4OC4A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with cpibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxy-2-(pyridin-4-yl)ethyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
690
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYNVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc4A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc4A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc4A02
2GLFA 4DYOA 4P10A 1TKFA 4IK2A 4A94A 2C6CA 5D29A 2QVPA 1BPMA 1XF1A 1ZG9A 2RB7A 1BLLE 1Q7LA 4OMEA 3S9NA 4NGNA 5HVHA 2ZEDA 4F9VA 2PE3A 2EK9A 4R6TA 2PJ6A 3KL9A 3KQZA 1RTQA 2F8HA 3WC5A 4OC3A 3BI0A 1VHOA 2ABZA 5JM6A 3VTAA 3KZWA 3QNVA 3DGVA 4EFDA 1F2OA 2PVVA 4C9VA 1UWYA 4CDJA 1FT7A 4TWEA 3TX8A 4ZY1A 5F09A 1HEEA 2PJ1A 2V77A 5HVFA 3I74A 4UEFA 1VGYA 2ANPA 2F7VA 2ZEOA 5CBMA 3IIBA 3IO1A 4UF4A 4P4JA 2WZNA 4P44A 4WWVA 3GUXA 4Q7AA 1CPXA 3MRUA 3FJUA 1XMBA 2HB6A 5LRJA 5HXDA 1ZG7A 3PBEA 2WYRA 1H8LA 3FMCA 4P4EA 4FBEA 4PXBA 1LCPA 3PB7X 2C1CA 3PBBA 4KSIA 2AFWA 2JEWA 1ELLP 3S9MA 1ELMP 3V38A 3H8EA 2POKA 3B2YA 3D68A 1WVMA 3PB6X 4GM5A 3WABA 4OIDA 4ZX8A 3RZAA 3I6SA 4H2KA 1Z2LA 3PB4X 2J9AA 1ZG8A 8CPAA 5LYLA 1XRYA 3SI1A 5ELYA 5LRGA 2V8VA 3D67A 4YU9A 4C8FA 4X2TA 3CPAA 2PJ9A 2Q51A 4W9YA 1BAVA 2G9DA 1FNOA 3PB8X 3K2KA 4X3RA 1Z5RA 2AFZA 3IJ3A 2ZEMA 4DUKA 4R76A 5LYDA 3S9LA 2PIYA 5LYIA 4MCPA 1YSJA 2CTBA 1DE4C 2ZEEA 4C84A 4C8TA 3FF3A 4PPZA 4B6ZA 3NA6A 4FAIA 4F8ZA 3D7FA 3D4UA 1Y7EA 4DJLA 1VIXA 5K8OA 3SJFA 1HDQA 4OC1A 7CPAA 2GU2A 2AFSA 4MMOA 1LANA 5IB9A 5JGFA 4NGQA 1TF8A 1CBXA 1YW4A 4C9RA 5DS0A 1R3NA 4AXVA 1KWMA 3KR5A 4C9UA 2VL1A 4EWTA 1XBUA 2IMOA 5HVGA 2PVWA 3T8WA 2ZENA 2OOTA 2XEIA 1XFOA 1PCAA 3D7HA 3KHZA 4WJBA 2CTCA 2NSMA 2V8HA 1F2PA 4MXUA 1ZLIA 3B7IA 2OR4A 2PJ5A 2HC9A 1EE3P 4X8IA 3SJXA 1ARLA 1LOKA 4NGTA 3RBUA 4NGPA 3SI2A 3D7DA 1YLOA 2PJ2A 2PJBA 4P4IA 4C86A 1V6CA 3HUVA 1Y9ZA 4LQGA 4RUHA 3IFEA 2V8DA 3KI9A 3SJGA 1Z8LA 3PRTA 4MRIA 4O23A 4PXDA 2AFOA 5JH9A 4MCQA 2ZEPA 3WT4A 1IY7A 3KQXA 3N5FA 4YWYA 4Z65A 2AFUA 2RFHA 3D66A 3GB0A 4IHMA 4ZY2A 3DLJA 3FVLA 4KNGE 4OC2A 5K8PA 1CG2A 4C8UA 2ZOGA 4OKOA 3BI1A 2QJ8A 4ZYQA 1QMUA 4MHNA 2PCUA 3HLPA 2O4HA 3K9TA 5K8MA 3VATA 1LAMA 5LRKA 2ZEHA 3B3TA 3PB9X 6CPAA 4R8FA 1Y0RA 1XJOA 2IJZA 3JRUA 1AYEA 4P45A 3B3CA 1LFWA 5I4MA 1QQ9A 3CDXA 3NFZA 3H8FA 4ZX9A 2PJCA 3V7ZA 5CPAA 3FEDA 1CP7A 1CP6A 3BXMA 2DEAA 4ZI6A 2PRQA 2Q4ZA 3FECA 2CIJA 4A37A 1CPSA 3BHXA 4UIAA 4P6YA 1CX8A 4UEEA 4JZ0A 3ICUA 4NGMA 3B35A 3SJEA 3B3WA 1TKJA 3FX6A 2ZEFA 2GREA 3SI0A 2ZOFA 2XEFA 3IEHA 1YMEA 3CPXA 2ZEGA 2QYVA 4OP4A 3EIFA 3WC6A 4C9EA 4EMEA 4MHYA 3RAMA 2PIZA 2O53A 2V8GA 1IGBA 3H8GA 1TF9A 4ZY0A 4YN3A 4P4FA 4PXCA 2BOAA 3B3SA 4G1PA 4C8AA 1GYTA 3NH5A 4FWUA 4PXEA 2XEGA 1BPNA 4CPAA 2JBJA 1PYTB 2CF4A 1M4LA 1ARMA 3TC8A 3FH4A 2AFMA 4NJQA 4C99A 2Q43A 4C9AA 1TKHA 4ONWA 1R43A 3GLJA 4P4BA 3LWUA 1Y0YA 2PJ7A 3PFEA 3L2NA 4A38A 4NFRA 3NH4A 4MHZA 3D7GA 2BO9A 3NH8A 3PEIA 3B3VA 3KASA 5THWA 3I1UA 2C6PA 4NGRA 4BD9A 2PJ8A 3ISXA 3CT9A 4P4DA 4MCRA 2EWBA 3VARA 4MCSA 2NYQA 4PQAA 2EK8A 2XEJA 4TJXA 5LYFA 1NSAA 3KHXA 4OC5A 4C85A 1F57A 1OBRA 2FVGA 2C6GA 3PFOA 3IC1A 5K8NA 2AFXA 3KR4A 3KGQA 3VH9A 3ISZA 4F9UA 1HDUA 2PJ0A 1VHEA 2IQ6A 4OIWA 3WC7A 1LAPA 5D8NA 4C8CA 2PJ3A 4IAVA 3LMSA 4K3NA 4UIBA 4UEZA 1DTDA 4NGSA 1TXRA 1AMPA 1ZLHA 4A39A 3IWWA 4JYWA 2BCOA 2JBKA 4NJRA 4FUUA 4CDKA 1YW6A 4TJVA 3MN8A 4OC0A 2PJAA 4R7MA 2GLJA 4MHPA 4TNUA 4C8PA 5J1QA 2PJ4A 2ZELA 2I3CA 1JQGA 3FEEA 4OC4A
chains in the Genus database with same CATH superfamily
2GLFA 4CYOA 4DYOA 4P10A 1TKFA 4BPXB 4IK2A 4U9ZA 1WK4A 4A94A 2AE6A 2PR1A 2C6CA 5D29A 2ZW6A 2QVPA 1BPMA 2Z0ZA 1XF1A 3T5MA 3BUOB 4CAVA 1ZG9A 2RB7A 1BLLE 4GXHA 3PFVA 1Q7LA 3EZAA 3RYOA 4H89A 2CXAA 2D4PA 4M6HA 4OMEA 3S9NA 1ZO0A 4NGNA 2EVNA 4R87A 2PR8A 4KVOE 2DIKA 3DNSA 5HVHA 2ZEDA 4F9VA 2PE3A 3CZXA 4NSQA 4MJ8A 2NMTA 1N71A 4L8AA 2G3TA 2EK9A 2VBQA 1ON0A 3VROA 4R6TA 3EY5A 3SR3A 2PJ6A 1XOVA 2RC4A 3KL9A 3TO6A 3KQZA 1RTQA 4CGNA 2F8HA 3WC5A 1P0HA 2OB0A 2GFQA 3TLAA 4OC3A 3BI0A 1VHOA 2ABZA 5JM6A 3TFYA 2Q0YA 4XNHB 5FD8A 4CO9A 4AVCA 4CAWA 3VTAA 1Z8XA 3KZWA 1R61A 3BJ8A 1MJ9A 1M44A 2R1IA 5JPHA 3T0TA 5HKWA 1XMTA 3QNVA 3DGVA 4EFDA 4A4CA 4B11A 1F2OA 1NMTA 1JDEA 2PVVA 3LACA 3K4IA 4C9VA 1UWYA 2EBJA 4ORFA 4CDJA 1FT7A 5BY0A 4TWEA 1NSLA 1VBHA 3TX8A 4QVTA 4ZY1A 3OP0A 5A27A 2C5QA 1KC7A 2P6EA 5F09A 1HEEA 2PJ1A 2V77A 4KORA 5HVFA 4KSFA 3I74A 3OB2B 2OU2A 1VGYA 2ANPA 2YNCC 3NE8A 4UEFA 4HNYB 1YX0A 3PP9A 4LUAA 1Z8WA 2F7VA 2ZEOA 5C82A 1Z9UA 3IIBA 2FT0A 3IO1A 4UF4A 5F47A 5CBMA 2CNMA 2FSRA 1IOFA 4P4JA 2WZNA 4AVAA 3VWEA 4P44A 4WWVA 1S5KA 3GUXA 4FD5A 4YFJA 5I0CA 4Q7AA 4IIYA 4EYSA 4M6IA 2K5TA 1PU9A 1CPXA 3MRUA 3QB8A 3I9SA 3FJUA 2B5GA 1X12A 1XMBA 2HB6A 4UBRA 5LRJA 4B12A 1NBWA 4KLVA 4MFPA 5HXDA 1ZG7A 3IWGA 3PBEA 2WYRA 1H8LA 4KOWA 3FMCA 2P6GA 2FS5A 4GS4A 3W91A 1A9XB 1IB1E 2EUIA 4P4EA 3OWCA 4M85A 4FBEA 4J0NA 5F49A 5A28A 4PXBA 3FRMA 1EZAA 1LCPA 3PB7X 1ZRSA 4IIXA 5AGEA 1EO0A 2OZGA 2C1CA 2JDDA 3BUMB 2B4JC 3PBBA 4KSIA 4L89A 2AFWA 3OAKA 2JEWA 1ELLP 4JXRA 4UCPA 3S9MA 1ELMP 2D0PA 3V38A 3CXSA 3H8EA 2XPPA 2POKA 3B2YA 3D68A 3PB6X 3TO7A 4GM5A 4E2AA 2Y1NA 3PLFB 3F5BA 4RN7A 4E5SA 4E8OA 1BXRB 1AUGA 1P4NA 1XF8A 3K9UA 3WABA 4INJA 4C7HA 2G3AA 4NEXA 4OIDA 4ZX8A 4Q36A 3GJZA 1Q2DA 3RZAA 3G23A 3I6SA 5F5XA 4H2KA 3TLEA 3EFAA 4UWIA 3S6HA 1S7KA 2B0AA 1YVHA 2Z3PA 5IR2A 1Z2LA 2CNTA 1I1DA 1Y9KA 3PB4X 3I3GA 1X10A 2J9AA 1ZG8A 8CPAA 5LYLA 1WJTA 1YK3A 1XRYA 3SI1A 1LRZA 5J8FA 3TO9A 2AJ6A 4X5KA 4H6ZA 2Z3NA 3MGDA 2X0SA 2ARHA 4K30A 1M6VB 4C2YA 5ELYA 3S6GA 3G8WA 2B4BA 4MFQA 5LRGA 1Q5XA 2V8VA 2EZBA 5IB0A 1QSOA 1QSTA 3D67A 4M3SA 4YU9A 4PV6A 4C8FA 4X2TA 4C2XA 3V8IA 3CPAA 1M4GA 1TIQA 2OLSA 2PJ9A 3FXTA 2VI7A 5JQ4A 2Q51A 3LD2A 4RI1A 5AG4A 4W9YA 4UFXA 4KOUA 1BAVA 2G9DA 1FNOA 3PB8X 3ZZIA 4R3LA 1KUVA 5J8CA 3K2KA 4BPWB 4X3RA 4MBUA 2P0WA 4YRHA 1Z5RA 2AFZA 3IJ3A 2ZEMA 4PSXA 4DUKA 2UV8G 2Z3OA 4MFLA 2DXQA 4MI4A 4F0YA 3JVNA 1KEEB 3FNCA 3VRRA 4R76A 5LYDA 3S9LA 2PIYA 4KOXA 4A4BA 2HROA 5LYIA 2Q7SA 2ZW7A 2ZXVA 4YGOA 4MCPA 1YSJA 2CTBA 1DE4C 2ZEEA 2CNSA 4LQ6A 4XPDB 1IYKA 4C84A 4C8TA 2GANA 3FF3A 2B4DA 1FBVA 4PK3A 4PPZA 3F0AA 3TLCA 4B6ZA 3IU1A 1K4JA 3TLZA 5J3XA 4QUSA 2PCNA 3NA6A 3ZJ0A 5BWAB 3C26A 2F5IA 3EC4A 4CYNA 2VEZA 5H84A 4F8ZA 4QB9A 4FAIA 3D7FA 2JDCA 3D4UA 3EZEA 2B3VA 4KVME 1Y7EA 4B5PB 4DJLA 1VIXA 3NE7A 5K8OA 3H5ZA 3T05A 2B3UA 3SJFA 3FBUA 4M8DA 1HDQA 4OC1A 4F6AA 7CPAA 4C68A 1YVKA 2GU2A 2AFSA 4MMOA 2FIWA 4UCMA 1LANA 5IB9A 5JGFA 4NGQA 5CNPA 1JWQA 4BINA 3JTKA 1TF8A 1CBXA 3KKWA 2CBLA 3RO0A 4NXYA 1YW4A 4BPUB 5DS0A 4CAXA 5H86A 4NCZA 1CS0B 2FM4A 4C9RA 1R3NA 2FIAA 4AXVA 1KWMA 4E0AA 1YR0A 3PT1A 2YGWA 3KR5A 3R9FA 4C9UA 2DLAA 2VL1A 3A9LA 5EMIA 4EWTA 1XBUA 2IMOA 3VRPA 4MFZA 5HVGA 3GY9A 5F1YA 4CGMA 2PVWA 1GHEA 3T8WA 1Z9EA 2ZENA 5KTAA 2OOTA 2XEIA 1XFOA 3DR6A 4JLYA 1IOIA 5AG6A 1PCAA 3VRQA 3D7HA 2Z11A 2ZW4A 2PDOA 4HKFA 4A32A 3KHZA 4WJBA 3R96A 2FL4A 3TE4A 5HKZA 2CTCA 4MI1A 2NSMA 2V8HA 4A33A 2EO8A 1F2PA 4JJXA 4MXUA 1NXJA 2A4NA 1ZLIA 4FD6A 4FD4A 4H6UA 3B7IA 4CRZB 4CYPA 2OR4A 4KZTA 2PJ5A 1QSRA 2B58A 1QSNA 1EE3P 2HC9A 3R95A 4X8IA 3SJXA 1J4JA 1ARLA 1SQHA 1LOKA 4NGTA 4MHDA 2VQYA 4MY3A 3RBUA 1BO4A 2R82A 4NGPA 5HKYA 1VHSA 1YLEA 3SI2A 3D7DA 1YLOA 2PJ2A 2PJBA 4P4IA 4C86A 4R57A 1V6CA 3HUVA 1Y9ZA 3HPGG 2EZCA 3LODA 3GIUA 4LQGA 2Q7BA 3S6FA 4RUHA 3IFEA 2V8DA 2ZPAA 3TLBA 3KI9A 2AUMA 3SJGA 3OB1B 2QIRA 4KSAA 1YQEA 3BJ7A 4AB7A 1Z8LA 3PRTA 3QAHA 4MRIA 1WVMA 4CS0B 4O23A 3VGOA 4COBA 2XPOA 3DSBA 2AFOA 4KUAA 4PXDA 4CGLA 4HNWB 1S7NA 2HI6A 2J8RA 4A31A 2BEIA 5JH9A 1MJAA 4MCQA 2Q04A 2ZEPA 4UCNA 2PQ8A 3WT4A 4CAFA 1IY7A 3KQXA 3N5FA 4CZ1A 4YWYA 4Z65A 1T36B 1FY7A 2Q44A 4R9MA 3RNZA 4H1HA 1M1DA 3FYNA 2GE3A 2ODFA 3FIXA 2AFUA 1Z4EA 2PSWA 2R98A 2RFHA 1ZYMA 4U9YA 3D66A 3GB0A 4IHMA 1GGOA 4ZY2A 3DLJA 4BMHA 2B5GB 2Q4YA 4OC2A 2REFA 3F8KA 3FVLA 4NF1A 4UWJA 5K8PA 5KTDA 3VRNA 1I12A 4AVBA 4E94A 1CG2A 4XNHC 1YVOA 4M6GA 3BLNA 5ISVA 3R9EA 2E28A 5F9MA 4C8UA 2YNEA 2ZOGA 4OKOA 3VWDA 3TOBA 3BI1A 4MFJA 1B87A 2DF5A 2QJ8A 4ZYQA 4COGA 2HUZA 1QMUA 4MHNA 4B5OA 2PCUA 3G3SA 3HLPA 2O4HA 3K9TA 4KS9A 5EC4A 5K8MA 2WPWA 2YJVA 4A2ZA 4ZGYB 2DPTA 2VZZA 5JYBA 3TOAA 3VATA 3BUWB 1LAMA 5LRKA 2ZEHA 3B3TA 3KRVA 3PB9X 6CPAA 3SXNA 3GYAA 4R8FA 1Y0RA 1YREA 2JLMA 5AG5A 1XJOA 5GCNA 2HQYA 3P2FA 3SXOA 2IJZA 3JRUA 2X7BA 1CJWA 2WSAA 2JEVA 4P45A 1AYEA 3B3CA 2G0BA 3NOJA 1LFWA 3GKRA 1Q2YA 1MK4A 3N7ZA 4IF5A 4AG7A 4B5PA 5I4MA 1QQ9A 2ZW5A 2PRBA 2AUNA 2XPNA 1Z8TA 3CDXA 3NFZA 3H8FA 4ZX9A 2PJCA 5G20A 5CPAA 3V7ZA 1JDBC 3FEDA 4QC6A 1DIKA 1CP7A 3EZBA 4Y49C 5AXIA 1PUAA 1CP6A 1Q2CA 3BXMA 1QSMA 2DEAA 4ZI6A 2PRQA 2Q4ZA 3FECA 2CIJA 2ATRA 1UFHA 1Y7RA 3O8ZA 4RS2A 1CPSA 3BHXA 2O28A 4UIAA 4A37A 4P6YA 1CX8A 4UEEA 4BBHA 4B14A 1KUYA 2R8VA 4JZ0A 3E0KA 1XE4A 4I49A 2J8MA 4KOTA 4QBJA 3ICUA 4CGPA 4PK2A 4NGMA 3TCVA 4B10A 5KTCA 3CXQA 3IWEA 4KOVA 3B35A 4UFVA 3SJEA 3B3WA 5E96A 5G21A 4J3GA 2D4OA 1TKJA 4MY0A 5JVLA 1EZBA 2ZEFA 3FX6A 1IIDA 2GREA 2Y0MA 2CY2A 1U6MA 4Q38A 3SI0A 2ZOFA 2XEFA 4XPLA 3IEHA 4JWPA 1S60A 1YMEA 5HH1A 4A30A 3CPXA 2D0OA 3DDDA 3TLGB 3H4QA 2ZEGA 2QYVA 2R7HA 4OP4A 3U1BA 1Y9WA 3EIFA 3WC6A 3R9GA 3D2PA 4EMEA 4C9EA 2GP4A 1IU8A 3IGRA 2EZAA 4MHYA 3QAYA 3RAMA 5IV0A 3TLYA 2PIZA 2O53A 2V8GA 1IGBA 3H8GA 1TF9A 2P6FA 3EXNA 4ZY0A 4YN3A 4P4FA 1VBGA 2B4DB 4PXCA 2BOAA 2Y1MA 3B3SA 4G1PA 4C8AA 1M4IA 1GYTA 2QMLA 3NH5A 3EO4A 1R57A 4FWUA 3T9YA 4PXEA 2H5MA 2XEGA 3CXPA 4EVYA 1BPNA 4CPAA 3ZNIA 4BTFA 2WPXA 3TT2A 1RO5A 2JBJA 1PYTB 2CF4A 5IX3A 1M4LA 1ARMA 2BL1A 1BOBA 3TC8A 3FH4A 3HMJG 2AFMA 4NJQA 4C99A 4MFKA 2GIVA 4KNGE 2FCKA 2Q43A 4C9AA 3F9KC 4KLWA 1TKHA 3SHPA 1CE8B 3PZJA 4ONWA 1R43A 2Z3LA 3GLJA 4P4BA 2FXFA 3LWUA 3PGPA 1Y0YA 2OH1A 2PJ7A 3L2NA 1B6BA 3PFEA 4JXQA 4OLLA 5DWMA 4A38A 4NFRA 4JVOA 2OZHA 3NH4A 4MHZA 3D7GA 2BO9A 3NH8A 3PEIA 3B3VA 3KASA 3WR7A 2N3AB 1S3ZA 5THWA 1J3LA 3I1UA 2C6PA 4U5YA 2QECA 1MJBA 4XPDC 4NGRA 4JD6A 4BD9A 2PJ8A 3ISXA 5HMNA 3CT9A 3P2HA 4P4DA 4CGOA 2BUEA 2XPLA 4MCRA 4IUSA 4II9A 2EWBA 1L0CA 3VARA 4KOSA 4UFWA 1RXTA 4MCSA 2NYQA 4PQAA 2EK8A 4XPKA 4Y49B 2XEJA 4TJXA 2Q4VA 5LYFA 1IYLA 1NSAA 3KHXA 4OC5A 4DNCA 4C85A 3TTHA 1F57A 2Z3MA 1V0CA 5G1ZA 1OBRA 3NFQA 3S6KA 2FVGA 4KUBA 4UA3A 2C6GA 2PC1A 3W6XA 3PFOA 3IC1A 4A95A 2KCWA 5K8NA 1VI4A 1C3OB 1ZL0A 2AFXA 3KR4A 3KGQA 3C8OA 3B8GA 3IU2A 1OZPA 1A2ZA 1NE9A 4OAEA 3VH9A 4B13A 1KBLA 3ISZA 4F9UA 1HDUA 4C7IA 1WWZA 4GPLB 2I00A 3BUXB 1KUXA 1VHEA 1YGHA 2IQ6A 2PJ0A 4OIWA 2OZUA 5F46A 3R1KA 3D2MA 1M4DA 3WC7A 4C2ZA 4KOYA 1LAPA 5D8NA 4C8CA 4OADA 4MJXA 2YNCA 2PJ3A 4ZBGA 2C27A 4IAVA 4LX9A 1I21A 1Z4RA 5G22A 3BUNB 2Z10A 3D8PA 5C88A 4CRYB 1KZFA 3DR8A 3LMSA 3T90A 4K3NA 5F48A 1C30B 3U88C 4F0XA 4UIBA 2IL4A 4UEZA 1DTDA 4PSWA 5F13A 3HPHE 2Z3KA 2DPSA 3TYXA 4NGSA 4CAEA 1TXRA 1AMPA 1ZLHA 4A39A 5K99A 3IWWA 2VXKA 4JYWA 2BCOA 5DWNA 4AG9A 2HV2A 2JBKA 4NJRA 2YNDA 4HNXB 4ONUA 4FUUA 4KVXA 3UY5A 4CDKA 1YW6A 3W6SA 4FD7A 4HPSA 2FE7A 3FB3A 3JUWA 4CYQA 3MN8A 2I79A 4TJVA 4OC0A 2PJAA 2J8NA 2BSWA 4R7MA 1CM0A 5AG7A 2GLJA 4MHPA 5FVJA 2YJTA 2REEA 2MP0A 1S7LA 4R3KA 1VKCA 4TNUA 2WUUA 1XEBA 2HWGA 4C8PA 1IICA 1S7FA 5J1QA 3D3SA 5EBVA 3T07A 1XIXA 2PJ4A 2ZELA 3TLGA 1B47A 2I3CA 2VKZG 1JQGA 4RR2B 2VZYA 3FEEA 4OC4A
chains in the Genus database with same CATH topology
2GLFA 4DYOA 4P10A 1TKFA 4IK2A 4A94A 2C6CA 5D29A 2QVPA 1BPMA 1XF1A 1ZG9A 2RB7A 1BLLE 1Q7LA 4OMEA 3S9NA 4NGNA 5HVHA 2ZEDA 4F9VA 2PE3A 2EK9A 4R6TA 2PJ6A 3KL9A 3KQZA 1RTQA 2F8HA 3WC5A 4OC3A 3BI0A 1VHOA 2ABZA 5JM6A 3VTAA 3KZWA 3QNVA 3DGVA 4EFDA 1F2OA 2PVVA 4C9VA 1UWYA 4CDJA 1FT7A 4TWEA 3TX8A 4ZY1A 2C5QA 5F09A 1HEEA 2PJ1A 2V77A 5HVFA 3I74A 4UEFA 1VGYA 2ANPA 2F7VA 2ZEOA 5CBMA 3IIBA 3IO1A 4UF4A 4P4JA 2WZNA 4P44A 4WWVA 3GUXA 4Q7AA 1CPXA 3MRUA 3FJUA 1XMBA 2HB6A 5LRJA 5HXDA 1ZG7A 3PBEA 2WYRA 1H8LA 3FMCA 4P4EA 4FBEA 4PXBA 1LCPA 3PB7X 2C1CA 3PBBA 4KSIA 2AFWA 2JEWA 1ELLP 3S9MA 1ELMP 3V38A 3H8EA 2POKA 3B2YA 3D68A 1WVMA 3PB6X 4GM5A 3WABA 4OIDA 4ZX8A 3RZAA 3I6SA 4H2KA 5IR2A 1Z2LA 3PB4X 2J9AA 1ZG8A 8CPAA 5LYLA 1XRYA 3SI1A 5ELYA 5LRGA 2V8VA 3D67A 4YU9A 4C8FA 4X2TA 3CPAA 2PJ9A 2Q51A 4W9YA 1BAVA 2G9DA 1FNOA 3PB8X 3K2KA 4X3RA 1Z5RA 2AFZA 3IJ3A 2ZEMA 4DUKA 4R76A 5LYDA 3S9LA 2PIYA 5LYIA 4MCPA 1YSJA 2CTBA 1DE4C 2ZEEA 4C84A 4C8TA 3FF3A 4PPZA 4B6ZA 3NA6A 4FAIA 4F8ZA 3D7FA 3D4UA 1Y7EA 4DJLA 1VIXA 5K8OA 3SJFA 1HDQA 4OC1A 7CPAA 2GU2A 2AFSA 4MMOA 1LANA 5IB9A 5JGFA 4NGQA 1TF8A 1CBXA 1YW4A 4C9RA 5DS0A 1R3NA 4AXVA 1KWMA 3KR5A 4C9UA 2VL1A 4EWTA 1XBUA 2IMOA 5HVGA 2PVWA 3T8WA 2ZENA 2OOTA 2XEIA 1XFOA 1PCAA 3D7HA 3KHZA 4WJBA 2CTCA 2NSMA 2V8HA 1F2PA 4MXUA 1ZLIA 3B7IA 2OR4A 2PJ5A 2HC9A 1EE3P 4X8IA 3SJXA 1ARLA 1LOKA 4NGTA 3RBUA 4NGPA 3SI2A 3D7DA 1YLOA 2PJ2A 2PJBA 4P4IA 4C86A 1V6CA 3HUVA 1Y9ZA 4LQGA 4RUHA 3IFEA 2V8DA 3KI9A 3SJGA 1Z8LA 3PRTA 4MRIA 4O23A 4PXDA 2AFOA 5JH9A 4MCQA 2ZEPA 3WT4A 1IY7A 3KQXA 3N5FA 4YWYA 4Z65A 2AFUA 2RFHA 3D66A 3GB0A 4IHMA 4ZY2A 3DLJA 3FVLA 4KNGE 4OC2A 5K8PA 1CG2A 4C8UA 2ZOGA 4OKOA 3BI1A 2QJ8A 4ZYQA 1QMUA 4MHNA 2PCUA 3HLPA 2O4HA 3K9TA 5K8MA 3VATA 1LAMA 5LRKA 2ZEHA 3B3TA 3PB9X 6CPAA 4R8FA 1Y0RA 1XJOA 2IJZA 3JRUA 1AYEA 4P45A 3B3CA 1LFWA 5I4MA 1QQ9A 3CDXA 3NFZA 3H8FA 4ZX9A 2PJCA 3V7ZA 5CPAA 3FEDA 1CP7A 1CP6A 3BXMA 2DEAA 4ZI6A 2PRQA 2Q4ZA 3FECA 2CIJA 4A37A 1CPSA 3BHXA 4UIAA 4P6YA 1CX8A 4UEEA 4JZ0A 3ICUA 4NGMA 3B35A 3SJEA 3B3WA 1TKJA 3FX6A 2ZEFA 2GREA 3SI0A 2ZOFA 2XEFA 3IEHA 1YMEA 3CPXA 2ZEGA 2QYVA 4OP4A 3EIFA 3WC6A 4C9EA 4EMEA 2GP4A 4MHYA 3RAMA 2PIZA 2O53A 2V8GA 1IGBA 3H8GA 1TF9A 4ZY0A 4YN3A 4P4FA 4PXCA 2BOAA 3B3SA 4G1PA 4C8AA 1GYTA 3NH5A 4FWUA 4PXEA 2XEGA 1BPNA 4CPAA 2JBJA 1PYTB 2CF4A 1M4LA 1ARMA 3TC8A 3FH4A 2AFMA 4NJQA 4C99A 2Q43A 4C9AA 1TKHA 4ONWA 1R43A 3GLJA 4P4BA 3LWUA 1Y0YA 2PJ7A 3PFEA 3L2NA 4A38A 4NFRA 3NH4A 4MHZA 3D7GA 2BO9A 3NH8A 3PEIA 3B3VA 3KASA 5THWA 3I1UA 2C6PA 4NGRA 4BD9A 2PJ8A 3ISXA 3CT9A 4P4DA 4MCRA 2EWBA 3VARA 4MCSA 2NYQA 4PQAA 2EK8A 2XEJA 4TJXA 5LYFA 1NSAA 3KHXA 4OC5A 4C85A 1F57A 1OBRA 2FVGA 2C6GA 3PFOA 3IC1A 5K8NA 2AFXA 3KR4A 3KGQA 3VH9A 3ISZA 4F9UA 1HDUA 2PJ0A 1VHEA 2IQ6A 4OIWA 3WC7A 1LAPA 5D8NA 4C8CA 2PJ3A 4IAVA 3LMSA 4K3NA 4UIBA 4UEZA 1DTDA 4NGSA 1TXRA 1AMPA 1ZLHA 4A39A 3IWWA 4JYWA 2BCOA 2JBKA 4NJRA 4FUUA 4CDKA 1YW6A 4TJVA 3MN8A 4OC0A 2PJAA 4R7MA 2GLJA 4MHPA 4TNUA 4C8PA 5J1QA 2PJ4A 2ZELA 2I3CA 1JQGA 3FEEA 4OC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLF A;  4DYO A;  4P10 A;  1TKF A;  4IK2 A;  4A94 A;  2C6C A;  5D29 A;  2QVP A;  1BPM A;  1XF1 A;  1ZG9 A;  2RB7 A;  1BLL E;  1Q7L A;  4OME A;  3S9N A;  4NGN A;  5HVH A;  2ZED A;  4F9V A;  2PE3 A;  2EK9 A;  4R6T A;  2PJ6 A;  3KL9 A;  3KQZ A;  1RTQ A;  2F8H A;  3WC5 A;  4OC3 A;  3BI0 A;  1VHO A;  2ABZ A;  5JM6 A;  3VTA A;  3KZW A;  3QNV A;  3DGV A;  4EFD A;  1F2O A;  2PVV A;  4C9V A;  1UWY A;  4CDJ A;  1FT7 A;  4TWE A;  3TX8 A;  4ZY1 A;  5F09 A;  1HEE A;  2PJ1 A;  2V77 A;  5HVF A;  3I74 A;  4UEF A;  1VGY A;  2ANP A;  2F7V A;  2ZEO A;  5CBM A;  3IIB A;  3IO1 A;  4UF4 A;  4P4J A;  2WZN A;  4P44 A;  4WWV A;  3GUX A;  4Q7A A;  1CPX A;  3MRU A;  3FJU A;  1XMB A;  2HB6 A;  5LRJ A;  5HXD A;  1ZG7 A;  3PBE A;  2WYR A;  1H8L A;  3FMC A;  4P4E A;  4FBE A;  4PXB A;  1LCP A;  3PB7 X;  2C1C A;  3PBB A;  4KSI A;  2AFW A;  2JEW A;  1ELL P;  3S9M A;  1ELM P;  3V38 A;  3H8E A;  2POK A;  3B2Y A;  3D68 A;  1WVM A;  3PB6 X;  4GM5 A;  3WAB A;  4OID A;  4ZX8 A;  3RZA A;  3I6S A;  4H2K A;  1Z2L A;  3PB4 X;  2J9A A;  1ZG8 A;  8CPA A;  5LYL A;  1XRY A;  3SI1 A;  5ELY A;  5LRG A;  2V8V A;  3D67 A;  4YU9 A;  4C8F A;  4X2T A;  3CPA A;  2PJ9 A;  2Q51 A;  4W9Y A;  1BAV A;  2G9D A;  1FNO A;  3PB8 X;  3K2K A;  4X3R A;  1Z5R A;  2AFZ A;  3IJ3 A;  2ZEM A;  4DUK A;  4R76 A;  5LYD A;  3S9L A;  2PIY A;  5LYI A;  4MCP A;  1YSJ A;  2CTB A;  1DE4 C;  2ZEE A;  4C84 A;  4C8T A;  3FF3 A;  4PPZ A;  4B6Z A;  3NA6 A;  4FAI A;  4F8Z A;  3D7F A;  3D4U A;  1Y7E A;  4DJL A;  1VIX A;  5K8O A;  3SJF A;  1HDQ A;  4OC1 A;  7CPA A;  2GU2 A;  2AFS A;  4MMO A;  1LAN A;  5IB9 A;  5JGF A;  4NGQ A;  1TF8 A;  1CBX A;  1YW4 A;  4C9R A;  5DS0 A;  1R3N A;  4AXV A;  1KWM A;  3KR5 A;  4C9U A;  2VL1 A;  4EWT A;  1XBU A;  2IMO A;  5HVG A;  2PVW A;  3T8W A;  2ZEN A;  2OOT A;  2XEI A;  1XFO A;  1PCA A;  3D7H A;  3KHZ A;  4WJB A;  2CTC A;  2NSM A;  2V8H A;  1F2P A;  4MXU A;  1ZLI A;  3B7I A;  2OR4 A;  2PJ5 A;  2HC9 A;  1EE3 P;  4X8I A;  3SJX A;  1ARL A;  1LOK A;  4NGT A;  3RBU A;  4NGP A;  3SI2 A;  3D7D A;  1YLO A;  2PJ2 A;  2PJB A;  4P4I A;  4C86 A;  1V6C A;  3HUV A;  1Y9Z A;  4LQG A;  4RUH A;  3IFE A;  2V8D A;  3KI9 A;  3SJG A;  1Z8L A;  3PRT A;  4MRI A;  4O23 A;  4PXD A;  2AFO A;  5JH9 A;  4MCQ A;  2ZEP A;  3WT4 A;  1IY7 A;  3KQX A;  3N5F A;  4YWY A;  4Z65 A;  2AFU A;  2RFH A;  3D66 A;  3GB0 A;  4IHM A;  4ZY2 A;  3DLJ A;  3FVL A;  4KNG E;  4OC2 A;  5K8P A;  1CG2 A;  4C8U A;  2ZOG A;  4OKO A;  3BI1 A;  2QJ8 A;  4ZYQ A;  1QMU A;  4MHN A;  2PCU A;  3HLP A;  2O4H A;  3K9T A;  5K8M A;  3VAT A;  1LAM A;  5LRK A;  2ZEH A;  3B3T A;  3PB9 X;  6CPA A;  4R8F A;  1Y0R A;  1XJO A;  2IJZ A;  3JRU A;  1AYE A;  4P45 A;  3B3C A;  1LFW A;  5I4M A;  1QQ9 A;  3CDX A;  3NFZ A;  3H8F A;  4ZX9 A;  2PJC A;  3V7Z A;  5CPA A;  3FED A;  1CP7 A;  1CP6 A;  3BXM A;  2DEA A;  4ZI6 A;  2PRQ A;  2Q4Z A;  3FEC A;  2CIJ A;  4A37 A;  1CPS A;  3BHX A;  4UIA A;  4P6Y A;  1CX8 A;  4UEE A;  4JZ0 A;  3ICU A;  4NGM A;  3B35 A;  3SJE A;  3B3W A;  1TKJ A;  3FX6 A;  2ZEF A;  2GRE A;  3SI0 A;  2ZOF A;  2XEF A;  3IEH A;  1YME A;  3CPX A;  2ZEG A;  2QYV A;  4OP4 A;  3EIF A;  3WC6 A;  4C9E A;  4EME A;  4MHY A;  3RAM A;  2PIZ A;  2O53 A;  2V8G A;  1IGB A;  3H8G A;  1TF9 A;  4ZY0 A;  4YN3 A;  4P4F A;  4PXC A;  2BOA A;  3B3S A;  4G1P A;  4C8A A;  1GYT A;  3NH5 A;  4FWU A;  4PXE A;  2XEG A;  1BPN A;  4CPA A;  2JBJ A;  1PYT B;  2CF4 A;  1M4L A;  1ARM A;  3TC8 A;  3FH4 A;  2AFM A;  4NJQ A;  4C99 A;  2Q43 A;  4C9A A;  1TKH A;  4ONW A;  1R43 A;  3GLJ A;  4P4B A;  3LWU A;  1Y0Y A;  2PJ7 A;  3PFE A;  3L2N A;  4A38 A;  4NFR A;  3NH4 A;  4MHZ A;  3D7G A;  2BO9 A;  3NH8 A;  3PEI A;  3B3V A;  3KAS A;  5THW A;  3I1U A;  2C6P A;  4NGR A;  4BD9 A;  2PJ8 A;  3ISX A;  3CT9 A;  4P4D A;  4MCR A;  2EWB A;  3VAR A;  4MCS A;  2NYQ A;  4PQA A;  2EK8 A;  2XEJ A;  4TJX A;  5LYF A;  1NSA A;  3KHX A;  4OC5 A;  4C85 A;  1F57 A;  1OBR A;  2FVG A;  2C6G A;  3PFO A;  3IC1 A;  5K8N A;  2AFX A;  3KR4 A;  3KGQ A;  3VH9 A;  3ISZ A;  4F9U A;  1HDU A;  2PJ0 A;  1VHE A;  2IQ6 A;  4OIW A;  3WC7 A;  1LAP A;  5D8N A;  4C8C A;  2PJ3 A;  4IAV A;  3LMS A;  4K3N A;  4UIB A;  4UEZ A;  1DTD A;  4NGS A;  1TXR A;  1AMP A;  1ZLH A;  4A39 A;  3IWW A;  4JYW A;  2BCO A;  2JBK A;  4NJR A;  4FUU A;  4CDK A;  1YW6 A;  4TJV A;  3MN8 A;  4OC0 A;  2PJA A;  4R7M A;  2GLJ A;  4MHP A;  4TNU A;  4C8P A;  5J1Q A;  2PJ4 A;  2ZEL A;  2I3C A;  1JQG A;  3FEE A;  4OC4 A; 
#chains in the Genus database with same CATH topology
 2GLF A;  4CYO A;  4DYO A;  4P10 A;  1TKF A;  4BPX B;  4IK2 A;  4U9Z A;  1WK4 A;  4A94 A;  2AE6 A;  2PR1 A;  2C6C A;  5D29 A;  2ZW6 A;  2QVP A;  1BPM A;  2Z0Z A;  1XF1 A;  3T5M A;  3BUO B;  4CAV A;  1ZG9 A;  2RB7 A;  1BLL E;  4GXH A;  3PFV A;  1Q7L A;  3EZA A;  3RYO A;  4H89 A;  2CXA A;  2D4P A;  4M6H A;  4OME A;  3S9N A;  1ZO0 A;  4NGN A;  2EVN A;  4R87 A;  2PR8 A;  4KVO E;  2DIK A;  3DNS A;  5HVH A;  2ZED A;  4F9V A;  2PE3 A;  3CZX A;  4NSQ A;  4MJ8 A;  2NMT A;  1N71 A;  4L8A A;  2G3T A;  2EK9 A;  2VBQ A;  1ON0 A;  3VRO A;  4R6T A;  3EY5 A;  3SR3 A;  2PJ6 A;  1XOV A;  2RC4 A;  3KL9 A;  3TO6 A;  3KQZ A;  1RTQ A;  4CGN A;  2F8H A;  3WC5 A;  1P0H A;  2OB0 A;  2GFQ A;  3TLA A;  4OC3 A;  3BI0 A;  1VHO A;  2ABZ A;  5JM6 A;  3TFY A;  2Q0Y A;  4XNH B;  5FD8 A;  4CO9 A;  4AVC A;  4CAW A;  3VTA A;  1Z8X A;  3KZW A;  1R61 A;  3BJ8 A;  1MJ9 A;  1M44 A;  2R1I A;  5JPH A;  3T0T A;  5HKW A;  1XMT A;  3QNV A;  3DGV A;  4EFD A;  4A4C A;  4B11 A;  1F2O A;  1NMT A;  1JDE A;  2PVV A;  3LAC A;  3K4I A;  4C9V A;  1UWY A;  2EBJ A;  4ORF A;  4CDJ A;  1FT7 A;  5BY0 A;  4TWE A;  1NSL A;  1VBH A;  3TX8 A;  4QVT A;  4ZY1 A;  3OP0 A;  5A27 A;  2C5Q A;  1KC7 A;  2P6E A;  5F09 A;  1HEE A;  2PJ1 A;  2V77 A;  4KOR A;  5HVF A;  4KSF A;  3I74 A;  3OB2 B;  2OU2 A;  1VGY A;  2ANP A;  2YNC C;  3NE8 A;  4UEF A;  4HNY B;  1YX0 A;  3PP9 A;  4LUA A;  1Z8W A;  2F7V A;  2ZEO A;  5C82 A;  1Z9U A;  3IIB A;  2FT0 A;  3IO1 A;  4UF4 A;  5F47 A;  5CBM A;  2CNM A;  2FSR A;  1IOF A;  4P4J A;  2WZN A;  4AVA A;  3VWE A;  4P44 A;  4WWV A;  1S5K A;  3GUX A;  4FD5 A;  4YFJ A;  5I0C A;  4Q7A A;  4IIY A;  4EYS A;  4M6I A;  2K5T A;  1PU9 A;  1CPX A;  3MRU A;  3QB8 A;  3I9S A;  3FJU A;  2B5G A;  1X12 A;  1XMB A;  2HB6 A;  4UBR A;  5LRJ A;  4B12 A;  1NBW A;  4KLV A;  4MFP A;  5HXD A;  1ZG7 A;  3IWG A;  3PBE A;  2WYR A;  1H8L A;  4KOW A;  3FMC A;  2P6G A;  2FS5 A;  4GS4 A;  3W91 A;  1A9X B;  1IB1 E;  2EUI A;  4P4E A;  3OWC A;  4M85 A;  4FBE A;  4J0N A;  5F49 A;  5A28 A;  4PXB A;  3FRM A;  1EZA A;  1LCP A;  3PB7 X;  1ZRS A;  4IIX A;  5AGE A;  1EO0 A;  2OZG A;  2C1C A;  2JDD A;  3BUM B;  2B4J C;  3PBB A;  4KSI A;  4L89 A;  2AFW A;  3OAK A;  2JEW A;  1ELL P;  4JXR A;  4UCP A;  3S9M A;  1ELM P;  2D0P A;  3V38 A;  3CXS A;  3H8E A;  2XPP A;  2POK A;  3B2Y A;  3D68 A;  3PB6 X;  3TO7 A;  4GM5 A;  4E2A A;  2Y1N A;  3PLF B;  3F5B A;  4RN7 A;  4E5S A;  4E8O A;  1BXR B;  1AUG A;  1P4N A;  1XF8 A;  3K9U A;  3WAB A;  4INJ A;  4C7H A;  2G3A A;  4NEX A;  4OID A;  4ZX8 A;  4Q36 A;  3GJZ A;  1Q2D A;  3RZA A;  3G23 A;  3I6S A;  5F5X A;  4H2K A;  3TLE A;  3EFA A;  4UWI A;  3S6H A;  1S7K A;  2B0A A;  1YVH A;  2Z3P A;  5IR2 A;  1Z2L A;  2CNT A;  1I1D A;  1Y9K A;  3PB4 X;  3I3G A;  1X10 A;  2J9A A;  1ZG8 A;  8CPA A;  5LYL A;  1WJT A;  1YK3 A;  1XRY A;  3SI1 A;  1LRZ A;  5J8F A;  3TO9 A;  2AJ6 A;  4X5K A;  4H6Z A;  2Z3N A;  3MGD A;  2X0S A;  2ARH A;  4K30 A;  1M6V B;  4C2Y A;  5ELY A;  3S6G A;  3G8W A;  2B4B A;  4MFQ A;  5LRG A;  1Q5X A;  2V8V A;  2EZB A;  5IB0 A;  1QSO A;  1QST A;  3D67 A;  4M3S A;  4YU9 A;  4PV6 A;  4C8F A;  4X2T A;  4C2X A;  3V8I A;  3CPA A;  1M4G A;  1TIQ A;  2OLS A;  2PJ9 A;  3FXT A;  2VI7 A;  5JQ4 A;  2Q51 A;  3LD2 A;  4RI1 A;  5AG4 A;  4W9Y A;  4UFX A;  4KOU A;  1BAV A;  2G9D A;  1FNO A;  3PB8 X;  3ZZI A;  4R3L A;  1KUV A;  5J8C A;  3K2K A;  4BPW B;  4X3R A;  4MBU A;  2P0W A;  4YRH A;  1Z5R A;  2AFZ A;  3IJ3 A;  2ZEM A;  4PSX A;  4DUK A;  2UV8 G;  2Z3O A;  4MFL A;  2DXQ A;  4MI4 A;  4F0Y A;  3JVN A;  1KEE B;  3FNC A;  3VRR A;  4R76 A;  5LYD A;  3S9L A;  2PIY A;  4KOX A;  4A4B A;  2HRO A;  5LYI A;  2Q7S A;  2ZW7 A;  2ZXV A;  4YGO A;  4MCP A;  1YSJ A;  2CTB A;  1DE4 C;  2ZEE A;  2CNS A;  4LQ6 A;  4XPD B;  1IYK A;  4C84 A;  4C8T A;  2GAN A;  3FF3 A;  2B4D A;  1FBV A;  4PK3 A;  4PPZ A;  3F0A A;  3TLC A;  4B6Z A;  3IU1 A;  1K4J A;  3TLZ A;  5J3X A;  4QUS A;  2PCN A;  3NA6 A;  3ZJ0 A;  5BWA B;  3C26 A;  2F5I A;  3EC4 A;  4CYN A;  2VEZ A;  5H84 A;  4F8Z A;  4QB9 A;  4FAI A;  3D7F A;  2JDC A;  3D4U A;  3EZE A;  2B3V A;  4KVM E;  1Y7E A;  4B5P B;  4DJL A;  1VIX A;  3NE7 A;  5K8O A;  3H5Z A;  3T05 A;  2B3U A;  3SJF A;  3FBU A;  4M8D A;  1HDQ A;  4OC1 A;  4F6A A;  7CPA A;  4C68 A;  1YVK A;  2GU2 A;  2AFS A;  4MMO A;  2FIW A;  4UCM A;  1LAN A;  5IB9 A;  5JGF A;  4NGQ A;  5CNP A;  1JWQ A;  4BIN A;  3JTK A;  1TF8 A;  1CBX A;  3KKW A;  2CBL A;  3RO0 A;  4NXY A;  1YW4 A;  4BPU B;  5DS0 A;  4CAX A;  5H86 A;  4NCZ A;  1CS0 B;  2FM4 A;  4C9R A;  1R3N A;  2FIA A;  4AXV A;  1KWM A;  4E0A A;  1YR0 A;  3PT1 A;  2YGW A;  3KR5 A;  3R9F A;  4C9U A;  2DLA A;  2VL1 A;  3A9L A;  5EMI A;  4EWT A;  1XBU A;  2IMO A;  3VRP A;  4MFZ A;  5HVG A;  3GY9 A;  5F1Y A;  4CGM A;  2PVW A;  1GHE A;  3T8W A;  1Z9E A;  2ZEN A;  5KTA A;  2OOT A;  2XEI A;  1XFO A;  3DR6 A;  4JLY A;  1IOI A;  5AG6 A;  1PCA A;  3VRQ A;  3D7H A;  2Z11 A;  2ZW4 A;  2PDO A;  4HKF A;  4A32 A;  3KHZ A;  4WJB A;  3R96 A;  2FL4 A;  3TE4 A;  5HKZ A;  2CTC A;  4MI1 A;  2NSM A;  2V8H A;  4A33 A;  2EO8 A;  1F2P A;  4JJX A;  4MXU A;  1NXJ A;  2A4N A;  1ZLI A;  4FD6 A;  4FD4 A;  4H6U A;  3B7I A;  4CRZ B;  4CYP A;  2OR4 A;  4KZT A;  2PJ5 A;  1QSR A;  2B58 A;  1QSN A;  1EE3 P;  2HC9 A;  3R95 A;  4X8I A;  3SJX A;  1J4J A;  1ARL A;  1SQH A;  1LOK A;  4NGT A;  4MHD A;  2VQY A;  4MY3 A;  3RBU A;  1BO4 A;  2R82 A;  4NGP A;  5HKY A;  1VHS A;  1YLE A;  3SI2 A;  3D7D A;  1YLO A;  2PJ2 A;  2PJB A;  4P4I A;  4C86 A;  4R57 A;  1V6C A;  3HUV A;  1Y9Z A;  3HPG G;  2EZC A;  3LOD A;  3GIU A;  4LQG A;  2Q7B A;  3S6F A;  4RUH A;  3IFE A;  2V8D A;  2ZPA A;  3TLB A;  3KI9 A;  2AUM A;  3SJG A;  3OB1 B;  2QIR A;  4KSA A;  1YQE A;  3BJ7 A;  4AB7 A;  1Z8L A;  3PRT A;  3QAH A;  4MRI A;  1WVM A;  4CS0 B;  4O23 A;  3VGO A;  4COB A;  2XPO A;  3DSB A;  2AFO A;  4KUA A;  4PXD A;  4CGL A;  4HNW B;  1S7N A;  2HI6 A;  2J8R A;  4A31 A;  2BEI A;  5JH9 A;  1MJA A;  4MCQ A;  2Q04 A;  2ZEP A;  4UCN A;  2PQ8 A;  3WT4 A;  4CAF A;  1IY7 A;  3KQX A;  3N5F A;  4CZ1 A;  4YWY A;  4Z65 A;  1T36 B;  1FY7 A;  2Q44 A;  4R9M A;  3RNZ A;  4H1H A;  1M1D A;  3FYN A;  2GE3 A;  2ODF A;  3FIX A;  2AFU A;  1Z4E A;  2PSW A;  2R98 A;  2RFH A;  1ZYM A;  4U9Y A;  3D66 A;  3GB0 A;  4IHM A;  1GGO A;  4ZY2 A;  3DLJ A;  4BMH A;  2B5G B;  2Q4Y A;  4OC2 A;  2REF A;  3F8K A;  3FVL A;  4NF1 A;  4UWJ A;  5K8P A;  5KTD A;  3VRN A;  1I12 A;  4AVB A;  4E94 A;  1CG2 A;  4XNH C;  1YVO A;  4M6G A;  3BLN A;  5ISV A;  3R9E A;  2E28 A;  5F9M A;  4C8U A;  2YNE A;  2ZOG A;  4OKO A;  3VWD A;  3TOB A;  3BI1 A;  4MFJ A;  1B87 A;  2DF5 A;  2QJ8 A;  4ZYQ A;  4COG A;  2HUZ A;  1QMU A;  4MHN A;  4B5O A;  2PCU A;  3G3S A;  3HLP A;  2O4H A;  3K9T A;  4KS9 A;  5EC4 A;  5K8M A;  2WPW A;  2YJV A;  4A2Z A;  4ZGY B;  2DPT A;  2VZZ A;  5JYB A;  3TOA A;  3VAT A;  3BUW B;  1LAM A;  5LRK A;  2ZEH A;  3B3T A;  3KRV A;  3PB9 X;  6CPA A;  3SXN A;  3GYA A;  4R8F A;  1Y0R A;  1YRE A;  2JLM A;  5AG5 A;  1XJO A;  5GCN A;  2HQY A;  3P2F A;  3SXO A;  2IJZ A;  3JRU A;  2X7B A;  1CJW A;  2WSA A;  2JEV A;  4P45 A;  1AYE A;  3B3C A;  2G0B A;  3NOJ A;  1LFW A;  3GKR A;  1Q2Y A;  1MK4 A;  3N7Z A;  4IF5 A;  4AG7 A;  4B5P A;  5I4M A;  1QQ9 A;  2ZW5 A;  2PRB A;  2AUN A;  2XPN A;  1Z8T A;  3CDX A;  3NFZ A;  3H8F A;  4ZX9 A;  2PJC A;  5G20 A;  5CPA A;  3V7Z A;  1JDB C;  3FED A;  4QC6 A;  1DIK A;  1CP7 A;  3EZB A;  4Y49 C;  5AXI A;  1PUA A;  1CP6 A;  1Q2C A;  3BXM A;  1QSM A;  2DEA A;  4ZI6 A;  2PRQ A;  2Q4Z A;  3FEC A;  2CIJ A;  2ATR A;  1UFH A;  1Y7R A;  3O8Z A;  4RS2 A;  1CPS A;  3BHX A;  2O28 A;  4UIA A;  4A37 A;  4P6Y A;  1CX8 A;  4UEE A;  4BBH A;  4B14 A;  1KUY A;  2R8V A;  4JZ0 A;  3E0K A;  1XE4 A;  4I49 A;  2J8M A;  4KOT A;  4QBJ A;  3ICU A;  4CGP A;  4PK2 A;  4NGM A;  3TCV A;  4B10 A;  5KTC A;  3CXQ A;  3IWE A;  4KOV A;  3B35 A;  4UFV A;  3SJE A;  3B3W A;  5E96 A;  5G21 A;  4J3G A;  2D4O A;  1TKJ A;  4MY0 A;  5JVL A;  1EZB A;  2ZEF A;  3FX6 A;  1IID A;  2GRE A;  2Y0M A;  2CY2 A;  1U6M A;  4Q38 A;  3SI0 A;  2ZOF A;  2XEF A;  4XPL A;  3IEH A;  4JWP A;  1S60 A;  1YME A;  5HH1 A;  4A30 A;  3CPX A;  2D0O A;  3DDD A;  3TLG B;  3H4Q A;  2ZEG A;  2QYV A;  2R7H A;  4OP4 A;  3U1B A;  1Y9W A;  3EIF A;  3WC6 A;  3R9G A;  3D2P A;  4EME A;  4C9E A;  2GP4 A;  1IU8 A;  3IGR A;  2EZA A;  4MHY A;  3QAY A;  3RAM A;  5IV0 A;  3TLY A;  2PIZ A;  2O53 A;  2V8G A;  1IGB A;  3H8G A;  1TF9 A;  2P6F A;  3EXN A;  4ZY0 A;  4YN3 A;  4P4F A;  1VBG A;  2B4D B;  4PXC A;  2BOA A;  2Y1M A;  3B3S A;  4G1P A;  4C8A A;  1M4I A;  1GYT A;  2QML A;  3NH5 A;  3EO4 A;  1R57 A;  4FWU A;  3T9Y A;  4PXE A;  2H5M A;  2XEG A;  3CXP A;  4EVY A;  1BPN A;  4CPA A;  3ZNI A;  4BTF A;  2WPX A;  3TT2 A;  1RO5 A;  2JBJ A;  1PYT B;  2CF4 A;  5IX3 A;  1M4L A;  1ARM A;  2BL1 A;  1BOB A;  3TC8 A;  3FH4 A;  3HMJ G;  2AFM A;  4NJQ A;  4C99 A;  4MFK A;  2GIV A;  4KNG E;  2FCK A;  2Q43 A;  4C9A A;  3F9K C;  4KLW A;  1TKH A;  3SHP A;  1CE8 B;  3PZJ A;  4ONW A;  1R43 A;  2Z3L A;  3GLJ A;  4P4B A;  2FXF A;  3LWU A;  3PGP A;  1Y0Y A;  2OH1 A;  2PJ7 A;  3L2N A;  1B6B A;  3PFE A;  4JXQ A;  4OLL A;  5DWM A;  4A38 A;  4NFR A;  4JVO A;  2OZH A;  3NH4 A;  4MHZ A;  3D7G A;  2BO9 A;  3NH8 A;  3PEI A;  3B3V A;  3KAS A;  3WR7 A;  2N3A B;  1S3Z A;  5THW A;  1J3L A;  3I1U A;  2C6P A;  4U5Y A;  2QEC A;  1MJB A;  4XPD C;  4NGR A;  4JD6 A;  4BD9 A;  2PJ8 A;  3ISX A;  5HMN A;  3CT9 A;  3P2H A;  4P4D A;  4CGO A;  2BUE A;  2XPL A;  4MCR A;  4IUS A;  4II9 A;  2EWB A;  1L0C A;  3VAR A;  4KOS A;  4UFW A;  1RXT A;  4MCS A;  2NYQ A;  4PQA A;  2EK8 A;  4XPK A;  4Y49 B;  2XEJ A;  4TJX A;  2Q4V A;  5LYF A;  1IYL A;  1NSA A;  3KHX A;  4OC5 A;  4DNC A;  4C85 A;  3TTH A;  1F57 A;  2Z3M A;  1V0C A;  5G1Z A;  1OBR A;  3NFQ A;  3S6K A;  2FVG A;  4KUB A;  4UA3 A;  2C6G A;  2PC1 A;  3W6X A;  3PFO A;  3IC1 A;  4A95 A;  2KCW A;  5K8N A;  1VI4 A;  1C3O B;  1ZL0 A;  2AFX A;  3KR4 A;  3KGQ A;  3C8O A;  3B8G A;  3IU2 A;  1OZP A;  1A2Z A;  1NE9 A;  4OAE A;  3VH9 A;  4B13 A;  1KBL A;  3ISZ A;  4F9U A;  1HDU A;  4C7I A;  1WWZ A;  4GPL B;  2I00 A;  3BUX B;  1KUX A;  1VHE A;  1YGH A;  2IQ6 A;  2PJ0 A;  4OIW A;  2OZU A;  5F46 A;  3R1K A;  3D2M A;  1M4D A;  3WC7 A;  4C2Z A;  4KOY A;  1LAP A;  5D8N A;  4C8C A;  4OAD A;  4MJX A;  2YNC A;  2PJ3 A;  4ZBG A;  2C27 A;  4IAV A;  4LX9 A;  1I21 A;  1Z4R A;  5G22 A;  3BUN B;  2Z10 A;  3D8P A;  5C88 A;  4CRY B;  1KZF A;  3DR8 A;  3LMS A;  3T90 A;  4K3N A;  5F48 A;  1C30 B;  3U88 C;  4F0X A;  4UIB A;  2IL4 A;  4UEZ A;  1DTD A;  4PSW A;  5F13 A;  3HPH E;  2Z3K A;  2DPS A;  3TYX A;  4NGS A;  4CAE A;  1TXR A;  1AMP A;  1ZLH A;  4A39 A;  5K99 A;  3IWW A;  2VXK A;  4JYW A;  2BCO A;  5DWN A;  4AG9 A;  2HV2 A;  2JBK A;  4NJR A;  2YND A;  4HNX B;  4ONU A;  4FUU A;  4KVX A;  3UY5 A;  4CDK A;  1YW6 A;  3W6S A;  4FD7 A;  4HPS A;  2FE7 A;  3FB3 A;  3JUW A;  4CYQ A;  3MN8 A;  2I79 A;  4TJV A;  4OC0 A;  2PJA A;  2J8N A;  2BSW A;  4R7M A;  1CM0 A;  5AG7 A;  2GLJ A;  4MHP A;  5FVJ A;  2YJT A;  2REE A;  2MP0 A;  1S7L A;  4R3K A;  1VKC A;  4TNU A;  2WUU A;  1XEB A;  2HWG A;  4C8P A;  1IIC A;  1S7F A;  5J1Q A;  3D3S A;  5EBV A;  3T07 A;  1XIX A;  2PJ4 A;  2ZEL A;  3TLG A;  1B47 A;  2I3C A;  2VKZ G;  1JQG A;  4RR2 B;  2VZY A;  3FEE A;  4OC4 A; 
#chains in the Genus database with same CATH homology
 2GLF A;  4DYO A;  4P10 A;  1TKF A;  4IK2 A;  4A94 A;  2C6C A;  5D29 A;  2QVP A;  1BPM A;  1XF1 A;  1ZG9 A;  2RB7 A;  1BLL E;  1Q7L A;  4OME A;  3S9N A;  4NGN A;  5HVH A;  2ZED A;  4F9V A;  2PE3 A;  2EK9 A;  4R6T A;  2PJ6 A;  3KL9 A;  3KQZ A;  1RTQ A;  2F8H A;  3WC5 A;  4OC3 A;  3BI0 A;  1VHO A;  2ABZ A;  5JM6 A;  3VTA A;  3KZW A;  3QNV A;  3DGV A;  4EFD A;  1F2O A;  2PVV A;  4C9V A;  1UWY A;  4CDJ A;  1FT7 A;  4TWE A;  3TX8 A;  4ZY1 A;  2C5Q A;  5F09 A;  1HEE A;  2PJ1 A;  2V77 A;  5HVF A;  3I74 A;  4UEF A;  1VGY A;  2ANP A;  2F7V A;  2ZEO A;  5CBM A;  3IIB A;  3IO1 A;  4UF4 A;  4P4J A;  2WZN A;  4P44 A;  4WWV A;  3GUX A;  4Q7A A;  1CPX A;  3MRU A;  3FJU A;  1XMB A;  2HB6 A;  5LRJ A;  5HXD A;  1ZG7 A;  3PBE A;  2WYR A;  1H8L A;  3FMC A;  4P4E A;  4FBE A;  4PXB A;  1LCP A;  3PB7 X;  2C1C A;  3PBB A;  4KSI A;  2AFW A;  2JEW A;  1ELL P;  3S9M A;  1ELM P;  3V38 A;  3H8E A;  2POK A;  3B2Y A;  3D68 A;  1WVM A;  3PB6 X;  4GM5 A;  3WAB A;  4OID A;  4ZX8 A;  3RZA A;  3I6S A;  4H2K A;  5IR2 A;  1Z2L A;  3PB4 X;  2J9A A;  1ZG8 A;  8CPA A;  5LYL A;  1XRY A;  3SI1 A;  5ELY A;  5LRG A;  2V8V A;  3D67 A;  4YU9 A;  4C8F A;  4X2T A;  3CPA A;  2PJ9 A;  2Q51 A;  4W9Y A;  1BAV A;  2G9D A;  1FNO A;  3PB8 X;  3K2K A;  4X3R A;  1Z5R A;  2AFZ A;  3IJ3 A;  2ZEM A;  4DUK A;  4R76 A;  5LYD A;  3S9L A;  2PIY A;  5LYI A;  4MCP A;  1YSJ A;  2CTB A;  1DE4 C;  2ZEE A;  4C84 A;  4C8T A;  3FF3 A;  4PPZ A;  4B6Z A;  3NA6 A;  4FAI A;  4F8Z A;  3D7F A;  3D4U A;  1Y7E A;  4DJL A;  1VIX A;  5K8O A;  3SJF A;  1HDQ A;  4OC1 A;  7CPA A;  2GU2 A;  2AFS A;  4MMO A;  1LAN A;  5IB9 A;  5JGF A;  4NGQ A;  1TF8 A;  1CBX A;  1YW4 A;  4C9R A;  5DS0 A;  1R3N A;  4AXV A;  1KWM A;  3KR5 A;  4C9U A;  2VL1 A;  4EWT A;  1XBU A;  2IMO A;  5HVG A;  2PVW A;  3T8W A;  2ZEN A;  2OOT A;  2XEI A;  1XFO A;  1PCA A;  3D7H A;  3KHZ A;  4WJB A;  2CTC A;  2NSM A;  2V8H A;  1F2P A;  4MXU A;  1ZLI A;  3B7I A;  2OR4 A;  2PJ5 A;  2HC9 A;  1EE3 P;  4X8I A;  3SJX A;  1ARL A;  1LOK A;  4NGT A;  3RBU A;  4NGP A;  3SI2 A;  3D7D A;  1YLO A;  2PJ2 A;  2PJB A;  4P4I A;  4C86 A;  1V6C A;  3HUV A;  1Y9Z A;  4LQG A;  4RUH A;  3IFE A;  2V8D A;  3KI9 A;  3SJG A;  1Z8L A;  3PRT A;  4MRI A;  4O23 A;  4PXD A;  2AFO A;  5JH9 A;  4MCQ A;  2ZEP A;  3WT4 A;  1IY7 A;  3KQX A;  3N5F A;  4YWY A;  4Z65 A;  2AFU A;  2RFH A;  3D66 A;  3GB0 A;  4IHM A;  4ZY2 A;  3DLJ A;  3FVL A;  4KNG E;  4OC2 A;  5K8P A;  1CG2 A;  4C8U A;  2ZOG A;  4OKO A;  3BI1 A;  2QJ8 A;  4ZYQ A;  1QMU A;  4MHN A;  2PCU A;  3HLP A;  2O4H A;  3K9T A;  5K8M A;  3VAT A;  1LAM A;  5LRK A;  2ZEH A;  3B3T A;  3PB9 X;  6CPA A;  4R8F A;  1Y0R A;  1XJO A;  2IJZ A;  3JRU A;  1AYE A;  4P45 A;  3B3C A;  1LFW A;  5I4M A;  1QQ9 A;  3CDX A;  3NFZ A;  3H8F A;  4ZX9 A;  2PJC A;  3V7Z A;  5CPA A;  3FED A;  1CP7 A;  1CP6 A;  3BXM A;  2DEA A;  4ZI6 A;  2PRQ A;  2Q4Z A;  3FEC A;  2CIJ A;  4A37 A;  1CPS A;  3BHX A;  4UIA A;  4P6Y A;  1CX8 A;  4UEE A;  4JZ0 A;  3ICU A;  4NGM A;  3B35 A;  3SJE A;  3B3W A;  1TKJ A;  3FX6 A;  2ZEF A;  2GRE A;  3SI0 A;  2ZOF A;  2XEF A;  3IEH A;  1YME A;  3CPX A;  2ZEG A;  2QYV A;  4OP4 A;  3EIF A;  3WC6 A;  4C9E A;  4EME A;  2GP4 A;  4MHY A;  3RAM A;  2PIZ A;  2O53 A;  2V8G A;  1IGB A;  3H8G A;  1TF9 A;  4ZY0 A;  4YN3 A;  4P4F A;  4PXC A;  2BOA A;  3B3S A;  4G1P A;  4C8A A;  1GYT A;  3NH5 A;  4FWU A;  4PXE A;  2XEG A;  1BPN A;  4CPA A;  2JBJ A;  1PYT B;  2CF4 A;  1M4L A;  1ARM A;  3TC8 A;  3FH4 A;  2AFM A;  4NJQ A;  4C99 A;  2Q43 A;  4C9A A;  1TKH A;  4ONW A;  1R43 A;  3GLJ A;  4P4B A;  3LWU A;  1Y0Y A;  2PJ7 A;  3PFE A;  3L2N A;  4A38 A;  4NFR A;  3NH4 A;  4MHZ A;  3D7G A;  2BO9 A;  3NH8 A;  3PEI A;  3B3V A;  3KAS A;  5THW A;  3I1U A;  2C6P A;  4NGR A;  4BD9 A;  2PJ8 A;  3ISX A;  3CT9 A;  4P4D A;  4MCR A;  2EWB A;  3VAR A;  4MCS A;  2NYQ A;  4PQA A;  2EK8 A;  2XEJ A;  4TJX A;  5LYF A;  1NSA A;  3KHX A;  4OC5 A;  4C85 A;  1F57 A;  1OBR A;  2FVG A;  2C6G A;  3PFO A;  3IC1 A;  5K8N A;  2AFX A;  3KR4 A;  3KGQ A;  3VH9 A;  3ISZ A;  4F9U A;  1HDU A;  2PJ0 A;  1VHE A;  2IQ6 A;  4OIW A;  3WC7 A;  1LAP A;  5D8N A;  4C8C A;  2PJ3 A;  4IAV A;  3LMS A;  4K3N A;  4UIB A;  4UEZ A;  1DTD A;  4NGS A;  1TXR A;  1AMP A;  1ZLH A;  4A39 A;  3IWW A;  4JYW A;  2BCO A;  2JBK A;  4NJR A;  4FUU A;  4CDK A;  1YW6 A;  4TJV A;  3MN8 A;  4OC0 A;  2PJA A;  4R7M A;  2GLJ A;  4MHP A;  4TNU A;  4C8P A;  5J1Q A;  2PJ4 A;  2ZEL A;  2I3C A;  1JQG A;  3FEE A;  4OC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...