4OC4A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with cpibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxy-2-(pyridin-4-yl)ethyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYNVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc4A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc4A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc4A02
3RBUA 5LRJA 1H8LA 4OP4A 1TKFA 1RTQA 5LYIA 3CPXA 2DEAA 4DYOA 2Q51A 2AFXA 3ICUA 1FNOA 5LRGA 6CPAA 1DE4C 2PIYA 4R6TA 3D68A 1EE3P 2J9AA 4UEZA 3B3VA 4FUUA 2XEIA 1ZG9A 4NGPA 3NH8A 8CPAA 3B3TA 5LYDA 4GM5A 4C8PA 4MMOA 4ZX9A 3KASA 3IFEA 2ZEPA 2IMOA 1OBRA 4KNGE 3TC8A 2OOTA 3VH9A 3KL9A 4A38A 4TJXA 5THWA 5K8NA 1TF9A 4G1PA 3B3SA 4WWVA 5DS0A 2JBKA 2C6GA 2CF4A 2POKA 1XF1A 2CTBA 3IC1A 4BD9A 3H8EA 3D66A 1M4LA 2PVWA 1LOKA 5K8PA 4P45A 3D7HA 4C8UA 3B3WA 4X2TA 3KR5A 5LYLA 4PXDA 4A37A 4C9VA 4P4BA 1CPSA 3SI1A 3GUXA 2ZOGA 1ELMP 1QQ9A 1CP7A 3D7FA 3L2NA 3BI1A 4CPAA 1XMBA 1Y9ZA 4OKOA 7CPAA 1AYEA 4MCRA 1LAPA 3ISZA 4MCQA 3VATA 3MRUA 4JYWA 2BCOA 3FMCA 4IHMA 5HVHA 5HXDA 2PJ9A 4F9VA 3VTAA 2PVVA 2XEJA 1HDQA 4MHYA 1VHEA 4NGRA 3GLJA 4R76A 2AFWA 2V77A 1LFWA 2V8HA 3WC6A 1WVMA 1YW6A 1HDUA 2EK8A 2ZENA 3NH5A 2HC9A 3B3CA 3HUVA 3PEIA 3IO1A 3WT4A 2QVPA 2Q4ZA 2RB7A 3KR4A 4MCSA 2AFUA 4OMEA 1JQGA 3LMSA 4P10A 1TXRA 3B2YA 2AFMA 4OC3A 3CT9A 2PJ0A 3PFEA 3SJGA 2EWBA 3K9TA 1NSAA 4EWTA 1TF8A 2RFHA 4MHNA 5JGFA 2PJ2A 2C1CA 1ZG7A 4FBEA 5CBMA 3IJ3A 3DLJA 4MHPA 2HB6A 1V6CA 2GLFA 4UIAA 3NA6A 3NFZA 3WC7A 4JZ0A 3FVLA 3IWWA 3PRTA 4C8TA 1BAVA 3GB0A 3SJXA 3I74A 4UEEA 4FWUA 3BHXA 4RUHA 1LAMA 1Q7LA 4TJVA 3SJFA 2PJ6A 4R7MA 4OC0A 2GU2A 3QNVA 2JBJA 5HVFA 1CPXA 4C8CA 4Z65A 3I1UA 3FF3A 1F57A 3PB6X 3RAMA 1AMPA 5K8OA 2QYVA 4P4IA 4B6ZA 2AFZA 2ZEEA 3FEDA 1R43A 2V8GA 2AFOA 3K2KA 4MCPA 3PBBA 1XBUA 3JRUA 4PPZA 4PXEA 5K8MA 4Q7AA 3V38A 4YWYA 2GREA 2ZOFA 4NGQA 4UIBA 2ABZA 4DUKA 3RZAA 4X8IA 2AFSA 1IGBA 4PXBA 4WJBA 3KI9A 2PJBA 4NGMA 2ZEGA 2JEWA 5I4MA 5ELYA 4P6YA 2CTCA 4X3RA 3D7DA 2WZNA 3I6SA 2ZEMA 5F09A 2ZEHA 2ZEOA 4OIWA 4C9AA 4H2KA 3SJEA 3FH4A 1ZLHA 2VL1A 1ARLA 4C8FA 3KZWA 2PJCA 1UWYA 1CX8A 1Y7EA 3FEEA 5D8NA 2PJ4A 2C6CA 2GLJA 4W9YA 1LCPA 3N5FA 4FAIA 2CIJA 4ZYQA 2PJ8A 2I3CA 4UF4A 4NGNA 4A94A 4PQAA 2PJ1A 4C9RA 3KQXA 2PJAA 2XEGA 3PB9X 1IY7A 4TNUA 4MHZA 5JM6A 4MRIA 3PFOA 4C8AA 1VHOA 4NGTA 3V7ZA 3PB4X 2QJ8A 2PE3A 5LYFA 4F8ZA 3WABA 4C85A 2PIZA 4NJRA 3FJUA 4TWEA 1TKHA 4C84A 2NYQA 2C6PA 2BOAA 4LQGA 2WYRA 4IK2A 4ZY1A 3T8WA 3SI2A 1BPNA 1R3NA 1FT7A 4NGSA 5IB9A 2IJZA 4MXUA 1BPMA 4P4FA 4DJLA 3WC5A 3TX8A 1CP6A 1XFOA 2XEFA 3KQZA 2ZEDA 3PBEA 1YSJA 3B7IA 1ZLIA 2Q43A 3PB8X 4P4JA 1LANA 4C9EA 1Z8LA 2O53A 1CG2A 1YMEA 3VARA 4IAVA 2PJ7A 4YU9A 3BXMA 3PB7X 3FX6A 4ZX8A 4AXVA 3H8GA 3IEHA 4OC5A 3HLPA 3D7GA 2F8HA 2PJ3A 4YN3A 2ZEFA 1TKJA 4OIDA 3SI0A 1ZG8A 4C86A 4CDKA 2V8VA 1PCAA 5CPAA 3KGQA 5J1QA 2OR4A 1CBXA 4C99A 3BI0A 4CDJA 3H8FA 4P4EA 4UEFA 2PJ5A 4F9UA 5JH9A 1VIXA 4OC1A 3B35A 2PRQA 4A39A 1ARMA 1YW4A 3IIBA 3KHZA 3CDXA 1KWMA 4C9UA 1XJOA 2G9DA 5HVGA 4ONWA 3EIFA 5D29A 3D4UA 1XRYA 4ZY2A 4ZY0A 2PCUA 4K3NA 2IQ6A 5LRKA 1BLLE 1F2PA 1QMUA 4EMEA 3S9LA 4PXCA 3S9MA 1F2OA 2F7VA 1PYTB 2O4HA 3MN8A 1Z2LA 4ZI6A 1GYTA 3S9NA 4EFDA 3KHXA 1HEEA 1Y0RA 2NSMA 2EK9A 3CPAA 4P44A 1VGYA 2FVGA 4O23A 4OC2A 4KSIA 3DGVA 2BO9A 4P4DA 4NFRA 3ISXA 4NJQA 3D67A 1Z5RA 4R8FA 4OC4A 3NH4A 3FECA 2V8DA 2ZELA 1Y0YA 2ANPA 1ELLP 3LWUA 1DTDA 1YLOA
chains in the Genus database with same CATH superfamily
2P6EA 3RBUA 2PR8A 3K9UA 3GYAA 2CXAA 3GIUA 5LRJA 2XPNA 1H8LA 2FT0A 4OP4A 5G21A 1VBHA 2J8RA 3NE7A 1IB1E 2VXKA 5F1YA 2B4BA 3R1KA 1TKFA 1RTQA 1I12A 1S5KA 4OADA 1X10A 4UFXA 3CPXA 5LYIA 3VRQA 5G1ZA 2DEAA 5KTCA 1I1DA 2I00A 4CRZB 1CM0A 1PUAA 4A95A 4BPWB 3KKWA 4DYOA 2Q51A 3OWCA 2BUEA 2AFXA 2ATRA 4KLVA 4XNHB 3CXPA 2BL1A 4MY3A 4ONUA 3ICUA 3T07A 1FNOA 5LRGA 3QB8A 6CPAA 1DE4C 4KVOE 2PIYA 4R6TA 3EZBA 5HKYA 1EE3P 2J9AA 3D68A 4UEZA 4XPDC 3B3VA 4FUUA 3DDDA 1CE8B 1YR0A 2XEIA 3TOAA 1CJWA 1ZG9A 1YK3A 4KOSA 3R9GA 4NGPA 3QAHA 2EZBA 4MFKA 4OAEA 2OH1A 2FE7A 1EZBA 1Q2YA 3NH8A 4JJXA 1U6MA 8CPAA 4CAEA 2WPWA 3B3TA 5JQ4A 1J4JA 5LYDA 2DIKA 4GM5A 4C8PA 3VRRA 4MMOA 4RN7A 1VBGA 1YQEA 4ZX9A 3KASA 4A32A 3IFEA 1NBWA 1IOFA 3IU1A 3TT2A 1XF8A 3D2MA 2ZEPA 1ZL0A 2IMOA 2O28A 2NMTA 4KZTA 1NMTA 3SHPA 3FNCA 4NEXA 3TO9A 2REEA 4IIYA 1OBRA 4EYSA 3RYOA 4J0NA 2QIRA 4KNGE 2P6FA 3TC8A 2OOTA 3VH9A 3KL9A 4A38A 2BEIA 4IUSA 3PFVA 5THWA 4NSQA 2YNCA 1MK4A 2AE6A 4A30A 5K8NA 2XPLA 4KOUA 1QSNA 1TF9A 4G1PA 3B3SA 4WWVA 4CGLA 5DS0A 5GCNA 2JBKA 2C6GA 2CF4A 1VI4A 2JDCA 3P2HA 1IYKA 2POKA 2QMLA 3TOBA 1XF1A 3R9FA 1M44A 2CTBA 3IC1A 3IGRA 1UFHA 4JWPA 1KZFA 1S7KA 2GE3A 4JD6A 3S6KA 5IR2A 2CNMA 2OLSA 2GANA 2JEVA 1Q2CA 4BD9A 1Q2DA 3H8EA 3D66A 1M4LA 5AXIA 2PVWA 1LOKA 4RR2B 5K8PA 4P45A 3D7HA 5F48A 4C8UA 2DLAA 2R8VA 3OP0A 3B3WA 4X2TA 3KR5A 5LYLA 4PXDA 4A37A 4C9VA 5F49A 4P4BA 2J8MA 1CPSA 4XNHC 3SI1A 3GUXA 4C68A 2Y1MA 2ZOGA 1ELMP 1QQ9A 4TJVA 2Q7BA 1CP7A 4BTFA 3DNSA 1Z9UA 3D7FA 3L2NA 1S7NA 3FBUA 5EC4A 3D3SA 3BI1A 2D0PA 4CPAA 4QC6A 1M4IA 3PZJA 1XMBA 3VWEA 4BMHA 1C30B 1Y9ZA 4OKOA 4MY0A 7CPAA 2OZGA 2R1IA 1AYEA 4MCRA 1LAPA 3ISZA 4MCQA 4KUBA 1OZPA 1YX0A 4JYWA 5HKZA 1BO4A 3MRUA 2BCOA 3FMCA 4MHDA 3TLAA 4IHMA 3EC4A 2VZZA 2QECA 1Y9WA 5HVHA 5HXDA 2PJ9A 3BJ7A 4F9VA 2BSWA 2GP4A 3D2PA 4X5KA 3VTAA 4Y49B 2PVVA 4A31A 2XEJA 1HDQA 2D4OA 1VHEA 4MHYA 4NGRA 3FIXA 2EBJA 2R82A 3GLJA 4R76A 3PLFB 2AFWA 2V77A 3H4QA 1LFWA 4UCMA 3OB2B 4C2ZA 5AG4A 1JDBC 2V8HA 3WC6A 1WVMA 3T90A 2AUNA 4UWIA 1YW6A 2DPTA 5G20A 1VKCA 1HDUA 3F5BA 4R3LA 2EK8A 4HNYB 1IICA 2ZENA 2HC9A 3ZNIA 3NH5A 4FD5A 4GPLB 3B3CA 3HUVA 3PEIA 3IO1A 4KVME 3WT4A 1M1DA 2QVPA 2R7HA 4KSFA 2Q4ZA 5G22A 5IV0A 2RB7A 1QSMA 2AJ6A 3KR4A 4MCSA 4J3GA 4KOYA 4NF1A 1WK4A 2AFUA 4UWJA 3ZJ0A 1RXTA 3JVNA 4OMEA 1MJBA 4A33A 3BLNA 1JQGA 3LMSA 3TO7A 4YGOA 4CGNA 4P10A 1TXRA 4JXRA 1EO0A 2B5GA 3B2YA 2AFMA 4OC3A 3BUWB 3CT9A 2PJ0A 3PFEA 3SJGA 5AG5A 4A4CA 1B6BA 2EWBA 2OU2A 2HUZA 1C3OB 3K9TA 4HNXB 1JWQA 1NSAA 4FD4A 4EWTA 1TF8A 2I79A 2RFHA 4KORA 4MHNA 5ISVA 5J8FA 2Z11A 4K30A 4LQ6A 5JGFA 3LACA 3TLYA 4JLYA 4KOWA 2PJ2A 2VI7A 5H84A 3TTHA 2C1CA 1ZG7A 4FBEA 5CBMA 3IJ3A 3DLJA 4MHPA 1S3ZA 2HB6A 4E5SA 1V6CA 3TLCA 4CAWA 1R61A 2GLFA 4UIAA 2ZW4A 3NA6A 3G3SA 3NFZA 3WC7A 4QB9A 3HPHE 4JZ0A 5JYBA 2Q4VA 4MFLA 2R98A 1RO5A 3FVLA 4JXQA 4MFJA 4Q38A 3IWGA 3VATA 4M6IA 3PP9A 3IWWA 3PRTA 1KEEB 1BAVA 2PDOA 3GB0A 4KS9A 4C8TA 3SJXA 2A4NA 2PR1A 4BBHA 3I74A 4CO9A 5J3XA 4UEEA 3T05A 4L89A 4FWUA 3BHXA 1Q5XA 4BPUB 1PU9A 1ZO0A 3MGDA 5EMIA 5IB0A 4Y49C 1NXJA 4ORFA 1LAMA 1Q7LA 4RI1A 3SJFA 3BUOB 3WR7A 2PJ6A 4R7MA 4RUHA 5IX3A 4OC0A 1S7LA 1JDEA 2GU2A 3BUXB 4QBJA 3QNVA 4KOVA 3TLGB 2JBJA 3BUNB 1WWZA 5HVFA 1CPXA 1BOBA 2J8NA 4C8CA 4R3KA 2VBQA 4Z65A 4CS0B 2Q04A 4FD7A 3I1UA 2CNSA 1M4GA 3EFAA 4CGMA 4XPKA 2G3AA 3FB3A 1BXRB 3FF3A 1F57A 4KUAA 3PB6X 4CYPA 4BINA 3RAMA 1AMPA 2FSRA 5K8OA 2QYVA 4A4BA 4P4IA 3LD2A 1P0HA 4KOXA 4B6ZA 4CGPA 4COBA 2AFZA 2ZEEA 4TJXA 3FEDA 3VRNA 1R43A 2JDDA 2AFOA 2Q7SA 2XPOA 3O8ZA 5F13A 2V8GA 3K2KA 1YGHA 4E8OA 4MCPA 4JVOA 4CZ1A 4M85A 1YLEA 3PBBA 1XBUA 3JRUA 4PPZA 4PXEA 5K8MA 4Q7AA 4B10A 3V38A 5F5XA 4YWYA 3BJ8A 4H1HA 2GREA 3SR3A 2ZOFA 1CS0B 4NGQA 1DIKA 5C82A 2P0WA 3W6XA 4E94A 2FIWA 4UIBA 4AG9A 4UCNA 2ABZA 3VRPA 4DUKA 2GIVA 2Z3LA 1YVKA 5F46A 3T5MA 1IIDA 3IWEA 4X8IA 3RZAA 2AFSA 1Z8TA 5F9MA 1IGBA 4PXBA 4UBRA 4WJBA 3TO6A 3KI9A 4M3SA 2FL4A 4AVAA 4MJXA 2Q0YA 4R9MA 3C8OA 3EZAA 4CYOA 2PJBA 3OB1B 2VEZA 2H5MA 4NGMA 2ZEGA 2JEWA 4B5PA 5ELYA 5I4MA 4P6YA 2PC1A 4AG7A 2PRBA 3R96A 2CTCA 4X3RA 3D7DA 2WZNA 3I6SA 2YJTA 1XOVA 4UFWA 2ZEMA 4F6AA 1Z9EA 4UA3A 1K4JA 1MJAA 1MJ9A 2E28A 2EO8A 1J3LA 3FXTA 4KSAA 4MBUA 2X7BA 4QVTA 1ZYMA 3TLEA 1WJTA 5F09A 2ZEHA 2ZEOA 2ZW7A 2Y1NA 2VKZG 4OIWA 1GGOA 4C9AA 4H2KA 4AB7A 1B87A 3T0TA 3T9YA 3SJEA 2ZW5A 3FH4A 1XIXA 1ZLHA 2VL1A 4ZGYB 5BWAB 1L0CA 2CNTA 2HROA 2YNDA 1ARLA 1X12A 4C8FA 1IYLA 2ZW6A 4C2XA 1QSRA 5KTDA 3S6FA 3KRVA 1Z4EA 2EUIA 3KZWA 4HPSA 5HKWA 2PJCA 1UWYA 1CX8A 2YNCC 2OZHA 4U5YA 5DWNA 4LUAA 1Y7EA 5F47A 2DXQA 3FEEA 5D8NA 4LX9A 4BPXB 2PJ4A 5C88A 2AUMA 2C6CA 4UCPA 2GLJA 4W9YA 2Z3MA 3I9SA 1LCPA 1B47A 1M6VB 3N5FA 2B4DA 2P6GA 1VHSA 4KVXA 4FAIA 5JVLA 4YRHA 4MI1A 4MFZA 1YVHA 2CIJA 4C7HA 4ZYQA 2PJ8A 2I3CA 3VGOA 2WPXA 4HNWB 4UF4A 4NGNA 4A94A 4PQAA 1Y9KA 3F0AA 2PJ1A 4C9RA 3KQXA 4II9A 4MJ8A 2PJAA 2F5IA 3TCVA 2B58A 2XEGA 3R9EA 3PB9X 1S7FA 1IY7A 4R57A 4MHZA 4TNUA 2RC4A 2Y0MA 2VZYA 3SXNA 5JM6A 2B4JC 3DR6A 3PFOA 4MRIA 4OLLA 5I0CA 4B5OA 4C8AA 2YGWA 4B14A 1VHOA 4H89A 5FVJA 3F9KC 2JLMA 3LODA 4MFPA 4NGTA 3V7ZA 3PB4X 2QJ8A 2PE3A 3GY9A 1YREA 3F8KA 4AVBA 5AG6A 1T36B 2GFQA 3FRMA 5LYFA 4F8ZA 5AGEA 3H5ZA 3HPGG 2ARHA 2OB0A 5AG7A 3WABA 2OZUA 2PIZA 4C85A 4NJRA 5A28A 3RO0A 3DSBA 3FJUA 2HI6A 2PCNA 4TWEA 5HH1A 1TKHA 2WUUA 4C84A 2NYQA 2Z0ZA 4GXHA 2C6PA 2BOAA 4LQGA 2FXFA 2WYRA 4IK2A 2HWGA 2EVNA 4ZY1A 2FM4A 3T8WA 2XPPA 3SI2A 4INJA 4COGA 1BPNA 3B8GA 3CXQA 3EY5A 3EXNA 1R3NA 3PGPA 1EZAA 3E0KA 1FT7A 4NGSA 2Z3OA 4CAVA 5K99A 2FIAA 5IB9A 2IJZA 4MXUA 1BPMA 4P4FA 4DJLA 3GKRA 1A9XB 3WC5A 2B3VA 4GS4A 3TX8A 1CP6A 5EBVA 2PSWA 3GJZA 1QSOA 1XFOA 2N3AB 2XEFA 3KQZA 1P4NA 2ZEDA 4PK3A 4AVCA 3OAKA 4I49A 3PBEA 1YSJA 3CXSA 2Z10A 1QSTA 4KLWA 3ZZIA 2D4PA 3B7IA 1ZLIA 1KUYA 1IU8A 2Q43A 3PB8X 4YFJA 4NXYA 3TLZA 4P4JA 1LANA 1Z8WA 4C9EA 5BY0A 1Z8LA 2O53A 1CG2A 1ON0A 1YMEA 2B3UA 3A9LA 1A2ZA 3VARA 2ZXVA 3U88C 2WSAA 4CGOA 1Z4RA 4XPLA 4IAVA 3VWDA 2PJ7A 3N7ZA 4YU9A 3BXMA 3PB7X 4PSWA 3FX6A 4ZX8A 1M4DA 3W6SA 3H8GA 3IEHA 4AXVA 4F0XA 4OC5A 1Z8XA 3HLPA 4M8DA 4KOTA 3D7GA 2F8HA 2PJ3A 4C2YA 4F0YA 4YN3A 2KCWA 3QAYA 2ZEFA 4DNCA 1TKJA 3FYNA 4NCZA 1SQHA 3EO4A 4OIDA 1ZRSA 3SI0A 1ZG8A 4EVYA 4IF5A 3G23A 3D8PA 3TLGA 1NE9A 4C86A 3EZEA 2X0SA 4CYNA 4L8AA 4CDKA 1KC7A 2V8VA 1PCAA 4PSXA 5CPAA 1NSLA 3KGQA 4A2ZA 3G8WA 4U9ZA 2B0AA 5J1QA 2OR4A 3BUMB 3W91A 1CBXA 3CZXA 4C99A 3BI0A 4E2AA 4CDJA 4PK2A 3H8FA 4P4EA 2UV8G 4UEFA 4B12A 1XEBA 2PJ5A 4F9UA 5JH9A 1VIXA 4OC1A 3B35A 2PRQA 5H86A 4A39A 5A27A 4C7IA 3JTKA 1ARMA 1FY7A 2FS5A 3RNZA 1KUXA 4B5PB 1YW4A 3NOJA 3IIBA 3KHZA 4PV6A 3CDXA 1KWMA 4C9UA 3VROA 1XJOA 4HKFA 2Z3PA 4Q36A 3C26A 2G9DA 3UY5A 5HVGA 4FD6A 4ONWA 4ZBGA 1XMTA 1KUVA 3EIFA 2Z3KA 5D29A 2YNEA 4H6UA 3D4UA 3K4IA 1XRYA 3TLBA 4ZY2A 4MI4A 4M6GA 2PQ8A 1IOIA 4ZY0A 2PCUA 5JPHA 4K3NA 2IQ6A 2VQYA 3S6HA 4CAFA 3R95A 3V8IA 5LRKA 1BLLE 2DF5A 1YVOA 2CBLA 2HV2A 4M6HA 1F2PA 1QMUA 1V0CA 3S9LA 2FCKA 2G3TA 4EMEA 4PXCA 4UFVA 4XPDB 1R57A 2MP0A 4R87A 2ODFA 4U9YA 2REFA 4B11A 4H6ZA 3DR8A 4B13A 4IIXA 3IU2A 3S9MA 1GHEA 1S60A 2EZAA 2C27A 2HQYA 1F2OA 1I21A 2F7VA 1PYTB 3TFYA 1XE4A 1TIQA 2O4HA 2K5TA 2B4DB 3MN8A 5DWMA 5CNPA 3HMJG 1Z2LA 5E96A 3P2FA 4ZI6A 2C5QA 1GYTA 3S9NA 2IL4A 4CYQA 3PT1A 4EFDA 1Y7RA 2ZPAA 3JUWA 3S6GA 3KHXA 1HEEA 1Y0RA 4RS2A 2G0BA 2EK9A 2NSMA 3CPAA 5HMNA 2YJVA 5FD8A 1KBLA 4CRYB 4P44A 1VGYA 2B5GB 2FVGA 1N71A 4O23A 4OC2A 5KTAA 2DPSA 1FBVA 4KSIA 3DGVA 2Q4YA 2EZCA 2BO9A 3I3GA 4P4DA 2D0OA 4NFRA 3U1BA 2CY2A 3SXOA 3ISXA 4MFQA 2Q44A 4NJQA 2Z3NA 4CAXA 1LRZA 3D67A 3NFQA 1Z5RA 4OC4A 4R8FA 3TE4A 3TYXA 3NH4A 4E0AA 3FECA 1AUGA 2V8DA 2ZELA 1Y0YA 3NE8A 4QUSA 2ANPA 1ELLP 3LWUA 5J8CA 1DTDA 1YLOA
chains in the Genus database with same CATH topology
3RBUA 5LRJA 1H8LA 4OP4A 1TKFA 1RTQA 5LYIA 3CPXA 2DEAA 4DYOA 2Q51A 2AFXA 3ICUA 1FNOA 5LRGA 6CPAA 1DE4C 2PIYA 4R6TA 3D68A 1EE3P 2J9AA 4UEZA 3B3VA 4FUUA 2XEIA 1ZG9A 4NGPA 3NH8A 8CPAA 3B3TA 5LYDA 4GM5A 4C8PA 4MMOA 4ZX9A 3KASA 3IFEA 2ZEPA 2IMOA 1OBRA 4KNGE 3TC8A 2OOTA 3VH9A 3KL9A 4A38A 4TJXA 5THWA 5K8NA 1TF9A 4G1PA 3B3SA 4WWVA 5DS0A 2JBKA 2C6GA 2CF4A 2POKA 1XF1A 2CTBA 3IC1A 5IR2A 4BD9A 3H8EA 3D66A 1M4LA 2PVWA 1LOKA 5K8PA 4P45A 3D7HA 4C8UA 3B3WA 4X2TA 3KR5A 5LYLA 4PXDA 4A37A 4C9VA 4P4BA 1CPSA 3SI1A 3GUXA 2ZOGA 1ELMP 1QQ9A 1CP7A 3D7FA 3L2NA 3BI1A 4CPAA 1XMBA 1Y9ZA 4OKOA 7CPAA 1AYEA 4MCRA 1LAPA 3ISZA 4MCQA 3VATA 3MRUA 4JYWA 2BCOA 3FMCA 4IHMA 5HVHA 5HXDA 2PJ9A 4F9VA 2GP4A 3VTAA 2PVVA 2XEJA 1HDQA 4MHYA 1VHEA 4NGRA 3GLJA 4R76A 2AFWA 2V77A 1LFWA 2V8HA 3WC6A 1WVMA 1YW6A 1HDUA 2EK8A 2ZENA 3NH5A 2HC9A 3B3CA 3HUVA 3PEIA 3IO1A 3WT4A 2QVPA 2Q4ZA 2RB7A 3KR4A 4MCSA 2AFUA 4OMEA 1JQGA 3LMSA 4P10A 1TXRA 3B2YA 2AFMA 4OC3A 3CT9A 2PJ0A 3PFEA 3SJGA 2EWBA 3K9TA 1NSAA 4EWTA 1TF8A 2RFHA 4MHNA 5JGFA 2PJ2A 2C1CA 1ZG7A 4FBEA 5CBMA 3IJ3A 3DLJA 4MHPA 2HB6A 1V6CA 2GLFA 4UIAA 3NA6A 3NFZA 3WC7A 4JZ0A 3FVLA 3IWWA 3PRTA 4C8TA 1BAVA 3GB0A 3SJXA 3I74A 4UEEA 4FWUA 3BHXA 4RUHA 1LAMA 1Q7LA 4TJVA 3SJFA 2PJ6A 4R7MA 4OC0A 2GU2A 3QNVA 2JBJA 5HVFA 1CPXA 4C8CA 4Z65A 3I1UA 3FF3A 1F57A 3PB6X 3RAMA 1AMPA 5K8OA 2QYVA 4P4IA 4B6ZA 2AFZA 2ZEEA 3FEDA 1R43A 2V8GA 2AFOA 3K2KA 4MCPA 3PBBA 1XBUA 3JRUA 4PPZA 4PXEA 5K8MA 4Q7AA 3V38A 4YWYA 2GREA 2ZOFA 4NGQA 4UIBA 2ABZA 4DUKA 3RZAA 4X8IA 2AFSA 1IGBA 4PXBA 4WJBA 3KI9A 2PJBA 4NGMA 2ZEGA 2JEWA 5I4MA 5ELYA 4P6YA 2CTCA 4X3RA 3D7DA 2WZNA 3I6SA 2ZEMA 5F09A 2ZEHA 2ZEOA 4OIWA 4C9AA 4H2KA 3SJEA 3FH4A 1ZLHA 2VL1A 1ARLA 4C8FA 3KZWA 2PJCA 1UWYA 1CX8A 1Y7EA 3FEEA 5D8NA 2PJ4A 2C6CA 2GLJA 4W9YA 1LCPA 3N5FA 4FAIA 2CIJA 4ZYQA 2PJ8A 2I3CA 4UF4A 4NGNA 4A94A 4PQAA 2PJ1A 4C9RA 3KQXA 2PJAA 2XEGA 3PB9X 1IY7A 4TNUA 4MHZA 5JM6A 4MRIA 3PFOA 4C8AA 1VHOA 4NGTA 3V7ZA 3PB4X 2QJ8A 2PE3A 5LYFA 4F8ZA 3WABA 4C85A 2PIZA 4NJRA 3FJUA 4TWEA 1TKHA 4C84A 2NYQA 2C6PA 2BOAA 4LQGA 2WYRA 4IK2A 4ZY1A 3T8WA 3SI2A 1BPNA 1R3NA 1FT7A 4NGSA 5IB9A 2IJZA 4MXUA 1BPMA 4P4FA 4DJLA 3WC5A 3TX8A 1CP6A 1XFOA 2XEFA 3KQZA 2ZEDA 3PBEA 1YSJA 3B7IA 1ZLIA 2Q43A 3PB8X 4P4JA 1LANA 4C9EA 1Z8LA 2O53A 1CG2A 1YMEA 3VARA 4IAVA 2PJ7A 4YU9A 3BXMA 3PB7X 3FX6A 4ZX8A 4AXVA 3H8GA 3IEHA 4OC5A 3HLPA 3D7GA 2F8HA 2PJ3A 4YN3A 2ZEFA 1TKJA 4OIDA 3SI0A 1ZG8A 4C86A 4CDKA 2V8VA 1PCAA 5CPAA 3KGQA 5J1QA 2OR4A 1CBXA 4C99A 3BI0A 4CDJA 3H8FA 4P4EA 4UEFA 2PJ5A 4F9UA 5JH9A 1VIXA 4OC1A 3B35A 2PRQA 4A39A 1ARMA 1YW4A 3IIBA 3KHZA 3CDXA 1KWMA 4C9UA 1XJOA 2G9DA 5HVGA 4ONWA 3EIFA 5D29A 3D4UA 1XRYA 4ZY2A 4ZY0A 2PCUA 4K3NA 2IQ6A 5LRKA 1BLLE 1F2PA 1QMUA 4EMEA 3S9LA 4PXCA 3S9MA 1F2OA 2F7VA 1PYTB 2O4HA 3MN8A 1Z2LA 4ZI6A 2C5QA 1GYTA 3S9NA 4EFDA 3KHXA 1HEEA 1Y0RA 2NSMA 2EK9A 3CPAA 4P44A 1VGYA 2FVGA 4O23A 4OC2A 4KSIA 3DGVA 2BO9A 4P4DA 4NFRA 3ISXA 4NJQA 3D67A 1Z5RA 4R8FA 4OC4A 3NH4A 3FECA 2V8DA 2ZELA 1Y0YA 2ANPA 1ELLP 3LWUA 1DTDA 1YLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBU A;  5LRJ A;  1H8L A;  4OP4 A;  1TKF A;  1RTQ A;  5LYI A;  3CPX A;  2DEA A;  4DYO A;  2Q51 A;  2AFX A;  3ICU A;  1FNO A;  5LRG A;  6CPA A;  1DE4 C;  2PIY A;  4R6T A;  3D68 A;  1EE3 P;  2J9A A;  4UEZ A;  3B3V A;  4FUU A;  2XEI A;  1ZG9 A;  4NGP A;  3NH8 A;  8CPA A;  3B3T A;  5LYD A;  4GM5 A;  4C8P A;  4MMO A;  4ZX9 A;  3KAS A;  3IFE A;  2ZEP A;  2IMO A;  1OBR A;  4KNG E;  3TC8 A;  2OOT A;  3VH9 A;  3KL9 A;  4A38 A;  4TJX A;  5THW A;  5K8N A;  1TF9 A;  4G1P A;  3B3S A;  4WWV A;  5DS0 A;  2JBK A;  2C6G A;  2CF4 A;  2POK A;  1XF1 A;  2CTB A;  3IC1 A;  4BD9 A;  3H8E A;  3D66 A;  1M4L A;  2PVW A;  1LOK A;  5K8P A;  4P45 A;  3D7H A;  4C8U A;  3B3W A;  4X2T A;  3KR5 A;  5LYL A;  4PXD A;  4A37 A;  4C9V A;  4P4B A;  1CPS A;  3SI1 A;  3GUX A;  2ZOG A;  1ELM P;  1QQ9 A;  1CP7 A;  3D7F A;  3L2N A;  3BI1 A;  4CPA A;  1XMB A;  1Y9Z A;  4OKO A;  7CPA A;  1AYE A;  4MCR A;  1LAP A;  3ISZ A;  4MCQ A;  3VAT A;  3MRU A;  4JYW A;  2BCO A;  3FMC A;  4IHM A;  5HVH A;  5HXD A;  2PJ9 A;  4F9V A;  3VTA A;  2PVV A;  2XEJ A;  1HDQ A;  4MHY A;  1VHE A;  4NGR A;  3GLJ A;  4R76 A;  2AFW A;  2V77 A;  1LFW A;  2V8H A;  3WC6 A;  1WVM A;  1YW6 A;  1HDU A;  2EK8 A;  2ZEN A;  3NH5 A;  2HC9 A;  3B3C A;  3HUV A;  3PEI A;  3IO1 A;  3WT4 A;  2QVP A;  2Q4Z A;  2RB7 A;  3KR4 A;  4MCS A;  2AFU A;  4OME A;  1JQG A;  3LMS A;  4P10 A;  1TXR A;  3B2Y A;  2AFM A;  4OC3 A;  3CT9 A;  2PJ0 A;  3PFE A;  3SJG A;  2EWB A;  3K9T A;  1NSA A;  4EWT A;  1TF8 A;  2RFH A;  4MHN A;  5JGF A;  2PJ2 A;  2C1C A;  1ZG7 A;  4FBE A;  5CBM A;  3IJ3 A;  3DLJ A;  4MHP A;  2HB6 A;  1V6C A;  2GLF A;  4UIA A;  3NA6 A;  3NFZ A;  3WC7 A;  4JZ0 A;  3FVL A;  3IWW A;  3PRT A;  4C8T A;  1BAV A;  3GB0 A;  3SJX A;  3I74 A;  4UEE A;  4FWU A;  3BHX A;  4RUH A;  1LAM A;  1Q7L A;  4TJV A;  3SJF A;  2PJ6 A;  4R7M A;  4OC0 A;  2GU2 A;  3QNV A;  2JBJ A;  5HVF A;  1CPX A;  4C8C A;  4Z65 A;  3I1U A;  3FF3 A;  1F57 A;  3PB6 X;  3RAM A;  1AMP A;  5K8O A;  2QYV A;  4P4I A;  4B6Z A;  2AFZ A;  2ZEE A;  3FED A;  1R43 A;  2V8G A;  2AFO A;  3K2K A;  4MCP A;  3PBB A;  1XBU A;  3JRU A;  4PPZ A;  4PXE A;  5K8M A;  4Q7A A;  3V38 A;  4YWY A;  2GRE A;  2ZOF A;  4NGQ A;  4UIB A;  2ABZ A;  4DUK A;  3RZA A;  4X8I A;  2AFS A;  1IGB A;  4PXB A;  4WJB A;  3KI9 A;  2PJB A;  4NGM A;  2ZEG A;  2JEW A;  5I4M A;  5ELY A;  4P6Y A;  2CTC A;  4X3R A;  3D7D A;  2WZN A;  3I6S A;  2ZEM A;  5F09 A;  2ZEH A;  2ZEO A;  4OIW A;  4C9A A;  4H2K A;  3SJE A;  3FH4 A;  1ZLH A;  2VL1 A;  1ARL A;  4C8F A;  3KZW A;  2PJC A;  1UWY A;  1CX8 A;  1Y7E A;  3FEE A;  5D8N A;  2PJ4 A;  2C6C A;  2GLJ A;  4W9Y A;  1LCP A;  3N5F A;  4FAI A;  2CIJ A;  4ZYQ A;  2PJ8 A;  2I3C A;  4UF4 A;  4NGN A;  4A94 A;  4PQA A;  2PJ1 A;  4C9R A;  3KQX A;  2PJA A;  2XEG A;  3PB9 X;  1IY7 A;  4TNU A;  4MHZ A;  5JM6 A;  4MRI A;  3PFO A;  4C8A A;  1VHO A;  4NGT A;  3V7Z A;  3PB4 X;  2QJ8 A;  2PE3 A;  5LYF A;  4F8Z A;  3WAB A;  4C85 A;  2PIZ A;  4NJR A;  3FJU A;  4TWE A;  1TKH A;  4C84 A;  2NYQ A;  2C6P A;  2BOA A;  4LQG A;  2WYR A;  4IK2 A;  4ZY1 A;  3T8W A;  3SI2 A;  1BPN A;  1R3N A;  1FT7 A;  4NGS A;  5IB9 A;  2IJZ A;  4MXU A;  1BPM A;  4P4F A;  4DJL A;  3WC5 A;  3TX8 A;  1CP6 A;  1XFO A;  2XEF A;  3KQZ A;  2ZED A;  3PBE A;  1YSJ A;  3B7I A;  1ZLI A;  2Q43 A;  3PB8 X;  4P4J A;  1LAN A;  4C9E A;  1Z8L A;  2O53 A;  1CG2 A;  1YME A;  3VAR A;  4IAV A;  2PJ7 A;  4YU9 A;  3BXM A;  3PB7 X;  3FX6 A;  4ZX8 A;  4AXV A;  3H8G A;  3IEH A;  4OC5 A;  3HLP A;  3D7G A;  2F8H A;  2PJ3 A;  4YN3 A;  2ZEF A;  1TKJ A;  4OID A;  3SI0 A;  1ZG8 A;  4C86 A;  4CDK A;  2V8V A;  1PCA A;  5CPA A;  3KGQ A;  5J1Q A;  2OR4 A;  1CBX A;  4C99 A;  3BI0 A;  4CDJ A;  3H8F A;  4P4E A;  4UEF A;  2PJ5 A;  4F9U A;  5JH9 A;  1VIX A;  4OC1 A;  3B35 A;  2PRQ A;  4A39 A;  1ARM A;  1YW4 A;  3IIB A;  3KHZ A;  3CDX A;  1KWM A;  4C9U A;  1XJO A;  2G9D A;  5HVG A;  4ONW A;  3EIF A;  5D29 A;  3D4U A;  1XRY A;  4ZY2 A;  4ZY0 A;  2PCU A;  4K3N A;  2IQ6 A;  5LRK A;  1BLL E;  1F2P A;  1QMU A;  4EME A;  3S9L A;  4PXC A;  3S9M A;  1F2O A;  2F7V A;  1PYT B;  2O4H A;  3MN8 A;  1Z2L A;  4ZI6 A;  1GYT A;  3S9N A;  4EFD A;  3KHX A;  1HEE A;  1Y0R A;  2NSM A;  2EK9 A;  3CPA A;  4P44 A;  1VGY A;  2FVG A;  4O23 A;  4OC2 A;  4KSI A;  3DGV A;  2BO9 A;  4P4D A;  4NFR A;  3ISX A;  4NJQ A;  3D67 A;  1Z5R A;  4R8F A;  4OC4 A;  3NH4 A;  3FEC A;  2V8D A;  2ZEL A;  1Y0Y A;  2ANP A;  1ELL P;  3LWU A;  1DTD A;  1YLO A; 
#chains in the Genus database with same CATH topology
 2P6E A;  3RBU A;  2PR8 A;  3K9U A;  3GYA A;  2CXA A;  3GIU A;  5LRJ A;  2XPN A;  1H8L A;  2FT0 A;  4OP4 A;  5G21 A;  1VBH A;  2J8R A;  3NE7 A;  1IB1 E;  2VXK A;  5F1Y A;  2B4B A;  3R1K A;  1TKF A;  1RTQ A;  1I12 A;  1S5K A;  4OAD A;  1X10 A;  4UFX A;  3CPX A;  5LYI A;  3VRQ A;  5G1Z A;  2DEA A;  5KTC A;  1I1D A;  2I00 A;  4CRZ B;  1CM0 A;  1PUA A;  4A95 A;  4BPW B;  3KKW A;  4DYO A;  2Q51 A;  3OWC A;  2BUE A;  2AFX A;  2ATR A;  4KLV A;  4XNH B;  3CXP A;  2BL1 A;  4MY3 A;  4ONU A;  3ICU A;  3T07 A;  1FNO A;  5LRG A;  3QB8 A;  6CPA A;  1DE4 C;  4KVO E;  2PIY A;  4R6T A;  3EZB A;  5HKY A;  1EE3 P;  2J9A A;  3D68 A;  4UEZ A;  4XPD C;  3B3V A;  4FUU A;  3DDD A;  1CE8 B;  1YR0 A;  2XEI A;  3TOA A;  1CJW A;  1ZG9 A;  1YK3 A;  4KOS A;  3R9G A;  4NGP A;  3QAH A;  2EZB A;  4MFK A;  4OAE A;  2OH1 A;  2FE7 A;  1EZB A;  1Q2Y A;  3NH8 A;  4JJX A;  1U6M A;  8CPA A;  4CAE A;  2WPW A;  3B3T A;  5JQ4 A;  1J4J A;  5LYD A;  2DIK A;  4GM5 A;  4C8P A;  3VRR A;  4MMO A;  4RN7 A;  1VBG A;  1YQE A;  4ZX9 A;  3KAS A;  4A32 A;  3IFE A;  1NBW A;  1IOF A;  3IU1 A;  3TT2 A;  1XF8 A;  3D2M A;  2ZEP A;  1ZL0 A;  2IMO A;  2O28 A;  2NMT A;  4KZT A;  1NMT A;  3SHP A;  3FNC A;  4NEX A;  3TO9 A;  2REE A;  4IIY A;  1OBR A;  4EYS A;  3RYO A;  4J0N A;  2QIR A;  4KNG E;  2P6F A;  3TC8 A;  2OOT A;  3VH9 A;  3KL9 A;  4A38 A;  2BEI A;  4IUS A;  3PFV A;  5THW A;  4NSQ A;  2YNC A;  1MK4 A;  2AE6 A;  4A30 A;  5K8N A;  2XPL A;  4KOU A;  1QSN A;  1TF9 A;  4G1P A;  3B3S A;  4WWV A;  4CGL A;  5DS0 A;  5GCN A;  2JBK A;  2C6G A;  2CF4 A;  1VI4 A;  2JDC A;  3P2H A;  1IYK A;  2POK A;  2QML A;  3TOB A;  1XF1 A;  3R9F A;  1M44 A;  2CTB A;  3IC1 A;  3IGR A;  1UFH A;  4JWP A;  1KZF A;  1S7K A;  2GE3 A;  4JD6 A;  3S6K A;  5IR2 A;  2CNM A;  2OLS A;  2GAN A;  2JEV A;  1Q2C A;  4BD9 A;  1Q2D A;  3H8E A;  3D66 A;  1M4L A;  5AXI A;  2PVW A;  1LOK A;  4RR2 B;  5K8P A;  4P45 A;  3D7H A;  5F48 A;  4C8U A;  2DLA A;  2R8V A;  3OP0 A;  3B3W A;  4X2T A;  3KR5 A;  5LYL A;  4PXD A;  4A37 A;  4C9V A;  5F49 A;  4P4B A;  2J8M A;  1CPS A;  4XNH C;  3SI1 A;  3GUX A;  4C68 A;  2Y1M A;  2ZOG A;  1ELM P;  1QQ9 A;  4TJV A;  2Q7B A;  1CP7 A;  4BTF A;  3DNS A;  1Z9U A;  3D7F A;  3L2N A;  1S7N A;  3FBU A;  5EC4 A;  3D3S A;  3BI1 A;  2D0P A;  4CPA A;  4QC6 A;  1M4I A;  3PZJ A;  1XMB A;  3VWE A;  4BMH A;  1C30 B;  1Y9Z A;  4OKO A;  4MY0 A;  7CPA A;  2OZG A;  2R1I A;  1AYE A;  4MCR A;  1LAP A;  3ISZ A;  4MCQ A;  4KUB A;  1OZP A;  1YX0 A;  4JYW A;  5HKZ A;  1BO4 A;  3MRU A;  2BCO A;  3FMC A;  4MHD A;  3TLA A;  4IHM A;  3EC4 A;  2VZZ A;  2QEC A;  1Y9W A;  5HVH A;  5HXD A;  2PJ9 A;  3BJ7 A;  4F9V A;  2BSW A;  2GP4 A;  3D2P A;  4X5K A;  3VTA A;  4Y49 B;  2PVV A;  4A31 A;  2XEJ A;  1HDQ A;  2D4O A;  1VHE A;  4MHY A;  4NGR A;  3FIX A;  2EBJ A;  2R82 A;  3GLJ A;  4R76 A;  3PLF B;  2AFW A;  2V77 A;  3H4Q A;  1LFW A;  4UCM A;  3OB2 B;  4C2Z A;  5AG4 A;  1JDB C;  2V8H A;  3WC6 A;  1WVM A;  3T90 A;  2AUN A;  4UWI A;  1YW6 A;  2DPT A;  5G20 A;  1VKC A;  1HDU A;  3F5B A;  4R3L A;  2EK8 A;  4HNY B;  1IIC A;  2ZEN A;  2HC9 A;  3ZNI A;  3NH5 A;  4FD5 A;  4GPL B;  3B3C A;  3HUV A;  3PEI A;  3IO1 A;  4KVM E;  3WT4 A;  1M1D A;  2QVP A;  2R7H A;  4KSF A;  2Q4Z A;  5G22 A;  5IV0 A;  2RB7 A;  1QSM A;  2AJ6 A;  3KR4 A;  4MCS A;  4J3G A;  4KOY A;  4NF1 A;  1WK4 A;  2AFU A;  4UWJ A;  3ZJ0 A;  1RXT A;  3JVN A;  4OME A;  1MJB A;  4A33 A;  3BLN A;  1JQG A;  3LMS A;  3TO7 A;  4YGO A;  4CGN A;  4P10 A;  1TXR A;  4JXR A;  1EO0 A;  2B5G A;  3B2Y A;  2AFM A;  4OC3 A;  3BUW B;  3CT9 A;  2PJ0 A;  3PFE A;  3SJG A;  5AG5 A;  4A4C A;  1B6B A;  2EWB A;  2OU2 A;  2HUZ A;  1C3O B;  3K9T A;  4HNX B;  1JWQ A;  1NSA A;  4FD4 A;  4EWT A;  1TF8 A;  2I79 A;  2RFH A;  4KOR A;  4MHN A;  5ISV A;  5J8F A;  2Z11 A;  4K30 A;  4LQ6 A;  5JGF A;  3LAC A;  3TLY A;  4JLY A;  4KOW A;  2PJ2 A;  2VI7 A;  5H84 A;  3TTH A;  2C1C A;  1ZG7 A;  4FBE A;  5CBM A;  3IJ3 A;  3DLJ A;  4MHP A;  1S3Z A;  2HB6 A;  4E5S A;  1V6C A;  3TLC A;  4CAW A;  1R61 A;  2GLF A;  4UIA A;  2ZW4 A;  3NA6 A;  3G3S A;  3NFZ A;  3WC7 A;  4QB9 A;  3HPH E;  4JZ0 A;  5JYB A;  2Q4V A;  4MFL A;  2R98 A;  1RO5 A;  3FVL A;  4JXQ A;  4MFJ A;  4Q38 A;  3IWG A;  3VAT A;  4M6I A;  3PP9 A;  3IWW A;  3PRT A;  1KEE B;  1BAV A;  2PDO A;  3GB0 A;  4KS9 A;  4C8T A;  3SJX A;  2A4N A;  2PR1 A;  4BBH A;  3I74 A;  4CO9 A;  5J3X A;  4UEE A;  3T05 A;  4L89 A;  4FWU A;  3BHX A;  1Q5X A;  4BPU B;  1PU9 A;  1ZO0 A;  3MGD A;  5EMI A;  5IB0 A;  4Y49 C;  1NXJ A;  4ORF A;  1LAM A;  1Q7L A;  4RI1 A;  3SJF A;  3BUO B;  3WR7 A;  2PJ6 A;  4R7M A;  4RUH A;  5IX3 A;  4OC0 A;  1S7L A;  1JDE A;  2GU2 A;  3BUX B;  4QBJ A;  3QNV A;  4KOV A;  3TLG B;  2JBJ A;  3BUN B;  1WWZ A;  5HVF A;  1CPX A;  1BOB A;  2J8N A;  4C8C A;  4R3K A;  2VBQ A;  4Z65 A;  4CS0 B;  2Q04 A;  4FD7 A;  3I1U A;  2CNS A;  1M4G A;  3EFA A;  4CGM A;  4XPK A;  2G3A A;  3FB3 A;  1BXR B;  3FF3 A;  1F57 A;  4KUA A;  3PB6 X;  4CYP A;  4BIN A;  3RAM A;  1AMP A;  2FSR A;  5K8O A;  2QYV A;  4A4B A;  4P4I A;  3LD2 A;  1P0H A;  4KOX A;  4B6Z A;  4CGP A;  4COB A;  2AFZ A;  2ZEE A;  4TJX A;  3FED A;  3VRN A;  1R43 A;  2JDD A;  2AFO A;  2Q7S A;  2XPO A;  3O8Z A;  5F13 A;  2V8G A;  3K2K A;  1YGH A;  4E8O A;  4MCP A;  4JVO A;  4CZ1 A;  4M85 A;  1YLE A;  3PBB A;  1XBU A;  3JRU A;  4PPZ A;  4PXE A;  5K8M A;  4Q7A A;  4B10 A;  3V38 A;  5F5X A;  4YWY A;  3BJ8 A;  4H1H A;  2GRE A;  3SR3 A;  2ZOF A;  1CS0 B;  4NGQ A;  1DIK A;  5C82 A;  2P0W A;  3W6X A;  4E94 A;  2FIW A;  4UIB A;  4AG9 A;  4UCN A;  2ABZ A;  3VRP A;  4DUK A;  2GIV A;  2Z3L A;  1YVK A;  5F46 A;  3T5M A;  1IID A;  3IWE A;  4X8I A;  3RZA A;  2AFS A;  1Z8T A;  5F9M A;  1IGB A;  4PXB A;  4UBR A;  4WJB A;  3TO6 A;  3KI9 A;  4M3S A;  2FL4 A;  4AVA A;  4MJX A;  2Q0Y A;  4R9M A;  3C8O A;  3EZA A;  4CYO A;  2PJB A;  3OB1 B;  2VEZ A;  2H5M A;  4NGM A;  2ZEG A;  2JEW A;  4B5P A;  5ELY A;  5I4M A;  4P6Y A;  2PC1 A;  4AG7 A;  2PRB A;  3R96 A;  2CTC A;  4X3R A;  3D7D A;  2WZN A;  3I6S A;  2YJT A;  1XOV A;  4UFW A;  2ZEM A;  4F6A A;  1Z9E A;  4UA3 A;  1K4J A;  1MJA A;  1MJ9 A;  2E28 A;  2EO8 A;  1J3L A;  3FXT A;  4KSA A;  4MBU A;  2X7B A;  4QVT A;  1ZYM A;  3TLE A;  1WJT A;  5F09 A;  2ZEH A;  2ZEO A;  2ZW7 A;  2Y1N A;  2VKZ G;  4OIW A;  1GGO A;  4C9A A;  4H2K A;  4AB7 A;  1B87 A;  3T0T A;  3T9Y A;  3SJE A;  2ZW5 A;  3FH4 A;  1XIX A;  1ZLH A;  2VL1 A;  4ZGY B;  5BWA B;  1L0C A;  2CNT A;  2HRO A;  2YND A;  1ARL A;  1X12 A;  4C8F A;  1IYL A;  2ZW6 A;  4C2X A;  1QSR A;  5KTD A;  3S6F A;  3KRV A;  1Z4E A;  2EUI A;  3KZW A;  4HPS A;  5HKW A;  2PJC A;  1UWY A;  1CX8 A;  2YNC C;  2OZH A;  4U5Y A;  5DWN A;  4LUA A;  1Y7E A;  5F47 A;  2DXQ A;  3FEE A;  5D8N A;  4LX9 A;  4BPX B;  2PJ4 A;  5C88 A;  2AUM A;  2C6C A;  4UCP A;  2GLJ A;  4W9Y A;  2Z3M A;  3I9S A;  1LCP A;  1B47 A;  1M6V B;  3N5F A;  2B4D A;  2P6G A;  1VHS A;  4KVX A;  4FAI A;  5JVL A;  4YRH A;  4MI1 A;  4MFZ A;  1YVH A;  2CIJ A;  4C7H A;  4ZYQ A;  2PJ8 A;  2I3C A;  3VGO A;  2WPX A;  4HNW B;  4UF4 A;  4NGN A;  4A94 A;  4PQA A;  1Y9K A;  3F0A A;  2PJ1 A;  4C9R A;  3KQX A;  4II9 A;  4MJ8 A;  2PJA A;  2F5I A;  3TCV A;  2B58 A;  2XEG A;  3R9E A;  3PB9 X;  1S7F A;  1IY7 A;  4R57 A;  4MHZ A;  4TNU A;  2RC4 A;  2Y0M A;  2VZY A;  3SXN A;  5JM6 A;  2B4J C;  3DR6 A;  3PFO A;  4MRI A;  4OLL A;  5I0C A;  4B5O A;  4C8A A;  2YGW A;  4B14 A;  1VHO A;  4H89 A;  5FVJ A;  3F9K C;  2JLM A;  3LOD A;  4MFP A;  4NGT A;  3V7Z A;  3PB4 X;  2QJ8 A;  2PE3 A;  3GY9 A;  1YRE A;  3F8K A;  4AVB A;  5AG6 A;  1T36 B;  2GFQ A;  3FRM A;  5LYF A;  4F8Z A;  5AGE A;  3H5Z A;  3HPG G;  2ARH A;  2OB0 A;  5AG7 A;  3WAB A;  2OZU A;  2PIZ A;  4C85 A;  4NJR A;  5A28 A;  3RO0 A;  3DSB A;  3FJU A;  2HI6 A;  2PCN A;  4TWE A;  5HH1 A;  1TKH A;  2WUU A;  4C84 A;  2NYQ A;  2Z0Z A;  4GXH A;  2C6P A;  2BOA A;  4LQG A;  2FXF A;  2WYR A;  4IK2 A;  2HWG A;  2EVN A;  4ZY1 A;  2FM4 A;  3T8W A;  2XPP A;  3SI2 A;  4INJ A;  4COG A;  1BPN A;  3B8G A;  3CXQ A;  3EY5 A;  3EXN A;  1R3N A;  3PGP A;  1EZA A;  3E0K A;  1FT7 A;  4NGS A;  2Z3O A;  4CAV A;  5K99 A;  2FIA A;  5IB9 A;  2IJZ A;  4MXU A;  1BPM A;  4P4F A;  4DJL A;  3GKR A;  1A9X B;  3WC5 A;  2B3V A;  4GS4 A;  3TX8 A;  1CP6 A;  5EBV A;  2PSW A;  3GJZ A;  1QSO A;  1XFO A;  2N3A B;  2XEF A;  3KQZ A;  1P4N A;  2ZED A;  4PK3 A;  4AVC A;  3OAK A;  4I49 A;  3PBE A;  1YSJ A;  3CXS A;  2Z10 A;  1QST A;  4KLW A;  3ZZI A;  2D4P A;  3B7I A;  1ZLI A;  1KUY A;  1IU8 A;  2Q43 A;  3PB8 X;  4YFJ A;  4NXY A;  3TLZ A;  4P4J A;  1LAN A;  1Z8W A;  4C9E A;  5BY0 A;  1Z8L A;  2O53 A;  1CG2 A;  1ON0 A;  1YME A;  2B3U A;  3A9L A;  1A2Z A;  3VAR A;  2ZXV A;  3U88 C;  2WSA A;  4CGO A;  1Z4R A;  4XPL A;  4IAV A;  3VWD A;  2PJ7 A;  3N7Z A;  4YU9 A;  3BXM A;  3PB7 X;  4PSW A;  3FX6 A;  4ZX8 A;  1M4D A;  3W6S A;  3H8G A;  3IEH A;  4AXV A;  4F0X A;  4OC5 A;  1Z8X A;  3HLP A;  4M8D A;  4KOT A;  3D7G A;  2F8H A;  2PJ3 A;  4C2Y A;  4F0Y A;  4YN3 A;  2KCW A;  3QAY A;  2ZEF A;  4DNC A;  1TKJ A;  3FYN A;  4NCZ A;  1SQH A;  3EO4 A;  4OID A;  1ZRS A;  3SI0 A;  1ZG8 A;  4EVY A;  4IF5 A;  3G23 A;  3D8P A;  3TLG A;  1NE9 A;  4C86 A;  3EZE A;  2X0S A;  4CYN A;  4L8A A;  4CDK A;  1KC7 A;  2V8V A;  1PCA A;  4PSX A;  5CPA A;  1NSL A;  3KGQ A;  4A2Z A;  3G8W A;  4U9Z A;  2B0A A;  5J1Q A;  2OR4 A;  3BUM B;  3W91 A;  1CBX A;  3CZX A;  4C99 A;  3BI0 A;  4E2A A;  4CDJ A;  4PK2 A;  3H8F A;  4P4E A;  2UV8 G;  4UEF A;  4B12 A;  1XEB A;  2PJ5 A;  4F9U A;  5JH9 A;  1VIX A;  4OC1 A;  3B35 A;  2PRQ A;  5H86 A;  4A39 A;  5A27 A;  4C7I A;  3JTK A;  1ARM A;  1FY7 A;  2FS5 A;  3RNZ A;  1KUX A;  4B5P B;  1YW4 A;  3NOJ A;  3IIB A;  3KHZ A;  4PV6 A;  3CDX A;  1KWM A;  4C9U A;  3VRO A;  1XJO A;  4HKF A;  2Z3P A;  4Q36 A;  3C26 A;  2G9D A;  3UY5 A;  5HVG A;  4FD6 A;  4ONW A;  4ZBG A;  1XMT A;  1KUV A;  3EIF A;  2Z3K A;  5D29 A;  2YNE A;  4H6U A;  3D4U A;  3K4I A;  1XRY A;  3TLB A;  4ZY2 A;  4MI4 A;  4M6G A;  2PQ8 A;  1IOI A;  4ZY0 A;  2PCU A;  5JPH A;  4K3N A;  2IQ6 A;  2VQY A;  3S6H A;  4CAF A;  3R95 A;  3V8I A;  5LRK A;  1BLL E;  2DF5 A;  1YVO A;  2CBL A;  2HV2 A;  4M6H A;  1F2P A;  1QMU A;  1V0C A;  3S9L A;  2FCK A;  2G3T A;  4EME A;  4PXC A;  4UFV A;  4XPD B;  1R57 A;  2MP0 A;  4R87 A;  2ODF A;  4U9Y A;  2REF A;  4B11 A;  4H6Z A;  3DR8 A;  4B13 A;  4IIX A;  3IU2 A;  3S9M A;  1GHE A;  1S60 A;  2EZA A;  2C27 A;  2HQY A;  1F2O A;  1I21 A;  2F7V A;  1PYT B;  3TFY A;  1XE4 A;  1TIQ A;  2O4H A;  2K5T A;  2B4D B;  3MN8 A;  5DWM A;  5CNP A;  3HMJ G;  1Z2L A;  5E96 A;  3P2F A;  4ZI6 A;  2C5Q A;  1GYT A;  3S9N A;  2IL4 A;  4CYQ A;  3PT1 A;  4EFD A;  1Y7R A;  2ZPA A;  3JUW A;  3S6G A;  3KHX A;  1HEE A;  1Y0R A;  4RS2 A;  2G0B A;  2EK9 A;  2NSM A;  3CPA A;  5HMN A;  2YJV A;  5FD8 A;  1KBL A;  4CRY B;  4P44 A;  1VGY A;  2B5G B;  2FVG A;  1N71 A;  4O23 A;  4OC2 A;  5KTA A;  2DPS A;  1FBV A;  4KSI A;  3DGV A;  2Q4Y A;  2EZC A;  2BO9 A;  3I3G A;  4P4D A;  2D0O A;  4NFR A;  3U1B A;  2CY2 A;  3SXO A;  3ISX A;  4MFQ A;  2Q44 A;  4NJQ A;  2Z3N A;  4CAX A;  1LRZ A;  3D67 A;  3NFQ A;  1Z5R A;  4OC4 A;  4R8F A;  3TE4 A;  3TYX A;  3NH4 A;  4E0A A;  3FEC A;  1AUG A;  2V8D A;  2ZEL A;  1Y0Y A;  3NE8 A;  4QUS A;  2ANP A;  1ELL P;  3LWU A;  5J8C A;  1DTD A;  1YLO A; 
#chains in the Genus database with same CATH homology
 3RBU A;  5LRJ A;  1H8L A;  4OP4 A;  1TKF A;  1RTQ A;  5LYI A;  3CPX A;  2DEA A;  4DYO A;  2Q51 A;  2AFX A;  3ICU A;  1FNO A;  5LRG A;  6CPA A;  1DE4 C;  2PIY A;  4R6T A;  3D68 A;  1EE3 P;  2J9A A;  4UEZ A;  3B3V A;  4FUU A;  2XEI A;  1ZG9 A;  4NGP A;  3NH8 A;  8CPA A;  3B3T A;  5LYD A;  4GM5 A;  4C8P A;  4MMO A;  4ZX9 A;  3KAS A;  3IFE A;  2ZEP A;  2IMO A;  1OBR A;  4KNG E;  3TC8 A;  2OOT A;  3VH9 A;  3KL9 A;  4A38 A;  4TJX A;  5THW A;  5K8N A;  1TF9 A;  4G1P A;  3B3S A;  4WWV A;  5DS0 A;  2JBK A;  2C6G A;  2CF4 A;  2POK A;  1XF1 A;  2CTB A;  3IC1 A;  5IR2 A;  4BD9 A;  3H8E A;  3D66 A;  1M4L A;  2PVW A;  1LOK A;  5K8P A;  4P45 A;  3D7H A;  4C8U A;  3B3W A;  4X2T A;  3KR5 A;  5LYL A;  4PXD A;  4A37 A;  4C9V A;  4P4B A;  1CPS A;  3SI1 A;  3GUX A;  2ZOG A;  1ELM P;  1QQ9 A;  1CP7 A;  3D7F A;  3L2N A;  3BI1 A;  4CPA A;  1XMB A;  1Y9Z A;  4OKO A;  7CPA A;  1AYE A;  4MCR A;  1LAP A;  3ISZ A;  4MCQ A;  3VAT A;  3MRU A;  4JYW A;  2BCO A;  3FMC A;  4IHM A;  5HVH A;  5HXD A;  2PJ9 A;  4F9V A;  2GP4 A;  3VTA A;  2PVV A;  2XEJ A;  1HDQ A;  4MHY A;  1VHE A;  4NGR A;  3GLJ A;  4R76 A;  2AFW A;  2V77 A;  1LFW A;  2V8H A;  3WC6 A;  1WVM A;  1YW6 A;  1HDU A;  2EK8 A;  2ZEN A;  3NH5 A;  2HC9 A;  3B3C A;  3HUV A;  3PEI A;  3IO1 A;  3WT4 A;  2QVP A;  2Q4Z A;  2RB7 A;  3KR4 A;  4MCS A;  2AFU A;  4OME A;  1JQG A;  3LMS A;  4P10 A;  1TXR A;  3B2Y A;  2AFM A;  4OC3 A;  3CT9 A;  2PJ0 A;  3PFE A;  3SJG A;  2EWB A;  3K9T A;  1NSA A;  4EWT A;  1TF8 A;  2RFH A;  4MHN A;  5JGF A;  2PJ2 A;  2C1C A;  1ZG7 A;  4FBE A;  5CBM A;  3IJ3 A;  3DLJ A;  4MHP A;  2HB6 A;  1V6C A;  2GLF A;  4UIA A;  3NA6 A;  3NFZ A;  3WC7 A;  4JZ0 A;  3FVL A;  3IWW A;  3PRT A;  4C8T A;  1BAV A;  3GB0 A;  3SJX A;  3I74 A;  4UEE A;  4FWU A;  3BHX A;  4RUH A;  1LAM A;  1Q7L A;  4TJV A;  3SJF A;  2PJ6 A;  4R7M A;  4OC0 A;  2GU2 A;  3QNV A;  2JBJ A;  5HVF A;  1CPX A;  4C8C A;  4Z65 A;  3I1U A;  3FF3 A;  1F57 A;  3PB6 X;  3RAM A;  1AMP A;  5K8O A;  2QYV A;  4P4I A;  4B6Z A;  2AFZ A;  2ZEE A;  3FED A;  1R43 A;  2V8G A;  2AFO A;  3K2K A;  4MCP A;  3PBB A;  1XBU A;  3JRU A;  4PPZ A;  4PXE A;  5K8M A;  4Q7A A;  3V38 A;  4YWY A;  2GRE A;  2ZOF A;  4NGQ A;  4UIB A;  2ABZ A;  4DUK A;  3RZA A;  4X8I A;  2AFS A;  1IGB A;  4PXB A;  4WJB A;  3KI9 A;  2PJB A;  4NGM A;  2ZEG A;  2JEW A;  5I4M A;  5ELY A;  4P6Y A;  2CTC A;  4X3R A;  3D7D A;  2WZN A;  3I6S A;  2ZEM A;  5F09 A;  2ZEH A;  2ZEO A;  4OIW A;  4C9A A;  4H2K A;  3SJE A;  3FH4 A;  1ZLH A;  2VL1 A;  1ARL A;  4C8F A;  3KZW A;  2PJC A;  1UWY A;  1CX8 A;  1Y7E A;  3FEE A;  5D8N A;  2PJ4 A;  2C6C A;  2GLJ A;  4W9Y A;  1LCP A;  3N5F A;  4FAI A;  2CIJ A;  4ZYQ A;  2PJ8 A;  2I3C A;  4UF4 A;  4NGN A;  4A94 A;  4PQA A;  2PJ1 A;  4C9R A;  3KQX A;  2PJA A;  2XEG A;  3PB9 X;  1IY7 A;  4TNU A;  4MHZ A;  5JM6 A;  4MRI A;  3PFO A;  4C8A A;  1VHO A;  4NGT A;  3V7Z A;  3PB4 X;  2QJ8 A;  2PE3 A;  5LYF A;  4F8Z A;  3WAB A;  4C85 A;  2PIZ A;  4NJR A;  3FJU A;  4TWE A;  1TKH A;  4C84 A;  2NYQ A;  2C6P A;  2BOA A;  4LQG A;  2WYR A;  4IK2 A;  4ZY1 A;  3T8W A;  3SI2 A;  1BPN A;  1R3N A;  1FT7 A;  4NGS A;  5IB9 A;  2IJZ A;  4MXU A;  1BPM A;  4P4F A;  4DJL A;  3WC5 A;  3TX8 A;  1CP6 A;  1XFO A;  2XEF A;  3KQZ A;  2ZED A;  3PBE A;  1YSJ A;  3B7I A;  1ZLI A;  2Q43 A;  3PB8 X;  4P4J A;  1LAN A;  4C9E A;  1Z8L A;  2O53 A;  1CG2 A;  1YME A;  3VAR A;  4IAV A;  2PJ7 A;  4YU9 A;  3BXM A;  3PB7 X;  3FX6 A;  4ZX8 A;  4AXV A;  3H8G A;  3IEH A;  4OC5 A;  3HLP A;  3D7G A;  2F8H A;  2PJ3 A;  4YN3 A;  2ZEF A;  1TKJ A;  4OID A;  3SI0 A;  1ZG8 A;  4C86 A;  4CDK A;  2V8V A;  1PCA A;  5CPA A;  3KGQ A;  5J1Q A;  2OR4 A;  1CBX A;  4C99 A;  3BI0 A;  4CDJ A;  3H8F A;  4P4E A;  4UEF A;  2PJ5 A;  4F9U A;  5JH9 A;  1VIX A;  4OC1 A;  3B35 A;  2PRQ A;  4A39 A;  1ARM A;  1YW4 A;  3IIB A;  3KHZ A;  3CDX A;  1KWM A;  4C9U A;  1XJO A;  2G9D A;  5HVG A;  4ONW A;  3EIF A;  5D29 A;  3D4U A;  1XRY A;  4ZY2 A;  4ZY0 A;  2PCU A;  4K3N A;  2IQ6 A;  5LRK A;  1BLL E;  1F2P A;  1QMU A;  4EME A;  3S9L A;  4PXC A;  3S9M A;  1F2O A;  2F7V A;  1PYT B;  2O4H A;  3MN8 A;  1Z2L A;  4ZI6 A;  2C5Q A;  1GYT A;  3S9N A;  4EFD A;  3KHX A;  1HEE A;  1Y0R A;  2NSM A;  2EK9 A;  3CPA A;  4P44 A;  1VGY A;  2FVG A;  4O23 A;  4OC2 A;  4KSI A;  3DGV A;  2BO9 A;  4P4D A;  4NFR A;  3ISX A;  4NJQ A;  3D67 A;  1Z5R A;  4R8F A;  4OC4 A;  3NH4 A;  3FEC A;  2V8D A;  2ZEL A;  1Y0Y A;  2ANP A;  1ELL P;  3LWU A;  1DTD A;  1YLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...