4OCHA

Apo structure of smr domain of muts2 from deinococcus radiodurans
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
RFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease MutS2
publication title Structural and functional studies of MutS2 from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 28
structure length 82
sequence length 82
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ochA00
4OCHA 3QD7X 2VKCA 2D9IA 2ZQEA 4OD6A 3FAUA
chains in the Genus database with same CATH superfamily
2CTLA 2O4CA 4AM3A 4YY3H 4DR5H 3T1HH 3U1KA 2CPQA 1XNRH 4LF4H 1DT4A 2JVZA 4EC5A 4WALA 1J5KA 4DV4H 1XMQH 3L7ZC 1HNWH 2HH2A 4H8AA 1Z2IA 2K1HA 4DR7H 4NZTM 4B3SH 1VBIA 3J80W 4B8CD 4DR1H 4JYAH 1EC6A 2UXCH 5DT9A 4BA1I 2UXBH 2D9IA 1TUAA 4KHPH 4JI3H 2Y3MA 4JI4H 4YHHH 4AQYH 1N34H 1KHMA 5C0XG 3QD7X 1IBLH 4JV5H 2PQUA 4K0KH 4JI8H 4LF5H 4OD6A 2FFMA 1X0AA 4DV5H 5K36G 5A2QW 4LFCH 2YQRA 2CTFA 1FKAH 4NXMH 2M6QA 2M8WA 1WE8A 4BA2I 3KDKA 4JI1H 4DV0H 4DV2H 1X9ZA 4JI0H 1S03G 3SB1A 3OTOH 1X4NA 2JA9A 1ZZKA 2CTKA 2P2RA 2QNDA 3GKUA 4DV7H 4GKJH 2CTEA 1ZZJA 4LF8H 3FAUA 1V8CA 3J7AK 4X62H 2F4VH 1WHRA 4DR3H 2E5LH 1SEIA 4LFBH 1N32H 2X06A 4DUYH 1MSZA 2CPMA 3EZJA 2A1SA 2DGRA 1IBKH 4LF7H 1ZZIA 3AEVB 1XRHA 2AXYA 4B3RH 2UUAH 4PDBA 4LIJA 4X65H 5IT9W 2LRRA 4AIMA 2JEAI 1HNXH 1N36H 2CTMA 1NXUA 4G08A 3KDGA 5IWAH 4JI2H 1IBMH 4DV1H 5LMNH 3V69A 2OPUA 2NN6G 4X66H 2ANNA 3NCVA 3OETA 4E9JA 2UU9H 4OO1G 4JVHA 2FMRA 3GR5A 5BR8H 2UUBH 2CWHA 4B3TH 2JE6I 2PY9A 1K1GA 4B3MH 5JEAG 2UXDH 2ZM6H 3GABA 1VIHA 1UG8A 2JZXA 4DR6H 2CWFA 4FJSA 1N33H 3T1YH 4LF9H 2LF0A 2ZQEA 4NZRM 1V9NA 4OX9H 4NBQA 4LF6H 4X64H 4DR2H 4DV3H 1WTJA 1HNZH 1WVNA 2VKCA 2Z0SA 1S20A 3I0PA 1FJGH 2BL5A 2PT7G 2ANRA 3J81W 5LMUH 2VQFH 4IFDG 1F0XA 1VIGA 2LTMA 3RF2A 4JI5H 1PQXA 2G8YA 1ZTGA 4JI7H 4DUZH 1I6UA 2CTJA 3JAMW 2HHHH 4FJUA 1J4WA 5LL6b 2UUCH 5FLXW 4NXNH 1AN7A 2OPVA 4LFAH 4GKKH 1XNQH 4JVYA 3UOEA 4DV6H 2JEBI 4DR4H 1ODHA 1X4MA 2VQEH 4JI6H 2FPHX 4OCHA 4B8TA 3OSSD 4WANA 2MJHA 2E3UA 4QMFB 3VKEA 2LTLA 1DTJA 2HH3A 2BA0A 1J5EH 1XMOH 1HR0H 1I94H
chains in the Genus database with same CATH topology
2O4CA 4YY3H 4DR5H 3T1HH 1XNRH 4LF4H 4EC5A 4DV4H 1XMQH 1HNWH 4DR7H 4NZTM 4B3SH 3J80W 4B8CD 4DR1H 4JYAH 2UXCH 5DT9A 2UXBH 2D9IA 4KHPH 4JI3H 2Y3MA 4JI4H 4YHHH 4AQYH 1N34H 1IBLH 3QD7X 4JV5H 4K0KH 4JI8H 4LF5H 4OD6A 4DV5H 5A2QW 4LFCH 1FKAH 4NXMH 3KDKA 4JI1H 4DV0H 4DV2H 1X9ZA 4JI0H 1S03G 3SB1A 3OTOH 4DV7H 4GKJH 4LF8H 3FAUA 3J7AK 4X62H 2F4VH 4DR3H 2E5LH 1SEIA 4LFBH 1N32H 4DUYH 3EZJA 1IBKH 4LF7H 4PDBA 2UUAH 4X65H 5IT9W 1HNXH 1N36H 4G08A 5IWAH 3KDGA 4JI2H 1IBMH 4DV1H 5LMNH 4X66H 3NCVA 3OETA 4E9JA 2UU9H 3GR5A 5BR8H 2UUBH 4B3TH 2UXDH 4B3MH 2ZM6H 3GABA 4DR6H 1N33H 3T1YH 4LF9H 2LF0A 2ZQEA 4NZRM 4OX9H 4LF6H 4X64H 4DR2H 4DV3H 1HNZH 2VKCA 1FJGH 2PT7G 3J81W 5LMUH 2VQFH 1F0XA 4JI5H 3RF2A 4JI7H 4DUZH 1I6UA 3JAMW 2HHHH 5LL6b 2UUCH 5FLXW 4NXNH 1AN7A 4GKKH 4LFAH 1XNQH 4DV6H 4DR4H 1ODHA 4JI6H 2VQEH 2FPHX 4OCHA 3OSSD 4B3RH 1J5EH 1XMOH 1HR0H 1I94H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCH A;  3QD7 X;  2VKC A;  2D9I A;  2ZQE A;  4OD6 A;  3FAU A; 
#chains in the Genus database with same CATH topology
 2CTL A;  2O4C A;  4AM3 A;  4YY3 H;  4DR5 H;  3T1H H;  3U1K A;  2CPQ A;  1XNR H;  4LF4 H;  1DT4 A;  2JVZ A;  4EC5 A;  4WAL A;  1J5K A;  4DV4 H;  1XMQ H;  3L7Z C;  1HNW H;  2HH2 A;  4H8A A;  1Z2I A;  2K1H A;  4DR7 H;  4NZT M;  4B3S H;  1VBI A;  3J80 W;  4B8C D;  4DR1 H;  4JYA H;  1EC6 A;  2UXC H;  5DT9 A;  4BA1 I;  2UXB H;  2D9I A;  1TUA A;  4KHP H;  4JI3 H;  2Y3M A;  4JI4 H;  4YHH H;  4AQY H;  1N34 H;  1KHM A;  5C0X G;  3QD7 X;  1IBL H;  4JV5 H;  2PQU A;  4K0K H;  4JI8 H;  4LF5 H;  4OD6 A;  2FFM A;  1X0A A;  4DV5 H;  5K36 G;  5A2Q W;  4LFC H;  2YQR A;  2CTF A;  1FKA H;  4NXM H;  2M6Q A;  2M8W A;  1WE8 A;  4BA2 I;  3KDK A;  4JI1 H;  4DV0 H;  4DV2 H;  1X9Z A;  4JI0 H;  1S03 G;  3SB1 A;  3OTO H;  1X4N A;  2JA9 A;  1ZZK A;  2CTK A;  2P2R A;  2QND A;  3GKU A;  4DV7 H;  4GKJ H;  2CTE A;  1ZZJ A;  4LF8 H;  3FAU A;  1V8C A;  3J7A K;  4X62 H;  2F4V H;  1WHR A;  4DR3 H;  2E5L H;  1SEI A;  4LFB H;  1N32 H;  2X06 A;  4DUY H;  1MSZ A;  2CPM A;  3EZJ A;  2A1S A;  2DGR A;  1IBK H;  4LF7 H;  1ZZI A;  3AEV B;  1XRH A;  2AXY A;  4B3R H;  2UUA H;  4PDB A;  4LIJ A;  4X65 H;  5IT9 W;  2LRR A;  4AIM A;  2JEA I;  1HNX H;  1N36 H;  2CTM A;  1NXU A;  4G08 A;  3KDG A;  5IWA H;  4JI2 H;  1IBM H;  4DV1 H;  5LMN H;  3V69 A;  2OPU A;  2NN6 G;  4X66 H;  2ANN A;  3NCV A;  3OET A;  4E9J A;  2UU9 H;  4OO1 G;  4JVH A;  2FMR A;  3GR5 A;  5BR8 H;  2UUB H;  2CWH A;  4B3T H;  2JE6 I;  2PY9 A;  1K1G A;  4B3M H;  5JEA G;  2UXD H;  2ZM6 H;  3GAB A;  1VIH A;  1UG8 A;  2JZX A;  4DR6 H;  2CWF A;  4FJS A;  1N33 H;  3T1Y H;  4LF9 H;  2LF0 A;  2ZQE A;  4NZR M;  1V9N A;  4OX9 H;  4NBQ A;  4LF6 H;  4X64 H;  4DR2 H;  4DV3 H;  1WTJ A;  1HNZ H;  1WVN A;  2VKC A;  2Z0S A;  1S20 A;  3I0P A;  1FJG H;  2BL5 A;  2PT7 G;  2ANR A;  3J81 W;  5LMU H;  2VQF H;  4IFD G;  1F0X A;  1VIG A;  2LTM A;  3RF2 A;  4JI5 H;  1PQX A;  2G8Y A;  1ZTG A;  4JI7 H;  4DUZ H;  1I6U A;  2CTJ A;  3JAM W;  2HHH H;  4FJU A;  1J4W A;  5LL6 b;  2UUC H;  5FLX W;  4NXN H;  1AN7 A;  2OPV A;  4LFA H;  4GKK H;  1XNQ H;  4JVY A;  3UOE A;  4DV6 H;  2JEB I;  4DR4 H;  1ODH A;  1X4M A;  2VQE H;  4JI6 H;  2FPH X;  4OCH A;  4B8T A;  3OSS D;  4WAN A;  2MJH A;  2E3U A;  4QMF B;  3VKE A;  2LTL A;  1DTJ A;  2HH3 A;  2BA0 A;  1J5E H;  1XMO H;  1HR0 H;  1I94 H; 
#chains in the Genus database with same CATH homology
 2O4C A;  4YY3 H;  4DR5 H;  3T1H H;  1XNR H;  4LF4 H;  4EC5 A;  4DV4 H;  1XMQ H;  1HNW H;  4DR7 H;  4NZT M;  4B3S H;  3J80 W;  4B8C D;  4DR1 H;  4JYA H;  2UXC H;  5DT9 A;  2UXB H;  2D9I A;  4KHP H;  4JI3 H;  2Y3M A;  4JI4 H;  4YHH H;  4AQY H;  1N34 H;  1IBL H;  3QD7 X;  4JV5 H;  4K0K H;  4JI8 H;  4LF5 H;  4OD6 A;  4DV5 H;  5A2Q W;  4LFC H;  1FKA H;  4NXM H;  3KDK A;  4JI1 H;  4DV0 H;  4DV2 H;  1X9Z A;  4JI0 H;  1S03 G;  3SB1 A;  3OTO H;  4DV7 H;  4GKJ H;  4LF8 H;  3FAU A;  3J7A K;  4X62 H;  2F4V H;  4DR3 H;  2E5L H;  1SEI A;  4LFB H;  1N32 H;  4DUY H;  3EZJ A;  1IBK H;  4LF7 H;  4PDB A;  2UUA H;  4X65 H;  5IT9 W;  1HNX H;  1N36 H;  4G08 A;  5IWA H;  3KDG A;  4JI2 H;  1IBM H;  4DV1 H;  5LMN H;  4X66 H;  3NCV A;  3OET A;  4E9J A;  2UU9 H;  3GR5 A;  5BR8 H;  2UUB H;  4B3T H;  2UXD H;  4B3M H;  2ZM6 H;  3GAB A;  4DR6 H;  1N33 H;  3T1Y H;  4LF9 H;  2LF0 A;  2ZQE A;  4NZR M;  4OX9 H;  4LF6 H;  4X64 H;  4DR2 H;  4DV3 H;  1HNZ H;  2VKC A;  1FJG H;  2PT7 G;  3J81 W;  5LMU H;  2VQF H;  1F0X A;  4JI5 H;  3RF2 A;  4JI7 H;  4DUZ H;  1I6U A;  3JAM W;  2HHH H;  5LL6 b;  2UUC H;  5FLX W;  4NXN H;  1AN7 A;  4GKK H;  4LFA H;  1XNQ H;  4DV6 H;  4DR4 H;  1ODH A;  4JI6 H;  2VQE H;  2FPH X;  4OCH A;  3OSS D;  4B3R H;  1J5E H;  1XMO H;  1HR0 H;  1I94 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...