4OCHA

Apo structure of smr domain of muts2 from deinococcus radiodurans
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
RFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional studies of MutS2 from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Endonuclease MutS2
total genus 28
structure length 82
sequence length 82
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ochA00
2D9IA 3FAUA 4OCHA 2ZQEA 4OD6A 3QD7X 2VKCA
chains in the Genus database with same CATH superfamily
4X64H 2PY9A 2CTMA 4YHHH 4AM3A 5LMUH 4DUYH 5JEAG 3V69A 3RF2A 3EZJA 2M6QA 3SB1A 3QD7X 3OETA 4DR7H 1K1GA 1ZTGA 3J80W 4H8AA 2HHHH 1Z2IA 3J81W 4LF9H 5A2QW 3AEVB 1IBKH 2P2RA 2AXYA 2UU9H 5IT9W 2CPQA 5FLXW 1XMQH 2QNDA 1WTJA 3KDGA 4DR3H 2UXBH 1X4NA 1I94H 4JYAH 2LTMA 1FJGH 5K36G 4OD6A 4JI1H 2VQEH 2PQUA 4DR4H 2CWFA 1WE8A 1HNXH 4LIJA 4LF6H 1J4WA 1XNRH 4DR5H 2CTKA 4AQYH 2DGRA 4LF7H 2HH2A 2CWHA 3OSSD 1TUAA 4FJUA 1I6UA 4DV3H 4DV5H 4JVHA 1ZZJA 2K1HA 4DUZH 2MJHA 1ZZKA 2E3UA 2NN6G 1F0XA 5BR8H 1NXUA 1VIHA 2CPMA 4B8TA 2UUCH 4JI2H 4EC5A 2ANNA 4JI8H 3GABA 4NZRM 1IBMH 2HH3A 1V8CA 2LF0A 1ODHA 1V9NA 2JA9A 2JVZA 2A1SA 4AIMA 4B3SH 4BA1I 4DV6H 2BL5A 4YY3H 1S20A 2FMRA 4G08A 4DV1H 1HNZH 4B3TH 4NZTM 2F4VH 2BA0A 1IBLH 4B3RH 4E9JA 4QMFB 4PDBA 2JE6I 2VQFH 2D9IA 1J5KA 4LFCH 4JI3H 2ZQEA 2Z0SA 1N32H 1N33H 5C0XG 3GKUA 1N36H 4LF8H 1MSZA 3JAMW 3OTOH 3U1KA 4DV0H 2CTJA 1N34H 1HR0H 4DV4H 1XMOH 1XNQH 1ZZIA 2YQRA 2CTFA 3I0PA 4LF4H 1X9ZA 2X06A 1UG8A 1X0AA 3T1HH 4OCHA 2ANRA 2OPVA 1S03G 5LMNH 1VBIA 1XRHA 5IWAH 4DR1H 4GKJH 4GKKH 4JVYA 4WANA 2VKCA 2JEBI 2CTLA 2UUBH 3UOEA 1FKAH 2UXDH 2UXCH 4X66H 4JI0H 4OX9H 3KDKA 4DR2H 5DT9A 4JI6H 2FPHX 4LFBH 4B3MH 1X4MA 2OPUA 1DTJA 3J7AK 4LFAH 1KHMA 4K0KH 1VIGA 3NCVA 2PT7G 2CTEA 4JI7H 3GR5A 4JV5H 2O4CA 4OO1G 1PQXA 4FJSA 1WHRA 1WVNA 4X65H 2UUAH 4LF5H 4JI4H 2LTLA 4DV7H 4NXMH 5LL6b 1AN7A 2LRRA 1DT4A 4JI5H 2FFMA 1J5EH 4WALA 4DR6H 4DV2H 2E5LH 4X62H 3VKEA 2JEAI 4KHPH 1SEIA 2G8YA 1EC6A 2M8WA 3FAUA 4BA2I 2ZM6H 4B8CD 4IFDG 2JZXA 3L7ZC 4NXNH 4NBQA 1HNWH 2Y3MA 3T1YH
chains in the Genus database with same CATH topology
4X64H 4YHHH 5LMUH 4DUYH 3RF2A 3EZJA 3SB1A 3QD7X 3OETA 4DR7H 4LF9H 3J80W 2HHHH 3J81W 5A2QW 1IBKH 5IT9W 2UU9H 5FLXW 1XMQH 4DR3H 3KDGA 2UXBH 1I94H 4JYAH 1FJGH 4OD6A 4JI1H 2VQEH 4DR4H 1HNXH 4LF6H 1XNRH 4DR5H 4AQYH 4LF7H 1I6UA 3OSSD 4DV3H 4DV5H 4DUZH 1F0XA 5BR8H 2UUCH 4JI2H 4EC5A 4JI8H 3GABA 4NZRM 1IBMH 2LF0A 1ODHA 4B3SH 4DV6H 4YY3H 4DV1H 4B3TH 4G08A 1HNZH 4NZTM 2F4VH 1IBLH 4B3RH 4E9JA 4PDBA 2VQFH 2D9IA 4LFCH 4JI3H 2ZQEA 1N32H 1N33H 1N36H 4LF8H 3JAMW 3OTOH 4DV0H 1N34H 1HR0H 4DV4H 1XMOH 1XNQH 4LF4H 1X9ZA 3T1HH 4OCHA 1S03G 5LMNH 4DR1H 5IWAH 4GKKH 4GKJH 2VKCA 2UUBH 1FKAH 2UXDH 2UXCH 4X66H 4JI0H 4OX9H 3KDKA 4DR2H 5DT9A 4JI6H 2FPHX 4LFBH 4B3MH 3J7AK 4LFAH 4K0KH 3NCVA 2PT7G 4JI7H 3GR5A 4JV5H 2O4CA 4X65H 2UUAH 4LF5H 4JI4H 4NXMH 4DV7H 5LL6b 1AN7A 4JI5H 1J5EH 4DR6H 4DV2H 2E5LH 4X62H 4KHPH 1SEIA 3FAUA 2ZM6H 4B8CD 1HNWH 4NXNH 2Y3MA 3T1YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9I A;  3FAU A;  4OCH A;  2ZQE A;  4OD6 A;  3QD7 X;  2VKC A; 
#chains in the Genus database with same CATH topology
 4X64 H;  2PY9 A;  2CTM A;  4YHH H;  4AM3 A;  5LMU H;  4DUY H;  5JEA G;  3V69 A;  3RF2 A;  3EZJ A;  2M6Q A;  3SB1 A;  3QD7 X;  3OET A;  4DR7 H;  1K1G A;  1ZTG A;  3J80 W;  4H8A A;  2HHH H;  1Z2I A;  3J81 W;  4LF9 H;  5A2Q W;  3AEV B;  1IBK H;  2P2R A;  2AXY A;  2UU9 H;  5IT9 W;  2CPQ A;  5FLX W;  1XMQ H;  2QND A;  1WTJ A;  3KDG A;  4DR3 H;  2UXB H;  1X4N A;  1I94 H;  4JYA H;  2LTM A;  1FJG H;  5K36 G;  4OD6 A;  4JI1 H;  2VQE H;  2PQU A;  4DR4 H;  2CWF A;  1WE8 A;  1HNX H;  4LIJ A;  4LF6 H;  1J4W A;  1XNR H;  4DR5 H;  2CTK A;  4AQY H;  2DGR A;  4LF7 H;  2HH2 A;  2CWH A;  3OSS D;  1TUA A;  4FJU A;  1I6U A;  4DV3 H;  4DV5 H;  4JVH A;  1ZZJ A;  2K1H A;  4DUZ H;  2MJH A;  1ZZK A;  2E3U A;  2NN6 G;  1F0X A;  5BR8 H;  1NXU A;  1VIH A;  2CPM A;  4B8T A;  2UUC H;  4JI2 H;  4EC5 A;  2ANN A;  4JI8 H;  3GAB A;  4NZR M;  1IBM H;  2HH3 A;  1V8C A;  2LF0 A;  1ODH A;  1V9N A;  2JA9 A;  2JVZ A;  2A1S A;  4AIM A;  4B3S H;  4BA1 I;  4DV6 H;  2BL5 A;  4YY3 H;  1S20 A;  2FMR A;  4G08 A;  4DV1 H;  1HNZ H;  4B3T H;  4NZT M;  2F4V H;  2BA0 A;  1IBL H;  4B3R H;  4E9J A;  4QMF B;  4PDB A;  2JE6 I;  2VQF H;  2D9I A;  1J5K A;  4LFC H;  4JI3 H;  2ZQE A;  2Z0S A;  1N32 H;  1N33 H;  5C0X G;  3GKU A;  1N36 H;  4LF8 H;  1MSZ A;  3JAM W;  3OTO H;  3U1K A;  4DV0 H;  2CTJ A;  1N34 H;  1HR0 H;  4DV4 H;  1XMO H;  1XNQ H;  1ZZI A;  2YQR A;  2CTF A;  3I0P A;  4LF4 H;  1X9Z A;  2X06 A;  1UG8 A;  1X0A A;  3T1H H;  4OCH A;  2ANR A;  2OPV A;  1S03 G;  5LMN H;  1VBI A;  1XRH A;  5IWA H;  4DR1 H;  4GKJ H;  4GKK H;  4JVY A;  4WAN A;  2VKC A;  2JEB I;  2CTL A;  2UUB H;  3UOE A;  1FKA H;  2UXD H;  2UXC H;  4X66 H;  4JI0 H;  4OX9 H;  3KDK A;  4DR2 H;  5DT9 A;  4JI6 H;  2FPH X;  4LFB H;  4B3M H;  1X4M A;  2OPU A;  1DTJ A;  3J7A K;  4LFA H;  1KHM A;  4K0K H;  1VIG A;  3NCV A;  2PT7 G;  2CTE A;  4JI7 H;  3GR5 A;  4JV5 H;  2O4C A;  4OO1 G;  1PQX A;  4FJS A;  1WHR A;  1WVN A;  4X65 H;  2UUA H;  4LF5 H;  4JI4 H;  2LTL A;  4DV7 H;  4NXM H;  5LL6 b;  1AN7 A;  2LRR A;  1DT4 A;  4JI5 H;  2FFM A;  1J5E H;  4WAL A;  4DR6 H;  4DV2 H;  2E5L H;  4X62 H;  3VKE A;  2JEA I;  4KHP H;  1SEI A;  2G8Y A;  1EC6 A;  2M8W A;  3FAU A;  4BA2 I;  2ZM6 H;  4B8C D;  4IFD G;  2JZX A;  3L7Z C;  4NXN H;  4NBQ A;  1HNW H;  2Y3M A;  3T1Y H; 
#chains in the Genus database with same CATH homology
 4X64 H;  4YHH H;  5LMU H;  4DUY H;  3RF2 A;  3EZJ A;  3SB1 A;  3QD7 X;  3OET A;  4DR7 H;  4LF9 H;  3J80 W;  2HHH H;  3J81 W;  5A2Q W;  1IBK H;  5IT9 W;  2UU9 H;  5FLX W;  1XMQ H;  4DR3 H;  3KDG A;  2UXB H;  1I94 H;  4JYA H;  1FJG H;  4OD6 A;  4JI1 H;  2VQE H;  4DR4 H;  1HNX H;  4LF6 H;  1XNR H;  4DR5 H;  4AQY H;  4LF7 H;  1I6U A;  3OSS D;  4DV3 H;  4DV5 H;  4DUZ H;  1F0X A;  5BR8 H;  2UUC H;  4JI2 H;  4EC5 A;  4JI8 H;  3GAB A;  4NZR M;  1IBM H;  2LF0 A;  1ODH A;  4B3S H;  4DV6 H;  4YY3 H;  4DV1 H;  4B3T H;  4G08 A;  1HNZ H;  4NZT M;  2F4V H;  1IBL H;  4B3R H;  4E9J A;  4PDB A;  2VQF H;  2D9I A;  4LFC H;  4JI3 H;  2ZQE A;  1N32 H;  1N33 H;  1N36 H;  4LF8 H;  3JAM W;  3OTO H;  4DV0 H;  1N34 H;  1HR0 H;  4DV4 H;  1XMO H;  1XNQ H;  4LF4 H;  1X9Z A;  3T1H H;  4OCH A;  1S03 G;  5LMN H;  4DR1 H;  5IWA H;  4GKK H;  4GKJ H;  2VKC A;  2UUB H;  1FKA H;  2UXD H;  2UXC H;  4X66 H;  4JI0 H;  4OX9 H;  3KDK A;  4DR2 H;  5DT9 A;  4JI6 H;  2FPH X;  4LFB H;  4B3M H;  3J7A K;  4LFA H;  4K0K H;  3NCV A;  2PT7 G;  4JI7 H;  3GR5 A;  4JV5 H;  2O4C A;  4X65 H;  2UUA H;  4LF5 H;  4JI4 H;  4NXM H;  4DV7 H;  5LL6 b;  1AN7 A;  4JI5 H;  1J5E H;  4DR6 H;  4DV2 H;  2E5L H;  4X62 H;  4KHP H;  1SEI A;  3FAU A;  2ZM6 H;  4B8C D;  1HNW H;  4NXN H;  2Y3M A;  3T1Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...