4OC2A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ceibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxybut-3-yn-1-yl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc2A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc2A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc2A02
1TXRA 1R43A 4YN3A 2NSMA 1IGBA 4O23A 1LFWA 2GU2A 3D7DA 3GLJA 4TJXA 2HC9A 4OP4A 4C9UA 1M4LA 2PE3A 3PB9X 4NJRA 4P10A 1LANA 2WYRA 3WABA 1KWMA 2CTBA 2IJZA 3KL9A 4OC1A 4MHZA 3KHZA 4R8FA 1LCPA 3RAMA 5HVGA 4P6YA 3FEDA 3MN8A 3KZWA 1FT7A 4OMEA 1ZG8A 2PJ6A 4PXBA 4C8FA 5CPAA 4W9YA 2ZOFA 2JBJA 2ZELA 1F2OA 4CDJA 2XEGA 1CP7A 3IO1A 2PJAA 4MCRA 2CTCA 4DYOA 4IAVA 2PJ1A 5LYIA 1F2PA 4A38A 8CPAA 4WWVA 1TKHA 4LQGA 3ISZA 5HVHA 3VH9A 4R7MA 4NGRA 4X2TA 2J9AA 4ZX9A 3CPAA 1ELLP 3KASA 1YW6A 3IWWA 2AFMA 6CPAA 2OR4A 1H8LA 1CPXA 2PJ7A 4RUHA 4Z65A 3D7HA 3B3TA 4MRIA 2IQ6A 4FAIA 1YW4A 3K9TA 4C86A 5LRJA 1Y7EA 3WC7A 1VHEA 4PXCA 2XEIA 2GLFA 1ARLA 3D67A 4UIAA 4F9VA 2ZEFA 2XEJA 5LYLA 2V8DA 4CDKA 1TKFA 4FWUA 5HVFA 1IY7A 3SJFA 1F57A 2GLJA 2V8GA 1OBRA 4ZX8A 2Q4ZA 4A94A 3N5FA 4ZY0A 4ZI6A 2PVVA 2ANPA 4C8AA 3B35A 1AYEA 1BAVA 3DGVA 3KHXA 2PJ9A 2F7VA 3WT4A 2DEAA 2G9DA 4C9VA 4UEZA 2C1CA 1BLLE 4K3NA 4NGTA 3BXMA 2V77A 4P45A 4C9EA 3PB7X 5K8OA 1Z8LA 1ZLIA 3D7GA 4UIBA 4CPAA 1EE3P 1QMUA 3SI2A 4FUUA 1HDQA 4P4FA 2F8HA 3VATA 3FJUA 4F8ZA 1TF9A 2ZEDA 3QNVA 4NGMA 4MMOA 2EK9A 2PJ8A 5DS0A 2JEWA 1TKJA 1XBUA 4FBEA 4TNUA 2IMOA 3BI1A 2ZEPA 3V38A 3PFEA 2ZEMA 3NA6A 3I1UA 3TX8A 2AFXA 2BOAA 3I6SA 3FF3A 2RB7A 1UWYA 1YLOA 3SJXA 4IHMA 3ICUA 3WC5A 3B2YA 4F9UA 1GYTA 2EWBA 1XFOA 2AFUA 5LYDA 3SI0A 4JZ0A 3B3WA 2C6CA 2AFSA 4TWEA 2CF4A 2PJ5A 4YU9A 1WVMA 3CPXA 1AMPA 1XJOA 1R3NA 1VIXA 2XEFA 3IIBA 4EWTA 1CP6A 5CBMA 4R76A 1JQGA 3KQZA 3S9NA 4NGNA 2HB6A 3EIFA 2BO9A 3B3SA 3PBBA 3PB6X 3GB0A 2AFOA 3KQXA 1BPNA 2NYQA 4OC3A 5K8PA 1YMEA 4DJLA 2ZEOA 2PIZA 1ZG7A 2O53A 4C8TA 4NGPA 1HDUA 4Q7AA 2POKA 2PJ2A 2C6PA 4P4DA 4C84A 3PFOA 2GREA 3IEHA 2PVWA 3JRUA 2ZEEA 4OIWA 2WZNA 3IJ3A 4NFRA 4MCSA 4P4IA 1TF8A 3B7IA 3IC1A 4X3RA 3DLJA 2PIYA 1XRYA 4MCQA 4P44A 4MCPA 3V7ZA 3H8EA 1CG2A 2PJ0A 5D29A 4H2KA 2PRQA 1DE4C 3L2NA 4KSIA 2EK8A 5LYFA 1VGYA 3BHXA 3FH4A 1LOKA 4OKOA 3BI0A 1CPSA 3RBUA 3SJGA 1XMBA 1ELMP 3HUVA 2AFWA 2C6GA 5THWA 4PQAA 3FVLA 2QJ8A 1ARMA 2FVGA 4C85A 3FEEA 2ZEGA 3NH4A 2PJBA 5ELYA 1PYTB 4PXEA 4WJBA 4ONWA 1Y0YA 3SJEA 1V6CA 3LMSA 3GUXA 2V8HA 4C8PA 4G1PA 1Y0RA 4MHPA 4TJVA 4OIDA 4X8IA 4PXDA 1CBXA 5D8NA 4BD9A 1FNOA 3VARA 4P4JA 3H8FA 4EMEA 3B3VA 1QQ9A 1HEEA 2QVPA 3ISXA 1NSAA 2V8VA 1Y9ZA 4A39A 2ABZA 4UF4A 4C99A 2I3CA 2Q51A 4C8UA 3TC8A 5K8NA 2PJ4A 4P4BA 4NGSA 3D7FA 3LWUA 2VL1A 5F09A 3KR5A 3KR4A 1XF1A 4JYWA 5J1QA 2PJ3A 3I74A 2ZENA 4C8CA 2CIJA 5LRGA 3S9LA 4ZYQA 1Z2LA 3VTAA 3PB8X 4GM5A 3MRUA 3NFZA 5K8MA 3WC6A 5I4MA 3FMCA 4OC5A 1CX8A 4OC0A 3CT9A 1YSJA 3KI9A 4P4EA 1BPMA 4DUKA 4B6ZA 1LAPA 2AFZA 3D68A 2RFHA 2ZOGA 7CPAA 5LRKA 1ZLHA 5IB9A 1RTQA 3D4UA 3NH8A 4EFDA 3HLPA 3SI1A 3K2KA 3PRTA 5JGFA 3NH5A 1Q7LA 4UEEA 3PEIA 4MHNA 3KGQA 3PB4X 4NJQA 1DTDA 2BCOA 4ZY2A 4UEFA 3CDXA 4PPZA 4IK2A 3T8WA 5JM6A 2PCUA 2QYVA 5HXDA 4C9AA 3IFEA 3RZAA 1VHOA 4C9RA 3FX6A 4KNGE 3PBEA 2ZEHA 2OOTA 2Q43A 2O4HA 3FECA 2PJCA 4AXVA 4ZY1A 4YWYA 4MXUA 4NGQA 4MHYA 2JBKA 4OC4A 4R6TA 1Z5RA 3H8GA 3S9MA 3B3CA 5JH9A 1PCAA 3D66A 1ZG9A 4OC2A 4A37A 1LAMA
chains in the Genus database with same CATH superfamily
4UFVA 1TXRA 4I49A 1R43A 4H6ZA 2K5TA 4YN3A 2NSMA 5K99A 2C5QA 1IGBA 3T9YA 1KBLA 4O23A 1LFWA 3VWEA 2GU2A 1M4DA 3DR8A 3D7DA 3EY5A 2HV2A 3GLJA 4KOUA 1Y7RA 1YLEA 2G3TA 5H86A 3SXNA 2HC9A 4OP4A 4B5PA 1M4LA 1M6VB 2FM4A 4C9UA 2PE3A 2B5GA 2BUEA 3PB9X 2PR8A 4NJRA 3PLFB 1XEBA 1LANA 4ORFA 4KSFA 4P10A 3TLEA 2WYRA 4Q7AA 3WABA 4B5OA 1KWMA 4EVYA 4IIXA 4GS4A 3TLGA 4BTFA 1ON0A 3CXPA 2PCNA 1L0CA 1U6MA 2CTBA 3HPGG 2G3AA 4LX9A 5F5XA 3ZJ0A 2IJZA 2EZCA 3R9FA 1CM0A 3KL9A 3GJZA 4CRZB 2FL4A 4OC1A 5F47A 4MHZA 2YNCA 5HKWA 3KHZA 2CXAA 4R8FA 2PSWA 5G20A 1LCPA 3RAMA 4B5PB 5C88A 5HVGA 3KRVA 3U1BA 2B5GB 4P6YA 1YREA 1GHEA 3FEDA 2ATRA 4M8DA 3S6KA 3OB2B 2EO8A 1WJTA 3MN8A 3KZWA 3NE8A 1FT7A 3TLGB 4OMEA 1ZG8A 4CGNA 2PJ6A 4MY3A 1ZYMA 4J3GA 3T0TA 4PXBA 4C8FA 5CPAA 4W9YA 4HKFA 2ZOFA 4C7IA 5JPHA 2JBJA 2ZELA 1F2OA 4KUBA 2Z3MA 3OB1B 1MJ9A 4K30A 4CDJA 2XEGA 1QSTA 1CP7A 4A32A 3IO1A 2PJAA 4BINA 1CS0B 4MCRA 5AG5A 2CTCA 4HNYB 1CJWA 4DYOA 4XPLA 5J3XA 4IAVA 2PJ1A 5LYIA 2I00A 2N3AB 5EBVA 3GIUA 1F2PA 4UBRA 4A38A 5F9MA 8CPAA 4FD5A 4NXYA 4II9A 4WWVA 2X0SA 1TKHA 5JYBA 4MI1A 2C27A 4LQGA 3ISZA 5HVHA 1P4NA 5I0CA 2R1IA 3VH9A 4R7MA 1IOIA 4BBHA 4NGRA 4X2TA 1N71A 2R7HA 2J9AA 4ZX9A 3R95A 3CPAA 1ELLP 3TO6A 3KASA 1ZO0A 1YW6A 2OZGA 3IWWA 2AFMA 3G3SA 6CPAA 3VROA 1EZAA 5JVLA 1IIDA 3OWCA 3D3SA 2Y1MA 4KOYA 2OR4A 4B10A 5FD8A 2R8VA 1H8LA 1CPXA 2PJ7A 4RUHA 3EXNA 4Z65A 3D7HA 3B3TA 1I21A 5IV0A 2OB0A 4CGOA 2ZW5A 1C3OB 4MRIA 2IQ6A 3T90A 4CS0B 1FBVA 1KUYA 4DNCA 4FAIA 1YW4A 5HMNA 4CO9A 4OLLA 3K9TA 4C86A 3IWGA 2GE3A 5LRJA 4B12A 1Y7EA 4Q36A 2JDDA 2DXQA 3WC7A 1VHEA 4PXCA 2Z3KA 2XEIA 4OAEA 4QVTA 2P6GA 1T36B 2GLFA 1ARLA 1OZPA 2D4PA 3D67A 4UIAA 4F9VA 4MFLA 3S6FA 5KTAA 4A4CA 2ZEFA 2GANA 2MP0A 2XEJA 2OU2A 2F5IA 1UFHA 5LYLA 2V8DA 5A28A 4CDKA 1TKFA 2WPWA 5KTDA 4FWUA 5HVFA 3GKRA 1IY7A 3D2PA 3SJFA 3T07A 4MJXA 1F57A 1Y9KA 1EZBA 4MI4A 2GLJA 2V8GA 1OBRA 4ZX8A 3C26A 2Q4ZA 4KUAA 3GYAA 4A94A 4PK2A 4JJXA 3N5FA 4ZY0A 2FT0A 4L89A 4PSXA 4ZI6A 1KZFA 2PVVA 2RC4A 4J0NA 4IUSA 4QC6A 4Y49B 1ZRSA 2ANPA 5ISVA 3QAHA 4C8AA 3B35A 3VWDA 2DPSA 1AYEA 1MJAA 1BAVA 3DGVA 4MY0A 4HNWB 2Z0ZA 4PSWA 3KHXA 1R57A 2PJ9A 2F7VA 3WR7A 3WT4A 2GP4A 2DEAA 2XPPA 1B6BA 2G9DA 4C9VA 3VRQA 1NSLA 3I9SA 4LQ6A 4ONUA 5BWAB 2Y1NA 4UEZA 5G1ZA 4M85A 2E28A 2OH1A 2C1CA 1BLLE 1M4GA 4K3NA 2IL4A 4NGTA 3BXMA 2V77A 2XPOA 4P45A 3CZXA 3PB7X 3S6HA 1Z8LA 5K8OA 3R96A 4C9EA 1ZLIA 3VRNA 4EYSA 3D7GA 4UIBA 2Q44A 4CPAA 1JWQA 3IU2A 1J4JA 1EE3P 1QMUA 4FUUA 3SI2A 2ZW4A 1HDQA 4P4FA 3EC4A 2F8HA 3W91A 1BOBA 3VATA 1YQEA 1RO5A 3FJUA 4L8AA 3FRMA 1TF9A 4U9YA 2ZEDA 3QNVA 4F8ZA 3W6XA 4NGMA 4MMOA 2VZYA 2EK9A 4UFWA 2PJ8A 3H5ZA 1QSOA 4CAWA 2A4NA 5DS0A 5IB0A 5DWNA 4JWPA 5AXIA 2JEWA 2Y0MA 4QUSA 1TKJA 3RNZA 5JQ4A 3MGDA 4AVCA 1XBUA 4FBEA 2VQYA 2VXKA 3LD2A 4TNUA 3V8IA 2IMOA 3BI1A 2ZEPA 4UA3A 4XPDB 3V38A 4NEXA 4E94A 2WSAA 2XPLA 1MJBA 1AUGA 2ZEMA 3I1UA 3NA6A 3PFEA 1QSNA 1XE4A 4R87A 3ZZIA 2DPTA 2AE6A 3TX8A 3BUNB 2YJTA 1ZL0A 3T05A 4CAXA 3BUOB 1WWZA 2QECA 2AFXA 2BOAA 2B58A 4E8OA 4KSAA 2YNCC 3FF3A 3I6SA 2B4DA 4AVAA 2RB7A 4JXRA 2I79A 1UWYA 1YLOA 3TO7A 2BL1A 3SJXA 1K4JA 4IHMA 2DF5A 2EBJA 3ICUA 3TT2A 5HKZA 1A2ZA 2VEZA 3TTHA 5GCNA 2XPNA 2D0PA 3BJ7A 4BPWB 1C30B 3QAYA 4M6GA 3WC5A 4U5YA 4XNHB 1NE9A 4C68A 3BUMB 2J8RA 3EZBA 3DR6A 1IYLA 2REEA 3B2YA 2AUMA 2HWGA 3LACA 2FIAA 1GYTA 1Z9EA 2EWBA 3RO0A 4KOWA 4FD6A 4F9UA 1R61A 3PZJA 2B4DB 1XFOA 2AFUA 2OZUA 5LYDA 2EZBA 3SI0A 4JZ0A 1XF8A 3B3WA 3P2FA 4JLYA 1JDBC 2C6CA 5KTCA 3ZNIA 2AFSA 4RN7A 4TWEA 4CAFA 4CZ1A 4YFJA 1IU8A 1VHSA 4UCNA 4UWIA 4YGOA 3TOAA 2CF4A 2PJ5A 5G21A 1CE8B 1XIXA 4YU9A 4C2ZA 3SR3A 1WVMA 1Q2YA 1S7LA 3CPXA 1QSMA 1S7FA 3UY5A 3PP9A 2Z10A 5A27A 1XJOA 1AMPA 2JEVA 1R3NA 1VIXA 2XEFA 3SXOA 3NE7A 5J8FA 3IIBA 4EWTA 1CP6A 5CBMA 4R76A 2QMLA 1JQGA 2BEIA 5EC4A 1I1DA 2EUIA 3KQZA 3S9NA 4NGNA 4KVME 2HB6A 4MBUA 5F49A 3TLBA 2FE7A 1I12A 2FIWA 2Z3NA 2BO9A 3QB8A 1VI4A 3EIFA 3B3SA 1IB1E 2PRBA 3PBBA 5EMIA 3PB6X 4A2ZA 3FYNA 1Z9UA 2AFOA 3GB0A 3IU1A 3KQXA 5F48A 1BPNA 2NYQA 2ODFA 5AG6A 4F6AA 4OC3A 2O28A 4KOVA 3SHPA 5K8PA 1YMEA 2Z3LA 3DDDA 4LUAA 1YVOA 4MFPA 1GGOA 1KEEB 4DJLA 1JDEA 1Q2DA 1NMTA 2ZEOA 4ZGYB 2PIZA 2Q0YA 3DSBA 4M3SA 1ZG7A 3JVNA 2O53A 4C8TA 2B4JC 4NGPA 3O8ZA 1HDUA 3FNCA 1XMTA 2POKA 2PJ2A 2Z11A 2GIVA 2HQYA 3B8GA 2C6PA 2ZXVA 4HPSA 4Y49C 3EZEA 4P4DA 2CBLA 4C84A 2H5MA 4C2XA 4GPLB 3PFOA 2GREA 3IEHA 2CY2A 3R9EA 4XPKA 2PVWA 3JRUA 1DIKA 2B0AA 2ZEEA 1RXTA 4OIWA 2WZNA 3IJ3A 4CYNA 4A30A 3BUWB 4NFRA 4B13A 1Q2CA 4MCSA 4P4IA 2Q7BA 1TF8A 3B7IA 4CGPA 2D0OA 4AG9A 3IC1A 3K4IA 3G23A 3FB3A 4X3RA 1FY7A 2P0WA 3DLJA 2PIYA 4H6UA 3JTKA 1XRYA 4MCQA 4P44A 3VGOA 3FBUA 4H89A 2P6EA 1S5KA 4MCPA 1SQHA 5AG7A 3V7ZA 1S7KA 1CG2A 3H8EA 2PJ0A 5D29A 4H2KA 4F0XA 3TFYA 1B47A 2PRQA 2ZPAA 1BXRB 1DE4C 2YNEA 4JXQA 2DIKA 3T5MA 2UV8G 3L2NA 4FD4A 3BUXB 4KSIA 2EK8A 2OLSA 3HPHE 5LYFA 4NF1A 4XPDC 1VGYA 2FS5A 4NSQA 4QB9A 3BHXA 2ZW6A 1IICA 1LOKA 3FH4A 2YNDA 3TO9A 4OKOA 3BI0A 1CPSA 1A9XB 2VZZA 3BLNA 3R1KA 3RBUA 2G0BA 4COBA 3SJGA 1PU9A 2HI6A 1XMBA 1ELMP 3HUVA 1QSRA 2AFWA 2C6GA 3P2HA 3W6SA 5IR2A 1S7NA 3F5BA 4UCMA 5THWA 3TE4A 1X12A 1XOVA 2FCKA 5BY0A 3IWEA 4PQAA 3E0KA 3FVLA 2PR1A 1IOFA 3FIXA 4H1HA 4KVXA 2QJ8A 4XNHC 4B11A 1YVKA 4MFZA 3OAKA 4KVOE 5DWMA 4B14A 4TJXA 3TLZA 1ARMA 2FVGA 2Z3OA 3I3GA 4C85A 5AGEA 1YR0A 1YGHA 2CNTA 1VKCA 5HKYA 5AG4A 3FEEA 2ZEGA 4CAVA 2OZHA 1Z4EA 2JDCA 2PJBA 3D8PA 3NH4A 2AJ6A 3CXQA 5ELYA 2D4OA 3TLAA 1PYTB 4PXEA 4WJBA 4ONWA 1Y0YA 3SJEA 3PFVA 1KUVA 4MFJA 2BSWA 4BPUB 3LMSA 1V6CA 3GUXA 2V8HA 4GXHA 4M6HA 1X10A 3DNSA 4C8PA 2QIRA 4G1PA 1Q5XA 4KORA 1Y0RA 4MHPA 4TJVA 1YX0A 4OIDA 3VRRA 3CXSA 4X8IA 4R3KA 4PXDA 1CBXA 5D8NA 4BD9A 1FNOA 4KS9A 4HNXB 3VARA 4P4JA 3H8FA 1V0CA 4EMEA 2B3UA 3TOBA 3B3VA 4INJA 1M4IA 1S60A 3A9LA 1QQ9A 1HEEA 2QVPA 3ISXA 4PK3A 1NSAA 2V8VA 4KZTA 4Q38A 2R98A 1Y9ZA 4CGLA 4A39A 2ABZA 4UF4A 1BO4A 2EZAA 4C99A 4A4BA 2HROA 3N7ZA 2I3CA 2Q51A 1TIQA 4C8UA 3TC8A 5C82A 2WUUA 3PGPA 3F0AA 2PJ4A 5K8NA 4MFKA 4P4BA 4MJ8A 4NGSA 3GY9A 3KKWA 3D7FA 2ZW7A 1Z4RA 4PV6A 1YK3A 1Z8XA 2ARHA 3LWUA 2VL1A 5F09A 3KR5A 3KR4A 2CNMA 1XF1A 2YJVA 4JYWA 5J1QA 2PJ3A 3I74A 2ZENA 4U9ZA 5F1YA 3NFQA 3EZAA 3TCVA 4C8CA 1Y9WA 4CGMA 2CIJA 4AB7A 4BPXB 5LRGA 3S9LA 2J8NA 2EVNA 4UFXA 1Z2LA 4ZYQA 2PDOA 3NOJA 2AUNA 3TYXA 3VTAA 3PB8X 4JVOA 4GM5A 2PQ8A 3MRUA 4MFQA 2JLMA 3NFZA 5K8MA 3WC6A 4JD6A 4CYPA 3IGRA 4X5KA 5I4MA 2REFA 3H4QA 1B87A 3FMCA 2Q4VA 1P0HA 4OC5A 1CX8A 4OC0A 3CT9A 3S6GA 4KOXA 1NBWA 2R82A 1YSJA 3KI9A 3RYOA 4P4EA 1BPMA 4R3LA 1LRZA 4E5SA 4KLVA 4DUKA 4BMHA 3EFAA 2B3VA 4CAEA 4RR2B 4B6ZA 1LAPA 2YGWA 1YVHA 2AFZA 3D68A 3JUWA 2P6FA 2RFHA 4E2AA 4YRHA 2ZOGA 7CPAA 3C8OA 3D2MA 3G8WA 3F9KC 2CNSA 4RI1A 5E96A 1ZLHA 2NMTA 5LRKA 1Z8TA 5IB9A 1RTQA 3D4UA 3R9GA 4KOSA 2VKZG 3NH8A 1PUAA 4A31A 4NCZA 4EFDA 4KOTA 2FXFA 2Z3PA 3LODA 5G22A 3HLPA 4AVBA 1M44A 2PC1A 3SI1A 3K2KA 3PRTA 5JGFA 5F13A 3NH5A 1Q7LA 4UEEA 4IIYA 3PEIA 4MHNA 3KGQA 3PB4X 1EO0A 4NJQA 4COGA 2Q04A 4QBJA 1DTDA 2BCOA 4C2YA 4ZY2A 4OADA 2B4BA 3CDXA 4UEFA 2Q4YA 2HUZA 4PPZA 4IK2A 4UWJA 3T8WA 1WK4A 5HH1A 5J8CA 5JM6A 3F8KA 1NXJA 1S3ZA 2PCUA 4IF5A 4F0YA 4AG7A 2QYVA 4RS2A 5HXDA 4R57A 3TLYA 3IFEA 3RZAA 4C9AA 1VHOA 4C7HA 3HMJG 2WPXA 4C9RA 3FX6A 2VI7A 3TLCA 1M1DA 3K9UA 3PT1A 1J3LA 4FD7A 5CNPA 4A95A 3PBEA 4KNGE 2FSRA 4ZBGA 2ZEHA 2OOTA 2Q43A 2X7BA 2O4HA 4M6IA 5H84A 4KLWA 3FECA 3U88C 4A33A 2PJCA 4AXVA 4UCPA 5IX3A 2GFQA 4ZY1A 3BJ8A 4CYQA 4YWYA 4MXUA 3OP0A 4R9MA 1VBHA 3VRPA 4NGQA 5FVJA 4MHYA 2JBKA 4OC4A 1KUXA 2Q7SA 4MHDA 4R6TA 1KC7A 4CRYB 2DLAA 1Z5RA 3EO4A 3H8GA 1VBGA 3S9MA 3B3CA 5JH9A 1PCAA 3D66A 1ZG9A 4OC2A 2KCWA 3FXTA 4E0AA 2VBQA 4CYOA 2J8MA 5F46A 1Z8WA 4A37A 1MK4A 1LAMA 1IYKA
chains in the Genus database with same CATH topology
1TXRA 1R43A 4YN3A 2NSMA 2C5QA 1IGBA 4O23A 1LFWA 2GU2A 3D7DA 3GLJA 4TJXA 2HC9A 4OP4A 4C9UA 1M4LA 2PE3A 3PB9X 4NJRA 4P10A 1LANA 2WYRA 3WABA 1KWMA 2CTBA 2IJZA 3KL9A 4OC1A 4MHZA 3KHZA 4R8FA 1LCPA 3RAMA 5HVGA 4P6YA 3FEDA 3MN8A 3KZWA 1FT7A 4OMEA 1ZG8A 2PJ6A 4PXBA 4C8FA 5CPAA 4W9YA 2ZOFA 2JBJA 2ZELA 1F2OA 4CDJA 2XEGA 1CP7A 3IO1A 2PJAA 4MCRA 2CTCA 4DYOA 4IAVA 2PJ1A 5LYIA 1F2PA 4A38A 8CPAA 4WWVA 1TKHA 4LQGA 3ISZA 5HVHA 3VH9A 4R7MA 4NGRA 4X2TA 2J9AA 4ZX9A 3CPAA 1ELLP 3KASA 1YW6A 3IWWA 2AFMA 6CPAA 2OR4A 1H8LA 1CPXA 2PJ7A 4RUHA 4Z65A 3D7HA 3B3TA 4MRIA 2IQ6A 4FAIA 1YW4A 3K9TA 4C86A 5LRJA 1Y7EA 3WC7A 1VHEA 4PXCA 2XEIA 2GLFA 1ARLA 3D67A 4UIAA 4F9VA 2ZEFA 2XEJA 5LYLA 2V8DA 4CDKA 1TKFA 4FWUA 5HVFA 1IY7A 3SJFA 1F57A 2GLJA 2V8GA 1OBRA 4ZX8A 2Q4ZA 4A94A 3N5FA 4ZY0A 4ZI6A 2PVVA 2ANPA 4C8AA 3B35A 1AYEA 1BAVA 3DGVA 3KHXA 2PJ9A 2GP4A 2F7VA 3WT4A 2DEAA 2G9DA 4C9VA 4UEZA 2C1CA 1BLLE 4K3NA 4NGTA 3BXMA 2V77A 4P45A 4C9EA 3PB7X 5K8OA 1Z8LA 1ZLIA 3D7GA 4UIBA 4CPAA 1EE3P 1QMUA 3SI2A 4FUUA 1HDQA 4P4FA 2F8HA 3VATA 3FJUA 4F8ZA 1TF9A 2ZEDA 3QNVA 4NGMA 4MMOA 2EK9A 2PJ8A 5DS0A 2JEWA 1TKJA 1XBUA 4FBEA 4TNUA 2IMOA 3BI1A 2ZEPA 3V38A 3PFEA 2ZEMA 3NA6A 3I1UA 3TX8A 2AFXA 2BOAA 3I6SA 3FF3A 2RB7A 1UWYA 1YLOA 3SJXA 4IHMA 3ICUA 3WC5A 3B2YA 4F9UA 1GYTA 2EWBA 1XFOA 2AFUA 5LYDA 3SI0A 4JZ0A 3B3WA 2C6CA 2AFSA 4TWEA 2CF4A 2PJ5A 4YU9A 1WVMA 3CPXA 1AMPA 1XJOA 1R3NA 1VIXA 2XEFA 3IIBA 4EWTA 1CP6A 5CBMA 4R76A 1JQGA 3KQZA 3S9NA 4NGNA 2HB6A 3EIFA 2BO9A 3B3SA 3PBBA 3PB6X 3GB0A 2AFOA 3KQXA 1BPNA 2NYQA 4OC3A 5K8PA 1YMEA 4DJLA 2ZEOA 2PIZA 1ZG7A 2O53A 4C8TA 4NGPA 1HDUA 4Q7AA 2POKA 2PJ2A 2C6PA 4P4DA 4C84A 3PFOA 2GREA 3IEHA 2PVWA 3JRUA 2ZEEA 4OIWA 2WZNA 3IJ3A 4NFRA 4MCSA 4P4IA 1TF8A 3B7IA 3IC1A 4X3RA 3DLJA 2PIYA 1XRYA 4MCQA 4P44A 4MCPA 3V7ZA 3H8EA 1CG2A 2PJ0A 5D29A 4H2KA 2PRQA 1DE4C 3L2NA 4KSIA 2EK8A 5LYFA 1VGYA 3BHXA 3FH4A 1LOKA 4OKOA 3BI0A 1CPSA 3RBUA 3SJGA 1XMBA 1ELMP 3HUVA 2AFWA 2C6GA 5IR2A 5THWA 4PQAA 3FVLA 2QJ8A 1ARMA 2FVGA 4C85A 3FEEA 2ZEGA 3NH4A 2PJBA 5ELYA 1PYTB 4PXEA 4WJBA 4ONWA 1Y0YA 3SJEA 1V6CA 3LMSA 3GUXA 2V8HA 4C8PA 4G1PA 1Y0RA 4MHPA 4TJVA 4OIDA 4X8IA 4PXDA 1CBXA 5D8NA 4BD9A 1FNOA 3VARA 4P4JA 3H8FA 4EMEA 3B3VA 1QQ9A 1HEEA 2QVPA 3ISXA 1NSAA 2V8VA 1Y9ZA 4A39A 2ABZA 4UF4A 4C99A 2I3CA 2Q51A 4C8UA 3TC8A 5K8NA 2PJ4A 4P4BA 4NGSA 3D7FA 3LWUA 2VL1A 5F09A 3KR5A 3KR4A 1XF1A 4JYWA 5J1QA 2PJ3A 3I74A 2ZENA 4C8CA 2CIJA 5LRGA 3S9LA 4ZYQA 1Z2LA 3VTAA 3PB8X 4GM5A 3MRUA 3NFZA 5K8MA 3WC6A 5I4MA 3FMCA 4OC5A 1CX8A 4OC0A 3CT9A 1YSJA 3KI9A 4P4EA 1BPMA 4DUKA 4B6ZA 1LAPA 2AFZA 3D68A 2RFHA 2ZOGA 7CPAA 5LRKA 1ZLHA 5IB9A 1RTQA 3D4UA 3NH8A 4EFDA 3HLPA 3SI1A 3K2KA 3PRTA 5JGFA 3NH5A 1Q7LA 4UEEA 3PEIA 4MHNA 3KGQA 3PB4X 4NJQA 1DTDA 2BCOA 4ZY2A 4UEFA 3CDXA 4PPZA 4IK2A 3T8WA 5JM6A 2PCUA 2QYVA 5HXDA 4C9AA 3IFEA 3RZAA 1VHOA 4C9RA 3FX6A 4KNGE 3PBEA 2ZEHA 2OOTA 2Q43A 2O4HA 3FECA 2PJCA 4AXVA 4ZY1A 4YWYA 4MXUA 4NGQA 4MHYA 2JBKA 4OC4A 4R6TA 1Z5RA 3H8GA 3S9MA 3B3CA 5JH9A 1PCAA 3D66A 1ZG9A 4OC2A 4A37A 1LAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXR A;  1R43 A;  4YN3 A;  2NSM A;  1IGB A;  4O23 A;  1LFW A;  2GU2 A;  3D7D A;  3GLJ A;  4TJX A;  2HC9 A;  4OP4 A;  4C9U A;  1M4L A;  2PE3 A;  3PB9 X;  4NJR A;  4P10 A;  1LAN A;  2WYR A;  3WAB A;  1KWM A;  2CTB A;  2IJZ A;  3KL9 A;  4OC1 A;  4MHZ A;  3KHZ A;  4R8F A;  1LCP A;  3RAM A;  5HVG A;  4P6Y A;  3FED A;  3MN8 A;  3KZW A;  1FT7 A;  4OME A;  1ZG8 A;  2PJ6 A;  4PXB A;  4C8F A;  5CPA A;  4W9Y A;  2ZOF A;  2JBJ A;  2ZEL A;  1F2O A;  4CDJ A;  2XEG A;  1CP7 A;  3IO1 A;  2PJA A;  4MCR A;  2CTC A;  4DYO A;  4IAV A;  2PJ1 A;  5LYI A;  1F2P A;  4A38 A;  8CPA A;  4WWV A;  1TKH A;  4LQG A;  3ISZ A;  5HVH A;  3VH9 A;  4R7M A;  4NGR A;  4X2T A;  2J9A A;  4ZX9 A;  3CPA A;  1ELL P;  3KAS A;  1YW6 A;  3IWW A;  2AFM A;  6CPA A;  2OR4 A;  1H8L A;  1CPX A;  2PJ7 A;  4RUH A;  4Z65 A;  3D7H A;  3B3T A;  4MRI A;  2IQ6 A;  4FAI A;  1YW4 A;  3K9T A;  4C86 A;  5LRJ A;  1Y7E A;  3WC7 A;  1VHE A;  4PXC A;  2XEI A;  2GLF A;  1ARL A;  3D67 A;  4UIA A;  4F9V A;  2ZEF A;  2XEJ A;  5LYL A;  2V8D A;  4CDK A;  1TKF A;  4FWU A;  5HVF A;  1IY7 A;  3SJF A;  1F57 A;  2GLJ A;  2V8G A;  1OBR A;  4ZX8 A;  2Q4Z A;  4A94 A;  3N5F A;  4ZY0 A;  4ZI6 A;  2PVV A;  2ANP A;  4C8A A;  3B35 A;  1AYE A;  1BAV A;  3DGV A;  3KHX A;  2PJ9 A;  2F7V A;  3WT4 A;  2DEA A;  2G9D A;  4C9V A;  4UEZ A;  2C1C A;  1BLL E;  4K3N A;  4NGT A;  3BXM A;  2V77 A;  4P45 A;  4C9E A;  3PB7 X;  5K8O A;  1Z8L A;  1ZLI A;  3D7G A;  4UIB A;  4CPA A;  1EE3 P;  1QMU A;  3SI2 A;  4FUU A;  1HDQ A;  4P4F A;  2F8H A;  3VAT A;  3FJU A;  4F8Z A;  1TF9 A;  2ZED A;  3QNV A;  4NGM A;  4MMO A;  2EK9 A;  2PJ8 A;  5DS0 A;  2JEW A;  1TKJ A;  1XBU A;  4FBE A;  4TNU A;  2IMO A;  3BI1 A;  2ZEP A;  3V38 A;  3PFE A;  2ZEM A;  3NA6 A;  3I1U A;  3TX8 A;  2AFX A;  2BOA A;  3I6S A;  3FF3 A;  2RB7 A;  1UWY A;  1YLO A;  3SJX A;  4IHM A;  3ICU A;  3WC5 A;  3B2Y A;  4F9U A;  1GYT A;  2EWB A;  1XFO A;  2AFU A;  5LYD A;  3SI0 A;  4JZ0 A;  3B3W A;  2C6C A;  2AFS A;  4TWE A;  2CF4 A;  2PJ5 A;  4YU9 A;  1WVM A;  3CPX A;  1AMP A;  1XJO A;  1R3N A;  1VIX A;  2XEF A;  3IIB A;  4EWT A;  1CP6 A;  5CBM A;  4R76 A;  1JQG A;  3KQZ A;  3S9N A;  4NGN A;  2HB6 A;  3EIF A;  2BO9 A;  3B3S A;  3PBB A;  3PB6 X;  3GB0 A;  2AFO A;  3KQX A;  1BPN A;  2NYQ A;  4OC3 A;  5K8P A;  1YME A;  4DJL A;  2ZEO A;  2PIZ A;  1ZG7 A;  2O53 A;  4C8T A;  4NGP A;  1HDU A;  4Q7A A;  2POK A;  2PJ2 A;  2C6P A;  4P4D A;  4C84 A;  3PFO A;  2GRE A;  3IEH A;  2PVW A;  3JRU A;  2ZEE A;  4OIW A;  2WZN A;  3IJ3 A;  4NFR A;  4MCS A;  4P4I A;  1TF8 A;  3B7I A;  3IC1 A;  4X3R A;  3DLJ A;  2PIY A;  1XRY A;  4MCQ A;  4P44 A;  4MCP A;  3V7Z A;  3H8E A;  1CG2 A;  2PJ0 A;  5D29 A;  4H2K A;  2PRQ A;  1DE4 C;  3L2N A;  4KSI A;  2EK8 A;  5LYF A;  1VGY A;  3BHX A;  3FH4 A;  1LOK A;  4OKO A;  3BI0 A;  1CPS A;  3RBU A;  3SJG A;  1XMB A;  1ELM P;  3HUV A;  2AFW A;  2C6G A;  5THW A;  4PQA A;  3FVL A;  2QJ8 A;  1ARM A;  2FVG A;  4C85 A;  3FEE A;  2ZEG A;  3NH4 A;  2PJB A;  5ELY A;  1PYT B;  4PXE A;  4WJB A;  4ONW A;  1Y0Y A;  3SJE A;  1V6C A;  3LMS A;  3GUX A;  2V8H A;  4C8P A;  4G1P A;  1Y0R A;  4MHP A;  4TJV A;  4OID A;  4X8I A;  4PXD A;  1CBX A;  5D8N A;  4BD9 A;  1FNO A;  3VAR A;  4P4J A;  3H8F A;  4EME A;  3B3V A;  1QQ9 A;  1HEE A;  2QVP A;  3ISX A;  1NSA A;  2V8V A;  1Y9Z A;  4A39 A;  2ABZ A;  4UF4 A;  4C99 A;  2I3C A;  2Q51 A;  4C8U A;  3TC8 A;  5K8N A;  2PJ4 A;  4P4B A;  4NGS A;  3D7F A;  3LWU A;  2VL1 A;  5F09 A;  3KR5 A;  3KR4 A;  1XF1 A;  4JYW A;  5J1Q A;  2PJ3 A;  3I74 A;  2ZEN A;  4C8C A;  2CIJ A;  5LRG A;  3S9L A;  4ZYQ A;  1Z2L A;  3VTA A;  3PB8 X;  4GM5 A;  3MRU A;  3NFZ A;  5K8M A;  3WC6 A;  5I4M A;  3FMC A;  4OC5 A;  1CX8 A;  4OC0 A;  3CT9 A;  1YSJ A;  3KI9 A;  4P4E A;  1BPM A;  4DUK A;  4B6Z A;  1LAP A;  2AFZ A;  3D68 A;  2RFH A;  2ZOG A;  7CPA A;  5LRK A;  1ZLH A;  5IB9 A;  1RTQ A;  3D4U A;  3NH8 A;  4EFD A;  3HLP A;  3SI1 A;  3K2K A;  3PRT A;  5JGF A;  3NH5 A;  1Q7L A;  4UEE A;  3PEI A;  4MHN A;  3KGQ A;  3PB4 X;  4NJQ A;  1DTD A;  2BCO A;  4ZY2 A;  4UEF A;  3CDX A;  4PPZ A;  4IK2 A;  3T8W A;  5JM6 A;  2PCU A;  2QYV A;  5HXD A;  4C9A A;  3IFE A;  3RZA A;  1VHO A;  4C9R A;  3FX6 A;  4KNG E;  3PBE A;  2ZEH A;  2OOT A;  2Q43 A;  2O4H A;  3FEC A;  2PJC A;  4AXV A;  4ZY1 A;  4YWY A;  4MXU A;  4NGQ A;  4MHY A;  2JBK A;  4OC4 A;  4R6T A;  1Z5R A;  3H8G A;  3S9M A;  3B3C A;  5JH9 A;  1PCA A;  3D66 A;  1ZG9 A;  4OC2 A;  4A37 A;  1LAM A; 
#chains in the Genus database with same CATH topology
 4UFV A;  1TXR A;  4I49 A;  1R43 A;  4H6Z A;  2K5T A;  4YN3 A;  2NSM A;  5K99 A;  2C5Q A;  1IGB A;  3T9Y A;  1KBL A;  4O23 A;  1LFW A;  3VWE A;  2GU2 A;  1M4D A;  3DR8 A;  3D7D A;  3EY5 A;  2HV2 A;  3GLJ A;  4KOU A;  1Y7R A;  1YLE A;  2G3T A;  5H86 A;  3SXN A;  2HC9 A;  4OP4 A;  4B5P A;  1M4L A;  1M6V B;  2FM4 A;  4C9U A;  2PE3 A;  2B5G A;  2BUE A;  3PB9 X;  2PR8 A;  4NJR A;  3PLF B;  1XEB A;  1LAN A;  4ORF A;  4KSF A;  4P10 A;  3TLE A;  2WYR A;  4Q7A A;  3WAB A;  4B5O A;  1KWM A;  4EVY A;  4IIX A;  4GS4 A;  3TLG A;  4BTF A;  1ON0 A;  3CXP A;  2PCN A;  1L0C A;  1U6M A;  2CTB A;  3HPG G;  2G3A A;  4LX9 A;  5F5X A;  3ZJ0 A;  2IJZ A;  2EZC A;  3R9F A;  1CM0 A;  3KL9 A;  3GJZ A;  4CRZ B;  2FL4 A;  4OC1 A;  5F47 A;  4MHZ A;  2YNC A;  5HKW A;  3KHZ A;  2CXA A;  4R8F A;  2PSW A;  5G20 A;  1LCP A;  3RAM A;  4B5P B;  5C88 A;  5HVG A;  3KRV A;  3U1B A;  2B5G B;  4P6Y A;  1YRE A;  1GHE A;  3FED A;  2ATR A;  4M8D A;  3S6K A;  3OB2 B;  2EO8 A;  1WJT A;  3MN8 A;  3KZW A;  3NE8 A;  1FT7 A;  3TLG B;  4OME A;  1ZG8 A;  4CGN A;  2PJ6 A;  4MY3 A;  1ZYM A;  4J3G A;  3T0T A;  4PXB A;  4C8F A;  5CPA A;  4W9Y A;  4HKF A;  2ZOF A;  4C7I A;  5JPH A;  2JBJ A;  2ZEL A;  1F2O A;  4KUB A;  2Z3M A;  3OB1 B;  1MJ9 A;  4K30 A;  4CDJ A;  2XEG A;  1QST A;  1CP7 A;  4A32 A;  3IO1 A;  2PJA A;  4BIN A;  1CS0 B;  4MCR A;  5AG5 A;  2CTC A;  4HNY B;  1CJW A;  4DYO A;  4XPL A;  5J3X A;  4IAV A;  2PJ1 A;  5LYI A;  2I00 A;  2N3A B;  5EBV A;  3GIU A;  1F2P A;  4UBR A;  4A38 A;  5F9M A;  8CPA A;  4FD5 A;  4NXY A;  4II9 A;  4WWV A;  2X0S A;  1TKH A;  5JYB A;  4MI1 A;  2C27 A;  4LQG A;  3ISZ A;  5HVH A;  1P4N A;  5I0C A;  2R1I A;  3VH9 A;  4R7M A;  1IOI A;  4BBH A;  4NGR A;  4X2T A;  1N71 A;  2R7H A;  2J9A A;  4ZX9 A;  3R95 A;  3CPA A;  1ELL P;  3TO6 A;  3KAS A;  1ZO0 A;  1YW6 A;  2OZG A;  3IWW A;  2AFM A;  3G3S A;  6CPA A;  3VRO A;  1EZA A;  5JVL A;  1IID A;  3OWC A;  3D3S A;  2Y1M A;  4KOY A;  2OR4 A;  4B10 A;  5FD8 A;  2R8V A;  1H8L A;  1CPX A;  2PJ7 A;  4RUH A;  3EXN A;  4Z65 A;  3D7H A;  3B3T A;  1I21 A;  5IV0 A;  2OB0 A;  4CGO A;  2ZW5 A;  1C3O B;  4MRI A;  2IQ6 A;  3T90 A;  4CS0 B;  1FBV A;  1KUY A;  4DNC A;  4FAI A;  1YW4 A;  5HMN A;  4CO9 A;  4OLL A;  3K9T A;  4C86 A;  3IWG A;  2GE3 A;  5LRJ A;  4B12 A;  1Y7E A;  4Q36 A;  2JDD A;  2DXQ A;  3WC7 A;  1VHE A;  4PXC A;  2Z3K A;  2XEI A;  4OAE A;  4QVT A;  2P6G A;  1T36 B;  2GLF A;  1ARL A;  1OZP A;  2D4P A;  3D67 A;  4UIA A;  4F9V A;  4MFL A;  3S6F A;  5KTA A;  4A4C A;  2ZEF A;  2GAN A;  2MP0 A;  2XEJ A;  2OU2 A;  2F5I A;  1UFH A;  5LYL A;  2V8D A;  5A28 A;  4CDK A;  1TKF A;  2WPW A;  5KTD A;  4FWU A;  5HVF A;  3GKR A;  1IY7 A;  3D2P A;  3SJF A;  3T07 A;  4MJX A;  1F57 A;  1Y9K A;  1EZB A;  4MI4 A;  2GLJ A;  2V8G A;  1OBR A;  4ZX8 A;  3C26 A;  2Q4Z A;  4KUA A;  3GYA A;  4A94 A;  4PK2 A;  4JJX A;  3N5F A;  4ZY0 A;  2FT0 A;  4L89 A;  4PSX A;  4ZI6 A;  1KZF A;  2PVV A;  2RC4 A;  4J0N A;  4IUS A;  4QC6 A;  4Y49 B;  1ZRS A;  2ANP A;  5ISV A;  3QAH A;  4C8A A;  3B35 A;  3VWD A;  2DPS A;  1AYE A;  1MJA A;  1BAV A;  3DGV A;  4MY0 A;  4HNW B;  2Z0Z A;  4PSW A;  3KHX A;  1R57 A;  2PJ9 A;  2F7V A;  3WR7 A;  3WT4 A;  2GP4 A;  2DEA A;  2XPP A;  1B6B A;  2G9D A;  4C9V A;  3VRQ A;  1NSL A;  3I9S A;  4LQ6 A;  4ONU A;  5BWA B;  2Y1N A;  4UEZ A;  5G1Z A;  4M85 A;  2E28 A;  2OH1 A;  2C1C A;  1BLL E;  1M4G A;  4K3N A;  2IL4 A;  4NGT A;  3BXM A;  2V77 A;  2XPO A;  4P45 A;  3CZX A;  3PB7 X;  3S6H A;  1Z8L A;  5K8O A;  3R96 A;  4C9E A;  1ZLI A;  3VRN A;  4EYS A;  3D7G A;  4UIB A;  2Q44 A;  4CPA A;  1JWQ A;  3IU2 A;  1J4J A;  1EE3 P;  1QMU A;  4FUU A;  3SI2 A;  2ZW4 A;  1HDQ A;  4P4F A;  3EC4 A;  2F8H A;  3W91 A;  1BOB A;  3VAT A;  1YQE A;  1RO5 A;  3FJU A;  4L8A A;  3FRM A;  1TF9 A;  4U9Y A;  2ZED A;  3QNV A;  4F8Z A;  3W6X A;  4NGM A;  4MMO A;  2VZY A;  2EK9 A;  4UFW A;  2PJ8 A;  3H5Z A;  1QSO A;  4CAW A;  2A4N A;  5DS0 A;  5IB0 A;  5DWN A;  4JWP A;  5AXI A;  2JEW A;  2Y0M A;  4QUS A;  1TKJ A;  3RNZ A;  5JQ4 A;  3MGD A;  4AVC A;  1XBU A;  4FBE A;  2VQY A;  2VXK A;  3LD2 A;  4TNU A;  3V8I A;  2IMO A;  3BI1 A;  2ZEP A;  4UA3 A;  4XPD B;  3V38 A;  4NEX A;  4E94 A;  2WSA A;  2XPL A;  1MJB A;  1AUG A;  2ZEM A;  3I1U A;  3NA6 A;  3PFE A;  1QSN A;  1XE4 A;  4R87 A;  3ZZI A;  2DPT A;  2AE6 A;  3TX8 A;  3BUN B;  2YJT A;  1ZL0 A;  3T05 A;  4CAX A;  3BUO B;  1WWZ A;  2QEC A;  2AFX A;  2BOA A;  2B58 A;  4E8O A;  4KSA A;  2YNC C;  3FF3 A;  3I6S A;  2B4D A;  4AVA A;  2RB7 A;  4JXR A;  2I79 A;  1UWY A;  1YLO A;  3TO7 A;  2BL1 A;  3SJX A;  1K4J A;  4IHM A;  2DF5 A;  2EBJ A;  3ICU A;  3TT2 A;  5HKZ A;  1A2Z A;  2VEZ A;  3TTH A;  5GCN A;  2XPN A;  2D0P A;  3BJ7 A;  4BPW B;  1C30 B;  3QAY A;  4M6G A;  3WC5 A;  4U5Y A;  4XNH B;  1NE9 A;  4C68 A;  3BUM B;  2J8R A;  3EZB A;  3DR6 A;  1IYL A;  2REE A;  3B2Y A;  2AUM A;  2HWG A;  3LAC A;  2FIA A;  1GYT A;  1Z9E A;  2EWB A;  3RO0 A;  4KOW A;  4FD6 A;  4F9U A;  1R61 A;  3PZJ A;  2B4D B;  1XFO A;  2AFU A;  2OZU A;  5LYD A;  2EZB A;  3SI0 A;  4JZ0 A;  1XF8 A;  3B3W A;  3P2F A;  4JLY A;  1JDB C;  2C6C A;  5KTC A;  3ZNI A;  2AFS A;  4RN7 A;  4TWE A;  4CAF A;  4CZ1 A;  4YFJ A;  1IU8 A;  1VHS A;  4UCN A;  4UWI A;  4YGO A;  3TOA A;  2CF4 A;  2PJ5 A;  5G21 A;  1CE8 B;  1XIX A;  4YU9 A;  4C2Z A;  3SR3 A;  1WVM A;  1Q2Y A;  1S7L A;  3CPX A;  1QSM A;  1S7F A;  3UY5 A;  3PP9 A;  2Z10 A;  5A27 A;  1XJO A;  1AMP A;  2JEV A;  1R3N A;  1VIX A;  2XEF A;  3SXO A;  3NE7 A;  5J8F A;  3IIB A;  4EWT A;  1CP6 A;  5CBM A;  4R76 A;  2QML A;  1JQG A;  2BEI A;  5EC4 A;  1I1D A;  2EUI A;  3KQZ A;  3S9N A;  4NGN A;  4KVM E;  2HB6 A;  4MBU A;  5F49 A;  3TLB A;  2FE7 A;  1I12 A;  2FIW A;  2Z3N A;  2BO9 A;  3QB8 A;  1VI4 A;  3EIF A;  3B3S A;  1IB1 E;  2PRB A;  3PBB A;  5EMI A;  3PB6 X;  4A2Z A;  3FYN A;  1Z9U A;  2AFO A;  3GB0 A;  3IU1 A;  3KQX A;  5F48 A;  1BPN A;  2NYQ A;  2ODF A;  5AG6 A;  4F6A A;  4OC3 A;  2O28 A;  4KOV A;  3SHP A;  5K8P A;  1YME A;  2Z3L A;  3DDD A;  4LUA A;  1YVO A;  4MFP A;  1GGO A;  1KEE B;  4DJL A;  1JDE A;  1Q2D A;  1NMT A;  2ZEO A;  4ZGY B;  2PIZ A;  2Q0Y A;  3DSB A;  4M3S A;  1ZG7 A;  3JVN A;  2O53 A;  4C8T A;  2B4J C;  4NGP A;  3O8Z A;  1HDU A;  3FNC A;  1XMT A;  2POK A;  2PJ2 A;  2Z11 A;  2GIV A;  2HQY A;  3B8G A;  2C6P A;  2ZXV A;  4HPS A;  4Y49 C;  3EZE A;  4P4D A;  2CBL A;  4C84 A;  2H5M A;  4C2X A;  4GPL B;  3PFO A;  2GRE A;  3IEH A;  2CY2 A;  3R9E A;  4XPK A;  2PVW A;  3JRU A;  1DIK A;  2B0A A;  2ZEE A;  1RXT A;  4OIW A;  2WZN A;  3IJ3 A;  4CYN A;  4A30 A;  3BUW B;  4NFR A;  4B13 A;  1Q2C A;  4MCS A;  4P4I A;  2Q7B A;  1TF8 A;  3B7I A;  4CGP A;  2D0O A;  4AG9 A;  3IC1 A;  3K4I A;  3G23 A;  3FB3 A;  4X3R A;  1FY7 A;  2P0W A;  3DLJ A;  2PIY A;  4H6U A;  3JTK A;  1XRY A;  4MCQ A;  4P44 A;  3VGO A;  3FBU A;  4H89 A;  2P6E A;  1S5K A;  4MCP A;  1SQH A;  5AG7 A;  3V7Z A;  1S7K A;  1CG2 A;  3H8E A;  2PJ0 A;  5D29 A;  4H2K A;  4F0X A;  3TFY A;  1B47 A;  2PRQ A;  2ZPA A;  1BXR B;  1DE4 C;  2YNE A;  4JXQ A;  2DIK A;  3T5M A;  2UV8 G;  3L2N A;  4FD4 A;  3BUX B;  4KSI A;  2EK8 A;  2OLS A;  3HPH E;  5LYF A;  4NF1 A;  4XPD C;  1VGY A;  2FS5 A;  4NSQ A;  4QB9 A;  3BHX A;  2ZW6 A;  1IIC A;  1LOK A;  3FH4 A;  2YND A;  3TO9 A;  4OKO A;  3BI0 A;  1CPS A;  1A9X B;  2VZZ A;  3BLN A;  3R1K A;  3RBU A;  2G0B A;  4COB A;  3SJG A;  1PU9 A;  2HI6 A;  1XMB A;  1ELM P;  3HUV A;  1QSR A;  2AFW A;  2C6G A;  3P2H A;  3W6S A;  5IR2 A;  1S7N A;  3F5B A;  4UCM A;  5THW A;  3TE4 A;  1X12 A;  1XOV A;  2FCK A;  5BY0 A;  3IWE A;  4PQA A;  3E0K A;  3FVL A;  2PR1 A;  1IOF A;  3FIX A;  4H1H A;  4KVX A;  2QJ8 A;  4XNH C;  4B11 A;  1YVK A;  4MFZ A;  3OAK A;  4KVO E;  5DWM A;  4B14 A;  4TJX A;  3TLZ A;  1ARM A;  2FVG A;  2Z3O A;  3I3G A;  4C85 A;  5AGE A;  1YR0 A;  1YGH A;  2CNT A;  1VKC A;  5HKY A;  5AG4 A;  3FEE A;  2ZEG A;  4CAV A;  2OZH A;  1Z4E A;  2JDC A;  2PJB A;  3D8P A;  3NH4 A;  2AJ6 A;  3CXQ A;  5ELY A;  2D4O A;  3TLA A;  1PYT B;  4PXE A;  4WJB A;  4ONW A;  1Y0Y A;  3SJE A;  3PFV A;  1KUV A;  4MFJ A;  2BSW A;  4BPU B;  3LMS A;  1V6C A;  3GUX A;  2V8H A;  4GXH A;  4M6H A;  1X10 A;  3DNS A;  4C8P A;  2QIR A;  4G1P A;  1Q5X A;  4KOR A;  1Y0R A;  4MHP A;  4TJV A;  1YX0 A;  4OID A;  3VRR A;  3CXS A;  4X8I A;  4R3K A;  4PXD A;  1CBX A;  5D8N A;  4BD9 A;  1FNO A;  4KS9 A;  4HNX B;  3VAR A;  4P4J A;  3H8F A;  1V0C A;  4EME A;  2B3U A;  3TOB A;  3B3V A;  4INJ A;  1M4I A;  1S60 A;  3A9L A;  1QQ9 A;  1HEE A;  2QVP A;  3ISX A;  4PK3 A;  1NSA A;  2V8V A;  4KZT A;  4Q38 A;  2R98 A;  1Y9Z A;  4CGL A;  4A39 A;  2ABZ A;  4UF4 A;  1BO4 A;  2EZA A;  4C99 A;  4A4B A;  2HRO A;  3N7Z A;  2I3C A;  2Q51 A;  1TIQ A;  4C8U A;  3TC8 A;  5C82 A;  2WUU A;  3PGP A;  3F0A A;  2PJ4 A;  5K8N A;  4MFK A;  4P4B A;  4MJ8 A;  4NGS A;  3GY9 A;  3KKW A;  3D7F A;  2ZW7 A;  1Z4R A;  4PV6 A;  1YK3 A;  1Z8X A;  2ARH A;  3LWU A;  2VL1 A;  5F09 A;  3KR5 A;  3KR4 A;  2CNM A;  1XF1 A;  2YJV A;  4JYW A;  5J1Q A;  2PJ3 A;  3I74 A;  2ZEN A;  4U9Z A;  5F1Y A;  3NFQ A;  3EZA A;  3TCV A;  4C8C A;  1Y9W A;  4CGM A;  2CIJ A;  4AB7 A;  4BPX B;  5LRG A;  3S9L A;  2J8N A;  2EVN A;  4UFX A;  1Z2L A;  4ZYQ A;  2PDO A;  3NOJ A;  2AUN A;  3TYX A;  3VTA A;  3PB8 X;  4JVO A;  4GM5 A;  2PQ8 A;  3MRU A;  4MFQ A;  2JLM A;  3NFZ A;  5K8M A;  3WC6 A;  4JD6 A;  4CYP A;  3IGR A;  4X5K A;  5I4M A;  2REF A;  3H4Q A;  1B87 A;  3FMC A;  2Q4V A;  1P0H A;  4OC5 A;  1CX8 A;  4OC0 A;  3CT9 A;  3S6G A;  4KOX A;  1NBW A;  2R82 A;  1YSJ A;  3KI9 A;  3RYO A;  4P4E A;  1BPM A;  4R3L A;  1LRZ A;  4E5S A;  4KLV A;  4DUK A;  4BMH A;  3EFA A;  2B3V A;  4CAE A;  4RR2 B;  4B6Z A;  1LAP A;  2YGW A;  1YVH A;  2AFZ A;  3D68 A;  3JUW A;  2P6F A;  2RFH A;  4E2A A;  4YRH A;  2ZOG A;  7CPA A;  3C8O A;  3D2M A;  3G8W A;  3F9K C;  2CNS A;  4RI1 A;  5E96 A;  1ZLH A;  2NMT A;  5LRK A;  1Z8T A;  5IB9 A;  1RTQ A;  3D4U A;  3R9G A;  4KOS A;  2VKZ G;  3NH8 A;  1PUA A;  4A31 A;  4NCZ A;  4EFD A;  4KOT A;  2FXF A;  2Z3P A;  3LOD A;  5G22 A;  3HLP A;  4AVB A;  1M44 A;  2PC1 A;  3SI1 A;  3K2K A;  3PRT A;  5JGF A;  5F13 A;  3NH5 A;  1Q7L A;  4UEE A;  4IIY A;  3PEI A;  4MHN A;  3KGQ A;  3PB4 X;  1EO0 A;  4NJQ A;  4COG A;  2Q04 A;  4QBJ A;  1DTD A;  2BCO A;  4C2Y A;  4ZY2 A;  4OAD A;  2B4B A;  3CDX A;  4UEF A;  2Q4Y A;  2HUZ A;  4PPZ A;  4IK2 A;  4UWJ A;  3T8W A;  1WK4 A;  5HH1 A;  5J8C A;  5JM6 A;  3F8K A;  1NXJ A;  1S3Z A;  2PCU A;  4IF5 A;  4F0Y A;  4AG7 A;  2QYV A;  4RS2 A;  5HXD A;  4R57 A;  3TLY A;  3IFE A;  3RZA A;  4C9A A;  1VHO A;  4C7H A;  3HMJ G;  2WPX A;  4C9R A;  3FX6 A;  2VI7 A;  3TLC A;  1M1D A;  3K9U A;  3PT1 A;  1J3L A;  4FD7 A;  5CNP A;  4A95 A;  3PBE A;  4KNG E;  2FSR A;  4ZBG A;  2ZEH A;  2OOT A;  2Q43 A;  2X7B A;  2O4H A;  4M6I A;  5H84 A;  4KLW A;  3FEC A;  3U88 C;  4A33 A;  2PJC A;  4AXV A;  4UCP A;  5IX3 A;  2GFQ A;  4ZY1 A;  3BJ8 A;  4CYQ A;  4YWY A;  4MXU A;  3OP0 A;  4R9M A;  1VBH A;  3VRP A;  4NGQ A;  5FVJ A;  4MHY A;  2JBK A;  4OC4 A;  1KUX A;  2Q7S A;  4MHD A;  4R6T A;  1KC7 A;  4CRY B;  2DLA A;  1Z5R A;  3EO4 A;  3H8G A;  1VBG A;  3S9M A;  3B3C A;  5JH9 A;  1PCA A;  3D66 A;  1ZG9 A;  4OC2 A;  2KCW A;  3FXT A;  4E0A A;  2VBQ A;  4CYO A;  2J8M A;  5F46 A;  1Z8W A;  4A37 A;  1MK4 A;  1LAM A;  1IYK A; 
#chains in the Genus database with same CATH homology
 1TXR A;  1R43 A;  4YN3 A;  2NSM A;  2C5Q A;  1IGB A;  4O23 A;  1LFW A;  2GU2 A;  3D7D A;  3GLJ A;  4TJX A;  2HC9 A;  4OP4 A;  4C9U A;  1M4L A;  2PE3 A;  3PB9 X;  4NJR A;  4P10 A;  1LAN A;  2WYR A;  3WAB A;  1KWM A;  2CTB A;  2IJZ A;  3KL9 A;  4OC1 A;  4MHZ A;  3KHZ A;  4R8F A;  1LCP A;  3RAM A;  5HVG A;  4P6Y A;  3FED A;  3MN8 A;  3KZW A;  1FT7 A;  4OME A;  1ZG8 A;  2PJ6 A;  4PXB A;  4C8F A;  5CPA A;  4W9Y A;  2ZOF A;  2JBJ A;  2ZEL A;  1F2O A;  4CDJ A;  2XEG A;  1CP7 A;  3IO1 A;  2PJA A;  4MCR A;  2CTC A;  4DYO A;  4IAV A;  2PJ1 A;  5LYI A;  1F2P A;  4A38 A;  8CPA A;  4WWV A;  1TKH A;  4LQG A;  3ISZ A;  5HVH A;  3VH9 A;  4R7M A;  4NGR A;  4X2T A;  2J9A A;  4ZX9 A;  3CPA A;  1ELL P;  3KAS A;  1YW6 A;  3IWW A;  2AFM A;  6CPA A;  2OR4 A;  1H8L A;  1CPX A;  2PJ7 A;  4RUH A;  4Z65 A;  3D7H A;  3B3T A;  4MRI A;  2IQ6 A;  4FAI A;  1YW4 A;  3K9T A;  4C86 A;  5LRJ A;  1Y7E A;  3WC7 A;  1VHE A;  4PXC A;  2XEI A;  2GLF A;  1ARL A;  3D67 A;  4UIA A;  4F9V A;  2ZEF A;  2XEJ A;  5LYL A;  2V8D A;  4CDK A;  1TKF A;  4FWU A;  5HVF A;  1IY7 A;  3SJF A;  1F57 A;  2GLJ A;  2V8G A;  1OBR A;  4ZX8 A;  2Q4Z A;  4A94 A;  3N5F A;  4ZY0 A;  4ZI6 A;  2PVV A;  2ANP A;  4C8A A;  3B35 A;  1AYE A;  1BAV A;  3DGV A;  3KHX A;  2PJ9 A;  2GP4 A;  2F7V A;  3WT4 A;  2DEA A;  2G9D A;  4C9V A;  4UEZ A;  2C1C A;  1BLL E;  4K3N A;  4NGT A;  3BXM A;  2V77 A;  4P45 A;  4C9E A;  3PB7 X;  5K8O A;  1Z8L A;  1ZLI A;  3D7G A;  4UIB A;  4CPA A;  1EE3 P;  1QMU A;  3SI2 A;  4FUU A;  1HDQ A;  4P4F A;  2F8H A;  3VAT A;  3FJU A;  4F8Z A;  1TF9 A;  2ZED A;  3QNV A;  4NGM A;  4MMO A;  2EK9 A;  2PJ8 A;  5DS0 A;  2JEW A;  1TKJ A;  1XBU A;  4FBE A;  4TNU A;  2IMO A;  3BI1 A;  2ZEP A;  3V38 A;  3PFE A;  2ZEM A;  3NA6 A;  3I1U A;  3TX8 A;  2AFX A;  2BOA A;  3I6S A;  3FF3 A;  2RB7 A;  1UWY A;  1YLO A;  3SJX A;  4IHM A;  3ICU A;  3WC5 A;  3B2Y A;  4F9U A;  1GYT A;  2EWB A;  1XFO A;  2AFU A;  5LYD A;  3SI0 A;  4JZ0 A;  3B3W A;  2C6C A;  2AFS A;  4TWE A;  2CF4 A;  2PJ5 A;  4YU9 A;  1WVM A;  3CPX A;  1AMP A;  1XJO A;  1R3N A;  1VIX A;  2XEF A;  3IIB A;  4EWT A;  1CP6 A;  5CBM A;  4R76 A;  1JQG A;  3KQZ A;  3S9N A;  4NGN A;  2HB6 A;  3EIF A;  2BO9 A;  3B3S A;  3PBB A;  3PB6 X;  3GB0 A;  2AFO A;  3KQX A;  1BPN A;  2NYQ A;  4OC3 A;  5K8P A;  1YME A;  4DJL A;  2ZEO A;  2PIZ A;  1ZG7 A;  2O53 A;  4C8T A;  4NGP A;  1HDU A;  4Q7A A;  2POK A;  2PJ2 A;  2C6P A;  4P4D A;  4C84 A;  3PFO A;  2GRE A;  3IEH A;  2PVW A;  3JRU A;  2ZEE A;  4OIW A;  2WZN A;  3IJ3 A;  4NFR A;  4MCS A;  4P4I A;  1TF8 A;  3B7I A;  3IC1 A;  4X3R A;  3DLJ A;  2PIY A;  1XRY A;  4MCQ A;  4P44 A;  4MCP A;  3V7Z A;  3H8E A;  1CG2 A;  2PJ0 A;  5D29 A;  4H2K A;  2PRQ A;  1DE4 C;  3L2N A;  4KSI A;  2EK8 A;  5LYF A;  1VGY A;  3BHX A;  3FH4 A;  1LOK A;  4OKO A;  3BI0 A;  1CPS A;  3RBU A;  3SJG A;  1XMB A;  1ELM P;  3HUV A;  2AFW A;  2C6G A;  5IR2 A;  5THW A;  4PQA A;  3FVL A;  2QJ8 A;  1ARM A;  2FVG A;  4C85 A;  3FEE A;  2ZEG A;  3NH4 A;  2PJB A;  5ELY A;  1PYT B;  4PXE A;  4WJB A;  4ONW A;  1Y0Y A;  3SJE A;  1V6C A;  3LMS A;  3GUX A;  2V8H A;  4C8P A;  4G1P A;  1Y0R A;  4MHP A;  4TJV A;  4OID A;  4X8I A;  4PXD A;  1CBX A;  5D8N A;  4BD9 A;  1FNO A;  3VAR A;  4P4J A;  3H8F A;  4EME A;  3B3V A;  1QQ9 A;  1HEE A;  2QVP A;  3ISX A;  1NSA A;  2V8V A;  1Y9Z A;  4A39 A;  2ABZ A;  4UF4 A;  4C99 A;  2I3C A;  2Q51 A;  4C8U A;  3TC8 A;  5K8N A;  2PJ4 A;  4P4B A;  4NGS A;  3D7F A;  3LWU A;  2VL1 A;  5F09 A;  3KR5 A;  3KR4 A;  1XF1 A;  4JYW A;  5J1Q A;  2PJ3 A;  3I74 A;  2ZEN A;  4C8C A;  2CIJ A;  5LRG A;  3S9L A;  4ZYQ A;  1Z2L A;  3VTA A;  3PB8 X;  4GM5 A;  3MRU A;  3NFZ A;  5K8M A;  3WC6 A;  5I4M A;  3FMC A;  4OC5 A;  1CX8 A;  4OC0 A;  3CT9 A;  1YSJ A;  3KI9 A;  4P4E A;  1BPM A;  4DUK A;  4B6Z A;  1LAP A;  2AFZ A;  3D68 A;  2RFH A;  2ZOG A;  7CPA A;  5LRK A;  1ZLH A;  5IB9 A;  1RTQ A;  3D4U A;  3NH8 A;  4EFD A;  3HLP A;  3SI1 A;  3K2K A;  3PRT A;  5JGF A;  3NH5 A;  1Q7L A;  4UEE A;  3PEI A;  4MHN A;  3KGQ A;  3PB4 X;  4NJQ A;  1DTD A;  2BCO A;  4ZY2 A;  4UEF A;  3CDX A;  4PPZ A;  4IK2 A;  3T8W A;  5JM6 A;  2PCU A;  2QYV A;  5HXD A;  4C9A A;  3IFE A;  3RZA A;  1VHO A;  4C9R A;  3FX6 A;  4KNG E;  3PBE A;  2ZEH A;  2OOT A;  2Q43 A;  2O4H A;  3FEC A;  2PJC A;  4AXV A;  4ZY1 A;  4YWY A;  4MXU A;  4NGQ A;  4MHY A;  2JBK A;  4OC4 A;  4R6T A;  1Z5R A;  3H8G A;  3S9M A;  3B3C A;  5JH9 A;  1PCA A;  3D66 A;  1ZG9 A;  4OC2 A;  4A37 A;  1LAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...