4OCHA

Apo structure of smr domain of muts2 from deinococcus radiodurans
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
b'RFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease MutS2
molecule tags Hydrolase
source organism Deinococcus radiodurans
publication title Structural and functional studies of MutS2 from Deinococcus radiodurans.
pubmed doi rcsb
total genus 28
structure length 82
sequence length 82
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ochA00
3FAUA 2ZQEA 2VKCA 3QD7X 2D9IA 4OCHA 4OD6A
chains in the Genus database with same CATH superfamily
4LF6H 1KHMA 2OPUA 1J5KA 3L7ZC 1S20A 4LFCH 1I6UA 2ZM6H 1ZZJA 3KDGA 2JZXA 4X65H 3KDKA 4LF4H 4NXMH 2QNDA 4GKJH 1HNXH 3GR5A 1IBLH 2FMRA 2CWFA 4JI7H 4DV3H 1X0AA 4LFAH 1X9ZA 1V9NA 2CPMA 4G08A 4LF8H 1HR0H 1N32H 2CPQA 2VQFH 2Z0SA 4YY3H 2LTLA 2VKCA 4LIJA 4X64H 1ZZKA 2FPHX 3T1YH 4DV4H 2PY9A 1VIGA 4JI1H 2ANRA 2ANNA 4K0KH 4AM3A 4DR4H 4JYAH 4LFBH 2UUCH 2CTEA 4NZRM 2NN6G 2LRRA 3FAUA 4OD6A 3SB1A 4E9JA 4X66H 5BR8H 3OETA 2VQEH 1AN7A 2UU9H 5LL6b 4DR6H 4BA2I 4FJSA 3OTOH 2HH2A 3I0PA 5IT9W 3EZJA 4DV5H 1MSZA 2HHHH 3AEVB 5IWAH 4AQYH 2E3UA 4JI8H 2JA9A 1SEIA 2Y3MA 2CTFA 1FKAH 2LF0A 4GKKH 3GKUA 2ZQEA 4LF9H 2CTJA 4B3MH 2BL5A 2M8WA 1XRHA 2M6QA 2JE6I 2A1SA 3UOEA 1X4MA 2AXYA 2CWHA 3J80W 4DUZH 3V69A 1ODHA 1J5EH 2P2RA 5DT9A 4LF7H 1V8CA 2YQRA 3J81W 1N34H 1HNWH 4WANA 4DV1H 1K1GA 1EC6A 5C0XG 3J7AK 4JI2H 5K36G 4DV2H 4NZTM 4DR7H 1N36H 4JVYA 1IBKH 2UUBH 4B3TH 1WTJA 4OCHA 4PDBA 2CTMA 1Z2IA 1XMQH 4B3RH 5JEAG 4JI6H 2UXCH 2JVZA 4DV0H 2MJHA 4EC5A 1WE8A 1PQXA 4BA1I 2HH3A 2UXBH 4NXNH 2OPVA 4B8CD 4JV5H 1F0XA 4DV7H 2DGRA 4YHHH 1XMOH 4AIMA 1NXUA 4B3SH 4FJUA 1VIHA 2PQUA 1DT4A 2UUAH 2E5LH 2FFMA 2K1HA 3T1HH 2G8YA 1J4WA 1DTJA 4OO1G 2PT7G 1WHRA 3GABA 4JI5H 2JEBI 3VKEA 1VBIA 4NBQA 4B8TA 4KHPH 2CTKA 2CTLA 4JI0H 2UXDH 1XNQH 4JVHA 3NCVA 5LMNH 1ZZIA 3JAMW 2BA0A 5FLXW 4WALA 1I94H 1FJGH 3RF2A 3OSSD 4X62H 1IBMH 1WVNA 5A2QW 4JI3H 4DR1H 1UG8A 3QD7X 4DR2H 4LF5H 4DR5H 2O4CA 1TUAA 2LTMA 4DR3H 2D9IA 1ZTGA 1S03G 2F4VH 4IFDG 3U1KA 1X4NA 2X06A 4QMFB 4JI4H 5LMUH 4DUYH 1XNRH 1N33H 1HNZH 2JEAI 4H8AA 4DV6H 4OX9H
chains in the Genus database with same CATH topology
4LF6H 4LFCH 2ZM6H 3KDGA 4X65H 3KDKA 4LF4H 4NXMH 4GKJH 1HNXH 3GR5A 1IBLH 4JI7H 4DV3H 4LFAH 1X9ZA 4G08A 4LF8H 1HR0H 1N32H 2VQFH 4YY3H 2VKCA 4X64H 2FPHX 3T1YH 4DV4H 4JI1H 4K0KH 4DR4H 4JYAH 4LFBH 2UUCH 4NZRM 3SB1A 3FAUA 4E9JA 5BR8H 4X66H 2VQEH 4OD6A 3OETA 2UU9H 1AN7A 4DR6H 5LL6b 3OTOH 5IT9W 3EZJA 4DV5H 2HHHH 5IWAH 4AQYH 4JI8H 1SEIA 2Y3MA 1FKAH 2LF0A 4GKKH 2ZQEA 4LF9H 4B3MH 1ODHA 3J80W 4LF7H 4DUZH 1J5EH 5DT9A 1N34H 3J81W 1HNWH 4DV1H 3J7AK 4JI2H 4DV2H 4NZTM 4DR7H 1N36H 1IBKH 2UUBH 4B3TH 4PDBA 4OCHA 1XMQH 4B3RH 4JI6H 2UXCH 4DV0H 4EC5A 2UXBH 4NXNH 4B8CD 4JV5H 1F0XA 4DV7H 4YHHH 1XMOH 4B3SH 2UUAH 2E5LH 3T1HH 1I6UA 2PT7G 3GABA 4JI5H 4KHPH 4JI0H 2UXDH 1XNQH 3NCVA 5LMNH 3JAMW 5FLXW 1FJGH 1I94H 3RF2A 3OSSD 4X62H 1IBMH 5A2QW 4JI3H 4DR1H 3QD7X 4DR2H 4LF5H 4DR5H 2O4CA 4DR3H 1S03G 2D9IA 2F4VH 4JI4H 1XNRH 5LMUH 4DUYH 1N33H 1HNZH 4DV6H 4OX9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  2ZQE A;  2VKC A;  3QD7 X;  2D9I A;  4OCH A;  4OD6 A; 
#chains in the Genus database with same CATH topology
 4LF6 H;  1KHM A;  2OPU A;  1J5K A;  3L7Z C;  1S20 A;  4LFC H;  1I6U A;  2ZM6 H;  1ZZJ A;  3KDG A;  2JZX A;  4X65 H;  3KDK A;  4LF4 H;  4NXM H;  2QND A;  4GKJ H;  1HNX H;  3GR5 A;  1IBL H;  2FMR A;  2CWF A;  4JI7 H;  4DV3 H;  1X0A A;  4LFA H;  1X9Z A;  1V9N A;  2CPM A;  4G08 A;  4LF8 H;  1HR0 H;  1N32 H;  2CPQ A;  2VQF H;  2Z0S A;  4YY3 H;  2LTL A;  2VKC A;  4LIJ A;  4X64 H;  1ZZK A;  2FPH X;  3T1Y H;  4DV4 H;  2PY9 A;  1VIG A;  4JI1 H;  2ANR A;  2ANN A;  4K0K H;  4AM3 A;  4DR4 H;  4JYA H;  4LFB H;  2UUC H;  2CTE A;  4NZR M;  2NN6 G;  2LRR A;  3FAU A;  4OD6 A;  3SB1 A;  4E9J A;  4X66 H;  5BR8 H;  3OET A;  2VQE H;  1AN7 A;  2UU9 H;  5LL6 b;  4DR6 H;  4BA2 I;  4FJS A;  3OTO H;  2HH2 A;  3I0P A;  5IT9 W;  3EZJ A;  4DV5 H;  1MSZ A;  2HHH H;  3AEV B;  5IWA H;  4AQY H;  2E3U A;  4JI8 H;  2JA9 A;  1SEI A;  2Y3M A;  2CTF A;  1FKA H;  2LF0 A;  4GKK H;  3GKU A;  2ZQE A;  4LF9 H;  2CTJ A;  4B3M H;  2BL5 A;  2M8W A;  1XRH A;  2M6Q A;  2JE6 I;  2A1S A;  3UOE A;  1X4M A;  2AXY A;  2CWH A;  3J80 W;  4DUZ H;  3V69 A;  1ODH A;  1J5E H;  2P2R A;  5DT9 A;  4LF7 H;  1V8C A;  2YQR A;  3J81 W;  1N34 H;  1HNW H;  4WAN A;  4DV1 H;  1K1G A;  1EC6 A;  5C0X G;  3J7A K;  4JI2 H;  5K36 G;  4DV2 H;  4NZT M;  4DR7 H;  1N36 H;  4JVY A;  1IBK H;  2UUB H;  4B3T H;  1WTJ A;  4OCH A;  4PDB A;  2CTM A;  1Z2I A;  1XMQ H;  4B3R H;  5JEA G;  4JI6 H;  2UXC H;  2JVZ A;  4DV0 H;  2MJH A;  4EC5 A;  1WE8 A;  1PQX A;  4BA1 I;  2HH3 A;  2UXB H;  4NXN H;  2OPV A;  4B8C D;  4JV5 H;  1F0X A;  4DV7 H;  2DGR A;  4YHH H;  1XMO H;  4AIM A;  1NXU A;  4B3S H;  4FJU A;  1VIH A;  2PQU A;  1DT4 A;  2UUA H;  2E5L H;  2FFM A;  2K1H A;  3T1H H;  2G8Y A;  1J4W A;  1DTJ A;  4OO1 G;  2PT7 G;  1WHR A;  3GAB A;  4JI5 H;  2JEB I;  3VKE A;  1VBI A;  4NBQ A;  4B8T A;  4KHP H;  2CTK A;  2CTL A;  4JI0 H;  2UXD H;  1XNQ H;  4JVH A;  3NCV A;  5LMN H;  1ZZI A;  3JAM W;  2BA0 A;  5FLX W;  4WAL A;  1I94 H;  1FJG H;  3RF2 A;  3OSS D;  4X62 H;  1IBM H;  1WVN A;  5A2Q W;  4JI3 H;  4DR1 H;  1UG8 A;  3QD7 X;  4DR2 H;  4LF5 H;  4DR5 H;  2O4C A;  1TUA A;  2LTM A;  4DR3 H;  2D9I A;  1ZTG A;  1S03 G;  2F4V H;  4IFD G;  3U1K A;  1X4N A;  2X06 A;  4QMF B;  4JI4 H;  5LMU H;  4DUY H;  1XNR H;  1N33 H;  1HNZ H;  2JEA I;  4H8A A;  4DV6 H;  4OX9 H; 
#chains in the Genus database with same CATH homology
 4LF6 H;  4LFC H;  2ZM6 H;  3KDG A;  4X65 H;  3KDK A;  4LF4 H;  4NXM H;  4GKJ H;  1HNX H;  3GR5 A;  1IBL H;  4JI7 H;  4DV3 H;  4LFA H;  1X9Z A;  4G08 A;  4LF8 H;  1HR0 H;  1N32 H;  2VQF H;  4YY3 H;  2VKC A;  4X64 H;  2FPH X;  3T1Y H;  4DV4 H;  4JI1 H;  4K0K H;  4DR4 H;  4JYA H;  4LFB H;  2UUC H;  4NZR M;  3SB1 A;  3FAU A;  4E9J A;  5BR8 H;  4X66 H;  2VQE H;  4OD6 A;  3OET A;  2UU9 H;  1AN7 A;  4DR6 H;  5LL6 b;  3OTO H;  5IT9 W;  3EZJ A;  4DV5 H;  2HHH H;  5IWA H;  4AQY H;  4JI8 H;  1SEI A;  2Y3M A;  1FKA H;  2LF0 A;  4GKK H;  2ZQE A;  4LF9 H;  4B3M H;  1ODH A;  3J80 W;  4LF7 H;  4DUZ H;  1J5E H;  5DT9 A;  1N34 H;  3J81 W;  1HNW H;  4DV1 H;  3J7A K;  4JI2 H;  4DV2 H;  4NZT M;  4DR7 H;  1N36 H;  1IBK H;  2UUB H;  4B3T H;  4PDB A;  4OCH A;  1XMQ H;  4B3R H;  4JI6 H;  2UXC H;  4DV0 H;  4EC5 A;  2UXB H;  4NXN H;  4B8C D;  4JV5 H;  1F0X A;  4DV7 H;  4YHH H;  1XMO H;  4B3S H;  2UUA H;  2E5L H;  3T1H H;  1I6U A;  2PT7 G;  3GAB A;  4JI5 H;  4KHP H;  4JI0 H;  2UXD H;  1XNQ H;  3NCV A;  5LMN H;  3JAM W;  5FLX W;  1FJG H;  1I94 H;  3RF2 A;  3OSS D;  4X62 H;  1IBM H;  5A2Q W;  4JI3 H;  4DR1 H;  3QD7 X;  4DR2 H;  4LF5 H;  4DR5 H;  2O4C A;  4DR3 H;  1S03 G;  2D9I A;  2F4V H;  4JI4 H;  1XNR H;  5LMU H;  4DUY H;  1N33 H;  1HNZ H;  4DV6 H;  4OX9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...