4OC4A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with cpibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxy-2-(pyridin-4-yl)ethyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
690
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYNVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
total genus 265
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc4A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc4A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc4A02
3FEEA 4X2TA 3WT4A 2ZEPA 4CDKA 4B6ZA 2O53A 2GU2A 1KWMA 1ELLP 3H8GA 1ZLIA 2PJ4A 4PXBA 4C9RA 3NH8A 4F9UA 2PVWA 3SI1A 3T8WA 3NH5A 2CTCA 1Z5RA 2ABZA 2AFSA 1LAPA 3GUXA 2RB7A 3NA6A 2JBJA 1R43A 3KGQA 2PJ1A 1CP6A 3B3WA 2ZEFA 3DLJA 2G9DA 3SJXA 1Y7EA 2AFXA 1FT7A 2WYRA 3FH4A 3FF3A 2C6PA 3PRTA 4JZ0A 3B3TA 3KR4A 4H2KA 2HC9A 3IFEA 2ZENA 4ONWA 3HLPA 4ZX9A 2ZELA 3BXMA 2HB6A 1ZG8A 3BHXA 3RAMA 4NGSA 2PIZA 5D8NA 2GLJA 4P45A 4F8ZA 4C9UA 4FAIA 1BLLE 1TKFA 2GLFA 2I3CA 5THWA 4R7MA 3IIBA 4PXEA 3D7FA 4OC4A 3I6SA 1FNOA 2PJAA 1YW4A 4MHYA 4UF4A 3EIFA 2ZEDA 3D66A 2PRQA 1YLOA 3K9TA 4P4DA 5LRGA 2NYQA 4PPZA 1ARLA 3MRUA 2XEJA 4NGPA 2DEAA 4ZX8A 2F8HA 4A39A 1OBRA 3VATA 3KHZA 2EK9A 3B35A 4C9VA 1BPMA 4TWEA 3PB9X 3I1UA 1Z8LA 4C9EA 3DGVA 4P4IA 4PXCA 4C99A 4MHZA 1XF1A 4R76A 1H8LA 4DYOA 3CPXA 3IWWA 2IMOA 2XEIA 3N5FA 2C6GA 2NSMA 3VH9A 3PBEA 3TX8A 3QNVA 1ZG7A 5I4MA 5JH9A 1VHEA 3PB8X 1CPXA 3KZWA 4R6TA 2BO9A 4OMEA 1TKHA 1XFOA 3D67A 1GYTA 3NFZA 3SJFA 4P4BA 2QJ8A 1F57A 2PJ5A 5DS0A 1V6CA 4P4EA 2OR4A 1R3NA 1DE4C 2AFZA 3I74A 3KHXA 3WC5A 2Q43A 1Y0RA 1LOKA 4MCSA 3B2YA 3PB6X 3NH4A 2PJ7A 3H8FA 4C8CA 3CDXA 5JGFA 4WWVA 3H8EA 1AMPA 1TKJA 4PXDA 4FBEA 1XRYA 1HDQA 2ZEHA 1HDUA 1F2PA 3PBBA 3VARA 3SI2A 3V7ZA 4NFRA 4F9VA 5D29A 5HVGA 3PB4X 4ZY2A 5LYLA 4C86A 4NJQA 1YMEA 2AFMA 2V77A 4OC0A 1CBXA 2POKA 4P4JA 2OOTA 2AFOA 3S9LA 5ELYA 3KI9A 3D4UA 4OIDA 3ISXA 3V38A 4RUHA 3FVLA 4KNGE 1IY7A 2PJ2A 2C6CA 1Y9ZA 4OC2A 3KL9A 4CDJA 2J9AA 3JRUA 4TJVA 4C8AA 3B3CA 4NGNA 1Z2LA 1VHOA 5HXDA 3FECA 4OP4A 4YN3A 4Q7AA 2BOAA 3GLJA 3RBUA 2QVPA 4TNUA 4X3RA 2PJ3A 3ISZA 1M4LA 3IJ3A 1QQ9A 4OIWA 4K3NA 3LWUA 3D7GA 2F7VA 3FJUA 3IEHA 2Q4ZA 2ZEOA 3TC8A 1LCPA 3FX6A 5CBMA 3IC1A 1NSAA 3ICUA 4MCRA 1DTDA 3IO1A 2PIYA 2JEWA 4UEZA 2PCUA 4UEEA 4G1PA 6CPAA 5J1QA 1BAVA 3PEIA 4JYWA 3D68A 3B3SA 2IQ6A 4MMOA 4EFDA 2WZNA 3KQXA 3S9NA 4GM5A 5HVFA 1CX8A 3HUVA 2RFHA 4C85A 4WJBA 1XJOA 2V8HA 5K8PA 1Y0YA 1BPNA 4UEFA 2PJBA 3VTAA 1TF8A 2V8GA 1WVMA 2BCOA 5LYDA 4Z65A 3KQZA 4IK2A 5K8NA 5HVHA 4IAVA 1IGBA 5LRJA 2ZOFA 5LYFA 4FUUA 3WC7A 4NGRA 2AFWA 8CPAA 4ZI6A 1CG2A 2ZOGA 3B7IA 2PJCA 3SJEA 2CIJA 4C8UA 1HEEA 1YSJA 2C1CA 2CTBA 4YWYA 3CPAA 3L2NA 5CPAA 2ANPA 1CPSA 4X8IA 2XEFA 4ZYQA 3PFOA 1LANA 5IB9A 4R8FA 4C8PA 2ZEEA 2V8VA 1AYEA 4P4FA 2ZEGA 1ZLHA 4A94A 3KASA 4EWTA 4NGQA 3SI0A 4YU9A 1YW6A 4P6YA 4MXUA 4C84A 4UIAA 4OKOA 2PJ8A 4W9YA 4KSIA 4DJLA 5JM6A 4P44A 5F09A 3B3VA 4LQGA 3KR5A 4MRIA 4P10A 1CP7A 3CT9A 1F2OA 3RZAA 5LYIA 4A38A 3WC6A 4PQAA 3WABA 4OC1A 1EE3P 2CF4A 4A37A 4NGTA 4C8FA 2PJ0A 5K8OA 4C8TA 1QMUA 3FMCA 3MN8A 3FEDA 3PB7X 3S9MA 3LMSA 2O4HA 4MHNA 2XEGA 4NGMA 2JBKA 3PFEA 4ZY1A 2PE3A 2AFUA 3BI1A 4DUKA 1VIXA 4OC3A 3D7HA 1ELMP 2GREA 1TXRA 4OC5A 4BD9A 4MCQA 2PJ9A 2PJ6A 4ZY0A 3K2KA 3BI0A 1RTQA 1XBUA 3GB0A 4AXVA 1LAMA 1PCAA 1Q7LA 4MCPA 1ARMA 4IHMA 4EMEA 2ZEMA 1UWYA 1VGYA 2V8DA 2VL1A 4UIBA 4CPAA 2Q51A 2EWBA 4MHPA 3SJGA 1PYTB 3D7DA 4FWUA 4O23A 4C9AA 4NJRA 2EK8A 2QYVA 1JQGA 2PVVA 7CPAA 4TJXA 2FVGA 5K8MA 5LRKA 1TF9A 2IJZA 1LFWA 1XMBA 1ZG9A
chains in the Genus database with same CATH superfamily
3FEEA 1ZO0A 4X2TA 1JDBC 2AE6A 3WT4A 2YJTA 2DXQA 2ZEPA 1S7KA 3RYOA 3R9GA 4MFJA 4CRZB 3O8ZA 1KUYA 4B6ZA 5C88A 2O53A 1CS0B 4CDKA 4BPUB 4NSQA 2GU2A 4AB7A 2ZW7A 1KWMA 1ELLP 3TOAA 2FXFA 5G1ZA 2DPTA 3H8GA 4IUSA 5G22A 1ZLIA 2PJ4A 2YNCA 3B8GA 3G8WA 1I1DA 4L89A 4MFKA 4PXBA 3FBUA 4C9RA 3NH8A 2EBJA 4JD6A 4F9UA 5IV0A 2PVWA 3SI1A 1QSMA 4ONUA 2G3AA 5HKZA 1LRZA 3NH5A 2CTCA 1Z5RA 2ABZA 2HUZA 4JXRA 2HI6A 1IICA 3U88C 2AFSA 1LAPA 3GUXA 3IU1A 4KOXA 2RB7A 2FE7A 3NA6A 1YVOA 4CGPA 4KS9A 4XPKA 3W91A 2JBJA 1AUGA 1R43A 2CY2A 3DSBA 3I9SA 4KSFA 3KGQA 2PJ1A 1CP6A 2Q7SA 2I00A 2ZEFA 3B3WA 3PGPA 5KTCA 4JVOA 3TLGB 3BUMB 4AG9A 3DLJA 2G9DA 3JUWA 2D4OA 4R57A 2BEIA 1P4NA 2UV8G 2IL4A 3QAYA 5AG4A 3NOJA 1KBLA 4A4CA 5G20A 3SJXA 1Y7EA 2AFXA 4EVYA 1FT7A 2WYRA 4ZGYB 4RN7A 1NSLA 1VI4A 5K99A 3FH4A 4BINA 1GHEA 4K30A 4LQ6A 3FF3A 2C6PA 4BBHA 3PRTA 1Y7RA 2CBLA 4JZ0A 3B3TA 3KR4A 4H2KA 2HC9A 1WJTA 2R7HA 3IFEA 4KLWA 3TLAA 3TFYA 3IWGA 4ZBGA 4QBJA 2NMTA 3ZJ0A 1MK4A 2ZENA 4ONWA 2XPNA 2ZPAA 4QVTA 3HLPA 5IB0A 4ZX9A 2ZELA 1M4IA 2YJVA 3BXMA 2HB6A 1ZG8A 3BHXA 3RAMA 2PR8A 5ISVA 4KOTA 4NGSA 3HMJG 4CO9A 2PIZA 5D8NA 2GLJA 3P2FA 2Z3PA 4P45A 3TO6A 4F8ZA 4PSXA 4C9UA 2J8MA 5JYBA 4H6UA 4FAIA 3BUNB 1BLLE 4Q38A 1Z4RA 5FVJA 4KUBA 1TKFA 1VKCA 2DLAA 5F49A 2HV2A 5AG7A 2GLFA 2I3CA 5A28A 2EZBA 5THWA 2B3VA 4R7MA 2B4BA 4YFJA 2ZXVA 2J8NA 3IIBA 4IIXA 4PXEA 3D7FA 3R95A 4OC4A 4BPWB 2Y0MA 3FRMA 3EZAA 4COBA 1YREA 1ZL0A 3I6SA 4CYPA 3TLEA 1FNOA 2R1IA 1L0CA 2PJAA 1YW4A 4MHYA 4FD6A 4M6GA 4CRYB 3IU2A 1EO0A 4UF4A 3EIFA 2ZEDA 3D66A 2PRQA 2AUNA 1YLOA 5AG6A 3K9TA 2PDOA 4GXHA 4XPDC 4P4DA 5LRGA 2NYQA 4PK2A 4PPZA 1ARLA 2XEJA 3VRNA 3MRUA 4NGPA 3SHPA 3V8IA 2DEAA 4AVBA 1KEEB 3S6GA 4ZX8A 1ZRSA 3G23A 2F8HA 4A39A 4NCZA 4EYSA 1OBRA 3VATA 4AVCA 3KHZA 2EK9A 2BUEA 1KUXA 1XOVA 3B35A 1S60A 2J8RA 3ZZIA 4C2YA 1EZAA 3K4IA 4C9VA 4KOUA 4MBUA 5JPHA 2Q7BA 1X12A 4B5PA 1BPMA 3E0KA 2P6EA 4TWEA 2VKZG 3PB9X 2VEZA 3I1UA 1Z8LA 4C9EA 2F5IA 1VHSA 3DGVA 4P4IA 4PXCA 4C99A 2E28A 5KTDA 2Z3LA 3N7ZA 4MHZA 1XF1A 3GY9A 4R76A 4CYQA 2ZW5A 1H8LA 4DYOA 3CPXA 4DNCA 1PU9A 5DWNA 2X7BA 4BPXB 3IWWA 3PT1A 4Y49B 2IMOA 2XEIA 3N5FA 2C6GA 2NSMA 2OB0A 2D4PA 4YGOA 3VH9A 4A95A 2R8VA 3PBEA 3TX8A 3QNVA 4IF5A 2WUUA 4XPDB 5H84A 4UCMA 4B10A 1R61A 1ZG7A 5I4MA 2D0OA 5JH9A 1VHEA 3PB8X 2ATRA 3R96A 3OP0A 1CPXA 2P6GA 4LX9A 3KZWA 4MFLA 1KZFA 2FS5A 2BO9A 4R6TA 1MJ9A 3BJ8A 5AG5A 3T05A 4OMEA 1TKHA 3DR8A 5E96A 1CE8B 1XFOA 3D67A 1GYTA 1XMTA 3SJFA 4P4BA 2QJ8A 3NFZA 1F57A 2PJ5A 1IU8A 5DS0A 1MJBA 1V6CA 4P4EA 2OR4A 1R3NA 4COGA 4H1HA 4LUAA 3FIXA 1DE4C 2AFZA 2FT0A 4A30A 3KHXA 3PFVA 1XF8A 3I74A 3VRQA 4NF1A 3WC5A 2Q43A 1Y0RA 5DWMA 4A32A 4C2ZA 1IIDA 4C68A 2Z3OA 1LOKA 4MCSA 3A9LA 2PRBA 3B2YA 3PB6X 4UBRA 4E2AA 3NH4A 2OZUA 1FY7A 4CYOA 5CNPA 4UFWA 3R9EA 2PJ7A 3H8FA 3EZBA 4HNXB 3NFQA 4C8CA 1U6MA 3RNZA 3CDXA 3OB2B 5AGEA 4WWVA 5GCNA 3H8EA 5JGFA 2EZAA 4E5SA 1AMPA 1TKJA 5A27A 4PXDA 4FBEA 1XRYA 1HDQA 2VBQA 2ZEHA 1HDUA 1F2PA 5F46A 4B5OA 4II9A 3PBBA 3VARA 3DNSA 1Q5XA 3SI2A 3V7ZA 4HKFA 4NFRA 4F9VA 5D29A 3T0TA 5HVGA 3EZEA 2P6FA 1B6BA 3NE8A 3T9YA 1Z8TA 3EY5A 2P0WA 4A31A 3U1BA 4RS2A 3PB4X 4ZY2A 5HKWA 5LYLA 4XPLA 4C86A 2AUMA 3TOBA 4Y49C 4NJQA 3BJ7A 4L8AA 1K4JA 3H4QA 4MJXA 1YMEA 4MFZA 3W6XA 2CNSA 2AFMA 2V77A 4OC0A 4KOVA 1CBXA 2POKA 3GKRA 2CXAA 4P4JA 2OOTA 1RXTA 2AFOA 3OWCA 4FD4A 4B14A 1I12A 3IGRA 3S9LA 3C26A 5ELYA 3KI9A 3SXNA 4KUAA 2MP0A 3D2PA 3D4UA 2H5MA 4OIDA 2GIVA 3ISXA 3V38A 4RUHA 2HQYA 1Y9KA 3FVLA 1QSOA 2PCNA 4B5PB 1EZBA 4KNGE 1YR0A 1IY7A 2PJ2A 4KVXA 4NEXA 2C6CA 4MY0A 4OC2A 1Y9ZA 2EZCA 3KL9A 3F8KA 5F5XA 3TLBA 3P2HA 4CDJA 5F1YA 2J9AA 2VI7A 3JRUA 5EBVA 4TJVA 4C8AA 3B3CA 4CZ1A 2GANA 3H5ZA 4KVME 3TCVA 4M6HA 4NGNA 3K9UA 5G21A 1Z2LA 2CNMA 2DF5A 4C7HA 1VHOA 4UFXA 5HXDA 2A4NA 4MFPA 4UWJA 4B11A 2HWGA 3VWDA 3FECA 4OAEA 3T07A 4OP4A 5F47A 3OB1B 5F13A 4YN3A 5EMIA 5JVLA 4E94A 2FSRA 2BL1A 1S3ZA 3FNCA 4Q7AA 4UCPA 4CYNA 3D8PA 4R3KA 1YVHA 2XPLA 4NXYA 2BOAA 3GLJA 3RBUA 1A9XB 3VGOA 2N3AB 3VRPA 2QVPA 1VBHA 1C30B 2B5GA 1N71A 4H6ZA 1QSRA 4J0NA 2Q44A 4TNUA 4X3RA 2PJ3A 3ISZA 3RO0A 1M4LA 4CS0B 3IJ3A 1QQ9A 4GPLB 4BTFA 4K3NA 4OIWA 4E0AA 2EO8A 4J3GA 4KORA 3LWUA 3D7GA 2F7VA 3FJUA 1P0HA 3IEHA 4FD7A 4A2ZA 2Q4ZA 3FXTA 2Q0YA 2B3UA 2ZEOA 3TC8A 1S5KA 5I0CA 2GP4A 1LCPA 4CGNA 2OU2A 3FX6A 5CBMA 3IC1A 4M8DA 1NSAA 2Z3MA 1KC7A 3ICUA 3LACA 2REFA 4MCRA 3F5BA 3BLNA 1Y9WA 1DTDA 2Q04A 3IO1A 1KUVA 3T8WA 2PIYA 4QB9A 3JVNA 2JEWA 1M4DA 4PK3A 4UEZA 1RO5A 2JDCA 3T5MA 2PCUA 4UEEA 4B12A 2DPSA 4G1PA 6CPAA 5J1QA 1BAVA 3EC4A 3PEIA 4JYWA 4KSAA 4MI4A 2CNTA 1BXRB 3D68A 2FCKA 2OH1A 3B3SA 2IQ6A 1R57A 1BO4A 4MMOA 4EFDA 2WZNA 3KQXA 3WR7A 4F6AA 3OAKA 1YGHA 4CAFA 4MI1A 2ZW6A 4F0YA 3S9NA 2WPXA 2G0BA 4GM5A 1CX8A 1QSTA 5HVFA 3HUVA 2RFHA 3D2MA 4C85A 1S7FA 4WJBA 1XJOA 1YX0A 2V8HA 1Y0YA 4CAVA 5K8PA 4C7IA 1BPNA 4UEFA 2XPOA 2PJBA 3VTAA 2ARHA 1TF8A 2V8GA 3JTKA 4CAWA 1WVMA 2D0PA 4U9ZA 1XE4A 2BCOA 2Q4YA 5KTAA 2X0SA 1VBGA 5LYDA 4Z65A 4MJ8A 3KQZA 4OLLA 3QB8A 3GYAA 4UCNA 5AXIA 4IK2A 4X5KA 4CAXA 5K8NA 5HVHA 4IAVA 5HH1A 2PR1A 1IGBA 1TIQA 4JWPA 1B87A 4HNYB 5LRJA 2GFQA 2ZOFA 1UFHA 4FUUA 3WC7A 2WSAA 5LYFA 1I21A 1XIXA 1M6VB 2C5QA 1WK4A 4NGRA 2EUIA 3GIUA 2JEVA 4BMHA 4UFVA 2B0AA 2VQYA 2AFWA 3TYXA 1NE9A 4H89A 8CPAA 3SXOA 5H86A 4ZI6A 2FL4A 3FYNA 1XEBA 1CG2A 2VZYA 2ZOGA 3B7IA 4MY3A 2PJCA 3SJEA 3BUWB 3UY5A 4IIYA 2CIJA 5J3XA 4QUSA 1NXJA 1HEEA 1YSJA 2C1CA 4C8UA 4A33A 2CTBA 4YWYA 3VROA 3CPAA 2FIWA 2K5TA 4HPSA 3L2NA 2JLMA 2FIAA 4F0XA 5CPAA 2OLSA 2ANPA 2OZGA 4OADA 3S6FA 1CPSA 4X8IA 3MGDA 4XNHB 2XEFA 4ZYQA 3PFOA 2B4JC 1ON0A 1LANA 2Z0ZA 1Q2CA 1NBWA 3C8OA 2BSWA 2C27A 2QECA 4JJXA 1NMTA 5IB9A 1WWZA 4R8FA 2XPPA 3IWEA 3G3SA 1IB1E 1M4GA 2Y1NA 3I3GA 4C8PA 2ZEEA 2V8VA 1AYEA 3TLZA 4P4FA 2ZEGA 1ZLHA 4A94A 3VWEA 5BWAB 4A4BA 1JDEA 3TLGA 3KASA 4EWTA 4NGQA 1J4JA 4Q36A 3SI0A 3DR6A 3TLYA 4YU9A 1Z9UA 4MHDA 1YW6A 4P6YA 4KLVA 2OZHA 5EC4A 1Q2DA 4MXUA 4C2XA 4C84A 4UIAA 4OKOA 4CGOA 2PJ8A 4W9YA 4KSIA 4DJLA 4RI1A 4E8OA 5JM6A 2KCWA 4P44A 4I49A 5F09A 3B3VA 4XNHC 2QIRA 1Z4EA 4B13A 1OZPA 1SQHA 2B58A 4LQGA 3KR5A 3NE7A 4MRIA 4P10A 4U9YA 5IR2A 1CP7A 2Q4VA 2PC1A 3CT9A 2FM4A 5C82A 1F2OA 4CGLA 3EXNA 4R3LA 3RZAA 5LYIA 3S6KA 4A38A 4PSWA 3WC6A 1YVKA 4PQAA 2ZW4A 1PUAA 2PSWA 4YRHA 2Z3KA 3KRVA 3WABA 4OC1A 3TO9A 1IYLA 1EE3P 2AJ6A 2CF4A 4A37A 1V0CA 4NGTA 2RC4A 4C8FA 1CM0A 2PJ0A 3QAHA 2Z11A 3R1KA 4M6IA 3TO7A 2ODFA 5K8OA 4C8TA 1S7NA 1QMUA 3FMCA 3MN8A 4R87A 1Z8XA 4R9MA 1M1DA 5JQ4A 3FEDA 3PB7X 4M85A 1T36B 4KOSA 2DIKA 4RR2B 3S9MA 1IYKA 5HMNA 2HROA 1B47A 2PQ8A 3FB3A 1MJAA 4JXQA 1QSNA 3LMSA 3T90A 3PLFB 5HKYA 3LD2A 3R9FA 4UA3A 2G3TA 3TTHA 4KZTA 2YNEA 2O4HA 4CGMA 5J8CA 4MHNA 3BUOB 1M44A 1YK3A 2EVNA 3TT2A 2XEGA 4NGMA 3CXQA 4MFQA 2YGWA 2JBKA 2VXKA 3PFEA 3TE4A 3CZXA 4ZY1A 2PE3A 2VZZA 2AFUA 3BI1A 1BOBA 1DIKA 4DUKA 4KOYA 1VIXA 3F9KC 4OC3A 3D7HA 3CXSA 1Z9EA 1ELMP 2GREA 2R98A 1TXRA 4FD5A 4OC5A 4GS4A 4M3SA 4BD9A 4MCQA 1CJWA 2R82A 2PJ9A 2REEA 3W6SA 1Q2YA 1JWQA 2PJ6A 4ZY0A 3EFAA 3S6HA 3K2KA 2JDDA 3VRRA 2YNCC 3SR3A 3BI0A 1RTQA 1XBUA 5FD8A 3KKWA 3GB0A 4AXVA 1LAMA 1PCAA 1Q7LA 4MCPA 2YNDA 1ARMA 4IHMA 1J3LA 4AG7A 5F9MA 1C3OB 2QMLA 4JLYA 4ORFA 5F48A 3CXPA 5BY0A 4EMEA 2ZEMA 3TLCA 1UWYA 1VGYA 2V8DA 4UWIA 3F0AA 3ZNIA 2VL1A 4UIBA 1A2ZA 2Q51A 3LODA 4PV6A 4AVAA 4CPAA 3HPGG 4KVOE 2EWBA 2Z3NA 1IOFA 1YQEA 3D3SA 4HNWB 1GGOA 3BUXB 4MHPA 3HPHE 4KOWA 3SJGA 1IOIA 1PYTB 3D7DA 4FWUA 1S7LA 4O23A 2Z10A 2GE3A 4C9AA 2WPWA 3PZJA 4NJRA 1Z8WA 2B4DA 2EK8A 1FBVA 2QYVA 1JQGA 2PVVA 2I79A 2Y1MA 3DDDA 7CPAA 1ZYMA 4TJXA 2FVGA 5K8MA 1YLEA 5LRKA 2B4DB 2O28A 2B5GB 1X10A 4CAEA 3PP9A 4U5YA 5IX3A 3GJZA 1TF9A 4QC6A 4INJA 2IJZA 5J8FA 1LFWA 3EO4A 1XMBA 1ZG9A
chains in the Genus database with same CATH topology
3FEEA 4X2TA 3WT4A 2ZEPA 4CDKA 4B6ZA 2O53A 2GU2A 1KWMA 1ELLP 3H8GA 1ZLIA 2PJ4A 4PXBA 4C9RA 3NH8A 4F9UA 2PVWA 3SI1A 3T8WA 3NH5A 2CTCA 1Z5RA 2ABZA 2AFSA 1LAPA 3GUXA 2RB7A 3NA6A 2JBJA 1R43A 3KGQA 2PJ1A 1CP6A 3B3WA 2ZEFA 3DLJA 2G9DA 3SJXA 1Y7EA 2AFXA 1FT7A 2WYRA 3FH4A 3FF3A 2C6PA 3PRTA 4JZ0A 3B3TA 3KR4A 4H2KA 2HC9A 3IFEA 2ZENA 4ONWA 3HLPA 4ZX9A 2ZELA 3BXMA 2HB6A 1ZG8A 3BHXA 3RAMA 4NGSA 2PIZA 5D8NA 2GLJA 4P45A 4F8ZA 4C9UA 4FAIA 1BLLE 1TKFA 2GLFA 2I3CA 5THWA 4R7MA 3IIBA 4PXEA 3D7FA 4OC4A 3I6SA 1FNOA 2PJAA 1YW4A 4MHYA 4UF4A 3EIFA 2ZEDA 3D66A 2PRQA 1YLOA 3K9TA 4P4DA 5LRGA 2NYQA 4PPZA 1ARLA 3MRUA 2XEJA 4NGPA 2DEAA 4ZX8A 2F8HA 4A39A 1OBRA 3VATA 3KHZA 2EK9A 3B35A 4C9VA 1BPMA 4TWEA 3PB9X 3I1UA 1Z8LA 4C9EA 3DGVA 4P4IA 4PXCA 4C99A 4MHZA 1XF1A 4R76A 1H8LA 4DYOA 3CPXA 3IWWA 2IMOA 2XEIA 3N5FA 2C6GA 2NSMA 3VH9A 3PBEA 3TX8A 3QNVA 1ZG7A 5I4MA 5JH9A 1VHEA 3PB8X 1CPXA 3KZWA 4R6TA 2BO9A 4OMEA 1TKHA 1XFOA 3D67A 1GYTA 3NFZA 3SJFA 4P4BA 2QJ8A 1F57A 2PJ5A 5DS0A 1V6CA 4P4EA 2OR4A 1R3NA 1DE4C 2AFZA 3I74A 3KHXA 3WC5A 2Q43A 1Y0RA 1LOKA 4MCSA 3B2YA 3PB6X 3NH4A 2PJ7A 3H8FA 4C8CA 3CDXA 5JGFA 4WWVA 3H8EA 1AMPA 1TKJA 4PXDA 4FBEA 1XRYA 1HDQA 2ZEHA 1HDUA 1F2PA 3PBBA 3VARA 3SI2A 3V7ZA 4NFRA 4F9VA 5D29A 5HVGA 3PB4X 4ZY2A 5LYLA 4C86A 4NJQA 1YMEA 2AFMA 2V77A 4OC0A 1CBXA 2POKA 4P4JA 2OOTA 2AFOA 3S9LA 5ELYA 3KI9A 3D4UA 4OIDA 3ISXA 3V38A 4RUHA 3FVLA 4KNGE 1IY7A 2PJ2A 2C6CA 1Y9ZA 4OC2A 3KL9A 4CDJA 2J9AA 3JRUA 4TJVA 4C8AA 3B3CA 4NGNA 1Z2LA 1VHOA 5HXDA 3FECA 4OP4A 4YN3A 4Q7AA 2BOAA 3GLJA 3RBUA 2QVPA 4TNUA 4X3RA 2PJ3A 3ISZA 1M4LA 3IJ3A 1QQ9A 4OIWA 4K3NA 3LWUA 3D7GA 2F7VA 3FJUA 3IEHA 2Q4ZA 2ZEOA 3TC8A 2GP4A 1LCPA 3FX6A 5CBMA 3IC1A 1NSAA 3ICUA 4MCRA 1DTDA 3IO1A 2PIYA 2JEWA 4UEZA 2PCUA 4UEEA 4G1PA 6CPAA 5J1QA 1BAVA 3PEIA 4JYWA 3D68A 3B3SA 2IQ6A 4MMOA 4EFDA 2WZNA 3KQXA 3S9NA 4GM5A 5HVFA 1CX8A 3HUVA 2RFHA 4C85A 4WJBA 1XJOA 2V8HA 5K8PA 1Y0YA 1BPNA 4UEFA 2PJBA 3VTAA 1TF8A 2V8GA 1WVMA 2BCOA 5LYDA 4Z65A 3KQZA 4IK2A 5K8NA 5HVHA 4IAVA 1IGBA 5LRJA 2ZOFA 5LYFA 4FUUA 3WC7A 2C5QA 4NGRA 2AFWA 8CPAA 4ZI6A 1CG2A 2ZOGA 3B7IA 2PJCA 3SJEA 2CIJA 4C8UA 1HEEA 1YSJA 2C1CA 2CTBA 4YWYA 3CPAA 3L2NA 5CPAA 2ANPA 1CPSA 4X8IA 2XEFA 4ZYQA 3PFOA 1LANA 5IB9A 4R8FA 4C8PA 2ZEEA 2V8VA 1AYEA 4P4FA 2ZEGA 1ZLHA 4A94A 3KASA 4EWTA 4NGQA 3SI0A 4YU9A 1YW6A 4P6YA 4MXUA 4C84A 4UIAA 4OKOA 2PJ8A 4W9YA 4KSIA 4DJLA 5JM6A 4P44A 5F09A 3B3VA 4LQGA 3KR5A 4MRIA 4P10A 5IR2A 1CP7A 3CT9A 1F2OA 3RZAA 5LYIA 4A38A 3WC6A 4PQAA 3WABA 4OC1A 1EE3P 2CF4A 4A37A 4NGTA 4C8FA 2PJ0A 5K8OA 4C8TA 1QMUA 3FMCA 3MN8A 3FEDA 3PB7X 3S9MA 3LMSA 2O4HA 4MHNA 2XEGA 4NGMA 2JBKA 3PFEA 4ZY1A 2PE3A 2AFUA 3BI1A 4DUKA 1VIXA 4OC3A 3D7HA 1ELMP 2GREA 1TXRA 4OC5A 4BD9A 4MCQA 2PJ9A 2PJ6A 4ZY0A 3K2KA 3BI0A 1RTQA 1XBUA 3GB0A 4AXVA 1LAMA 1PCAA 1Q7LA 4MCPA 1ARMA 4IHMA 4EMEA 2ZEMA 1UWYA 1VGYA 2V8DA 2VL1A 4UIBA 4CPAA 2Q51A 2EWBA 4MHPA 3SJGA 1PYTB 3D7DA 4FWUA 4O23A 4C9AA 4NJRA 2EK8A 2QYVA 1JQGA 2PVVA 7CPAA 4TJXA 2FVGA 5K8MA 5LRKA 1TF9A 2IJZA 1LFWA 1XMBA 1ZG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEE A;  4X2T A;  3WT4 A;  2ZEP A;  4CDK A;  4B6Z A;  2O53 A;  2GU2 A;  1KWM A;  1ELL P;  3H8G A;  1ZLI A;  2PJ4 A;  4PXB A;  4C9R A;  3NH8 A;  4F9U A;  2PVW A;  3SI1 A;  3T8W A;  3NH5 A;  2CTC A;  1Z5R A;  2ABZ A;  2AFS A;  1LAP A;  3GUX A;  2RB7 A;  3NA6 A;  2JBJ A;  1R43 A;  3KGQ A;  2PJ1 A;  1CP6 A;  3B3W A;  2ZEF A;  3DLJ A;  2G9D A;  3SJX A;  1Y7E A;  2AFX A;  1FT7 A;  2WYR A;  3FH4 A;  3FF3 A;  2C6P A;  3PRT A;  4JZ0 A;  3B3T A;  3KR4 A;  4H2K A;  2HC9 A;  3IFE A;  2ZEN A;  4ONW A;  3HLP A;  4ZX9 A;  2ZEL A;  3BXM A;  2HB6 A;  1ZG8 A;  3BHX A;  3RAM A;  4NGS A;  2PIZ A;  5D8N A;  2GLJ A;  4P45 A;  4F8Z A;  4C9U A;  4FAI A;  1BLL E;  1TKF A;  2GLF A;  2I3C A;  5THW A;  4R7M A;  3IIB A;  4PXE A;  3D7F A;  4OC4 A;  3I6S A;  1FNO A;  2PJA A;  1YW4 A;  4MHY A;  4UF4 A;  3EIF A;  2ZED A;  3D66 A;  2PRQ A;  1YLO A;  3K9T A;  4P4D A;  5LRG A;  2NYQ A;  4PPZ A;  1ARL A;  3MRU A;  2XEJ A;  4NGP A;  2DEA A;  4ZX8 A;  2F8H A;  4A39 A;  1OBR A;  3VAT A;  3KHZ A;  2EK9 A;  3B35 A;  4C9V A;  1BPM A;  4TWE A;  3PB9 X;  3I1U A;  1Z8L A;  4C9E A;  3DGV A;  4P4I A;  4PXC A;  4C99 A;  4MHZ A;  1XF1 A;  4R76 A;  1H8L A;  4DYO A;  3CPX A;  3IWW A;  2IMO A;  2XEI A;  3N5F A;  2C6G A;  2NSM A;  3VH9 A;  3PBE A;  3TX8 A;  3QNV A;  1ZG7 A;  5I4M A;  5JH9 A;  1VHE A;  3PB8 X;  1CPX A;  3KZW A;  4R6T A;  2BO9 A;  4OME A;  1TKH A;  1XFO A;  3D67 A;  1GYT A;  3NFZ A;  3SJF A;  4P4B A;  2QJ8 A;  1F57 A;  2PJ5 A;  5DS0 A;  1V6C A;  4P4E A;  2OR4 A;  1R3N A;  1DE4 C;  2AFZ A;  3I74 A;  3KHX A;  3WC5 A;  2Q43 A;  1Y0R A;  1LOK A;  4MCS A;  3B2Y A;  3PB6 X;  3NH4 A;  2PJ7 A;  3H8F A;  4C8C A;  3CDX A;  5JGF A;  4WWV A;  3H8E A;  1AMP A;  1TKJ A;  4PXD A;  4FBE A;  1XRY A;  1HDQ A;  2ZEH A;  1HDU A;  1F2P A;  3PBB A;  3VAR A;  3SI2 A;  3V7Z A;  4NFR A;  4F9V A;  5D29 A;  5HVG A;  3PB4 X;  4ZY2 A;  5LYL A;  4C86 A;  4NJQ A;  1YME A;  2AFM A;  2V77 A;  4OC0 A;  1CBX A;  2POK A;  4P4J A;  2OOT A;  2AFO A;  3S9L A;  5ELY A;  3KI9 A;  3D4U A;  4OID A;  3ISX A;  3V38 A;  4RUH A;  3FVL A;  4KNG E;  1IY7 A;  2PJ2 A;  2C6C A;  1Y9Z A;  4OC2 A;  3KL9 A;  4CDJ A;  2J9A A;  3JRU A;  4TJV A;  4C8A A;  3B3C A;  4NGN A;  1Z2L A;  1VHO A;  5HXD A;  3FEC A;  4OP4 A;  4YN3 A;  4Q7A A;  2BOA A;  3GLJ A;  3RBU A;  2QVP A;  4TNU A;  4X3R A;  2PJ3 A;  3ISZ A;  1M4L A;  3IJ3 A;  1QQ9 A;  4OIW A;  4K3N A;  3LWU A;  3D7G A;  2F7V A;  3FJU A;  3IEH A;  2Q4Z A;  2ZEO A;  3TC8 A;  1LCP A;  3FX6 A;  5CBM A;  3IC1 A;  1NSA A;  3ICU A;  4MCR A;  1DTD A;  3IO1 A;  2PIY A;  2JEW A;  4UEZ A;  2PCU A;  4UEE A;  4G1P A;  6CPA A;  5J1Q A;  1BAV A;  3PEI A;  4JYW A;  3D68 A;  3B3S A;  2IQ6 A;  4MMO A;  4EFD A;  2WZN A;  3KQX A;  3S9N A;  4GM5 A;  5HVF A;  1CX8 A;  3HUV A;  2RFH A;  4C85 A;  4WJB A;  1XJO A;  2V8H A;  5K8P A;  1Y0Y A;  1BPN A;  4UEF A;  2PJB A;  3VTA A;  1TF8 A;  2V8G A;  1WVM A;  2BCO A;  5LYD A;  4Z65 A;  3KQZ A;  4IK2 A;  5K8N A;  5HVH A;  4IAV A;  1IGB A;  5LRJ A;  2ZOF A;  5LYF A;  4FUU A;  3WC7 A;  4NGR A;  2AFW A;  8CPA A;  4ZI6 A;  1CG2 A;  2ZOG A;  3B7I A;  2PJC A;  3SJE A;  2CIJ A;  4C8U A;  1HEE A;  1YSJ A;  2C1C A;  2CTB A;  4YWY A;  3CPA A;  3L2N A;  5CPA A;  2ANP A;  1CPS A;  4X8I A;  2XEF A;  4ZYQ A;  3PFO A;  1LAN A;  5IB9 A;  4R8F A;  4C8P A;  2ZEE A;  2V8V A;  1AYE A;  4P4F A;  2ZEG A;  1ZLH A;  4A94 A;  3KAS A;  4EWT A;  4NGQ A;  3SI0 A;  4YU9 A;  1YW6 A;  4P6Y A;  4MXU A;  4C84 A;  4UIA A;  4OKO A;  2PJ8 A;  4W9Y A;  4KSI A;  4DJL A;  5JM6 A;  4P44 A;  5F09 A;  3B3V A;  4LQG A;  3KR5 A;  4MRI A;  4P10 A;  1CP7 A;  3CT9 A;  1F2O A;  3RZA A;  5LYI A;  4A38 A;  3WC6 A;  4PQA A;  3WAB A;  4OC1 A;  1EE3 P;  2CF4 A;  4A37 A;  4NGT A;  4C8F A;  2PJ0 A;  5K8O A;  4C8T A;  1QMU A;  3FMC A;  3MN8 A;  3FED A;  3PB7 X;  3S9M A;  3LMS A;  2O4H A;  4MHN A;  2XEG A;  4NGM A;  2JBK A;  3PFE A;  4ZY1 A;  2PE3 A;  2AFU A;  3BI1 A;  4DUK A;  1VIX A;  4OC3 A;  3D7H A;  1ELM P;  2GRE A;  1TXR A;  4OC5 A;  4BD9 A;  4MCQ A;  2PJ9 A;  2PJ6 A;  4ZY0 A;  3K2K A;  3BI0 A;  1RTQ A;  1XBU A;  3GB0 A;  4AXV A;  1LAM A;  1PCA A;  1Q7L A;  4MCP A;  1ARM A;  4IHM A;  4EME A;  2ZEM A;  1UWY A;  1VGY A;  2V8D A;  2VL1 A;  4UIB A;  4CPA A;  2Q51 A;  2EWB A;  4MHP A;  3SJG A;  1PYT B;  3D7D A;  4FWU A;  4O23 A;  4C9A A;  4NJR A;  2EK8 A;  2QYV A;  1JQG A;  2PVV A;  7CPA A;  4TJX A;  2FVG A;  5K8M A;  5LRK A;  1TF9 A;  2IJZ A;  1LFW A;  1XMB A;  1ZG9 A; 
#chains in the Genus database with same CATH topology
 3FEE A;  1ZO0 A;  4X2T A;  1JDB C;  2AE6 A;  3WT4 A;  2YJT A;  2DXQ A;  2ZEP A;  1S7K A;  3RYO A;  3R9G A;  4MFJ A;  4CRZ B;  3O8Z A;  1KUY A;  4B6Z A;  5C88 A;  2O53 A;  1CS0 B;  4CDK A;  4BPU B;  4NSQ A;  2GU2 A;  4AB7 A;  2ZW7 A;  1KWM A;  1ELL P;  3TOA A;  2FXF A;  5G1Z A;  2DPT A;  3H8G A;  4IUS A;  5G22 A;  1ZLI A;  2PJ4 A;  2YNC A;  3B8G A;  3G8W A;  1I1D A;  4L89 A;  4MFK A;  4PXB A;  3FBU A;  4C9R A;  3NH8 A;  2EBJ A;  4JD6 A;  4F9U A;  5IV0 A;  2PVW A;  3SI1 A;  1QSM A;  4ONU A;  2G3A A;  5HKZ A;  1LRZ A;  3NH5 A;  2CTC A;  1Z5R A;  2ABZ A;  2HUZ A;  4JXR A;  2HI6 A;  1IIC A;  3U88 C;  2AFS A;  1LAP A;  3GUX A;  3IU1 A;  4KOX A;  2RB7 A;  2FE7 A;  3NA6 A;  1YVO A;  4CGP A;  4KS9 A;  4XPK A;  3W91 A;  2JBJ A;  1AUG A;  1R43 A;  2CY2 A;  3DSB A;  3I9S A;  4KSF A;  3KGQ A;  2PJ1 A;  1CP6 A;  2Q7S A;  2I00 A;  2ZEF A;  3B3W A;  3PGP A;  5KTC A;  4JVO A;  3TLG B;  3BUM B;  4AG9 A;  3DLJ A;  2G9D A;  3JUW A;  2D4O A;  4R57 A;  2BEI A;  1P4N A;  2UV8 G;  2IL4 A;  3QAY A;  5AG4 A;  3NOJ A;  1KBL A;  4A4C A;  5G20 A;  3SJX A;  1Y7E A;  2AFX A;  4EVY A;  1FT7 A;  2WYR A;  4ZGY B;  4RN7 A;  1NSL A;  1VI4 A;  5K99 A;  3FH4 A;  4BIN A;  1GHE A;  4K30 A;  4LQ6 A;  3FF3 A;  2C6P A;  4BBH A;  3PRT A;  1Y7R A;  2CBL A;  4JZ0 A;  3B3T A;  3KR4 A;  4H2K A;  2HC9 A;  1WJT A;  2R7H A;  3IFE A;  4KLW A;  3TLA A;  3TFY A;  3IWG A;  4ZBG A;  4QBJ A;  2NMT A;  3ZJ0 A;  1MK4 A;  2ZEN A;  4ONW A;  2XPN A;  2ZPA A;  4QVT A;  3HLP A;  5IB0 A;  4ZX9 A;  2ZEL A;  1M4I A;  2YJV A;  3BXM A;  2HB6 A;  1ZG8 A;  3BHX A;  3RAM A;  2PR8 A;  5ISV A;  4KOT A;  4NGS A;  3HMJ G;  4CO9 A;  2PIZ A;  5D8N A;  2GLJ A;  3P2F A;  2Z3P A;  4P45 A;  3TO6 A;  4F8Z A;  4PSX A;  4C9U A;  2J8M A;  5JYB A;  4H6U A;  4FAI A;  3BUN B;  1BLL E;  4Q38 A;  1Z4R A;  5FVJ A;  4KUB A;  1TKF A;  1VKC A;  2DLA A;  5F49 A;  2HV2 A;  5AG7 A;  2GLF A;  2I3C A;  5A28 A;  2EZB A;  5THW A;  2B3V A;  4R7M A;  2B4B A;  4YFJ A;  2ZXV A;  2J8N A;  3IIB A;  4IIX A;  4PXE A;  3D7F A;  3R95 A;  4OC4 A;  4BPW B;  2Y0M A;  3FRM A;  3EZA A;  4COB A;  1YRE A;  1ZL0 A;  3I6S A;  4CYP A;  3TLE A;  1FNO A;  2R1I A;  1L0C A;  2PJA A;  1YW4 A;  4MHY A;  4FD6 A;  4M6G A;  4CRY B;  3IU2 A;  1EO0 A;  4UF4 A;  3EIF A;  2ZED A;  3D66 A;  2PRQ A;  2AUN A;  1YLO A;  5AG6 A;  3K9T A;  2PDO A;  4GXH A;  4XPD C;  4P4D A;  5LRG A;  2NYQ A;  4PK2 A;  4PPZ A;  1ARL A;  2XEJ A;  3VRN A;  3MRU A;  4NGP A;  3SHP A;  3V8I A;  2DEA A;  4AVB A;  1KEE B;  3S6G A;  4ZX8 A;  1ZRS A;  3G23 A;  2F8H A;  4A39 A;  4NCZ A;  4EYS A;  1OBR A;  3VAT A;  4AVC A;  3KHZ A;  2EK9 A;  2BUE A;  1KUX A;  1XOV A;  3B35 A;  1S60 A;  2J8R A;  3ZZI A;  4C2Y A;  1EZA A;  3K4I A;  4C9V A;  4KOU A;  4MBU A;  5JPH A;  2Q7B A;  1X12 A;  4B5P A;  1BPM A;  3E0K A;  2P6E A;  4TWE A;  2VKZ G;  3PB9 X;  2VEZ A;  3I1U A;  1Z8L A;  4C9E A;  2F5I A;  1VHS A;  3DGV A;  4P4I A;  4PXC A;  4C99 A;  2E28 A;  5KTD A;  2Z3L A;  3N7Z A;  4MHZ A;  1XF1 A;  3GY9 A;  4R76 A;  4CYQ A;  2ZW5 A;  1H8L A;  4DYO A;  3CPX A;  4DNC A;  1PU9 A;  5DWN A;  2X7B A;  4BPX B;  3IWW A;  3PT1 A;  4Y49 B;  2IMO A;  2XEI A;  3N5F A;  2C6G A;  2NSM A;  2OB0 A;  2D4P A;  4YGO A;  3VH9 A;  4A95 A;  2R8V A;  3PBE A;  3TX8 A;  3QNV A;  4IF5 A;  2WUU A;  4XPD B;  5H84 A;  4UCM A;  4B10 A;  1R61 A;  1ZG7 A;  5I4M A;  2D0O A;  5JH9 A;  1VHE A;  3PB8 X;  2ATR A;  3R96 A;  3OP0 A;  1CPX A;  2P6G A;  4LX9 A;  3KZW A;  4MFL A;  1KZF A;  2FS5 A;  2BO9 A;  4R6T A;  1MJ9 A;  3BJ8 A;  5AG5 A;  3T05 A;  4OME A;  1TKH A;  3DR8 A;  5E96 A;  1CE8 B;  1XFO A;  3D67 A;  1GYT A;  1XMT A;  3SJF A;  4P4B A;  2QJ8 A;  3NFZ A;  1F57 A;  2PJ5 A;  1IU8 A;  5DS0 A;  1MJB A;  1V6C A;  4P4E A;  2OR4 A;  1R3N A;  4COG A;  4H1H A;  4LUA A;  3FIX A;  1DE4 C;  2AFZ A;  2FT0 A;  4A30 A;  3KHX A;  3PFV A;  1XF8 A;  3I74 A;  3VRQ A;  4NF1 A;  3WC5 A;  2Q43 A;  1Y0R A;  5DWM A;  4A32 A;  4C2Z A;  1IID A;  4C68 A;  2Z3O A;  1LOK A;  4MCS A;  3A9L A;  2PRB A;  3B2Y A;  3PB6 X;  4UBR A;  4E2A A;  3NH4 A;  2OZU A;  1FY7 A;  4CYO A;  5CNP A;  4UFW A;  3R9E A;  2PJ7 A;  3H8F A;  3EZB A;  4HNX B;  3NFQ A;  4C8C A;  1U6M A;  3RNZ A;  3CDX A;  3OB2 B;  5AGE A;  4WWV A;  5GCN A;  3H8E A;  5JGF A;  2EZA A;  4E5S A;  1AMP A;  1TKJ A;  5A27 A;  4PXD A;  4FBE A;  1XRY A;  1HDQ A;  2VBQ A;  2ZEH A;  1HDU A;  1F2P A;  5F46 A;  4B5O A;  4II9 A;  3PBB A;  3VAR A;  3DNS A;  1Q5X A;  3SI2 A;  3V7Z A;  4HKF A;  4NFR A;  4F9V A;  5D29 A;  3T0T A;  5HVG A;  3EZE A;  2P6F A;  1B6B A;  3NE8 A;  3T9Y A;  1Z8T A;  3EY5 A;  2P0W A;  4A31 A;  3U1B A;  4RS2 A;  3PB4 X;  4ZY2 A;  5HKW A;  5LYL A;  4XPL A;  4C86 A;  2AUM A;  3TOB A;  4Y49 C;  4NJQ A;  3BJ7 A;  4L8A A;  1K4J A;  3H4Q A;  4MJX A;  1YME A;  4MFZ A;  3W6X A;  2CNS A;  2AFM A;  2V77 A;  4OC0 A;  4KOV A;  1CBX A;  2POK A;  3GKR A;  2CXA A;  4P4J A;  2OOT A;  1RXT A;  2AFO A;  3OWC A;  4FD4 A;  4B14 A;  1I12 A;  3IGR A;  3S9L A;  3C26 A;  5ELY A;  3KI9 A;  3SXN A;  4KUA A;  2MP0 A;  3D2P A;  3D4U A;  2H5M A;  4OID A;  2GIV A;  3ISX A;  3V38 A;  4RUH A;  2HQY A;  1Y9K A;  3FVL A;  1QSO A;  2PCN A;  4B5P B;  1EZB A;  4KNG E;  1YR0 A;  1IY7 A;  2PJ2 A;  4KVX A;  4NEX A;  2C6C A;  4MY0 A;  4OC2 A;  1Y9Z A;  2EZC A;  3KL9 A;  3F8K A;  5F5X A;  3TLB A;  3P2H A;  4CDJ A;  5F1Y A;  2J9A A;  2VI7 A;  3JRU A;  5EBV A;  4TJV A;  4C8A A;  3B3C A;  4CZ1 A;  2GAN A;  3H5Z A;  4KVM E;  3TCV A;  4M6H A;  4NGN A;  3K9U A;  5G21 A;  1Z2L A;  2CNM A;  2DF5 A;  4C7H A;  1VHO A;  4UFX A;  5HXD A;  2A4N A;  4MFP A;  4UWJ A;  4B11 A;  2HWG A;  3VWD A;  3FEC A;  4OAE A;  3T07 A;  4OP4 A;  5F47 A;  3OB1 B;  5F13 A;  4YN3 A;  5EMI A;  5JVL A;  4E94 A;  2FSR A;  2BL1 A;  1S3Z A;  3FNC A;  4Q7A A;  4UCP A;  4CYN A;  3D8P A;  4R3K A;  1YVH A;  2XPL A;  4NXY A;  2BOA A;  3GLJ A;  3RBU A;  1A9X B;  3VGO A;  2N3A B;  3VRP A;  2QVP A;  1VBH A;  1C30 B;  2B5G A;  1N71 A;  4H6Z A;  1QSR A;  4J0N A;  2Q44 A;  4TNU A;  4X3R A;  2PJ3 A;  3ISZ A;  3RO0 A;  1M4L A;  4CS0 B;  3IJ3 A;  1QQ9 A;  4GPL B;  4BTF A;  4K3N A;  4OIW A;  4E0A A;  2EO8 A;  4J3G A;  4KOR A;  3LWU A;  3D7G A;  2F7V A;  3FJU A;  1P0H A;  3IEH A;  4FD7 A;  4A2Z A;  2Q4Z A;  3FXT A;  2Q0Y A;  2B3U A;  2ZEO A;  3TC8 A;  1S5K A;  5I0C A;  2GP4 A;  1LCP A;  4CGN A;  2OU2 A;  3FX6 A;  5CBM A;  3IC1 A;  4M8D A;  1NSA A;  2Z3M A;  1KC7 A;  3ICU A;  3LAC A;  2REF A;  4MCR A;  3F5B A;  3BLN A;  1Y9W A;  1DTD A;  2Q04 A;  3IO1 A;  1KUV A;  3T8W A;  2PIY A;  4QB9 A;  3JVN A;  2JEW A;  1M4D A;  4PK3 A;  4UEZ A;  1RO5 A;  2JDC A;  3T5M A;  2PCU A;  4UEE A;  4B12 A;  2DPS A;  4G1P A;  6CPA A;  5J1Q A;  1BAV A;  3EC4 A;  3PEI A;  4JYW A;  4KSA A;  4MI4 A;  2CNT A;  1BXR B;  3D68 A;  2FCK A;  2OH1 A;  3B3S A;  2IQ6 A;  1R57 A;  1BO4 A;  4MMO A;  4EFD A;  2WZN A;  3KQX A;  3WR7 A;  4F6A A;  3OAK A;  1YGH A;  4CAF A;  4MI1 A;  2ZW6 A;  4F0Y A;  3S9N A;  2WPX A;  2G0B A;  4GM5 A;  1CX8 A;  1QST A;  5HVF A;  3HUV A;  2RFH A;  3D2M A;  4C85 A;  1S7F A;  4WJB A;  1XJO A;  1YX0 A;  2V8H A;  1Y0Y A;  4CAV A;  5K8P A;  4C7I A;  1BPN A;  4UEF A;  2XPO A;  2PJB A;  3VTA A;  2ARH A;  1TF8 A;  2V8G A;  3JTK A;  4CAW A;  1WVM A;  2D0P A;  4U9Z A;  1XE4 A;  2BCO A;  2Q4Y A;  5KTA A;  2X0S A;  1VBG A;  5LYD A;  4Z65 A;  4MJ8 A;  3KQZ A;  4OLL A;  3QB8 A;  3GYA A;  4UCN A;  5AXI A;  4IK2 A;  4X5K A;  4CAX A;  5K8N A;  5HVH A;  4IAV A;  5HH1 A;  2PR1 A;  1IGB A;  1TIQ A;  4JWP A;  1B87 A;  4HNY B;  5LRJ A;  2GFQ A;  2ZOF A;  1UFH A;  4FUU A;  3WC7 A;  2WSA A;  5LYF A;  1I21 A;  1XIX A;  1M6V B;  2C5Q A;  1WK4 A;  4NGR A;  2EUI A;  3GIU A;  2JEV A;  4BMH A;  4UFV A;  2B0A A;  2VQY A;  2AFW A;  3TYX A;  1NE9 A;  4H89 A;  8CPA A;  3SXO A;  5H86 A;  4ZI6 A;  2FL4 A;  3FYN A;  1XEB A;  1CG2 A;  2VZY A;  2ZOG A;  3B7I A;  4MY3 A;  2PJC A;  3SJE A;  3BUW B;  3UY5 A;  4IIY A;  2CIJ A;  5J3X A;  4QUS A;  1NXJ A;  1HEE A;  1YSJ A;  2C1C A;  4C8U A;  4A33 A;  2CTB A;  4YWY A;  3VRO A;  3CPA A;  2FIW A;  2K5T A;  4HPS A;  3L2N A;  2JLM A;  2FIA A;  4F0X A;  5CPA A;  2OLS A;  2ANP A;  2OZG A;  4OAD A;  3S6F A;  1CPS A;  4X8I A;  3MGD A;  4XNH B;  2XEF A;  4ZYQ A;  3PFO A;  2B4J C;  1ON0 A;  1LAN A;  2Z0Z A;  1Q2C A;  1NBW A;  3C8O A;  2BSW A;  2C27 A;  2QEC A;  4JJX A;  1NMT A;  5IB9 A;  1WWZ A;  4R8F A;  2XPP A;  3IWE A;  3G3S A;  1IB1 E;  1M4G A;  2Y1N A;  3I3G A;  4C8P A;  2ZEE A;  2V8V A;  1AYE A;  3TLZ A;  4P4F A;  2ZEG A;  1ZLH A;  4A94 A;  3VWE A;  5BWA B;  4A4B A;  1JDE A;  3TLG A;  3KAS A;  4EWT A;  4NGQ A;  1J4J A;  4Q36 A;  3SI0 A;  3DR6 A;  3TLY A;  4YU9 A;  1Z9U A;  4MHD A;  1YW6 A;  4P6Y A;  4KLV A;  2OZH A;  5EC4 A;  1Q2D A;  4MXU A;  4C2X A;  4C84 A;  4UIA A;  4OKO A;  4CGO A;  2PJ8 A;  4W9Y A;  4KSI A;  4DJL A;  4RI1 A;  4E8O A;  5JM6 A;  2KCW A;  4P44 A;  4I49 A;  5F09 A;  3B3V A;  4XNH C;  2QIR A;  1Z4E A;  4B13 A;  1OZP A;  1SQH A;  2B58 A;  4LQG A;  3KR5 A;  3NE7 A;  4MRI A;  4P10 A;  4U9Y A;  5IR2 A;  1CP7 A;  2Q4V A;  2PC1 A;  3CT9 A;  2FM4 A;  5C82 A;  1F2O A;  4CGL A;  3EXN A;  4R3L A;  3RZA A;  5LYI A;  3S6K A;  4A38 A;  4PSW A;  3WC6 A;  1YVK A;  4PQA A;  2ZW4 A;  1PUA A;  2PSW A;  4YRH A;  2Z3K A;  3KRV A;  3WAB A;  4OC1 A;  3TO9 A;  1IYL A;  1EE3 P;  2AJ6 A;  2CF4 A;  4A37 A;  1V0C A;  4NGT A;  2RC4 A;  4C8F A;  1CM0 A;  2PJ0 A;  3QAH A;  2Z11 A;  3R1K A;  4M6I A;  3TO7 A;  2ODF A;  5K8O A;  4C8T A;  1S7N A;  1QMU A;  3FMC A;  3MN8 A;  4R87 A;  1Z8X A;  4R9M A;  1M1D A;  5JQ4 A;  3FED A;  3PB7 X;  4M85 A;  1T36 B;  4KOS A;  2DIK A;  4RR2 B;  3S9M A;  1IYK A;  5HMN A;  2HRO A;  1B47 A;  2PQ8 A;  3FB3 A;  1MJA A;  4JXQ A;  1QSN A;  3LMS A;  3T90 A;  3PLF B;  5HKY A;  3LD2 A;  3R9F A;  4UA3 A;  2G3T A;  3TTH A;  4KZT A;  2YNE A;  2O4H A;  4CGM A;  5J8C A;  4MHN A;  3BUO B;  1M44 A;  1YK3 A;  2EVN A;  3TT2 A;  2XEG A;  4NGM A;  3CXQ A;  4MFQ A;  2YGW A;  2JBK A;  2VXK A;  3PFE A;  3TE4 A;  3CZX A;  4ZY1 A;  2PE3 A;  2VZZ A;  2AFU A;  3BI1 A;  1BOB A;  1DIK A;  4DUK A;  4KOY A;  1VIX A;  3F9K C;  4OC3 A;  3D7H A;  3CXS A;  1Z9E A;  1ELM P;  2GRE A;  2R98 A;  1TXR A;  4FD5 A;  4OC5 A;  4GS4 A;  4M3S A;  4BD9 A;  4MCQ A;  1CJW A;  2R82 A;  2PJ9 A;  2REE A;  3W6S A;  1Q2Y A;  1JWQ A;  2PJ6 A;  4ZY0 A;  3EFA A;  3S6H A;  3K2K A;  2JDD A;  3VRR A;  2YNC C;  3SR3 A;  3BI0 A;  1RTQ A;  1XBU A;  5FD8 A;  3KKW A;  3GB0 A;  4AXV A;  1LAM A;  1PCA A;  1Q7L A;  4MCP A;  2YND A;  1ARM A;  4IHM A;  1J3L A;  4AG7 A;  5F9M A;  1C3O B;  2QML A;  4JLY A;  4ORF A;  5F48 A;  3CXP A;  5BY0 A;  4EME A;  2ZEM A;  3TLC A;  1UWY A;  1VGY A;  2V8D A;  4UWI A;  3F0A A;  3ZNI A;  2VL1 A;  4UIB A;  1A2Z A;  2Q51 A;  3LOD A;  4PV6 A;  4AVA A;  4CPA A;  3HPG G;  4KVO E;  2EWB A;  2Z3N A;  1IOF A;  1YQE A;  3D3S A;  4HNW B;  1GGO A;  3BUX B;  4MHP A;  3HPH E;  4KOW A;  3SJG A;  1IOI A;  1PYT B;  3D7D A;  4FWU A;  1S7L A;  4O23 A;  2Z10 A;  2GE3 A;  4C9A A;  2WPW A;  3PZJ A;  4NJR A;  1Z8W A;  2B4D A;  2EK8 A;  1FBV A;  2QYV A;  1JQG A;  2PVV A;  2I79 A;  2Y1M A;  3DDD A;  7CPA A;  1ZYM A;  4TJX A;  2FVG A;  5K8M A;  1YLE A;  5LRK A;  2B4D B;  2O28 A;  2B5G B;  1X10 A;  4CAE A;  3PP9 A;  4U5Y A;  5IX3 A;  3GJZ A;  1TF9 A;  4QC6 A;  4INJ A;  2IJZ A;  5J8F A;  1LFW A;  3EO4 A;  1XMB A;  1ZG9 A; 
#chains in the Genus database with same CATH homology
 3FEE A;  4X2T A;  3WT4 A;  2ZEP A;  4CDK A;  4B6Z A;  2O53 A;  2GU2 A;  1KWM A;  1ELL P;  3H8G A;  1ZLI A;  2PJ4 A;  4PXB A;  4C9R A;  3NH8 A;  4F9U A;  2PVW A;  3SI1 A;  3T8W A;  3NH5 A;  2CTC A;  1Z5R A;  2ABZ A;  2AFS A;  1LAP A;  3GUX A;  2RB7 A;  3NA6 A;  2JBJ A;  1R43 A;  3KGQ A;  2PJ1 A;  1CP6 A;  3B3W A;  2ZEF A;  3DLJ A;  2G9D A;  3SJX A;  1Y7E A;  2AFX A;  1FT7 A;  2WYR A;  3FH4 A;  3FF3 A;  2C6P A;  3PRT A;  4JZ0 A;  3B3T A;  3KR4 A;  4H2K A;  2HC9 A;  3IFE A;  2ZEN A;  4ONW A;  3HLP A;  4ZX9 A;  2ZEL A;  3BXM A;  2HB6 A;  1ZG8 A;  3BHX A;  3RAM A;  4NGS A;  2PIZ A;  5D8N A;  2GLJ A;  4P45 A;  4F8Z A;  4C9U A;  4FAI A;  1BLL E;  1TKF A;  2GLF A;  2I3C A;  5THW A;  4R7M A;  3IIB A;  4PXE A;  3D7F A;  4OC4 A;  3I6S A;  1FNO A;  2PJA A;  1YW4 A;  4MHY A;  4UF4 A;  3EIF A;  2ZED A;  3D66 A;  2PRQ A;  1YLO A;  3K9T A;  4P4D A;  5LRG A;  2NYQ A;  4PPZ A;  1ARL A;  3MRU A;  2XEJ A;  4NGP A;  2DEA A;  4ZX8 A;  2F8H A;  4A39 A;  1OBR A;  3VAT A;  3KHZ A;  2EK9 A;  3B35 A;  4C9V A;  1BPM A;  4TWE A;  3PB9 X;  3I1U A;  1Z8L A;  4C9E A;  3DGV A;  4P4I A;  4PXC A;  4C99 A;  4MHZ A;  1XF1 A;  4R76 A;  1H8L A;  4DYO A;  3CPX A;  3IWW A;  2IMO A;  2XEI A;  3N5F A;  2C6G A;  2NSM A;  3VH9 A;  3PBE A;  3TX8 A;  3QNV A;  1ZG7 A;  5I4M A;  5JH9 A;  1VHE A;  3PB8 X;  1CPX A;  3KZW A;  4R6T A;  2BO9 A;  4OME A;  1TKH A;  1XFO A;  3D67 A;  1GYT A;  3NFZ A;  3SJF A;  4P4B A;  2QJ8 A;  1F57 A;  2PJ5 A;  5DS0 A;  1V6C A;  4P4E A;  2OR4 A;  1R3N A;  1DE4 C;  2AFZ A;  3I74 A;  3KHX A;  3WC5 A;  2Q43 A;  1Y0R A;  1LOK A;  4MCS A;  3B2Y A;  3PB6 X;  3NH4 A;  2PJ7 A;  3H8F A;  4C8C A;  3CDX A;  5JGF A;  4WWV A;  3H8E A;  1AMP A;  1TKJ A;  4PXD A;  4FBE A;  1XRY A;  1HDQ A;  2ZEH A;  1HDU A;  1F2P A;  3PBB A;  3VAR A;  3SI2 A;  3V7Z A;  4NFR A;  4F9V A;  5D29 A;  5HVG A;  3PB4 X;  4ZY2 A;  5LYL A;  4C86 A;  4NJQ A;  1YME A;  2AFM A;  2V77 A;  4OC0 A;  1CBX A;  2POK A;  4P4J A;  2OOT A;  2AFO A;  3S9L A;  5ELY A;  3KI9 A;  3D4U A;  4OID A;  3ISX A;  3V38 A;  4RUH A;  3FVL A;  4KNG E;  1IY7 A;  2PJ2 A;  2C6C A;  1Y9Z A;  4OC2 A;  3KL9 A;  4CDJ A;  2J9A A;  3JRU A;  4TJV A;  4C8A A;  3B3C A;  4NGN A;  1Z2L A;  1VHO A;  5HXD A;  3FEC A;  4OP4 A;  4YN3 A;  4Q7A A;  2BOA A;  3GLJ A;  3RBU A;  2QVP A;  4TNU A;  4X3R A;  2PJ3 A;  3ISZ A;  1M4L A;  3IJ3 A;  1QQ9 A;  4OIW A;  4K3N A;  3LWU A;  3D7G A;  2F7V A;  3FJU A;  3IEH A;  2Q4Z A;  2ZEO A;  3TC8 A;  2GP4 A;  1LCP A;  3FX6 A;  5CBM A;  3IC1 A;  1NSA A;  3ICU A;  4MCR A;  1DTD A;  3IO1 A;  2PIY A;  2JEW A;  4UEZ A;  2PCU A;  4UEE A;  4G1P A;  6CPA A;  5J1Q A;  1BAV A;  3PEI A;  4JYW A;  3D68 A;  3B3S A;  2IQ6 A;  4MMO A;  4EFD A;  2WZN A;  3KQX A;  3S9N A;  4GM5 A;  5HVF A;  1CX8 A;  3HUV A;  2RFH A;  4C85 A;  4WJB A;  1XJO A;  2V8H A;  5K8P A;  1Y0Y A;  1BPN A;  4UEF A;  2PJB A;  3VTA A;  1TF8 A;  2V8G A;  1WVM A;  2BCO A;  5LYD A;  4Z65 A;  3KQZ A;  4IK2 A;  5K8N A;  5HVH A;  4IAV A;  1IGB A;  5LRJ A;  2ZOF A;  5LYF A;  4FUU A;  3WC7 A;  2C5Q A;  4NGR A;  2AFW A;  8CPA A;  4ZI6 A;  1CG2 A;  2ZOG A;  3B7I A;  2PJC A;  3SJE A;  2CIJ A;  4C8U A;  1HEE A;  1YSJ A;  2C1C A;  2CTB A;  4YWY A;  3CPA A;  3L2N A;  5CPA A;  2ANP A;  1CPS A;  4X8I A;  2XEF A;  4ZYQ A;  3PFO A;  1LAN A;  5IB9 A;  4R8F A;  4C8P A;  2ZEE A;  2V8V A;  1AYE A;  4P4F A;  2ZEG A;  1ZLH A;  4A94 A;  3KAS A;  4EWT A;  4NGQ A;  3SI0 A;  4YU9 A;  1YW6 A;  4P6Y A;  4MXU A;  4C84 A;  4UIA A;  4OKO A;  2PJ8 A;  4W9Y A;  4KSI A;  4DJL A;  5JM6 A;  4P44 A;  5F09 A;  3B3V A;  4LQG A;  3KR5 A;  4MRI A;  4P10 A;  5IR2 A;  1CP7 A;  3CT9 A;  1F2O A;  3RZA A;  5LYI A;  4A38 A;  3WC6 A;  4PQA A;  3WAB A;  4OC1 A;  1EE3 P;  2CF4 A;  4A37 A;  4NGT A;  4C8F A;  2PJ0 A;  5K8O A;  4C8T A;  1QMU A;  3FMC A;  3MN8 A;  3FED A;  3PB7 X;  3S9M A;  3LMS A;  2O4H A;  4MHN A;  2XEG A;  4NGM A;  2JBK A;  3PFE A;  4ZY1 A;  2PE3 A;  2AFU A;  3BI1 A;  4DUK A;  1VIX A;  4OC3 A;  3D7H A;  1ELM P;  2GRE A;  1TXR A;  4OC5 A;  4BD9 A;  4MCQ A;  2PJ9 A;  2PJ6 A;  4ZY0 A;  3K2K A;  3BI0 A;  1RTQ A;  1XBU A;  3GB0 A;  4AXV A;  1LAM A;  1PCA A;  1Q7L A;  4MCP A;  1ARM A;  4IHM A;  4EME A;  2ZEM A;  1UWY A;  1VGY A;  2V8D A;  2VL1 A;  4UIB A;  4CPA A;  2Q51 A;  2EWB A;  4MHP A;  3SJG A;  1PYT B;  3D7D A;  4FWU A;  4O23 A;  4C9A A;  4NJR A;  2EK8 A;  2QYV A;  1JQG A;  2PVV A;  7CPA A;  4TJX A;  2FVG A;  5K8M A;  5LRK A;  1TF9 A;  2IJZ A;  1LFW A;  1XMB A;  1ZG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...