 5HXDA 3PB9X 2EK9A 3H8FA 1Y0YA 4MHDA 2OH1A 2DLAA 4H6UA 4EWTA 4NJRA 1KBLA 1F2PA 5G21A 1Q5XA 3IWEA 3DNSA 2ZW6A 7CPAA 4CDJA 3W6SA 4C9VA 2C1CA 1Z9EA 2B4BA 3VRNA 3D7GA 1YMEA 4JYWA 4U5YA 1TKFA 1Y7EA 1LAMA 1Z2LA 2F5IA 4JLYA 4NSQA 1EO0A 4PSXA 2Q7BA 3T5MA 1ELMP 1QSTA 2V8HA 4CYQA 2FVGA 3BJ7A 3CXPA 5GCNA 5KTCA 4UCPA 5IB9A 1J3LA 3HPGG 2XPPA 1LRZA 5I4MA 1H8LA 3IEHA 3OAKA 3U88C 1F2OA 3DLJA 2B4DA 2ZENA 2I00A 2R8VA 3S9LA 3B3TA 4KOYA 2ZEFA 4Y49B 3SI2A 4C68A 1HDQA 4NGMA 3EO4A 3FMCA 4KOSA 4A31A 2ODFA 4C2ZA 2IMOA 1DE4C 3IWWA 2QYVA 5HKWA 2PJAA 2CNTA 4OIWA 2PC1A 2YNDA 1R3NA 1SQHA 1XOVA 3FJUA 4CAWA 2A4NA 3CT9A 4R87A 5JGFA 2R98A 3B2YA 3TLCA 3BI0A 2Z3MA 3A9LA 2N3AB 5LYLA 4YFJA 2J8RA 2PJ0A 2CBLA 4YWYA 1VGYA 2WPWA 4F0XA 2FT0A 4G1PA 4Y49C 3S6GA 4CYOA 3KRVA 1QSNA 4UCMA 5F49A 1XFOA 4C9EA 1IB1E 4XNHC 4A33A 4KVME 3WR7A 3TO6A 4A39A 1CE8B 4UCNA 1PUAA 4CGOA 4PQAA 1Y9WA 1Q2DA 1VKCA 3S9NA 2Q04A 3PFVA 1YSJA 2RB7A 1QSMA 2R82A 3B3CA 2AFOA 3R9GA 4A94A 2DIKA 3V38A 1XBUA 1XMBA 4H1HA 3PRTA 4C2YA 4FD4A 2GU2A 4C86A 4E0AA 5JH9A 1S7NA 2EK8A 2XEGA 1ON0A 2Z11A 4KOVA 3F0AA 2ZW4A 5AXIA 4MJXA 1P4NA 3I74A 3SHPA 4YGOA 3I1UA 2POKA 4MHYA 3WC7A 3FB3A 5LRKA 2JEWA 1KZFA 1KEEB 3GKRA 2D0PA 2BOAA 1Z8LA 1XIXA 3RNZA 5D8NA 1Q2CA 2J8NA 3LWUA 3KQZA 4K3NA 4KORA 2FIAA 4UEZA 1NBWA 2B4JC 2P6FA 1YGHA 2O28A 5FD8A 4C2XA 1S7FA 1UFHA 3SXOA 5HVHA 2PJ1A 4OP4A 5J1QA 2EWBA 3IU1A 3ICUA 1M4LA 4JD6A 3BHXA 2KCWA 1I1DA 4RR2B 3GLJA 4X5KA 5IX3A 5THWA 2PQ8A 5HVFA 3FF3A 4A4CA 2AFWA 3WC5A 3B7IA 4PXDA 2REEA 2CNSA 4C8AA 4XPDC 5F47A 1VIXA 2BL1A 1IYKA 2Z3KA 4WJBA 3OP0A 1RTQA 1A2ZA 4CDKA 2OZGA 4MRIA 1YVKA 1K4JA 4U9ZA 3VARA 4ZX9A 5F5XA 3K2KA 3NH8A 3D67A 3T9YA 2B3VA 4YU9A 3R9FA 4UWJA 1LCPA 5C88A 4II9A 2DEAA 2YJTA 3NFZA 4MFKA 5JQ4A 2AFUA 2VEZA 5AG6A 1BO4A 2P0WA 4HPSA 4L8AA 3R95A 3VROA 4P4FA 1MJAA 3TYXA 2F8HA 1TIQA 3PGPA 1YQEA 4J0NA 1CX8A 1B47A 3HMJG 5LRJA 1ZRSA 4H6ZA 4KOTA 4NJQA 4KOXA 5LYFA 4KVOE 2CTCA 2ZEDA 5CBMA 3D8PA 4RN7A 3HUVA 5J8FA 2C6CA 1HDUA 3K9UA 5BY0A 1CBXA 3FNCA 1NE9A 5A27A 4B5OA 2DPSA 2AJ6A 5EC4A 3BUNB 4U9YA 3T05A 3PT1A 3FBUA 2AUMA 2PJ6A 3C26A 3F8KA 4W9YA 4OAEA 1R43A 5G22A 2Q4VA 1P0HA 3BUXB 3CXSA 4J3GA 4P6YA 2YJVA 2EO8A 3CZXA 3FVLA 4CRYB 2HUZA 2WYRA 4P4IA 3BUOB 1R57A 3KGQA 1EZAA 1ZYMA 3KR4A 2GP4A 4BTFA 2P6GA 4WWVA 2ZEEA 3FYNA 4NF1A 4C7IA 1X10A 3T07A 5AG7A 1CPSA 2R1IA 2G3TA 2ZEMA 1LFWA 3DGVA 5FVJA 1OZPA 4ZBGA 2VQYA 1C30B 2OLSA 3B35A 2OR4A 2Q4ZA 4RS2A 2YNCC 4F8ZA 4B14A 1AMPA 1XE4A 1KUVA 1OBRA 4PXBA 3B3WA 1Z4EA 3ISXA 3WC6A 3SJXA 4ONWA 2ARHA 2ZXVA 1IICA 3V7ZA 3PFEA 4CPAA 4ORFA 4C8FA 3BXMA 2CF4A 4NEXA 3KHZA 4QUSA 2V8VA 4B13A 4XPLA 5EMIA 2FCKA 2VBQA 3QAYA 4A38A 4A2ZA 2ANPA 1Z8WA 4MHPA 4C8UA 5JYBA 2GANA 1JQGA 4CGPA 4JJXA 4MXUA 1I21A 1N71A 3FRMA 3FIXA 2V77A 1CM0A 3K4IA 1YW6A 3U1BA 3D3SA 3FXTA 5HKZA 2PJ8A 3D2PA 3SJGA 2JEVA 3R1KA 4H89A 1LAPA 4A32A 4AG9A 4EVYA 2ABZA 3F5BA 4F9VA 1WWZA 1IOFA 1MJBA 4F0YA 5ISVA 4IIYA 4R9MA 1BLLE 4C8TA 1XEBA 4CGLA 4I49A 3T0TA 1Y0RA 3QB8A 3TX8A 5IR2A 1IU8A 2OOTA 2GLJA 2VI7A 4P10A 5J3XA 3B3VA 3IWGA 4FD5A 4OKOA 3BLNA 2CY2A 2Q44A 3N5FA 4Q38A 2Z0ZA 3RBUA 1VI4A 3KZWA 4AXVA 3S6HA 2AFXA 2ZW5A 2E28A 3L2NA 4UFVA 2AE6A 4OC2A 4CRZB 4E5SA 4X3RA 2H5MA 2ZELA 3MN8A 4AVAA 4PK3A 2C5QA 2OU2A 1A9XB 3VATA 1S7LA 4B12A 4BINA 4OC1A 2J8MA 3JVNA 4C9UA 2FXFA 1C3OB 2CXAA 3TE4A 2NSMA 2PJ9A 4FBEA 4TNUA 3ZZIA 1Y7RA 3LD2A 4R7MA 1B87A 3KI9A 1F57A 5LYIA 3RYOA 4B10A 3NOJA 2ZEPA 4FWUA 1TF9A 3WT4A 4YRHA 2MP0A 4CAVA 3BJ8A 4P45A 1TF8A 4HNXB 1ARMA 4ZX8A 3TTHA 3JRUA 2GREA 4A95A 5K8NA 2DPTA 2AFSA 2Y1NA 1QSOA 1M4IA 2Z3NA 4OC0A 1T36B 2OZUA 3LODA 5KTAA 4NGSA 2Q0YA 4A30A 3PBBA 1KUYA 1UWYA 4R6TA 8CPAA 5HVGA 1Q2YA 2PJ5A 5AG5A 1ZG8A 3NA6A 4M85A 4RUHA 2PJ7A 5CPAA 3PB7X 1FY7A 2O53A 4MFPA 2HWGA 1FBVA 3D4UA 4XNHB 4XPDB 1R61A 1VHOA 4OADA 3EXNA 5K8MA 2JDDA 4LX9A 5HMNA 3TLEA 4C8CA 2EZAA 4Z65A 3F9KC 4MCQA 1XF1A 3NE7A 1CPXA 2DXQA 2JBKA 4NGPA 4LUAA 2Q43A 4TJXA 3GY9A 3RZAA 4B5PA 1JDEA 3G23A 3IGRA 3SR3A 1LANA 4P4EA 3NH5A 4F6AA 2JDCA 2VL1A 4EYSA 3PB6X 3ZNIA 3VH9A 3OB1B 1HEEA 2JBJA 1BAVA 1NMTA 3TT2A 4P4JA 4COGA 2RFHA 4A37A 5DS0A 1YREA 1MK4A 1PU9A 1GHEA 2FS5A 3DDDA 3BUMB 5JVLA 4IAVA 2B0AA 4NXYA 3GB0A 4ZY2A 2Z3LA 6CPAA 3D7DA 3DR6A 3H4QA 2X0SA 1RXTA 3GYAA 3GIUA 3ISZA 1ZLIA 3H5ZA 4ZY0A 4JVOA 5F9MA 3KHXA 2PJ4A 2PRQA 4MFLA 3I9SA 5DWNA 3W91A 4MFZA 4AVCA 1J4JA 4GS4A 1YX0A 1CP7A 4MCRA 4QVTA 4OC3A 4KNGE 4IIXA 3FEDA 2I3CA 2ZEOA 4CYPA 4M6IA 3H8GA 2QECA 4MMOA 3TOBA 1GGOA 4CZ1A 1ZG7A 2BEIA 2Y1MA 4NGTA 1GYTA 3CPXA 1YLEA 5E96A 3VRQA 1VBHA 5H84A 4HKFA 4MHZA 1ZL0A 1YR0A 1BPMA 2B5GB 3TC8A 2EVNA 4MI1A 3CXQA 3QNVA 5AGEA 4E2AA 1Z8XA 2XPNA 3NE8A 4UF4A 3FX6A 4CGNA 5I0CA 1TXRA 4DNCA 2PIZA 2G0BA 1JDBC 4M8DA 4X8IA 4ONUA 2PVVA 2ZOGA 4AG7A 4KVXA 2XEFA 1ZG9A 5DWMA 4TWEA 5HH1A 1IY7A 4KZTA 2PJCA 3G3SA 3NH4A 4KOUA 1Y9ZA 1PCAA 1RO5A 1KC7A 1L0CA 4C9RA 1XMTA 4LQ6A 4R3KA 1IOIA 3OB2B 3VWEA 3B8GA 4TJVA 4JWPA 2Q7SA 4MBUA 2XEIA 4P4DA 2FSRA 1CG2A 2C6GA 1Z8TA 3LACA 3QAHA 3N7ZA 4R76A 5F48A 3S6KA 4FAIA 1Y9KA 3G8WA 3IFEA 3VRRA 1IYLA 4GM5A 4HNWB 3R96A 1TKJA 1WK4A 4CO9A 3PZJA 2YGWA 5EBVA 3PBEA 3W6XA 2G9DA 2QJ8A 4PPZA 5K99A 2J9AA 4MFQA 2OZHA 2PRBA 1EE3P 1M44A 5F46A 5KTDA 2IL4A 4L89A 2GIVA 4NGNA 4R57A 2C27A 5CNPA 1XJOA 3IIBA 2CIJA 1MJ9A 1Q7LA 2WSAA 3V8IA 4DUKA 2VZYA 1YVHA 1YVOA 2PJBA 4KLWA 4CAEA 3GJZA 4JZ0A 4C7HA 1M1DA 4MHNA 3T8WA 3TLBA 1AYEA 2K5TA 1S60A 3D2MA 2C6PA 1QMUA 2IJZA 4PSWA 3SJFA 4EMEA 5AG4A 2B3UA 3PFOA 3PP9A 3S9MA 1M6VB 4RI1A 2ZEGA 3IC1A 2UV8G 3EZAA 2WUUA 2XPOA 3TLAA 1BPNA 4MY0A 5HKYA 4AVBA 3RAMA 3D7HA 4QB9A 4K30A 4M6HA 4NCZA 1ZO0A 3I6SA 4BBHA 3P2FA 4CGMA 3EFAA 1S7KA 1XRYA 4C84A 3PEIA 3K9TA 3T90A 5LRGA 4QBJA 1PYTB 3C8OA 4KUAA 2HB6A 3CDXA 4DYOA 4YN3A 3EC4A 3EY5A 4FUUA 1KUXA 1M4DA 1IGBA
chains in the Genus database with same CATH topology
2GLFA 1ZLHA 4UIBA 4EFDA 4IK2A 3EIFA 3KQXA 2Q51A 2CTBA 4MCSA 4NFRA 2PJ3A 3KR5A 1QQ9A 4BD9A 2ZOFA 2PVWA 4LQGA 4NGQA 3D68A 1ARLA 4C9AA 2XEJA 1FT7A 2V8DA 4UEEA 1TKHA 3FEEA 3CPAA 3SI1A 3KASA 3FH4A 5K8OA 4DJLA 5K8PA 4UEFA 1Z5RA 4UIAA 3FECA 1CP6A 4P4BA 2BO9A 4P44A 4NGRA 4PXEA 4C99A 2PE3A 4MCPA 4ZI6A 5ELYA 4C8CA 4C85A 3VTAA 2NYQA 2AFMA 4ZY1A 3IO1A 3BI1A 1LOKA 2WZNA 4H2KA 3SJEA 4OIDA 4O23A 2QVPA 3B3SA 2F7VA 2IQ6A 2O4HA 4KSIA 2HC9A 3H8EA 2PCUA 1VHEA 4OC5A 4OC4A 4IHMA 3D66A 3LMSA 4R8FA 4F9UA 1KWMA 2PIYA 4OMEA 1NSAA 5LYDA 2V8GA 3PB8X 5D29A 3KL9A 2AFZA 3MRUA 1YW4A 3SI0A 2ZEHA 4X2TA 3IJ3A 4ZYQA 4PXCA 1ELLP 5F09A 3PB4X 1V6CA 1YLOA 4B6ZA 4C8PA 3WABA 1WVMA 3GUXA 1DTDA 5JM6A 2BCOA 4ZX9A 1FNOA 3D7FA 2PJ2A 3HLPA 4Q7AA 5HXDA 3PB9X 2EK9A 3H8FA 1Y0YA 4EWTA 4NJRA 1F2PA 7CPAA 4CDJA 4C9VA 2C1CA 3D7GA 1YMEA 4JYWA 1TKFA 1Y7EA 1LAMA 1Z2LA 1ELMP 2V8HA 2FVGA 5IB9A 5I4MA 1H8LA 3IEHA 1F2OA 3DLJA 2ZENA 3S9LA 3B3TA 3SI2A 2ZEFA 1HDQA 4NGMA 3FMCA 2IMOA 1DE4C 3IWWA 2QYVA 2PJAA 4OIWA 1R3NA 3FJUA 3CT9A 5JGFA 3B2YA 3BI0A 5LYLA 2PJ0A 4YWYA 1VGYA 4G1PA 1XFOA 4C9EA 4A39A 4PQAA 3S9NA 1YSJA 2RB7A 3B3CA 2AFOA 4A94A 3V38A 1XBUA 1XMBA 3PRTA 2GU2A 4C86A 5JH9A 2EK8A 2XEGA 3I74A 3WC7A 3I1UA 2POKA 4MHYA 5LRKA 2JEWA 2BOAA 1Z8LA 5D8NA 3LWUA 4K3NA 3KQZA 4UEZA 5HVHA 2PJ1A 4OP4A 3ICUA 2EWBA 1M4LA 3BHXA 3GLJA 5THWA 5HVFA 3FF3A 2AFWA 3WC5A 3B7IA 4PXDA 4C8AA 1VIXA 4WJBA 1RTQA 4CDKA 4MRIA 3VARA 3K2KA 3NH8A 3D67A 4YU9A 1LCPA 2DEAA 3NFZA 2AFUA 4P4FA 2F8HA 1CX8A 5LRJA 4NJQA 5LYFA 2CTCA 2ZEDA 5CBMA 3HUVA 2C6CA 1HDUA 1CBXA 2PJ6A 4W9YA 1R43A 4P6YA 3FVLA 2WYRA 4P4IA 3KGQA 2GP4A 3KR4A 4WWVA 2ZEEA 1CPSA 2ZEMA 3DGVA 1LFWA 3B35A 2OR4A 2Q4ZA 4F8ZA 1AMPA 1OBRA 4PXBA 3B3WA 3ISXA 3WC6A 3SJXA 4ONWA 3V7ZA 3PFEA 4CPAA 3BXMA 2CF4A 3KHZA 2V8VA 4A38A 2ANPA 4MHPA 4C8UA 1JQGA 4MXUA 2V77A 1YW6A 2PJ8A 3SJGA 1LAPA 2ABZA 4F9VA 1BLLE 4C8TA 1Y0RA 3TX8A 5IR2A 2OOTA 2GLJA 4P10A 5J1QA 3B3VA 4OKOA 3N5FA 3RBUA 3KZWA 4AXVA 2AFXA 3L2NA 4OC2A 4X3RA 2ZELA 3MN8A 2C5QA 3VATA 4OC1A 4C9UA 2NSMA 2PJ9A 4FBEA 4TNUA 4R7MA 3KI9A 1F57A 5LYIA 2ZEPA 4FWUA 1TF9A 3WT4A 4C8FA 4P45A 1TF8A 4ZX8A 1ARMA 5K8NA 3JRUA 2GREA 2AFSA 4OC0A 4NGSA 3PBBA 1UWYA 4R6TA 8CPAA 5HVGA 2PJ5A 1ZG8A 3NA6A 4RUHA 2PJ7A 5CPAA 3PB7X 2O53A 3D4UA 1VHOA 5K8MA 4Z65A 4MCQA 1XF1A 1CPXA 2JBKA 4NGPA 4TJXA 2Q43A 3RZAA 1LANA 4P4EA 3NH5A 2VL1A 3PB6X 3VH9A 1HEEA 2JBJA 1BAVA 4P4JA 2RFHA 4A37A 5DS0A 4IAVA 3GB0A 4ZY2A 6CPAA 3D7DA 3ISZA 1ZLIA 4ZY0A 3KHXA 2PJ4A 2PRQA 1CP7A 4MCRA 4OC3A 4KNGE 3FEDA 2I3CA 2ZEOA 3H8GA 4MMOA 1ZG7A 4NGTA 1GYTA 3CPXA 4MHZA 3TC8A 1BPMA 4YN3A 3QNVA 4UF4A 3FX6A 1TXRA 2PIZA 4X8IA 2PVVA 2ZOGA 2XEFA 1ZG9A 4TWEA 1IY7A 1Y9ZA 2PJCA 3NH4A 1PCAA 4C9RA 4TJVA 2XEIA 4P4DA 1CG2A 2C6GA 4R76A 4FAIA 3IFEA 4GM5A 1TKJA 3PBEA 2G9DA 2QJ8A 4PPZA 2J9AA 1EE3P 4NGNA 1XJOA 3IIBA 2CIJA 1Q7LA 4DUKA 2PJBA 4JZ0A 4MHNA 3T8WA 1AYEA 2C6PA 1QMUA 2IJZA 4EMEA 3SJFA 3PFOA 3S9MA 2ZEGA 3IC1A 1BPNA 3RAMA 3D7HA 3I6SA 4C84A 1XRYA 3PEIA 3K9TA 5LRGA 1PYTB 2HB6A 3CDXA 4DYOA 4FUUA 1IGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLF A;  1ZLH A;  4UIB A;  4EFD A;  4IK2 A;  3EIF A;  3KQX A;  2Q51 A;  2CTB A;  4MCS A;  4NFR A;  2PJ3 A;  3KR5 A;  1QQ9 A;  4BD9 A;  2ZOF A;  2PVW A;  4LQG A;  4NGQ A;  3D68 A;  1ARL A;  4C9A A;  2XEJ A;  1FT7 A;  2V8D A;  4UEE A;  1TKH A;  3FEE A;  3CPA A;  3SI1 A;  3KAS A;  3FH4 A;  5K8O A;  4DJL A;  5K8P A;  4UEF A;  1Z5R A;  4UIA A;  3FEC A;  1CP6 A;  4P4B A;  2BO9 A;  4P44 A;  4NGR A;  4PXE A;  4C99 A;  2PE3 A;  4MCP A;  4ZI6 A;  5ELY A;  4C8C A;  4C85 A;  3VTA A;  2NYQ A;  2AFM A;  4ZY1 A;  3IO1 A;  3BI1 A;  1LOK A;  2WZN A;  4H2K A;  3SJE A;  4OID A;  4O23 A;  2QVP A;  3B3S A;  2F7V A;  2IQ6 A;  2O4H A;  4KSI A;  2HC9 A;  3H8E A;  2PCU A;  1VHE A;  4OC5 A;  4OC4 A;  4IHM A;  3D66 A;  3LMS A;  4R8F A;  4F9U A;  1KWM A;  2PIY A;  4OME A;  1NSA A;  5LYD A;  2V8G A;  3PB8 X;  5D29 A;  3KL9 A;  2AFZ A;  3MRU A;  1YW4 A;  3SI0 A;  2ZEH A;  4X2T A;  3IJ3 A;  4ZYQ A;  4PXC A;  1ELL P;  5F09 A;  3PB4 X;  1V6C A;  1YLO A;  4B6Z A;  4C8P A;  3WAB A;  1WVM A;  3GUX A;  1DTD A;  5JM6 A;  2BCO A;  4ZX9 A;  1FNO A;  3D7F A;  2PJ2 A;  3HLP A;  4Q7A A;  5HXD A;  3PB9 X;  2EK9 A;  3H8F A;  1Y0Y A;  4EWT A;  4NJR A;  1F2P A;  7CPA A;  4CDJ A;  4C9V A;  2C1C A;  3D7G A;  1YME A;  4JYW A;  1TKF A;  1Y7E A;  1LAM A;  1Z2L A;  1ELM P;  2V8H A;  2FVG A;  5IB9 A;  5I4M A;  1H8L A;  3IEH A;  1F2O A;  3DLJ A;  2ZEN A;  3S9L A;  3B3T A;  3SI2 A;  2ZEF A;  1HDQ A;  4NGM A;  3FMC A;  2IMO A;  1DE4 C;  3IWW A;  2QYV A;  2PJA A;  4OIW A;  1R3N A;  3FJU A;  3CT9 A;  5JGF A;  3B2Y A;  3BI0 A;  5LYL A;  2PJ0 A;  4YWY A;  1VGY A;  4G1P A;  1XFO A;  4C9E A;  4A39 A;  4PQA A;  3S9N A;  1YSJ A;  2RB7 A;  3B3C A;  2AFO A;  4A94 A;  3V38 A;  1XBU A;  1XMB A;  3PRT A;  2GU2 A;  4C86 A;  5JH9 A;  2EK8 A;  2XEG A;  3I74 A;  3WC7 A;  3I1U A;  2POK A;  4MHY A;  5LRK A;  2JEW A;  2BOA A;  1Z8L A;  5D8N A;  3LWU A;  4K3N A;  3KQZ A;  4UEZ A;  5HVH A;  2PJ1 A;  4OP4 A;  3ICU A;  2EWB A;  1M4L A;  3BHX A;  3GLJ A;  5THW A;  5HVF A;  3FF3 A;  2AFW A;  3WC5 A;  3B7I A;  4PXD A;  4C8A A;  1VIX A;  4WJB A;  1RTQ A;  4CDK A;  4MRI A;  3VAR A;  3K2K A;  3NH8 A;  3D67 A;  4YU9 A;  1LCP A;  2DEA A;  3NFZ A;  2AFU A;  4P4F A;  2F8H A;  1CX8 A;  5LRJ A;  4NJQ A;  5LYF A;  2CTC A;  2ZED A;  5CBM A;  3HUV A;  2C6C A;  1HDU A;  1CBX A;  2PJ6 A;  4W9Y A;  1R43 A;  4P6Y A;  3FVL A;  2WYR A;  4P4I A;  3KGQ A;  3KR4 A;  4WWV A;  2ZEE A;  1CPS A;  2ZEM A;  3DGV A;  1LFW A;  3B35 A;  2OR4 A;  2Q4Z A;  4F8Z A;  1AMP A;  1OBR A;  4PXB A;  3B3W A;  3ISX A;  3WC6 A;  3SJX A;  4ONW A;  3V7Z A;  3PFE A;  4CPA A;  3BXM A;  2CF4 A;  3KHZ A;  2V8V A;  4A38 A;  2ANP A;  4MHP A;  4C8U A;  1JQG A;  4MXU A;  2V77 A;  1YW6 A;  2PJ8 A;  3SJG A;  1LAP A;  2ABZ A;  4F9V A;  1BLL E;  4C8T A;  1Y0R A;  3TX8 A;  2OOT A;  2GLJ A;  4P10 A;  5J1Q A;  3B3V A;  4OKO A;  3N5F A;  3RBU A;  3KZW A;  4AXV A;  2AFX A;  3L2N A;  4OC2 A;  4X3R A;  2ZEL A;  3MN8 A;  3VAT A;  4OC1 A;  4C9U A;  2NSM A;  2PJ9 A;  4FBE A;  4TNU A;  4R7M A;  3KI9 A;  1F57 A;  5LYI A;  2ZEP A;  4FWU A;  1TF9 A;  3WT4 A;  4C8F A;  4P45 A;  1TF8 A;  4ZX8 A;  1ARM A;  5K8N A;  3JRU A;  2GRE A;  2AFS A;  4OC0 A;  4NGS A;  3PBB A;  1UWY A;  4R6T A;  8CPA A;  5HVG A;  2PJ5 A;  1ZG8 A;  3NA6 A;  4RUH A;  2PJ7 A;  5CPA A;  3PB7 X;  2O53 A;  3D4U A;  1VHO A;  5K8M A;  4Z65 A;  4MCQ A;  1XF1 A;  1CPX A;  2JBK A;  4NGP A;  4TJX A;  2Q43 A;  3RZA A;  1LAN A;  4P4E A;  3NH5 A;  2VL1 A;  3PB6 X;  3VH9 A;  1HEE A;  2JBJ A;  1BAV A;  4P4J A;  2RFH A;  4A37 A;  5DS0 A;  4IAV A;  3GB0 A;  4ZY2 A;  6CPA A;  3D7D A;  3ISZ A;  1ZLI A;  4ZY0 A;  3KHX A;  2PJ4 A;  2PRQ A;  1CP7 A;  4MCR A;  4OC3 A;  4KNG E;  3FED A;  2I3C A;  2ZEO A;  3H8G A;  4MMO A;  1ZG7 A;  4NGT A;  1GYT A;  3CPX A;  4MHZ A;  3TC8 A;  1BPM A;  4YN3 A;  3QNV A;  4UF4 A;  3FX6 A;  1TXR A;  2PIZ A;  4X8I A;  2PVV A;  2ZOG A;  2XEF A;  1ZG9 A;  4TWE A;  1IY7 A;  1Y9Z A;  2PJC A;  3NH4 A;  1PCA A;  4C9R A;  4TJV A;  2XEI A;  4P4D A;  1CG2 A;  2C6G A;  4R76 A;  4FAI A;  3IFE A;  4GM5 A;  1TKJ A;  3PBE A;  2G9D A;  2QJ8 A;  4PPZ A;  2J9A A;  1EE3 P;  4NGN A;  1XJO A;  3IIB A;  2CIJ A;  1Q7L A;  4DUK A;  2PJB A;  4JZ0 A;  4MHN A;  3T8W A;  1AYE A;  2C6P A;  1QMU A;  2IJZ A;  4EME A;  3SJF A;  3PFO A;  3S9M A;  2ZEG A;  3IC1 A;  1BPN A;  3RAM A;  3D7H A;  3I6S A;  4C84 A;  1XRY A;  3PEI A;  3K9T A;  5LRG A;  1PYT B;  2HB6 A;  3CDX A;  4DYO A;  4FUU A;  1IGB A; 
#chains in the Genus database with same CATH topology
 1B6B A;  2GLF A;  1IID A;  1ZLH A;  4MFJ A;  4M3S A;  4UIB A;  3NFQ A;  1VBG A;  4CS0 B;  4EFD A;  4IK2 A;  3EIF A;  4MY3 A;  3KQX A;  2GE3 A;  4COB A;  2Q51 A;  2X7B A;  4BPU B;  4BPW B;  3VRP A;  4MCS A;  2CTB A;  3OWC A;  4NFR A;  4INJ A;  1I12 A;  2PJ3 A;  3KR5 A;  1QQ9 A;  3EZE A;  4MI4 A;  1V0C A;  1NSL A;  2HV2 A;  4BD9 A;  1AUG A;  2ZOF A;  4IF5 A;  3PLF B;  3IU2 A;  2PVW A;  4LQG A;  4NGQ A;  3D68 A;  1S5K A;  1ARL A;  2DF5 A;  4C9A A;  2B5G A;  2G3A A;  2P6E A;  2GFQ A;  2XEJ A;  1YK3 A;  3MGD A;  1FT7 A;  2EZC A;  2V8D A;  4UEE A;  1TKH A;  2HRO A;  3FEE A;  4A4B A;  1XF8 A;  3CPA A;  3KAS A;  3FH4 A;  3SI1 A;  5K8O A;  2ATR A;  4KS9 A;  4DJL A;  3EZB A;  1QSR A;  2B4D B;  2NMT A;  3UY5 A;  5K8P A;  2RC4 A;  4JXQ A;  2FIW A;  4UEF A;  4CAX A;  5G1Z A;  2WPX A;  3R9E A;  1BXR B;  1NXJ A;  1Z5R A;  3VWD A;  1S3Z A;  5C82 A;  1EZB A;  4UIA A;  4CYN A;  5J8C A;  3FEC A;  1CP6 A;  4P4B A;  4KUB A;  2BO9 A;  2Q4Y A;  1VHS A;  1WJT A;  4P44 A;  1CJW A;  4NGR A;  4UWI A;  4FD6 A;  4OLL A;  4PXE A;  4C99 A;  2VZZ A;  2PE3 A;  4MCP A;  4ZI6 A;  5H86 A;  3TFY A;  5ELY A;  4M6G A;  1Z4R A;  2FE7 A;  4QC6 A;  3TOA A;  1DIK A;  4Q36 A;  2D0O A;  3TLG B;  1Z9U A;  4C85 A;  3VTA A;  4KSF A;  2NYQ A;  2AFM A;  3JUW A;  3RO0 A;  4ZGY B;  4ZY1 A;  5BWA B;  4XPK A;  3IO1 A;  5IV0 A;  3BI1 A;  1LOK A;  2B58 A;  2D4O A;  3DR8 A;  4HNY B;  2FM4 A;  1JWQ A;  2HI6 A;  4E8O A;  2WZN A;  4H2K A;  3SJE A;  4FD7 A;  2BSW A;  4OID A;  4O23 A;  2QVP A;  2REF A;  3B3S A;  2EBJ A;  2F7V A;  4UFX A;  2IQ6 A;  2O4H A;  4JXR A;  4KSI A;  4R3L A;  2HC9 A;  4KLV A;  3BUW B;  3H8E A;  3VGO A;  3I3G A;  1M4G A;  2PCU A;  4PV6 A;  1VHE A;  4OC5 A;  3KKW A;  2Z3P A;  3SXN A;  4OC4 A;  4AB7 A;  2ZPA A;  2VXK A;  3D66 A;  4IHM A;  2PR1 A;  3LMS A;  4R8F A;  3HPH E;  4F9U A;  1KWM A;  2PIY A;  1U6M A;  4OME A;  1X12 A;  1NSA A;  3TLG A;  4UFW A;  4KOW A;  2XPL A;  2YNC A;  2Z3O A;  3TO9 A;  4PK2 A;  3JTK A;  5LYD A;  2V8G A;  2Z10 A;  3PB8 X;  4GPL B;  2JLM A;  2BUE A;  4KSA A;  3TLY A;  5D29 A;  1BOB A;  2AFZ A;  3KL9 A;  4B11 A;  3MRU A;  3S6F A;  2AUN A;  1YW4 A;  3SI0 A;  5A28 A;  4CAF A;  2PDO A;  2ZEH A;  2YNE A;  2EZB A;  4X2T A;  2FL4 A;  3IJ3 A;  4BPX B;  4BMH A;  4ZYQ A;  3O8Z A;  4IUS A;  4PXC A;  1ELL P;  2PSW A;  5F09 A;  4B5P B;  2QML A;  2OB0 A;  3TCV A;  2VKZ G;  1CS0 B;  3ZJ0 A;  5F1Y A;  3PB4 X;  1V6C A;  2QIR A;  3TO7 A;  4UA3 A;  4MJ8 A;  1YLO A;  3DSB A;  4B6Z A;  2ZW7 A;  4C8P A;  5F13 A;  3WAB A;  4UBR A;  2CNM A;  2D4P A;  2I79 A;  1WVM A;  3TLZ A;  3GUX A;  1DTD A;  5JM6 A;  5G20 A;  2Y0M A;  2BCO A;  2EUI A;  5IB0 A;  3P2H A;  2PCN A;  4E94 A;  2HQY A;  3E0K A;  1FNO A;  2PR8 A;  4GXH A;  3D7F A;  2PJ2 A;  2R7H A;  3HLP A;  4Q7A A;  5JPH A;  5HXD A;  3PB9 X;  2EK9 A;  3H8F A;  1Y0Y A;  4MHD A;  2OH1 A;  2DLA A;  4H6U A;  4EWT A;  4NJR A;  1KBL A;  1F2P A;  5G21 A;  1Q5X A;  3IWE A;  3DNS A;  2ZW6 A;  7CPA A;  4CDJ A;  3W6S A;  4C9V A;  2C1C A;  1Z9E A;  2B4B A;  3VRN A;  3D7G A;  1YME A;  4JYW A;  4U5Y A;  1TKF A;  1Y7E A;  1LAM A;  1Z2L A;  2F5I A;  4JLY A;  4NSQ A;  1EO0 A;  4PSX A;  2Q7B A;  3T5M A;  1ELM P;  1QST A;  2V8H A;  4CYQ A;  2FVG A;  3BJ7 A;  3CXP A;  5GCN A;  5KTC A;  4UCP A;  5IB9 A;  1J3L A;  3HPG G;  2XPP A;  1LRZ A;  5I4M A;  1H8L A;  3IEH A;  3OAK A;  3U88 C;  1F2O A;  3DLJ A;  2B4D A;  2ZEN A;  2I00 A;  2R8V A;  3S9L A;  3B3T A;  4KOY A;  2ZEF A;  4Y49 B;  3SI2 A;  4C68 A;  1HDQ A;  4NGM A;  3EO4 A;  3FMC A;  4KOS A;  4A31 A;  2ODF A;  4C2Z A;  2IMO A;  1DE4 C;  3IWW A;  2QYV A;  5HKW A;  2PJA A;  2CNT A;  4OIW A;  2PC1 A;  2YND A;  1R3N A;  1SQH A;  1XOV A;  3FJU A;  4CAW A;  2A4N A;  3CT9 A;  4R87 A;  5JGF A;  2R98 A;  3B2Y A;  3TLC A;  3BI0 A;  2Z3M A;  3A9L A;  2N3A B;  5LYL A;  4YFJ A;  2J8R A;  2PJ0 A;  2CBL A;  4YWY A;  1VGY A;  2WPW A;  4F0X A;  2FT0 A;  4G1P A;  4Y49 C;  3S6G A;  4CYO A;  3KRV A;  1QSN A;  4UCM A;  5F49 A;  1XFO A;  4C9E A;  1IB1 E;  4XNH C;  4A33 A;  4KVM E;  3WR7 A;  3TO6 A;  4A39 A;  1CE8 B;  4UCN A;  1PUA A;  4CGO A;  4PQA A;  1Y9W A;  1Q2D A;  1VKC A;  3S9N A;  2Q04 A;  3PFV A;  1YSJ A;  2RB7 A;  1QSM A;  2R82 A;  3B3C A;  2AFO A;  3R9G A;  4A94 A;  2DIK A;  3V38 A;  1XBU A;  1XMB A;  4H1H A;  3PRT A;  4C2Y A;  4FD4 A;  2GU2 A;  4C86 A;  4E0A A;  5JH9 A;  1S7N A;  2EK8 A;  2XEG A;  1ON0 A;  2Z11 A;  4KOV A;  3F0A A;  2ZW4 A;  5AXI A;  4MJX A;  1P4N A;  3I74 A;  3SHP A;  4YGO A;  3I1U A;  2POK A;  4MHY A;  3WC7 A;  3FB3 A;  5LRK A;  2JEW A;  1KZF A;  1KEE B;  3GKR A;  2D0P A;  2BOA A;  1Z8L A;  1XIX A;  3RNZ A;  5D8N A;  1Q2C A;  2J8N A;  3LWU A;  3KQZ A;  4K3N A;  4KOR A;  2FIA A;  4UEZ A;  1NBW A;  2B4J C;  2P6F A;  1YGH A;  2O28 A;  5FD8 A;  4C2X A;  1S7F A;  1UFH A;  3SXO A;  5HVH A;  2PJ1 A;  4OP4 A;  5J1Q A;  2EWB A;  3IU1 A;  3ICU A;  1M4L A;  4JD6 A;  3BHX A;  2KCW A;  1I1D A;  4RR2 B;  3GLJ A;  4X5K A;  5IX3 A;  5THW A;  2PQ8 A;  5HVF A;  3FF3 A;  4A4C A;  2AFW A;  3WC5 A;  3B7I A;  4PXD A;  2REE A;  2CNS A;  4C8A A;  4XPD C;  5F47 A;  1VIX A;  2BL1 A;  1IYK A;  2Z3K A;  4WJB A;  3OP0 A;  1RTQ A;  1A2Z A;  4CDK A;  2OZG A;  4MRI A;  1YVK A;  1K4J A;  4U9Z A;  3VAR A;  4ZX9 A;  5F5X A;  3K2K A;  3NH8 A;  3D67 A;  3T9Y A;  2B3V A;  4YU9 A;  3R9F A;  4UWJ A;  1LCP A;  5C88 A;  4II9 A;  2DEA A;  2YJT A;  3NFZ A;  4MFK A;  5JQ4 A;  2AFU A;  2VEZ A;  5AG6 A;  1BO4 A;  2P0W A;  4HPS A;  4L8A A;  3R95 A;  3VRO A;  4P4F A;  1MJA A;  3TYX A;  2F8H A;  1TIQ A;  3PGP A;  1YQE A;  4J0N A;  1CX8 A;  1B47 A;  3HMJ G;  5LRJ A;  1ZRS A;  4H6Z A;  4KOT A;  4NJQ A;  4KOX A;  5LYF A;  4KVO E;  2CTC A;  2ZED A;  5CBM A;  3D8P A;  4RN7 A;  3HUV A;  5J8F A;  2C6C A;  1HDU A;  3K9U A;  5BY0 A;  1CBX A;  3FNC A;  1NE9 A;  5A27 A;  4B5O A;  2DPS A;  2AJ6 A;  5EC4 A;  3BUN B;  4U9Y A;  3T05 A;  3PT1 A;  3FBU A;  2AUM A;  2PJ6 A;  3C26 A;  3F8K A;  4W9Y A;  4OAE A;  1R43 A;  5G22 A;  2Q4V A;  1P0H A;  3BUX B;  3CXS A;  4J3G A;  4P6Y A;  2YJV A;  2EO8 A;  3CZX A;  3FVL A;  4CRY B;  2HUZ A;  2WYR A;  4P4I A;  3BUO B;  1R57 A;  3KGQ A;  1EZA A;  1ZYM A;  3KR4 A;  2GP4 A;  4BTF A;  2P6G A;  4WWV A;  2ZEE A;  3FYN A;  4NF1 A;  4C7I A;  1X10 A;  3T07 A;  5AG7 A;  1CPS A;  2R1I A;  2G3T A;  2ZEM A;  1LFW A;  3DGV A;  5FVJ A;  1OZP A;  4ZBG A;  2VQY A;  1C30 B;  2OLS A;  3B35 A;  2OR4 A;  2Q4Z A;  4RS2 A;  2YNC C;  4F8Z A;  4B14 A;  1AMP A;  1XE4 A;  1KUV A;  1OBR A;  4PXB A;  3B3W A;  1Z4E A;  3ISX A;  3WC6 A;  3SJX A;  4ONW A;  2ARH A;  2ZXV A;  1IIC A;  3V7Z A;  3PFE A;  4CPA A;  4ORF A;  4C8F A;  3BXM A;  2CF4 A;  4NEX A;  3KHZ A;  4QUS A;  2V8V A;  4B13 A;  4XPL A;  5EMI A;  2FCK A;  2VBQ A;  3QAY A;  4A38 A;  4A2Z A;  2ANP A;  1Z8W A;  4MHP A;  4C8U A;  5JYB A;  2GAN A;  1JQG A;  4CGP A;  4JJX A;  4MXU A;  1I21 A;  1N71 A;  3FRM A;  3FIX A;  2V77 A;  1CM0 A;  3K4I A;  1YW6 A;  3U1B A;  3D3S A;  3FXT A;  5HKZ A;  2PJ8 A;  3D2P A;  3SJG A;  2JEV A;  3R1K A;  4H89 A;  1LAP A;  4A32 A;  4AG9 A;  4EVY A;  2ABZ A;  3F5B A;  4F9V A;  1WWZ A;  1IOF A;  1MJB A;  4F0Y A;  5ISV A;  4IIY A;  4R9M A;  1BLL E;  4C8T A;  1XEB A;  4CGL A;  4I49 A;  3T0T A;  1Y0R A;  3QB8 A;  3TX8 A;  5IR2 A;  1IU8 A;  2OOT A;  2GLJ A;  2VI7 A;  4P10 A;  5J3X A;  3B3V A;  3IWG A;  4FD5 A;  4OKO A;  3BLN A;  2CY2 A;  2Q44 A;  3N5F A;  4Q38 A;  2Z0Z A;  3RBU A;  1VI4 A;  3KZW A;  4AXV A;  3S6H A;  2AFX A;  2ZW5 A;  2E28 A;  3L2N A;  4UFV A;  2AE6 A;  4OC2 A;  4CRZ B;  4E5S A;  4X3R A;  2H5M A;  2ZEL A;  3MN8 A;  4AVA A;  4PK3 A;  2C5Q A;  2OU2 A;  1A9X B;  3VAT A;  1S7L A;  4B12 A;  4BIN A;  4OC1 A;  2J8M A;  3JVN A;  4C9U A;  2FXF A;  1C3O B;  2CXA A;  3TE4 A;  2NSM A;  2PJ9 A;  4FBE A;  4TNU A;  3ZZI A;  1Y7R A;  3LD2 A;  4R7M A;  1B87 A;  3KI9 A;  1F57 A;  5LYI A;  3RYO A;  4B10 A;  3NOJ A;  2ZEP A;  4FWU A;  1TF9 A;  3WT4 A;  4YRH A;  2MP0 A;  4CAV A;  3BJ8 A;  4P45 A;  1TF8 A;  4HNX B;  1ARM A;  4ZX8 A;  3TTH A;  3JRU A;  2GRE A;  4A95 A;  5K8N A;  2DPT A;  2AFS A;  2Y1N A;  1QSO A;  1M4I A;  2Z3N A;  4OC0 A;  1T36 B;  2OZU A;  3LOD A;  5KTA A;  4NGS A;  2Q0Y A;  4A30 A;  3PBB A;  1KUY A;  1UWY A;  4R6T A;  8CPA A;  5HVG A;  1Q2Y A;  2PJ5 A;  5AG5 A;  1ZG8 A;  3NA6 A;  4M85 A;  4RUH A;  2PJ7 A;  5CPA A;  3PB7 X;  1FY7 A;  2O53 A;  4MFP A;  2HWG A;  1FBV A;  3D4U A;  4XNH B;  4XPD B;  1R61 A;  1VHO A;  4OAD A;  3EXN A;  5K8M A;  2JDD A;  4LX9 A;  5HMN A;  3TLE A;  4C8C A;  2EZA A;  4Z65 A;  3F9K C;  4MCQ A;  1XF1 A;  3NE7 A;  1CPX A;  2DXQ A;  2JBK A;  4NGP A;  4LUA A;  2Q43 A;  4TJX A;  3GY9 A;  3RZA A;  4B5P A;  1JDE A;  3G23 A;  3IGR A;  3SR3 A;  1LAN A;  4P4E A;  3NH5 A;  4F6A A;  2JDC A;  2VL1 A;  4EYS A;  3PB6 X;  3ZNI A;  3VH9 A;  3OB1 B;  1HEE A;  2JBJ A;  1BAV A;  1NMT A;  3TT2 A;  4P4J A;  4COG A;  2RFH A;  4A37 A;  5DS0 A;  1YRE A;  1MK4 A;  1PU9 A;  1GHE A;  2FS5 A;  3DDD A;  3BUM B;  5JVL A;  4IAV A;  2B0A A;  4NXY A;  3GB0 A;  4ZY2 A;  2Z3L A;  6CPA A;  3D7D A;  3DR6 A;  3H4Q A;  2X0S A;  1RXT A;  3GYA A;  3GIU A;  3ISZ A;  1ZLI A;  3H5Z A;  4ZY0 A;  4JVO A;  5F9M A;  3KHX A;  2PJ4 A;  2PRQ A;  4MFL A;  3I9S A;  5DWN A;  3W91 A;  4MFZ A;  4AVC A;  1J4J A;  4GS4 A;  1YX0 A;  1CP7 A;  4MCR A;  4QVT A;  4OC3 A;  4KNG E;  4IIX A;  3FED A;  2I3C A;  2ZEO A;  4CYP A;  4M6I A;  3H8G A;  2QEC A;  4MMO A;  3TOB A;  1GGO A;  4CZ1 A;  1ZG7 A;  2BEI A;  2Y1M A;  4NGT A;  1GYT A;  3CPX A;  1YLE A;  5E96 A;  3VRQ A;  1VBH A;  5H84 A;  4HKF A;  4MHZ A;  1ZL0 A;  1YR0 A;  1BPM A;  2B5G B;  3TC8 A;  2EVN A;  4MI1 A;  3CXQ A;  3QNV A;  5AGE A;  4E2A A;  1Z8X A;  2XPN A;  3NE8 A;  4UF4 A;  3FX6 A;  4CGN A;  5I0C A;  1TXR A;  4DNC A;  2PIZ A;  2G0B A;  1JDB C;  4M8D A;  4X8I A;  4ONU A;  2PVV A;  2ZOG A;  4AG7 A;  4KVX A;  2XEF A;  1ZG9 A;  5DWM A;  4TWE A;  5HH1 A;  1IY7 A;  4KZT A;  2PJC A;  3G3S A;  3NH4 A;  4KOU A;  1Y9Z A;  1PCA A;  1RO5 A;  1KC7 A;  1L0C A;  4C9R A;  1XMT A;  4LQ6 A;  4R3K A;  1IOI A;  3OB2 B;  3VWE A;  3B8G A;  4TJV A;  4JWP A;  2Q7S A;  4MBU A;  2XEI A;  4P4D A;  2FSR A;  1CG2 A;  2C6G A;  1Z8T A;  3LAC A;  3QAH A;  3N7Z A;  4R76 A;  5F48 A;  3S6K A;  4FAI A;  1Y9K A;  3G8W A;  3IFE A;  3VRR A;  1IYL A;  4GM5 A;  4HNW B;  3R96 A;  1TKJ A;  1WK4 A;  4CO9 A;  3PZJ A;  2YGW A;  5EBV A;  3PBE A;  3W6X A;  2G9D A;  2QJ8 A;  4PPZ A;  5K99 A;  2J9A A;  4MFQ A;  2OZH A;  2PRB A;  1EE3 P;  1M44 A;  5F46 A;  5KTD A;  2IL4 A;  4L89 A;  2GIV A;  4NGN A;  4R57 A;  2C27 A;  5CNP A;  1XJO A;  3IIB A;  2CIJ A;  1MJ9 A;  1Q7L A;  2WSA A;  3V8I A;  4DUK A;  2VZY A;  1YVH A;  1YVO A;  2PJB A;  4KLW A;  4CAE A;  3GJZ A;  4JZ0 A;  4C7H A;  1M1D A;  4MHN A;  3T8W A;  3TLB A;  1AYE A;  2K5T A;  1S60 A;  3D2M A;  2C6P A;  1QMU A;  2IJZ A;  4PSW A;  3SJF A;  4EME A;  5AG4 A;  2B3U A;  3PFO A;  3PP9 A;  3S9M A;  1M6V B;  4RI1 A;  2ZEG A;  3IC1 A;  2UV8 G;  3EZA A;  2WUU A;  2XPO A;  3TLA A;  1BPN A;  4MY0 A;  5HKY A;  4AVB A;  3RAM A;  3D7H A;  4QB9 A;  4K30 A;  4M6H A;  4NCZ A;  1ZO0 A;  3I6S A;  4BBH A;  3P2F A;  4CGM A;  3EFA A;  1S7K A;  1XRY A;  4C84 A;  3PEI A;  3K9T A;  3T90 A;  5LRG A;  4QBJ A;  1PYT B;  3C8O A;  4KUA A;  2HB6 A;  3CDX A;  4DYO A;  4YN3 A;  3EC4 A;  3EY5 A;  4FUU A;  1KUX A;  1M4D A;  1IGB A; 
#chains in the Genus database with same CATH homology
 2GLF A;  1ZLH A;  4UIB A;  4EFD A;  4IK2 A;  3EIF A;  3KQX A;  2Q51 A;  2CTB A;  4MCS A;  4NFR A;  2PJ3 A;  3KR5 A;  1QQ9 A;  4BD9 A;  2ZOF A;  2PVW A;  4LQG A;  4NGQ A;  3D68 A;  1ARL A;  4C9A A;  2XEJ A;  1FT7 A;  2V8D A;  4UEE A;  1TKH A;  3FEE A;  3CPA A;  3SI1 A;  3KAS A;  3FH4 A;  5K8O A;  4DJL A;  5K8P A;  4UEF A;  1Z5R A;  4UIA A;  3FEC A;  1CP6 A;  4P4B A;  2BO9 A;  4P44 A;  4NGR A;  4PXE A;  4C99 A;  2PE3 A;  4MCP A;  4ZI6 A;  5ELY A;  4C8C A;  4C85 A;  3VTA A;  2NYQ A;  2AFM A;  4ZY1 A;  3IO1 A;  3BI1 A;  1LOK A;  2WZN A;  4H2K A;  3SJE A;  4OID A;  4O23 A;  2QVP A;  3B3S A;  2F7V A;  2IQ6 A;  2O4H A;  4KSI A;  2HC9 A;  3H8E A;  2PCU A;  1VHE A;  4OC5 A;  4OC4 A;  4IHM A;  3D66 A;  3LMS A;  4R8F A;  4F9U A;  1KWM A;  2PIY A;  4OME A;  1NSA A;  5LYD A;  2V8G A;  3PB8 X;  5D29 A;  3KL9 A;  2AFZ A;  3MRU A;  1YW4 A;  3SI0 A;  2ZEH A;  4X2T A;  3IJ3 A;  4ZYQ A;  4PXC A;  1ELL P;  5F09 A;  3PB4 X;  1V6C A;  1YLO A;  4B6Z A;  4C8P A;  3WAB A;  1WVM A;  3GUX A;  1DTD A;  5JM6 A;  2BCO A;  4ZX9 A;  1FNO A;  3D7F A;  2PJ2 A;  3HLP A;  4Q7A A;  5HXD A;  3PB9 X;  2EK9 A;  3H8F A;  1Y0Y A;  4EWT A;  4NJR A;  1F2P A;  7CPA A;  4CDJ A;  4C9V A;  2C1C A;  3D7G A;  1YME A;  4JYW A;  1TKF A;  1Y7E A;  1LAM A;  1Z2L A;  1ELM P;  2V8H A;  2FVG A;  5IB9 A;  5I4M A;  1H8L A;  3IEH A;  1F2O A;  3DLJ A;  2ZEN A;  3S9L A;  3B3T A;  3SI2 A;  2ZEF A;  1HDQ A;  4NGM A;  3FMC A;  2IMO A;  1DE4 C;  3IWW A;  2QYV A;  2PJA A;  4OIW A;  1R3N A;  3FJU A;  3CT9 A;  5JGF A;  3B2Y A;  3BI0 A;  5LYL A;  2PJ0 A;  4YWY A;  1VGY A;  4G1P A;  1XFO A;  4C9E A;  4A39 A;  4PQA A;  3S9N A;  1YSJ A;  2RB7 A;  3B3C A;  2AFO A;  4A94 A;  3V38 A;  1XBU A;  1XMB A;  3PRT A;  2GU2 A;  4C86 A;  5JH9 A;  2EK8 A;  2XEG A;  3I74 A;  3WC7 A;  3I1U A;  2POK A;  4MHY A;  5LRK A;  2JEW A;  2BOA A;  1Z8L A;  5D8N A;  3LWU A;  4K3N A;  3KQZ A;  4UEZ A;  5HVH A;  2PJ1 A;  4OP4 A;  3ICU A;  2EWB A;  1M4L A;  3BHX A;  3GLJ A;  5THW A;  5HVF A;  3FF3 A;  2AFW A;  3WC5 A;  3B7I A;  4PXD A;  4C8A A;  1VIX A;  4WJB A;  1RTQ A;  4CDK A;  4MRI A;  3VAR A;  3K2K A;  3NH8 A;  3D67 A;  4YU9 A;  1LCP A;  2DEA A;  3NFZ A;  2AFU A;  4P4F A;  2F8H A;  1CX8 A;  5LRJ A;  4NJQ A;  5LYF A;  2CTC A;  2ZED A;  5CBM A;  3HUV A;  2C6C A;  1HDU A;  1CBX A;  2PJ6 A;  4W9Y A;  1R43 A;  4P6Y A;  3FVL A;  2WYR A;  4P4I A;  3KGQ A;  2GP4 A;  3KR4 A;  4WWV A;  2ZEE A;  1CPS A;  2ZEM A;  3DGV A;  1LFW A;  3B35 A;  2OR4 A;  2Q4Z A;  4F8Z A;  1AMP A;  1OBR A;  4PXB A;  3B3W A;  3ISX A;  3WC6 A;  3SJX A;  4ONW A;  3V7Z A;  3PFE A;  4CPA A;  3BXM A;  2CF4 A;  3KHZ A;  2V8V A;  4A38 A;  2ANP A;  4MHP A;  4C8U A;  1JQG A;  4MXU A;  2V77 A;  1YW6 A;  2PJ8 A;  3SJG A;  1LAP A;  2ABZ A;  4F9V A;  1BLL E;  4C8T A;  1Y0R A;  3TX8 A;  5IR2 A;  2OOT A;  2GLJ A;  4P10 A;  5J1Q A;  3B3V A;  4OKO A;  3N5F A;  3RBU A;  3KZW A;  4AXV A;  2AFX A;  3L2N A;  4OC2 A;  4X3R A;  2ZEL A;  3MN8 A;  2C5Q A;  3VAT A;  4OC1 A;  4C9U A;  2NSM A;  2PJ9 A;  4FBE A;  4TNU A;  4R7M A;  3KI9 A;  1F57 A;  5LYI A;  2ZEP A;  4FWU A;  1TF9 A;  3WT4 A;  4C8F A;  4P45 A;  1TF8 A;  4ZX8 A;  1ARM A;  5K8N A;  3JRU A;  2GRE A;  2AFS A;  4OC0 A;  4NGS A;  3PBB A;  1UWY A;  4R6T A;  8CPA A;  5HVG A;  2PJ5 A;  1ZG8 A;  3NA6 A;  4RUH A;  2PJ7 A;  5CPA A;  3PB7 X;  2O53 A;  3D4U A;  1VHO A;  5K8M A;  4Z65 A;  4MCQ A;  1XF1 A;  1CPX A;  2JBK A;  4NGP A;  4TJX A;  2Q43 A;  3RZA A;  1LAN A;  4P4E A;  3NH5 A;  2VL1 A;  3PB6 X;  3VH9 A;  1HEE A;  2JBJ A;  1BAV A;  4P4J A;  2RFH A;  4A37 A;  5DS0 A;  4IAV A;  3GB0 A;  4ZY2 A;  6CPA A;  3D7D A;  3ISZ A;  1ZLI A;  4ZY0 A;  3KHX A;  2PJ4 A;  2PRQ A;  1CP7 A;  4MCR A;  4OC3 A;  4KNG E;  3FED A;  2I3C A;  2ZEO A;  3H8G A;  4MMO A;  1ZG7 A;  4NGT A;  1GYT A;  3CPX A;  4MHZ A;  3TC8 A;  1BPM A;  4YN3 A;  3QNV A;  4UF4 A;  3FX6 A;  1TXR A;  2PIZ A;  4X8I A;  2PVV A;  2ZOG A;  2XEF A;  1ZG9 A;  4TWE A;  1IY7 A;  1Y9Z A;  2PJC A;  3NH4 A;  1PCA A;  4C9R A;  4TJV A;  2XEI A;  4P4D A;  1CG2 A;  2C6G A;  4R76 A;  4FAI A;  3IFE A;  4GM5 A;  1TKJ A;  3PBE A;  2G9D A;  2QJ8 A;  4PPZ A;  2J9A A;  1EE3 P;  4NGN A;  1XJO A;  3IIB A;  2CIJ A;  1Q7L A;  4DUK A;  2PJB A;  4JZ0 A;  4MHN A;  3T8W A;  1AYE A;  2C6P A;  1QMU A;  2IJZ A;  4EME A;  3SJF A;  3PFO A;  3S9M A;  2ZEG A;  3IC1 A;  1BPN A;  3RAM A;  3D7H A;  3I6S A;  4C84 A;  1XRY A;  3PEI A;  3K9T A;  5LRG A;  1PYT B;  2HB6 A;  3CDX A;  4DYO A;  4FUU A;  1IGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...