4OCRH

Crystal structure of human fab cap256-vrc26.01, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
247
structure length
233
Chain Sequence
b'EVQVVESGGGVVQPGRSLRLSCTASGFTFSNFAMGWVRQAPGKGLEWVAFISSDGSNKNYGDSVKGRFTISRDNSKNTVFLQMNSLRVEDTALYYCAKDVGDYKSPIQDPRAMVGAFDLWGQGTMVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
molecule keywords CAP256-VRC26.01 light chain
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 233
sequence length 247
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocrH01
4HKXB 4YHPA 5HGAA 5IK3B 5ADPL 5IMLB 4Z8FL 4KHXH 2DQEH 2VC2L 1RUPL 2BJML 4LPWA 4WWKB 3TZVB 2MJWA 3TNMA 2GUOB 5GZOD 5E6YA 2CPCA 4CN1A 4LSRL 5KS9A 2X4PA 2IANE 3A6CH 2DTMH 4XPBL 4HDIB 1F11A 2H2PD 3RU8L 1RUMH 2VDLH 4GBXA 4Z7WB 2V5SA 3ARBD 4P9HH 4HX1A 4DZ8A 3BPLC 1RURL 5JQHC 4NM8L 3QQ4A 4PJFF 1QUNA 1K6QL 1OTUC 2HJFB 1QKZH 2ERJB 3QFJD 4UV7L 1KYOJ 4N0CD 3W82A 2IADB 3LQMA 1LHZA 1KLUB 2EH8H 4WI7A 2V2XA 1ZT7A 4WEBL 5D70H 5ESQB 1I7ZB 1YEDA 4JZJC 1MRDH 1V5JA 1NGPH 5FCSH 4LPTA 3OG6B 5ICXB 2H32B 4EEEA 4MA8L 4B41A 3MRFA 4QHMB 1RK1B 1WFUA 3BD5A 1AD0A 4IRJC 3BH9A 4G9FD 5FKPA 3F7PC 5CMAA 3AGVA 3LRSA 3FT2A 3S96B 1JGVH 1XGRB 2YA0A 3WS3A 3QULB 2HT4D 2ZJSL 5HJ3A 3V5KB 3AREB 4O2EA 4EBQL 2UVFA 2ZUWA 3Q0HA 2R2HB 4AEIH 4NN6C 1XCQA 5EUOF 5FV2A 1V8HA 3DUHA 3MLRL 4PJ8A 5EUKB 1CGYA 5GGRB 5E8OB 4AZ8A 1SJXA 4O2CB 1T21A 3F6LA 1JPSL 3IFPB 3JV4B 4K9EH 2C5DC 1ZLUH 4LSVL 3C9NB 1VA9A 5CJOL 4K3DL 4CNIB 3RWGB 1F6FB 3L3JB 4G9FE 1PEZA 1YDPB 4HZLB 4KHTL 5DHYB 5A40E 1GXEA 3LSOA 2OBGA 1WITA 4Z18A 2Z93A 3V0AC 1EXUA 3IDMA 1PGRB 4Y5YC 3OAUH 3TEUA 1MHEA 5DQ9B 4UMGA 4JKKA 2AVGA 2KPNA 5J6GB 4PY7A 1GPOH 3DVIA 3QUXB 4LF3A 2FYYA 3AS0A 3GMLB 4FQXA 1FSKC 4JDVA 4Y4HB 5I75B 3DUSA 1MCLA 3KPRB 2X4SB 3V0VB 5GS1B 3J7HA 5FHBH 4HUVB 4FFYL 5BCAA 3GMQB 3Q5OA 5GISH 2VABA 2VDML 1VSCA 1C5CH 5IJVA 1C16A 5ILTL 5T3ZD 3O45B 3P40A 4I77L 3UBXI 1QO3B 3QHZH 3T0VA 3IDGA 2QQKL 4ORGA 4CDHA 2XY1A 1UYWH 1IVLA 2VUYA 3NCBB 3V9FA 4F58H 3RJDA 5JNYB 2GFBB 2OZ4A 4L29A 4X0KB 4W6XB 5EZLA 1IQWH 4Z7UF 3WHE0 5KVEH 5BVPL 4ODHL 2R29L 3GRWA 4YGAB 2VDPL 3MODL 4NQSA 5DRXA 4XVSH 4IDJL 4I48A 3O41B 2XA3A 2DAVA 3N50A 4ZSOA 4NHCL 1F4XL 1RD6A 3FZUC 5D8JH 1T20A 2WBJB 2FD6L 1ACYL 3C6SA 3CDGB 4OCXH 5KSBA 5T3ZE 1NCAL 3PQYA 3QT2A 1VFBA 5ALBH 3RY5A 1BD2D 1JPTH 2CUMA 1FH5H 5DDHA 4DN4H 1W0VA 3PV6A 3N1PC 3PL6C 4M93B 4U31A 2AS5M 3UDWC 1T3FB 2VLRB 1IGFL 1RI8A 2BXYA 1I9RL 3NCYP 4IOIB 2UYLA 5GPRA 4U6TA 4YIQA 3QXVA 4IOFD 4F33B 3T4AB 2MTPA 4UQ2A 2KZWA 5FO8B 1FCCA 1G6VK 1VDGA 4HGWA 1YPZB 2G75B 4JAMA 1KCKA 1ZA3B 4NHUA 5HSFA 5DD0H 4BKLB 4JPVH 3IJSB 3Q6FA 4PGCA 4XCCL 1T7YA 3CU7A 1KJ2A 3QUZA 4U3CA 1GHFH 3FB6B 2VXQH 1OPGH 5F96L 1JRHH 1BD2E 1RSFA 4JFOA 1ZGLM 2Q8AH 2AABH 4KQ4L 5IB1B 1FVCB 5DD3L 1QQDB 1S9VB 1PW3A 2MKWA 2ESVD 2HLAA 4FMFA 3LPWA 5AWNH 4HS3A 1ITCA 5D1QC 35C8H 4CVZB 4MJIB 3CLFH 4ZMAT 1KLGB 1U8LB 1U3HB 4GAYB 5HY9A 2HVJB 1FO0A 2FX8H 1QACA 3CFBA 3VXTA 1LO2H 3T4YB 3NFSL 2MQCA 4UOJA 3W11C 5I1CH 4PJHA 3ZYZA 2BX5A 1NAMB 1U91A 4M9OA 2VH5L 3PABB 4PRAA 4UTAL 5L9DH 3SE8L 1Q9KB 1G9MH 2DI8A 1T6WA 2P44B 3LKQA 4MA3B 1MAML 5HHQB 4HH9B 4HD9A 2IQAA 3H42H 4ONHB 1E6JH 1IGIL 5LCVH 1NGZA 1CU4L 1VGEH 2P47B 5IQ9B 3HMXL 8FABA 1ZLVK 2G5RA 2R0KH 2ESVE 1H8OA 1I75A 1PG7H 4Y2DD 2D3VA 1YEEH 4OUOA 5C09D 2VC2H 1QSFB 2ZG2A 4P9MH 5K9OB 3K4DA 1NUFA 4LPCA 3ULUC 4LSRH 1MFEL 2NY6C 5L88L 1L7IH 1X5GA 4UT9L 4UBDC 3AFLA 4TUKL 2KKQA 4MQSB 3QHTC 4KJYA 1G7IA 1RURH 4Y1AB 5DURB 5KG9B 5I66A 4FQLL 3UROR 4FG6C 4J3OC 4LGSB 2XRAL 1KB9J 1BFTA 1MCWW 4UV7H 4OIIL 1ZS8A 4WEBH 3X13B 4XAKD 3STBA 4AIXA 5BV7L 1N0LA 2YPLD 4DUXA 5C09E 2B1HH 3OSKA 4HH8A 5E4EB 4GG8A 3LKSB 3PP3K 1KT2B 3TT3H 2LU7A 5HVHC 3ZHLA 2EC8A 4MA8H 5F88B 3TESA 2VRAA 3CXDL 3ULVH 5B8CA 1T2QL 1EDQA 4DVBA 1TPXB 4P4RA 1CBVH 1NSNL 3JVGA 4HHAA 1KUMA 3WKML 1A9BB 1IL1A 3ARWA 3MOBL 2OK0L 4OD3L 4ELMA 3VXOA 2VXUL 2NXZB 4EBQH 4X5WA 5KSVA 3PWNB 4KTDL 3VXNB 3P0VH 4URTB 1JV5B 3MLRH 1F13A 2YPLE 4U6XA 2ADJB 3O6KH 3G5ZB 1JPSH 3A67L 2CR6A 4MCZB 4LSVH 1T4KA 4MD5A 5HYFA 5CJOH 2IG2H 2PO6D 5IB5B 1YNLL 3PWJA 4WWKC 3MGOB 4NRYB 4WVRA 2EDFA 3TZVC 2WWMC 1GGCH 2YR3A 2PW2A 2UY7A 4F37K 2A6JA 1CIUA 4GW1A 1CD9B 4OTXH 1QRNA 1NFIB 5IHZA 2R69L 5DTFB 1KIPA 2ITCA 1MVUA 4Z76A 4H1LB 3WHXA 3EO1B 5E08H 2JB6A 1S3KH 2F5AL 1I3RA 2ERJC 4HUNB 4PY8J 4YHNB 2OJZL 5INDB 4E0RB 5T1DL 3U79A 3GMOA 5DMIH 4C56D 4TTGA 2EXYC 2IEPA 1SJHB 1QR1A 1JVKA 1RQ5A 3FO9B 3QFDB 4EDWL 2IJ0C 4OD2B 4GQ9L 2NZIA 2Q20A 5C2UB 5C0BA 3ULUL 2GJZB 2VUOA 5CJ5A 5E6ZA 4Y5VB 5CUSL 5ILTH 4AEHL 5BO1L 1UC6A 4UOW0 4PRPD 3ARFA 1FYTD 5EU7E 3BN3B 1HYSD 4P5MB 4KTEH 1B4RA 2QQKH 5FM4A 3MCKB 1MJUH 3RBGA 3TFKC 4XX1G 5CEZH 3T8XB 2YD9A 1KTKE 1EZVY 3TYFB 3M17A 3AREC 4C56E 3MMEA 1ZV5A 4ODHH 2DQCL 2YD6A 3UJTH 1BJ1J 3UBXB 3BQUD 3UTSB 5FUZH 4M5ZL 4NHCH 1F4XH 2VITB 2YKLL 4LIQL 1E4KC 1G7PB 2F74B 1ACYH 3QNZB 3VMOA 2ENSA 3UCRA 5D71H 1CR9L 5E70A 1NCAH 5I71B 1XZ0B 1ND0B 3O2WL 3U0TB 4NWTH 4JO2L 4XWGL 4PRPE 3FO0L 2C3WA 3T04D 4F9LA 4CN4A 4Y19E 3OKOB 4L3AA 4HULB 4XVJH 1PSKL 4D9QD 3Q1SL 3MSPA 1IC5L 4M1GL 3U83A 1IGFH 4R0LB 1I9RH 1DQJA 1NEZG 3TN0D 4KVNL 4ODBD 3RVXD 1Y18A 3QXDA 3QUXC 3W5NA 2KQMA 1G7HA 1H8NA 3E3QC 5ICYA 1NCTA 3IDUA 2YUZA 3NFNA 4X7TA 5BVJB 1FNSH 2D7TH 4Y4HC 2XKUA 1ZHBB 3UTTD 3O3DB 5I75C 5BOZG 5T1KB 5TH2A 4BQCA 2FBJL 3HC4L 5ELIA 1CFBA 4FNLL 5FK9B 4F9PA 5GS1C 1F90L 1YMHA 5I1IL 2XPGB 3IDNA 5DJ2B 5F96H 3WLWC 5JHLL 1EO7A 3KJ6L 1N7MH 4KQ4H 4OBRA 3NCFB 1CE6A 3VGHA 4D9QE 1FFOA 2AAVA 2LFGA 2XNAA 1IGMH 1GVIA 2J8UA 5KJRL 3HRPA 2E9IA 5I2IA 2H45A 5HYJA 1Q1JH 3GMPA 4OT1H 3KYKL 1KCUL 3B4NA 5BS0B 4JN1L 1OAKL 2DLIA 3TBSB 4LVHB 5GSVB 2NTFB 4UIMB 4QY8A 2CJUL 3O2DA 2VLMD 4I4WB 2B4CC 3UTTE 3L3KB 3JBG7 3EUUA 6CGTA 3E6HA 1MJ8H 2VH5H 4UTAH 4EN3D 2A9NL 1CFTB 1QLEH 2PXYD 4G6FB 4WTZA 4LLUB 1GGYA 4U7KA 4WI5A 4FABL 1BWWA 3GSNA 1SBSL 2WBJC 5CD3A 1WC7B 3L3IA 4CBPA 3PDOB 3HAEG 1G7QB 3LMJL 3VFNA 43C9B 3VU2A 4Z0XB 1X9QA 4KJQD 1XIWA 3BWUC 4LLVB 3SBWA 2XQYG 3BVNB 4PJAA 4MSWB 5D7KE 4EUPH 4M93C 2Z35A 1M6OB 3MNZA 1MFEH 4N90D 2VLME 2YK1H 4MNHA 3CFEB 5L88H 5FYKL 5DJ0B 4UT9H 1A9EA 4PJ9B 4W81A 3ZDZE 4GRWH 1FFQA 4X4ZA 5KSBF 1MNUL 3KNBB 3IS1X 3FCTA 3B6SB 3O6LH 2IANA 3QYCA 1I4FB 4UI2A 2MQ0A 4UV4L 1AQKH 4X9BA 2PW1A 5C71A 2XRAH 2CXGA 4JFXA 4TNVF 4RFEB 4PJBE 1WVZA 2CGRH 4OIIH 3CFDA 3T2NL 2IPUK 1G1CA 5BV7H 3ARGA 4G6MH 5EORL 4MAUL 3T0XA 2H3NB 4CMMA 1MI5A 3ARDA 1T83C 1GIGH 2A6IB 4N90E 4S1RL 4G8GE 4X9GA 4WY7L 4G6KH 3CXDH 5CILL 5F89B 1U3HC 4P57B 2VLLB 3D0LA 1T2QH 3MQIA 1QBMH 5GSRA 4YK4B 1NSNH 1DJSA 4JDZB 5IHLB 2E7HA 2HVKA 4M7JL 2FSEB 2P7TB 3ULVD 1VKXA 3MOBH 5TDPB 2OK0H 3HC3H 3LD8B 4L9LB 2VIRA 3MRPA 3GDBA 4JM2A 3QFJA 4OLWH 5MERA 3P73A 4Z78B 4PGEB 5LXGH 1QHOA 2EE2A 1YJDH 4GMTH 1H8SA 1IMHC 3GI9L 3HE6B 1FHGA 1ZANH 1FNLA 3KR3H 3MV9D 2VO5A 4FP8L 3VDAA 4CVUA 5I1HL 3O4OB 1JHLL 1X4YA 4EXKA 2J4WH 3L7EA 2B4CL 3BZDA 4LMQI 4OZHA 1R24A 1ZTXH 5GJTL 3RTQB 3ULVE 1MCOH 1LQSR 2Z0BA 2NR6D 4I1NB 5CHNB 4XC3L 5BZWA 1NGYA 2ICEA 3AAZB 3DXAD 4LU5L 1AHWA 5IFAH 2I9LA 2Y9RT 1UCBH 4OB5H 4R7DB 1IKNC 3RIAF 5J1AA 1LMKA 1HHGA 2YBRA 2OJZH 4XNMB 1NJ9A 3SQBA 4TN9A 3ULSA 3T3MF 1J1PL 4XH2B 5FV1L 3QWRD 2APVA 4FRWA 4EDWH 4HC1L 4HIHB 1QLFA 3H3KA 2EYSB 3MV9E 5DUBB 3CFKA 5E4EC 1DDHB 4F7CB 4M6OL 5CUSH 4AM0A 5ID0B 2P1YA 3MLPA 2X4UB 2GK0A 3GJFK 3DXAE 1B3JA 1TPXC 1K8IA 3LN4B 4HMCA 2D4DA 1I85A 1CDCA 1B0GB 1ZXQA 2EDDA 2VL5B 3ZDYE 5LAXB 1IGCH 3KLSA 4MXVE 2Q76A 3L5HA 2KL6A 1JWUB 2QV2A 4OCLC 1PFCA 1ROWA 5BW7C 5CD5D 3A6BH 4RDQF 1RZ7L 2NXZC 3LKPA 2DQCH 1OTUD 5CEZD 4Y16C 3DVGB 5HHPA 5KN5B 1KV3A 1MCCA 1N3NB 3IB4A 2E6JA 2GKIA 4E5XA 4GG6B 3U7AA 4L4VB 2YKLH 2RCSH 2YC1A 4G6JL 4LIQH 4RISL 4IHOB 4NNYB 1H3PL 5E03A 1DEEA 5DC9B 5C0GA 5E1HB 5EO9B 1KELL 3O2WH 1V05A 3BKML 3RY6C 3SDAB 4AQ1B 3WL9A 2X9XA 1OM3H 5AYQA 4CVXB 3O4LD 5TDNB 2OCFD 1PZ5B 1NAML 1HHJA 4XPFL 2QQNL 3O8XB 4M1GH 3SCMA 5B38A 3JWDH 5IMMB 1HH6B 5CEYA 3EGSB 3FN0L 2DS4A 3P30H 5DT1H 1XF2B 4X6CE 3NH7L 5CEZE 3THML 2HRLA 2AP2A 4QRSB 5DLML 4DVRL 2VQTA 5C0RL 4TVPH 4YPJA 5FOJA 1S7UB 2R4SL 3H3BC 4LLMA 3MOQA 3MGTB 2G60H 4FNLH 4NKIL 2OTWA 4EZMA 3HAEB 2QHRH 1C12A 1M05B 2A73A 1WIOA 4LCIL 5E8PA 5I1IH 4JRYB 4HK0A 2IPKB 1YC7A 1I8KB 3DROA 5JHLH 1XR8A 3TV3H 3QO0A 5D72L 4AT6A 3IFOB 3KJ6H 2BVQB 4Y5VC 4EIGB 3O4LE 3L9RA 3KGRA 1HHKB 2BMKA 5E2JA 4PGZA 2NX5A 3D69B 1CD1B 5KJRH 5JR1L 1MRCL 5C2BL 4YXLL 1KCUH 5IVXB 1BLNB 5E94A 3U1SL 1OAKH 4QLRA 4ZYKA 1GGBL 4GRMA 3MOAH 5HHOB 2CJUH 4NQEA 1UT9A 5D7LD 2IAMD 4XTRC 2ED8A 4LSQL 4IMLA 5B4MC 4HUUB 3X3GL 2A9NH 2YUVA 4BK5A 4NKMB 5CJXC 2NYYD 4ZS6C 5T3XE 1BJ1H 4NUGL 2QTEA 4ONOA 4XPGH 4L8BA 2AJYH 4I9WD 3HE7D 1U3JA 3S36X 3FB8B 5FUCC 2GAZA 1HH9A 4XP6L 2O5XL 3KYNA 3HZVA 3VD3A 3SDCB 3FFDB 4H8WH 4ISVA 4DZBB 1N0XL 3IU3A 2BRRH 3VE0A 4UT7L 4R0LC 5IOPB 3M45A 1BQHG 1T22A 3OTTA 5IG7B 3V95A 4NO3B 5D7LE 3FB5B 1FGVL 4M7KL 1OAXL 1MF2H 1GZQA 4M8VA 4NO0B 3HR5B 4LCWB 5HVWA 4YGVB 4KY1L 5T5FH 1EFXA 2DLEA 4J8RA 1CE1H 4GFTB 4NWUL 3VGBA 5GZNC 4QRPB 3OF6A 1LDSA 4HWZB 3L6FA 4I9WE 5FYJU 3T2NH 4NZRL 1YQ2A 3KS0J 4MJ5A 1ORSA 4X9FA 2DLGA 2JJWA 5JA8B 2VAJA 4NC1C 3WFEL 2P5WB 3MLVH 4MAUH 5EORH 2FO4A 4Y2DA 3LDBB 5AD0A 5DJAB 4S1RH 3LAFA 4WY7H 2Z4QA 5C09A 1JUFA 2P4AB 2DIAA 3U9PH 3PL6D 4JPKL 4P2OB 2N56A 3CUPA 4LVHC 5JORB 1PYWB 5B39B 4XMLH 1CT8B 4M7JH 5EBMB 1BREA 3V2AR 1GSMA 3BHBB 1DLHA 3VH8A 1K3ZA 1CDBA 4QOKE 1KOAA 2DTSA 1WJ3A 4OZIF 5F1NA 5DD6A 4F57L 1AQDA 1MCPH 2ED9A 2AGJL 3G6JF 4AEFA 4LVEA 5DVLA 4RIRB 3MLYL 3GI9H 1XGUA 2OSLB 3QPQC 4WDIB 4OI8A 2ZKHL 2K7QA 3TO2B 1U92B 3QI9B 3JTTB 3H9SB 1URLA 5I1HH 3DX9B 2B4CH 5LJYH 4MA1B 1J9CT 3TNNA 3MRHA 5GJTH 3NCEB 4PJ9C 1CICB 5EU5B 2PYED 3ETBF 3DX7A 1GZPA 4LU5H 4F3FA 3U2SB 3L5WB 2YUWA 4CN6A 4PJAF 4ZXBD 2H26A 5JIIA 5DJ6A 5KAQF 3QXAA 2HAZA 2FJGA 1MUJB 2FGWH 3T08A 1KACB 1RZKC 3VMNA 4DN3L 3BAEH 4I2XB 5D96B 5IIEB 2QQLL 5J89A 1MH5B 1K4DB 1I7RA 1IGYB 2FBOJ 3TPUA 4M6OH 3S97C 5HYQA 2V7HB 4KK8D 4U3HA 1JZ7A 4YX2L 3EHBC 4NRXB 5T1MA 4NPYA 5K33A 2NPLX 3OR7A 4YK4C 1L6ZA 1T7XA 4KPHL 3QEQD 1T0MB 5K9QI 15C8H 2WBWB 3VGFA 5HI5C 1Z5LB 2WAHA 5J6HA 4XBGB 4M1DL 1IGTA 3LD8C 1YN7B 4L9LC 1FFPB 4MJ6A 3FT2B 1HIML 5EULV 3UTZA 1RZ7H 3X11B 2X4RB 4NOBA 4TNVK 3QWOA 1OAQL 2AXJA 5D7IA 4JJ5B 1QP1A 2OI9C 3KG5A 5H35B 3ARPA 4PJDE 4QHLA 4P5TB 4PJ8B 1H3PH 4X6DB 1EA9C 4YAQB 4YDJB 4NN5B 1YYLL 3D3VA 3O4OC 1E27A 2A9ML 3IS0X 4JM2F 2EYTB 5HI3D 3GGWA 3QEQE 3RTQC 1NAMH 4XPFH 2QQNH 1FYTA 1ZAGA 3C8KB 2GSIA 4ZPVB 5DC4B 1A6TA 1QBBA 3P77B 4PG2A 4UIKL 4PLJD 1II4E 1EHLH 2ADFL 3V5HB 3VXSE 3NH7H 5EB9A 4FXKA 3BW9B 3THMH 5DLMH 4DVRH 4GKNA 4MDJA 1FL6B 4LPUA 3P4MB 4JRXA 1OAZL 2FYYB 2R4SH 2VDRH 3MRJB 3VRIA 5DVKA 2D7QA 4GW4B 3E2HB 1Y0LB 2AK4B 4WUUA 2XZQH 2OXGA 4LCIH 3F62A 3SJVA 4J1UB 4M61A 4WFGE 3S88L 4TVPD 2WUBH 5I1EL 5J9PA 1DVFB 2D03H 5D72H 4DQOH 2XWJB 3L5IA 3D6GA 5JZ7C 2LU4A 3W9EB 1BM3L 3V4UH 4P3CH 4ZFOA 2WWMD 1CIDA 1Z9SA 3U9UB 1NGQL 4WO4B 3TIDB 1MRCH 5C2BH 1FIGH 3V6BR 4U1KB 4YXLH 3SGEH 4OCWH 4BZ2L 3T0EB 1GGBH 1JPFB 4EVNB 2DKSA 3BKJL 1T5WB 1BBJB 2DRUA 3KDMA 1RZKL 3KPQB 3RIAK 1PAMA 1FORL 3ZHKA 3SKMB 2HTKD 4LLQB 1MAJA 3UTTA 3FB7A 5KVMC 4D9RD 2P8LA 2FRGP 4KZDL 4CVWA 5C8JA 5JHDB 4MXWH 5HXMA 4TVPE 3DX6A 4NUGH 1JMXA 1AC0A 2EXYD 3CK0L 4PJ7E 4Z7VB 4R8WL 5I76B 3TVMB 4S10A 4NQDB 2FECL 4J23A 1YY9C 4C4KO 4XP6H 5FDWB 3C6SB 4IOSD 4TQEL 3SDAC 1UGNA 1NDGB 1T2XA 2O5XH 2NY0B 1XF5A 1WAAA 2R15A 4GAFB 4XXDA 1RULL 3O8XC 2PTTA 4UT7H 3UYRL 4QCIA 1ZGLA 2RIKA 3CZFB 1FG2A 4M7KH 1OAXH 5CZXD 1PVHA 4KVCL 1B0WA 4JQIL 1BQLH 5F97E 1NMAL 1BEYL 1NMBH 2VTFA 2XZAL 5DVNA 1NC4A 4D9RE 4FQ1L 1R3HB 4HV8A 2EKSA 3ARED 5J11B 5IBLC 2PXYA 4X80L 4ODXA 1QFWI 2CIIA 2BERA 4L5FL 1KPRA 4KKCC 2GJJA 5CJ8A 4NZRH 3QUZB 4PJBA 5FKAA 3O9WA 5ALCL 5J1SC 3WFEH 1NGXA 2X4TA 3VG9B 5GGUB 2YSSB 4ODUA 1YYML 4HWEL 3LH2L 2IH1B 4KRPB 4JN2A 2PCPA 4PRHD 2JJTA 2CR3A 3C2AL 3VXMB 3C6LB 3TA3B 3EYFA 4JPKH 1D5BA 1KG0A 1DBJL 3WCYA 5ESAB 4NN7B 1BFVL 1HILA 3NFPA 4LLDB 3B9KA 4R2GD 1ZLSL 3TIEB 2GCYA 3PJSA 2CLRA 3QUXD 1IT9L 2EYRB 1SVZA 3MV8D 5GS0H 3DYOA 1TQBB 3QDAA 1MPAH 1S5IL 4FZ8L 4L4TA 1J18A 2JK5B 2VKXA 3TT1L 5I1DA 5AEAA 4JREB 2AI0L 1I3UA 4ZFZA 4F57H 2IQAB 4OF5A 2QLVB 4RZCA 2YWYA 1Q72L 3MLYH 2X70A 5DUPH 4PRHE 3BIBX 1I1FA 4HKJB 1TZHB 4NNXB 5H2BB 1MCQA 5C6WH 3M1BA 3SDCC 2P8MA 5FGBC 2ZUVA 2P8PB 3IFLL 3HPLB 3S36L 4O4YL 1F5WA 1XGPA 2CO7B 5I1AB 2AXFA 5IV2A 4PJGE 1P5UA 1HK6A 2MCPH 2FR4B 3SDXB 1V7NH 4KKAD 4ESKA 4UILH 3MV8E 4NRZA 1MWAB 2AJVH 5D7SL 1MQKL 3P4NB 1EV2E 5F44A 1KENH 2A77L 2QHLA 2QEJA 2VE6B 4LCYA 2VWEC 3OKKB 3BP5B 2GITB 3DO3A 2QQLH 3CFCL 3KS0H 5MEPA 1YA5A 3MC0A 4OD1H 5FCUL 1P4LA 4H5SA 3MNVA 5MEQA 3BXNA 4I3RL 4C83A 3LDBC 2CK2A 1WT5A 4YX2H 2BDNH 4PR5A 2OTPA 3L95B 1M4KA 1U95A 3BKCL 4P2OC 4LOUC 1OLZA 4F2MB 2O61A 2Y5TA 1KPUA 4L3EA 5F7KC 2Y36L 4KXZH 1OP3H 4KPHH 2WZPD 3UJJL 2BSRA 2F54E 4DVBB 3Q6GL 5KAQG 2HFFB 1JP5A 3GK8L 1UZ6F 1S9YB 3F58L 3PGCB 3JSSA 1HIMH 3RNKA 4F8TA 4Y4FD 5F1IB 3C5ZD 3NA9L 4XHJC 4I0PB 4RGOL 2HWZH 3BDBA 1HHHA 4X5WB 3EW3B 2G2RB 4GS7B 3ZL4L 1MLCB 3FQTB 3QWRA 3O3BA 1WZKA 4LEOB 4ZTOL 2AEQL 4XCNB 5ANME 4P2QD 5H94B 3OHXA 4CADA 2GIYA 2UUDK 5EOTA 5C0EA 1RJCA 4K7PY 4UB0H 3VWKB 5IESL 3AXLA 2WK2A 4MA1C 3SO5A 1KNOB 3WIIL 3RNQA 1RUAH 1CICC 1VGKB 4P3DA 1MJ7H 2BHYA 2B0SL 2B7DT 4U6HA 5DUML 2OYPA 3GSOA 3KXFB 5KSUB 2ZOLA 4KMTL 4Y5XB 3DV6A 3CNKA 1FPTL 1T5XA 3L5XH 5SWSB 1QRNB 4PTUA 1A4KB 3IDYB 2DLHA 2R2EA 1T03L 4XNYH 3GSXA 5CIPH 1P69B 1X5JA 2FL5B 4QF1B 4PLOB 4FQHB 1BX2A 2CLVB 3DO7B 3RUGA 3EYQD 4MXQC 4P2QE 5D96C 2J5LB 5D1ZB 1S7RB 5E7FA 2IMNA 3UPRA 3HG1D 3UYOD 5I1EH 4JZJA 3U6RB 4QWWC 5GGSA 3G04A 2FIKA 5EO1A 1ZLWH 5IB3A 1IE5A 3TBYB 2WNGA 32C2A 5EDXA 5FA4B 1EBPA 5TQ2L 3AU1A 2F8XC 1XH3A 2DM4A 1AKJA 4D9LL 4HPYL 4XZUA 4JY5H 4ZDHB 4JHAL 3OKNA 3BDYL 1S7WA 4XAWL 4IRJA 3V4VL 3TH2T 1TIUA 4O58L 2QQQA 3BKJH 4JFHD 1HDMA 4P5KB 1V3KA 4PGDA 3FQWA 3SHSA 3PUCA 4PB9L 5CGMA 3DYMA 3M17B 1FL3B 3KHQA 1FORH 4K3EL 3QRGH 2NW3B 5I18L 4EOWH 4KZDH 3HG1E 5DJ8A 3CK0H 1VEPA 3FFCA 2FX9L 4P5TC 3V6FA 1CXIA 1S8DB 4XCYA 5FHAL 4NN5C 5F7FA 2GTZA 3UYPA 5JPNB 4FQIL 3INUL 1JNHA 1JPGB 1QEWA 3WEXA 5DHVB 1X3DA 3T3PE 1RK0B 3OJDA 4EI5B 1CFQB 4K8RH 4PJCE 4JFHE 4BFIB 2ARJA 5TF1L 1BZ7B 4D8PB 1EEYA 2XICA 2RFXB 5DRNB 3K7UA 4YHOL 1N6QL 4Y5YA 1TFHA 2X4NA 4KQ3H 3QXWA 5JOPD 2Y07L 1IFHH 5J13B 1DFBL 2VAAA 3HNTL 4FQ1H 1CZ8H 1BQSA 2K1MA 5TGBA 4JQXC 5ICYB 3L3OA 1ETZA 2NXZD 4HAGA 1AGFA 4PD4J 4Y16D 4NCC1 4XNXL 4HUMB 3E2HC 3STLB 2EEDA 5L2JB 5MENA 3TBWB 1DUYA 4L5FH 3OXSA 5C0IB 2AJ3B 2HLFC 1GOGA 3DUUB 4UNVA 1HINH 1YEHL 2WIIA 4U1JA 1C1EH 4ODSL 4HJ0D 1A2YA 1DVFC 3AM8C 4YDVA 3JXAA 4HF5L 1YN6B 4QTIH 2GT9B 4MNQD 3CSBA 1D5XA 1A22B 1D5MA 4PP1C 2FEEL 4YR6A 1S9WA 1VESA 1S5HB 4X7SL 1J0JA 3LH2H 4GOSA 2V7NA 4J4PD 4WO4C 4XHQA 3C2AH 3HMXA 4XC1L 2G5BB 5BXFB 5DJDA 1DBJH 5F8QC 5JOPE 3T0EC 2YWZA 3QNYA 4DCQB 1NGWB 1ZLSH 7CGTA 1JNLL 2X9WA 4TYUA 4EUPA 4OZIB 2GJ6B 2FLBT 3BE1H 4LLYB 5HI4C 4QY8B 4TRPH 4DFHA 2PTVA 2R8SL 3QEHA 3G6JB 4DKEL 1BGXL 3QBTB 3MCLL 3QUYD 1VEMA 3VXPB 4FZ8H 3D39A 4RX4A 4NQCB 3ROOB 4ZTPL 4BH7A 1DUZA 3TT1H 4RGNB 4J6RL 3GJEA 4MNQE 1A7RL 3TVMC 5EC1A 5F7UA 5T33L 1TQCB 1DQLH 3MACH 4GKZB 2JCCE 5GS0D 1YC8A 1Q72H 1HWGB 2QSTA 2BOCA 2MKLC 1YEJH 1FL5A 5C7XL 2NY0C 5IEHB 3U82B 3CH1A 3IFLH 2OXHA 4NJ9L 3BMVA 3S36H 4FXGA 4O4YH 3PGFH 4JFPB 4UDUA 3F65A 3PL6A 1P4IH 1DANU 4R3SA 5SX5K 3S7GA 2BXZA 3MRNA 3UDWA 2RGSA 1P7QD 1A9EB 5IBTH 3F5WA 4QYOA 1G7MB 2XTJC 4X98B 4PG9B 1T1YB 1MQKH 3EDDA 5F7YC 5GRWA 5J11C 5B4MD 3W0WD 2VR9A 3UJIL 3CDFA 1NCUA 3KPPB 5K9KB 1ITBB 2AEPL 4I3SL 4KFZC 4ZNEA 4U0RB 4U7SA 3BX7C 1CGXA 3CFCH 3VG9C 1FAIL 1H15A 5F3HB 1A47A 1RZIB 1HXYB 2IALB 3I85A 1AXSA 1AGEB 1EJ6A 4N0UE 4X6BB 4KRPC 1XCTB 3ARGB 3U7WL 2ZOKA 3OXRA 3ARDB 1EAPA 3C6LC 4Y7MA 5M95B 3S35X 3TA3C 1EUTA 4HZAA 1I1YB 3MROB 5D1QA 4M48H 4PJBF 2Y36H 4NN7C 2W91A 1CXHA 2PYEA 2HN7A 2OR9L 1FZMA 4M00A 2ORBH 3V79C 1DQML 2HA1A 5TDOB 3W0WE 4FQQA 3GK8H 3HAEH 3IDXH 1PDKA 3ARBB 1HQ4B 1IZKA 1TQBC 2I9TB 4YBLB 3WKNA 5T1KD 3BWAB 1BECA 2VIRB 3EDEA 3IT8D 3KPSD 4JREC 5JMRA 5DMKA 1M7XA 5LQBL 3H3PL 4FQCL 1K9TA 1WBZB 3I50L 3MXWL 3ELAT 4G7YH 2IWGA 2ICWJ 1R0AL 1RMFL 2AQ3A 1HQRB 4ZOCA 4LHJB 3D85A 4ZTOH 3HC0A 5BZDA 2DQUL 3QZWA 4OLVH 3FOMA 1RUKL 3G6DL 3G6AB 3WXVL 4X4YB 4PJEE 1BAFH 3MRIB 3I9GL 2IPTL 2VISA 4WNQB 5IESH 5BRZD 1P1ZB 3PNWA 1ERNA 4ZD3H 1HE7A 3JWOC 4JHWH 1XR9B 5DUMH 2YRZA 4U7MA 3SE4C 3C60D 3QH3A 1R24B 3VCLB 4Q9RH 2NMSA 2F53E 4G9FB 4BYHA 1FPTH 4C55A 2D7PA 4ZQKB 3KPSE 4ZUSB 3VG0L 4PGBA 5E6ID 2MFNA 4R26H 1KBGL 1QLRB 4YUEL 3EYSH 3FO2B 3WYRA 1CG9A 2IH3B 5C07E 3BPCB 2XFXB 4YHIA 2VLJA 3EYUL 5EU6A 3FRUB 2YZ8A 5I6XB 3GSVB 5IP4A 1J1OL 5BRZE 1FNHA 3E8UH 1EFQA 4KROD 5TQ2H 3VRJB 1J0IA 4NQXB 2BVPB 2PETA 4N9GA 4JR9L 3B3IB 4AM0B 4D9LH 3QUKB 4HPYH 2DWEB 5EOCL 3MREA 5C0JA 4JHAH 3BDYH 1CGUA 4PJ9D 4XAWH 2SEBB 4HKZA 5EBLB 1NUDA 5JPMA 3KLAA 1JN6A 3CU1A 3WE6B 1DSFH 4PB9H 2Q76B 1LE9B 2F9BT 4R90H 2OL3H 4I0PC 3AS1A 3MRKB 2FJFA 4QHKI 4GS7C 4FN0A 2ZPKL 4G9DB 4YQXH 4Y4KC 1TXKA 1U8HA 1JGLH 5FHAH 2NY7H 3HNVH 4PLKC 1F6AB 5IT2L 1M7IA 3ZDYF 1J86A 4MXVF 4HKXA 1IAIM 5IK3A 3VWKC 3IAGC 1IAIH 3E0GA 3LIZL 4JFDE 3EHBD 4WWKA 1AC6A 3TZVA 2GUOA 4XP5L 3WL9B 1C5DB 4YO0B 4Y5XC 2AJSH 4HDIA 4Z7WA 4YHOH 2CRMA 1N6QH 5KTEL 3IDYC 4WIQA 2Y07H 4K8RD 2CQVA 1RIVL 2EDKA 4POYA 3QNXB 2HJFA 3VFVB 5IGXL 1J8HD 4XNXH 1J0HA 2IADA 5EBGA 1KLUA 2J5LC 5D1ZC 2Q3AA 1YEHH 5ESQA 3RZWA 1I7ZA 5KVDH 1QFUL 1MCEA 3H9HB 1DL7H 1NC2D 3LRHA 3JWOL 4A2LA 1U42A 2VLKD 3VDCA 3NN8B 4M3JA 4X7SH 3R8BB 5ICXA 1Q0YL 2H32A 1SEBB 1ZHNB 5EN2B 3RUGF 2AK1L 1MWAL 3O6ML 1BD2B 4QHMA 1RK1A 1MY7A 1CDYA 2EZ0D 4CW1B 2YD3A 3QUMB 1JNLH 3RVTC 3VI3E 1XGRA 2R8SH 1J8HE 5DJCB 1GH7A 3V5KA 4NSKB 1AO7D 3AREA 4P46B 1G0DA 5EA0H 4QXGH 2R2HA 1DN2A 4ZTPH 1F3JB 3P11H 4J6RH 5EUKA 1OGAD 3G08B 1T04B 5GGRA 5JO5B 5T33H 3X14B 5D1XB 1JRHI 2VLKE 3IFPA 3JV4A 1E4KA 3C9NA 5DA4A 2WWKT 4LKCB 3GHBL 1LO3H 3IKCB 2W0FB 4CNIA 1IJ9A 1D9KB 4M6NL 3L3JA 4DWHA 4XBEL 1YDPA 4EI5C 4HZLA 4NJ9H 5DHYA 3KYNB 2COQA 4M62L 3DURB 2ESVB 1GGTA 3KPLA 4AEEA 4AQOA 3IU3B 1BFOB 2FEDD 3OJ2C 1G6RB 3ZDXF 5DQ9A 2QJDA 1AO7E 5J13C 1NKRA 5J6GA 3QUXA 2XXCB 4GH7B 2JJVA 2ICES 3GMLA 5E0QA 4ENEC 5F9OL 5HYEA 4Y4HA 2BCKB 1OGAE 1RIHH 1W72L 5DFVC 1S7VB 4NYLB 3KPRA 3PWLB 1ZLUK 2X4SA 4FFVC 2AEPH 4I3SH 3D48R 4WW2F 3BKYL 4L4VD 4OKDA 5GS1A 7FABH 1PJ9A 1KJ3H 4LAJH 5HTSA 4HUVA 3HZYB 4QHUB 3GMQA 4FQPA 3SN6N 1KCVH 1FAIH 3JUYA 2MNUA 4R97B 4PGJA 5C0CD 2I24N 1WBYB 4OGYL 5DR5L 3O45A 2YS4A 2QBWA 1MFNA 3BO8B 1QO3A 5C09B 2YMXH 3JUZA 1CI5A 2OR9H 3UZQA 3T77B 1KPVB 3BP6B 5JNYA 3NIFE 3S3PA 2GFBA 4X0KA 4YHKL 4F7EB 3QDMD 5DFWH 2VJXA 3DPBA 2UZIH 1F97A 1CLZL 4U3XA 1RHFA 3L3HB 4RGNC 5LQBH 1YEKL 4RMTA 1TQCC 3I50H 1UKQA 3O41A 1ORQB 4K94H 4JE4B 3BSZH 4KAQL 4PRBB 1R0AH 5C0CE 3VFWB 2WBJA 2R4RH 4NO2B 1JHKL 3V5DB 3CDGA 4DUVA 3G6DH 3ET9F 3GIVB 4W68A 2YPLB 4GRWF 3KPNB 3I9GH 3C08L 3HFML 5EOQL 4HC1A 3BT2L 3QHFL 3K1DA 4I8DA 4CRPA 4MJ2A 1T3FA 2OX5A 2VLRA 1TTFA 4IOIA 3MRHB 3QDME 4XBPA 2YN3A 1UB6B 3MYJB 4EDXB 4F33A 4P99A 3T4AA 3WJLC 2W38A 4WCYH 3DX7B 1O7VA 4PV9B 4XMPL 1J1XL 3SY0B 3VG0H 1VFUA 2D0HA 3D2UD 1YPZA 2G75A 4G43B 1ZA3A 5BJTB 4XMKL 4I18B 2DQJH 4XCFL 2EE9A 2D31B 3QXAB 3RRQA 1YZZA 2OM5A 4GMSL 4KK6C 2D7OA 1DBAL 3DRTB 2XG5A 4YDIH 3FB6A 4NJAL 3EYUH 2XKSA 1Z6JT 1EUUA 1FVCA 1WZ1L 4X6FB 5L2KD 1QQDA 1S9VA 2PYFB 4PJ5D 4V1DD 3RGHA 1T83A 3TPUB 5FO9B 3ARRA 5HYQB 4JY4B 4N8PA 2B8OT 2PO6B 4CVZA 4MJIA 4HWNA 1KLGA 1U8LA 1Y6NR 1U3HA 3BZ4B 1X4ZA 1IM9D 4GAYA 3RP1A 5GZOC 2HVJA 5K9JH 3BD3A 3U0PB 2H2PC 3P4OB 4N0YL 1KCSH 4L1DA 3T4YA 5I8CA 3ARBC 3S35L 2P24B 3FT3B 2D2OA 3AMLA 4H26B 1NAMA 3PABA 3HMWH 1CVSC 1Q9KA 4Z0BL 4MA3A 1HCVA 2DQHL 1LNUB 4XVTL 5FEBA 4HH9A 5HHQA 4ONHA 3ZYJA 3LEVL 1JGDB 3BEVA 1ZVHA 2CIKB 2ZPKH 4OIAA 3PWPD 2ZSWB 4C56B 3TCXA 5L2KE 5IQ9A 4FQ2L 4PJ5E 4V1DE 4OBSA 1KN4L 4OM1H 4IMKC 4JVUA 5AZ2L 4ZAKC 2JIXD 3MV7D 3IKKA 1QSFA 3BZEB 3GNMH 1F42A 1LO4H 5K9OA 3W9DB 4P2OD 1RY7B 3ESVF 1MAKA 2R0LH 3OL2A 4PRPB 1D5ZB 1KFAH 3O11B 1TVHB 3F12B 3MV01 4Y19B 5KTEH 3F7QA 4Y1AA 5KG9A 5D7JB 3VXQB 1RIVH 3NACH 5EU3B 4AYFA 1IKNA 5HHXL 2UVEA 3K4AA 2ZSVB 2HT4C 3PWPE 1PZUB 3QIWB 3ULUF 3FQRB 4Q7DA 3FHQA 1S9XB 3X13A 5IJKC 4OI9A 3BQUB 3QRFM 4NCDA 5I6XC 1EX0A 3MV7E 5DK2B 4UNUA 3JWOH 5J9PB 3LKSA 2Q7YB 4TUJB 5F88A 2P5ED 2AK1H 2F5BL 1MWAH 3U4AA 4PPTA 4ZUTB 4DK3A 4HT1L 4N5UA 1CICD 1MCWM 5I19H 5KSAB 4LSSL 5I17A 5GRVK 1A9BA 2RAMA 3C8HA 4WW1B 5A2FA 1DQQB 3TN0B 2HT2D 4D0CB 1MCJA 2C4FU 5BW7A 2E8YA 4FOMA 1SEQL 5IMOB 5IKCB 1VFAB 4Y16A 5IW3A 3PWNA 3UTTB 3VXNA 5F21B 4PJIE 1Z9MA 1JV5A 2L7UA 2ADJA 4HAFA 4G80B 3CX5J 3G5ZA 3DTXB 3ZE0E 4MCZA 4XGZB 2P5EE 2EE6A 1NBVH 1TJIH 4DGIH 5IB5A 4JZNA 4ZG1A 3MGOA 3SKUD 3RY6A 1HCFX 4ERSH 1XFPA 3EJJX 4M62H 1N2RB 3VFMB 1MCNA 3LZFL 5TFSL 3TLRA 5SWQB 2A1WH 3ARTA 4OJFL 1NFIA 1NFDE 1FG2B 5L8LB 4H1LA 5F1SA 4N0FB 3EO1A 3C5SB 2OJEB 5FOBB 4XPTL 2VL4A 3EDJA 2K3TA 5I1KL 2YA2A 5INDA 4IBLT 4E0RA 1W72H 3B5HA 5CEXB 3ZHDA 4EN3B 3MJ9H 4ODWB 2I27N 1SJHA 5AUMB 5IUSA 3WFZA 3FO9A 3BKYH 3QFDA 4JKPH 4OD2A 1BQUA 3QIUD 1EBAA 4PJBB 2GJZA 3RL2B 4Y5VA 2EDHA 3MRRB 2X4TB 4YBHA 3V7AE 4PBVC 5GGTH 3QA3B 4H88H 4MLIA 4P5MA 1A5FL 1VADB 3MCKA 4LNVA 3TO4D 3T8XA 4G8GB 3WD5L 4OUUB 1JZ3A 3TYFA 1NBYB 2Q1EA 4IOFC 4Q2ZB 5FFLA 1KYOK 2X05A 4YXKL 4P46C 1UWGL 2O5YL 3MFFB 5LGKA 2CDGB 1CLZH 3BJ91 5CJXA 5JQ6H 3UTSA 1L7TH 1FVDB 4R4ND 5D1XC 4LCUA 2HLFD 2R1XB 2DD8L 2VITA 4KAQH 2F74A 1G7PA 1JHKH 4QRTB 4RMUA 4M43L 2H9GB 2O26U 1UM5L 1XZ0A 1ND0A 3U0TA 2J88H 1AD9B 1D9KC 3C08H 2DLFL 3OKOA 3RJQB 3BT2H 4RWYH 2P43B 3BD4A 3OKLB 1IAMA 4NGHH 2ENYA 4R0LA 4JG1L 3T0ED 1EPFA 5JA9A 5FGCE 3U46A 4GSDL 1HSBA 1RIUH 1BFSA 2FIRT 3ES6B 5I8KL 3IDIB 1IEHA 1I7TB 4XMPH 2W07A 4KI5D 1J1XH 5BVJA 1F4YL 3KLDA 1ZHBA 1SBBA 3O3DA 3H9ZA 4XMKH 5T1KA 3OKEB 5ACZB 4XCFH 1X7QB 4WI9A 4NZDA 1EVTC 5FK9A 4WU7B 1B6DA 4RRPA 3LKRB 5DHVH 2XPGA 3MPCA 5DJ2A 4G42B 4AL8L 3WFBL 4R97C 2IGFL 5T3ZL 4MB3A 1A0QH 3EJZC 5JW3L 1U41A 2FB4L 1IC7L 3A6OA 3RPKA 3ROLB 3DRQB 1J05B 2NY5H 3MV9B 4I5BB 4P2RD 3B5TA 3QIBD 3PDDA 1U95B 1NBQA 5BS0A 3QCVH 2MSPA 4HW6A 1K4CB 3K2UH 5DVOA 3TBSA 5GSVA 4KI5E 2NTFA 4UIMA 1DLFL 4I4WA 2ZUQB 3L3KA 3S35H 4ZUUB 2BSRB 3DXAB 2XTJD 3C09B 4OCRH 3MRDB 5GGQL 4RQQA 1CFTA 4B0MM 1FIEA 4Z0BH 3MLXL 1U8KA 4LLUA 4Q9BA 4P9HC 2HYMA 4LQFL 4Y8AA 1ZMYA 1JTPA 43CAB 2V2WA 3LEVH 2L4OA 1FE8L 4M6ML 3QCUL 1WC7A 2X9YA 3Q48A 3RDTC 1HHHB 3PDOA 4WI3A 1A1MB 1G7QA 4IS6B 3PXHA 5I1GH 2Z92B 43C9A 4Z0XA 4TSCL 4K3JL 1AGCB 5AZ2H 1QFHA 2ZCHL 3CDYA 4LLVA 1KN2L 2W1NA 4P2RE 3BVNA 3QUML 4KRPD 1CWVA 1HXMB 4MSWA 1ADQH 2JELL 3VXMD 3C6LD 4X7EC 1M6OA 3GSRB 1DZBA 3CFEA 4R4FH 4HWUA 5DJ0A 5TPWL 3GIZL 4PBWD 4PJ9A 2XTJE 4M7LT 4U6HB 2VDNL 2J8HA 2IMMA 3S4SG 1I4FA 3QO1B 3S5LG 3DHMA 1B88A 3MXVL 1LP9E 4I18C 5HHXH 2DDQH 4RFEA 2CMRL 5A16B 1E28B 2UZXB 4X6CB 4ETQB 1A3LL 1IKFL 3VW3H 3NA4A 3GM0A 2ZCLH 1PLGH 2NXYD 2QSQA 4J12A 4KZEL 4FA8A 1YQVL 3WNNA 2H3NA 5GJSL 2A6IA 4MA7L 1G6RL 1OTSD 5EO1B 1WWAX 2PO6C 3G5XB 5F89A 4JFFE 3WHE1 3WDIA 1NDMB 4OGXL 4P57A 2NZ9C 2VLLA 4OFYD 4K9EC 1AP2B 2X89D 3O4LB 1U8PB 3ZSTA 5GHWH 4LSSH 3MA9H 3KYOB 4JDZA 5E5UB 1HKLL 2FSEA 2P7TA 5ECJE 3UAJC 5EU7C 5TDPA 4K23L 4L9LA 4ZS7L 4F80A 4PY8I 1RJYA 4G3YL 3L7FB 4O9HL 1N59B 3SDYL 4Z78A 4PGEA 4IDLA 1RZJC 4OQ1A 1DBBH 3BPNB 3LS5L 1A6WL 4EQ3A 4K71B 5IFHH 3BN9D 2XYCA 2Q6WB 1F3RB 4DKDC 2LAGB 3B2VL 1XGYL 1NQBA 5AAMA 3TH3T 2Z91B 3D1MC 5FDYA 2X40A 4E42B 2DQEL 2ADGB 3ZE1E 3RTQA 4HBCH 1NANH 1PKQE 2E7BA 4P3WA 4HKBB 1RUQH 3JV0A 4HLZH 4OJFH 3AAZA 2E9WA 4F7MB 5DFTA 3QSKB 1RUML 4WW2B 4P9HL 5D7JC 2X7LB 2JJSC 3DWTA 3GZKA 4R7DA 3BEWB 3U30B 4L3CB 5D7LB 2IAMB 2VAAB 3QIWC 1UQSB 5I30H 4XNMA 1IAKA 1CDGA 1HOCB 1QKZL 1KIRB 1FSKB 4XH2A 1R3JB 3BQUC 1EERB 3SKNB 3TBVB 1KLFA 1DUYB 4PJCF 4Y4KD 3OXSB 2EH8L 5J7CC 4HIHA 5D70L 2EYSA 5DUBA 4PLKD 1MRDL 4YEFA 1NGPL 1ZHKB 1DDHA 4FQJL 3EAKA 4IEFB 3HE7B 4WTWA 4F7CA 3O6FD 1AR1C 3VWKD 5ID0A 5JW5B 2A0LD 5SWZE 2X4UA 4OLZL 4AH2B 1U8JB 3I2CH 5KSAC 2XACC 2V7NB 3LN4A 3IDJB 4ZO7A 1UZ8B 1A5FH 1B0GA 2VL5A 1MOEA 3WD5H 5LAXA 5SWSD 3TN0C 3RVXC 3PGDB 1JWUA 2APTA 3ZT6A 4EUPB 4YXKH 2O5YH 5E9DD 5HDBE 4KJWD 4TTDD 3DVGA 1MCIA 5KN5A 3Q5YA 4ZOEA 1N3NA 3DGGB 4P48A 5FIEA 2CRYA 4GG6A 1I8MB 5DO2C 2VXTL 4X4ME 4L4VA 3GJEB 4MMXC 1WK0A 4IHOA 4NNYA 2OR7A 3NGBB 5FGSA 4R7NB 4M43H 5DSCB 1CGSL 3PWVB 3CPLB 4QOKB 5EO9A 4QGTA 1U0QA 3T1FB 3H7BB 3SDDB 3SDAA 4QRQB 3T2QA 1AIFB 4CVXA 1MFBH 1PZ5A 1BBDL 3O8XA 3WFCL 5ADOH 1HH6A 2BY1A 5IMMA 5BV7B 3EGSA 3PL6B 2EEAA 5I8KH 5E9DE 3RVTD 1XF2A 1A7OL 2FATH 2M26A 4QRSA 4RCAA 1RZJL 2E27L 3H0TB 2YEZB 1MEXH 4OCYL 1GPOL 4EXPX 3EFFB 3BP7B 3LQAL 1FZKB 3ZTJG 1S7UA 4MQTB 4EN3C 4PP2B 1YEFL 5C3LD 3PDGA 3MGTA 5HPOA 3HAEA 2HFEB 1M05A 3LB6D 4JRYA 2IPKA 1I8KA 4QRRD 4MS8C 4AL8H 3WFBH 2J8OA 2IGFH 3ZE2F 3IFOA 1G9MC 1FNFA 2BVQA 4FFZL 5C1MB 4KJQC 1HHKA 5C6TH 3D69A 1CD1A 4EI5D 1F2QA 4LRNH 3QDGE 5IVXA 3DVNB 5I9QB 1CXFA 3EO0B 5C08D 5HHOA 4H0IA 3S5LB 1UYWL 3T0BA 1UH3A 5F3BB 2F58H 4F58L 1A02N 4HUUA 4KK5D 1DQDL 2YPVL 4NKMA 4X5LA 3GMMB 3VFPB 5DZOA 4ZXBB 5B3NA 5DFVD 4QRRE 5BQ7B 3B9VA 4RMWA 4M6MH 3QCUH 2V5YA 4U6VL 5F6IB 4CU8A 3N1GC 5D8JL 3FB8A 1CCZA 4TSCH 4K3JH 1JYXA 1MLBB 1KN2H 4OCXL 3EOBB 3JTSB 5DI8B 5LWYH 5D9SB 3SDCA 1INQA 2QR0B 3FFDA 4PJDB 5FGBA 4DZBA 5EZJB 1JPTL 1AXIB 5EG6C 4XCEB 1E4WL 5C08E 2WV3A 1LEIB 5IOPA 5IG7A 4NO3A 4PJXE 3FB5A 3GIZH 4O00A 4BSJA 2VDNH 3HR5A 4LCWA 4Y2OA 4YGVA 3DARA 3QEQB 1LD9B 1LEKB 1YEIH 2CDEB 5EFIB 5GGVY 5A2IH 3ULVC 3CH8A 2UV3A 4GRLD 4NQUA 4QRPA 3WFHB 2W9DL 4E41D 1UWEH 2CMRH 2OMBA 4HWZA 3BGAA 5ESVB 3RWCB 3FQXB 3VXSB 1T66D 5DD0L 2EKJA 3DLQR 4HIEB 2XZCL 4UOW1 1FGNL 3FO1B 3BYYA 1CG9B 4N1CA 2HJKB 2APFA 5SV4A 3AS3A 1FNGB 4CU6A 1OPGL 1IAOB 5DC0A 4KZEH 1JRHL 5L6YH 2P5WA 1FNEB 2RB8A 1JF1B 4APQB 2Q8AL 4XPHH 4LBEB 1G6RH 3HZMB 3S8WA 2FH6A 5LGJB 1QSED 4C4KT 4ZOBA 5IBUG 4OGXH 4P2OA 1MFDH 3ECBB 2X1PA 1PYWA 5F7EL 5JW4Q 5C0JB 2ZUQC 5B39A 1J87A 2FX8L 4E41E 3C09C 2DQTH 2A6DB 1LO2L 5EBMA 3QPXH 3VDBA 1DTUA 3OQ3B 3WFDL 4NM4L 4GUPB 4MD4B 5L9DL 3X3FH 1G9ML 2D9QB 1L0YA 3LS5H 1L6XA 1A6WH 2W92A 5DMGD 4WV1C 4RIRA 1VGEL 2MPAL 4PJIA 2OSLA 3WMSA 3E1F1 3EZ8A 1WWBX 3MRQB 1QSEE 4JQVC 3TO2A 1U92A 3LHPL 4PJ7B 3JTTA 3H9SA 3DX9A 1E6OL 3NCCB 4OSUH 5IVNA 5EZIH 1YEEL 1TVBB 4GO6B 1UH4A 4P9ML 3SGEI 1CICA 5EU5A 4DOHE 3R06B 1NBZB 2AERT 3F8UB 1L7IL 3U2SA 4BSWB 1UXWB 5F7LB 3L5WA 3V0WL 5EWIH 1KEMH 5CD5C 5KVFL 2AQ2A 2YD2A 3VXUD 1PKOA 5CKGA 1CGTA 1IBGH 5GRVL 1MUJA 5D5ME 1LE5B 1K85A 2B2XH 1ODAA 4I2XA 5IIEA 3QP3A 1MH5A 2ID5A 1K4DA 3VXRD 2W65B 3OZ9H 1IGYA 5IVZB 2NW2B 3ILPB 4FQJH 1JJUA 3U36B 2V7HA 5LKNA 2B1HL 4KUCD 3NPZB 5JXED 3S9DB 4ZAKD 2BNRD 3TT3L 4NRXA 3DMMD 2DWDB 2BNQD 4OLZH 3N06B 4ZUVB 5HBBA 3ULVL 5DGRA 4MZ3A 1ZT4B 5MEOB 1GC1H 1T0MA 1YEGL 1Z5LA 1CBVL 4XBGA 3HR6A 3MR9B 3UX9B 1YN7A 3VXUE 1R5VB 1FFPA 1SYVB 3RVVD 3WNKA 3QG7H 2DQGL 3X11A 5IB4B 2X4RA 2Q86B 5E99H 2R0ZH 4XXCC 5LBSH 3BPNC 4JJ5A 3VXRE 5H35A 2VXTH 4K71C 4UAOB 2Y4SA 3P0VL 1TZGL 4P5TA 4MHHG 4X6DA 3D87B 3O6KL 4YDJA 2CDFB 4HUXB 4YAQA 1CGSH 2BNRE 5IWLC 5EO0B 4WFHD 4AG4L 2DKUA 2BNQE 5HYSG 2XKNA 2EYTA 4PJFE 2IG2L 2BHZA 4PRID 1BBDH 4NKOA 3HZKB 4PRHB 3VFTB 4AENB 3WFCH 1GGCL 3C8KA 4ZPVA 3KPLB 2DJUA 4WW2C 3P77A 1GAFH 3V5HA 3ZTJH 1NUGA 4OTXL 1RAMA 1A7OH 1JBJA 3BW9A 3U30C 3K8MA 4R2GB 4TSAH 1RZJH 2IAMC 4LHUD 1FL6A 2E27H 4PJGB 1FV1B 4OCYH 3MV11 3P4MA 1FCGA 4KI1A 5AG8A 3LQAH 1WF5A 4FS0A 5E08L 4JQXA 3MRJA 1S3KL 2R39A 4XRCB 1YEFH 4OLXL 1RU9L 3MV8B 4GW4A 2NYYC 1YNTB 3O2VL 1Y0LA 2AK4A 5DMIL 5E1AB 2F8VA 1H3XA 4PREB 2AJXL 1A7NL 4WFHE 4J1UA 2A74B 1DVFA 3AM8A 3RX7A 2DN7A 2VQ1A 3HE7C 2XWJA 4FFZH 4PRIE 1JHTB 2HT3D 3TBTA 3HUJB 3W9EA 2NQCA 5TE6H 3C5JA 1JI2A 1XGQB 1BQHA 1A7PH 1INEH 1ZVSB 4NT6B 4WO4A 3TIDA 3U9UA 3WLBB 1G9NC 4U1KA 3ALWA 5H8DA 3O3UN 5EUOE 3T0EA 1JPFA 1F6LL 1AE6H 4EVNA 3NIDE 4KTEL 2HP4A 1T5WA 3S3JA 1MJUL 5HDOA 1BBJA 5FB8B 5CEZL 3OR6B 5F70A 3KPQA 4U1IB 1O5DT 1DQDH 3SKMA 2YPVH 4LLQA 5JIPA 4FTVD 3MLZH 2F54B 3VFGH 2DB8A 5JHDA 1OB1B 5C0AD 3UJTL 1UB5B 3V4PH 4QXTA 4Z7VA 2DBLH 1T0PB 1OT1A 5I76A 4ODTH 3TVMA 3ZKNC 3NGBC 5FUZL 2A6KB 4U6VH 3VWJC 4NQDA 1PY4A 5F1KC 1GJIA 3LKOB 3RGVD 5FDWA 1NCDL 2DIBA 3SDDC 5D71L 2APXA 1NDGA 3NIFF 5DJZB 4OF0A 4YHLL 5IBUB 4NWTL 4PRNB 4IRSD 5ANMB 4GG6F 1R3KB 1E4WH 4KXZI 2VR5A 5BV7C 2EDEA 4RGMB 4XVJL 3CZFA 3TP4A 5J0BA 1S78D 2E9BA 2GYSA 4XBPB 3EDKA 1TVDA 3J8F7 4FTVE 5CLTA 1TITA 1R3HA 4KKBD 5C0AE 1NH6A 4P46D 2W9DH 1FNSL 4PRDB 2D7TL 5T3XL 3GUTB 4Y4FB 3C5ZB 1DP0A 1NLDH 5D1XD 2XZCH 1FGNH 3IJHB 3C2SA 2R2BB 5JIKA 4KUZH 1NL0H 2I5YH 3KYMB 2YD4A 2QKIB 5GGUA 3AY4C 5D2NE 2JKXA 3WS6C 2YSSA 3GI8H 3N9GH 1N7ML 1D9KD 4P2QB 2IH1A 3UEZA 1NEUA 4Z7UE 1IC1A 3QJHA 3TCLB 5DQJB 1YJDC 1IGML 3C6LA 4LSPL 3VXMA 3N1MC 3TA3A 1L4IA 2NY2D 5DRWB 5I9QC 1ES0B 1KIQB 5ESAA 3QDHA 5F7EH 1Q1JL 4OT1L 4LLDA 3TIEA 4LAQL 4QHNB 1Q8MA 2DM2A 1MCSA 5I8CB 4XNUL 2EYRA 3CXHJ 4OZFG 1QOKA 3BISA 4ZXBC 4NM4H 1LO0H 2YA1A 1MJ8L 2VZ3A 3WFDH 2JK5A 2IBBA 1QLEL 4EQ2A 3DV4B 5IVXF 5ACLA 3IF1B 2IQ9L 5J4MA 5F6IC 3L3GB 1CD8A 3BEVB 4U6YB 2MPAH 1OL0A 1G9NL 3HG1B 3EJZD 3PHOB 4Q6IB 4X5XB 3ME0A 4HKJA 1TZHA 4EJ1C 3VFSB 4JO1L 4NNXA 5H2BA 2X4QB 3LHPH 3IJYB 1JWSB 4JCLA 1E6OH 5F1OB 2P8PA 2R0WH 4KK8C 4KMLB 2E7LC 2ICCA 3HPLA 3HTLX 5D2LE 5I1AA 1UACL 2DL2A 4Q74A 2O93L 2FNBA 5DJYB 1UVQB 2X89A 2FR4A 3SDXA 2OZ4H 2YK1L 2Z31D 4JKMA 3SE4A 3NABH 2R1YB 4AIZB 1MWAA 2M2DA 3V0WH 4GJTB 4PJCB 3GRWH 3O6LL 3P4NA 4HSQA 4LSUH 4ZPTB 1H3GA 3CLEL 1N5YL 2OP4H 5KVFH 1UWXH 1FZOB 1AQKL 2NY4B 1INDH 3MJ7B 4Z5RB 2VE6A 3K74B 1ZHLB 4P59H 2CGRL 1YMMD 3BP5A 3OKKA 2GITA 3FT4B 3KPTA 3RDTD 2FECI 1XT5A 5EZOL 3RWEB 1AH1A 2AKRB 2YXFA 5HYSB 3MZGB 3CMOL 5IF0B 1NKOA 4APQC 4Z7NF 4OZGE 4G6ML 2VZVA 3L95A 1GIGL 1I1CA 1LWRA 1CGWA 5HI3C 4F2MA 4G6KL 3KPMB 2R23B 2W9EL 1YEGH 4GAGL 1QBML 1EZVX 2F19H 1WEJH 1TETH 2HFFA 1FFNB 3QB7C 2IC2A 5I17B 4Y8DC 4PLJC 1S9YA 3CD4A 3PGCA 4UT6L 5HYIA 5AZEH 4N0RA 2DQGH 5F1IA 3DX8B 3JWDC 3DIFB 3HC3L 1E4JA 1YMME 4JFED 4I0PA 5DWUH 1U58B 3BYTA 3B8SA 2BHUA 4Y16B 4OLWL 2G2RA 4MAYD 4DGYH 1MLCA 3FQTA 1TZGH 4Y4KA 5HGGS 4LEOA 4XCNA 5DQDL 5LXGL 3ZZ1A 1YJDL 1W72A 5H94A 4GMTL 3U4BL 4OIBA 4XP9H 1GL4B 4AG4H 1KF9B 4MNQB 5HD8D 1OP3K 4YH6A 1ZANL 5CZKA 1OOAA 3VWKA 3KR3L 2JCCB 3RKPA 1MHCB 5HHMD 4M1CC 1KNOA 2KH2B 4JZNB 1FO0H 5IHBA 4RBPH 1VGKA 1A6VH 2J4WL 2NZ9D 3MBED 5JOEA 2X6MA 3KXFA 5T1LB 5KSUA 1JZ2A 4Y5XA 2EIZB 1ZTXL 3SQOL 3ZMRA 1MCOL 2WLYA 4PJIF 1IRAY 5SWSA 1A4KA 3UAJD 4JFEE 5IFAL 1UCBL 1E4XL 3WO4B 5AAWA 2FL5A 4OB5L 4QF1A 4FQHA 4M8QB 5CBEB 2CLVA 2HTKC 1RU9H 2OR8A 3QUYB 4OLXH 3VD4A 3DO7A 1LEGB 1N8ZB 3IVKB 3QG6B 3O2VH 3R8QA 2AJXH 1A7NH 5CS7A 1S7RA 5D1ZA 2EEBA 3HS0B 5F7WC 4YHYB 3U6RA 3V6ZB 1HEZA 2C7UB 3D18B 4QRUB 5HHME 1NFDF 3TBYA 5FA4A 1P7HL 4MX7B 5GRUL 2D9CA 25C8H 5CBAB 4XNZB 4ZDHA 1TMCB 4MQXD 3D25B 3P0YL 4N0UB 4LASL 4Y19D 4J3VA 4P5KA 5CZXC 5IHUL 5D7JD 5ERWB 4H8WC 5A43C 1IGCL 1P7QB 5IB2B 4OFKA 2Y72A 1JNJA 1FL3A 4JZOA 1K8DB 2NW3A 2XQBH 3A6BL 3QIWD 4RNRB 1ZSDB 3W0WB 2R9HD 1MQ8A 3HCVB 1ZLWK 4UAOC 4G8FB 3LVEA 4O2FB 1EJOL 1S8DA 2JLLA 4KJPC 4NUJB 2EXWC 4LCUB 3ALXA 1OAYH 3T2OA 5JPNA 1GGIH 2RCSL 5CKAA 1NCDH 4U4BA 5F7NC 1AR1D 1JPGA 4YHLH 3B43A 3GFUA 5DHVA 2XOTA 2ATPA 1RK0A 3RWJB 4EI5A 1CFQA 3AROA 4HJJL 3OB0H 1OM3L 5KSAD 5KS9E 4BFIA 5CGTA 1I9JL 2VMFA 1BZ7A 3BZFB 3SGDH 1EEQA 1A6UL 4D8PA 4PJEB 4X6DF 2RFXA 4R96B 5DRNA 1U8IB 3JWDL 4S0TD 2VB5A 4ONGL 5E8DH 1ED3B 3QCTH 2G9HB 4R2GC 3U46B 1HSBB 3P30L 4OZFB 4B53A 5MP6L 2DQDH 4LMQE 5DT1L 3F6IA 1BVZA 2X2YA 2BVEA 2NNAB 1DCLA 4JGMA 1A3RL 3WSQL 1HWHB 5GGVH 1I7UB 5T3XH 2F53B 4TVPL 3STLA 5L2JA 2X1QA 3TBWA 5C0IA 2XWBB 2AJ3A 3VRLE 1MRFH 3DUUA 1U36A 3KPSB 2G60L 1CFSA 5DO2D 2QHRL 1X5HA 1YN6A 2FZ3B 2GT9A 3ZYIA 1FRGL 1A4JB 3WNLA 3TV3L 4LVNB 1NUNB 1S5HA 5F6HI 5C07B 5IW1B 4G6AD 2Z8RA 4OF3A 3UO1L 1B9ZA 4RAUB 3RWFB 4LSPH 1CFNB 3U4EB 1DN0B 2G5BA 3HI6L 5BXFA 5BRZB 1SJEB 3HA0A 4DCQA 1DQTA 2I25N 1NGWA 5D7KD 4LAQH 4KKAC 1A6ZB 4OZIA 3C60B 2GJ6A 4LLYA 3MOAL 4YWGH 3G6JA 4XNUH 3EYOB 4WU5B 4C58B 3OKMB 3VXPA 2FHCA 4NQCA 4RQQB 3ROOA 4HLJA 5E2UH 4FQXD 5E6IB 1U8KB 1GRWA 2IQ9H 3SPVB 3TYGH 4XPGL 4GKZA 2V2WB 2AJYL 1Q9WB 3F7RA 4MS8D 3RIFF 3VGAB 1JGEA 4WFED 5CIPB 2A38A 1G9NH 2AJUH 3KWWB 4JO1H 4NC0B 1BJMA 2ADIB 2P46B 1Y6KR 3QQNA 1WLHA 1F58H 4JPIB 5IEHA 4KROB 3GKWL 1XEDA 5ISZD 2XA8L 4Z7VF 2HH0L 4JFPA 3PP4L 4RGMC 4H25B 4H8WL 1UACH 2LVEA 2BRRL 3STZB 5JUEL 1WTGT 4S2SB 4G8GD 4JFYB 3MLSH 2WINB 4JFDB 1MF2L 1G7MA 3WIHL 3WJLA 4X98A 4PG9A 3P3YA 1DBMH 1T1YA 5T5FL 1T1XB 3LRGA 3CLEH 1CE1L 3EYVB 1N5YH 2BK8A 4Y4FC 3C5ZC 4C59B 2BSTB 3KPPA 1RFDL 5K9KA 3MLUH 4WFEE 4L8SB 3MRLB 1Q0XL 3OG4B 1AXTH 4HS6B 1N5AB 4YXHH 2Q8BL 5D5MA 5EZOH 5F3HA 3VI4E 1VHPA 1RZIA 1HXYA 5FA3B 3CMOH 2IALA 1AGEA 2DJ4A 4X6BA 5ISZE 1XCTA 3MLVL 1IAII 4LRIC 2AEIT 1HKFA 3PQYD 5ENWB 4U1NB 4J7RA 3BFOA 1OF2B 5TJWK 5H37H 1Z9LA 1I1YA 3NTCH 3MROA 1TZIB 3GMRB 3U9PL 1KTDB 2W9EH 4GAGH 5TDOA 1FN4B 2V17L 4Q6YA 3ARBA 4XMLL 1HQ4A 4PS4H 5CSGA 4UT6H 1VFOA 2I9TA 3DHJA 3BUYB 2BVYA 3EZJB 3LCYA 3BWAA 1WQVT 4GT7A 4Q0XH 2P45B 1WBZA 1RJYB 4ZSOE 3EYQC 1J8HB 4P4KB 1PG7X 2HMIC 1HQRA 4NO5B 2OI9B 3OAZK 1MCPL 5DQDH 4Q6IC 5E24E 5KSBE 2PF6A 3PQYE 4ONFL 3QEGL 1W0WB 2FEEI 3OGCB 3U4BH 3G6AA 3VGDA 1D5IL 4X4YA 4IMKA 1NC2B 3MRIA 2CKBL 4WNQA 4ZAKA 2BNRA 1NLBL 2VLKB 5L7XH 1P1ZA 2QL1A 5F9AC 1XR9A 4YDKL 3O2DH 4UTBL 4NFCA 1RPQA 5AYUL 3SQOH 4TPRL 3VCLA 3ZKXB 4G9FA 4WHYH 2XQYK 3FAWA 1JIBA 1T1WB 4ZQKA 4G5ZH 4ZUSA 5DMYA 1E4XH 4OLYL 1U8NB 4F7TB 4NP4H 3QJFB 4MCYA 2AV1A 2NY4C 1QLRA 4KKLD 3GSNH 3FO2A 1CGVA 1AO7B 3SDXF 1DE4A 2IH3A 2DQIL 1IAKB 3BPCA 2XFXA 2FGWL 4QGYA 5IJKA 3BAEL 5F9WB 1JZ6A 3FRUA 1OGAB 3GSVA 3BRGC 4K3GA 2UWEE 1KGCD 4OQTL 3VRJA 5GRUH 4NQXA 1J0KA 1UEMA 2BVPA 3B3IA 1Z3GH 4PRIA 3PWUB 1WFOA 3QUKA 1JE6A 2DWEA 1UA6H 2UZYB 5IQ7H 3P0YH 2D0GA 5CP3A 2SEBA 1NEZB 4IM8A 4LASH 2ZWLT 1NAKH 5EBLA 1I8IB 3ARYA 15C8L 3LN5B 5IHUH 3WE6A 1B0RB 3IXAB 4PJHE 1I1AB 1LE9A 4PV8B 4JG0H 4ORZC 1WCBB 1TCMA 1MSPA 3MRKA 3SOBL 4Z7OE 3O3AB 1N4XH 1QPPA 2H8PB 2CSPA 4MQ7B 5I16B 1K5NA 4G9DA 1EJOH 1KGCE 5TE4H 1CS6A 3MJ6A 3GSQB 4HJ0C 4K7FB 1F6AA 3KYAA 1SM3H 1CL7L 4U2ZA 1J8KA 3P0GB 5C0CB 1AFVL 4HEPG 5HDBF 4KDWA 4HJJH 1C5DA 4J4PC 3W5MA 4YO0A 2E3VA 1D6EB 4JFZH 4FZEL 1I9JH 3ALPA 5IW6B 1A6UH 3T3ME 3W2DL 4DW2H 3B9AA 3CVHB 4ONGH 3V7AG 3K8LA 1JZ8A 3WO4C 1I3VA 1EHLL 5MP6H 3CSYB 4OLUH 3QNXA 3VFVA 1A3RH 3QUYC 3QDMB 3WSQH 5IR1B 2VDRL 1KEGL 4Q9QH 4OFPA 1CQKA 4YHYC 2XZQL 1XF4B 3H9HA 5GS0C 5T3XD 1FRGH 2WUBL 4DKFH 2D03L 4DQOL 3NN8A 5C6PB 1SEBA 4J3TA 4N8CH 1HHIB 4D0BB 1ZHNA 5EN2A 1DANT 3FJTA 3B9EA 1A1NB 4XNZC 3UO1H 1BD2A 1WZLA 1MCRA 3V4UL 1UJ3B 3PF2A 4P3CL 3HI6H 4LP5A 4CW1A 5FM5M 1FIGL 4J2XA 3QUMA 2YN5A 4OCWL 4NQTA 5TF0A 4OFVA 5DJCA 1EHXA 1R5WB 2I60H 4ELME 1OAUH 4NSKA 1G7LB 4BA8A 4P46A 3LV3B 1CF8H 3BGFB 1F3JA 3D2UB 1I8LC 2RJMA 4NKQB 4M02A 3EFDL 4MXWL 3G08A 1T04A 3X14A 5JO5A 5D1XA 2E5EA 3WJJC 2C3GA 5ID1B 4X99B 5FF6B 2HKHL 1KB5L 3EIFA 4M6AA 4LKCA 1YUHB 2EDXA 5K59F 3IKCA 3KPOB 2W0FA 4W6WB 1D9KA 4WGVB 5C0BD 1JK8B 5L2KB 3GKWH 4PJ5B 4V1DB 1QFPA 2XA8H 3DURA 2ESVA 2HH0H 2XTLA 1INQB 3MLWH 3PP4H 4LCCB 4N8VG 2W59A 5A3ID 5DK3A 1BFOA 5JUEH 1L9NA 4QTHB 4DGVH 3ARFD 1G6RA 1IM9B 2J6EL 1BOYA 5EU4B 5DEFB 3ILQD 3WIHH 2V5TA 1BQLL 3H8NA 3UZVB 1P84J 1NMBL 1MJJB 2BCKA 1RJZB 4WENB 4NNPH 5EC2B 2APBA 5CCKL 1S7VA 4NYLA 3PWLA 1RFDH 4WWID 3RY4A 1SMAA 2ZCKL 4HPOH 1IARB 4NBXB 1Q0XH 3ZKND 3HZYA 4QHUA 3VWJD 2Q8BH 2ICWI 5C0DB 2A83B 1Q9OB 3PWPB 1Q94B 1U93B 4QOKD 5C0BE 3WV0A 4LVNC 2OL3B 3VFRB 3SDDD 2CUIA 1WBYA 3UTQB 1RZ8B 4YJZL 1AGBB 3ZSSA 2I07A 5JOFB 1CFVH 4YNYB 2JIXB 3MV7B 3AS2A 3BO8A 1FC1A 4J3UA 3WDHA 1MFAL 3I6KB 2NLJB 3BJLA 3HPJB 3T77A 4BFBD 1KPVA 3BP6A 3C60C 2V17H 5GRZA 4F7EA 4PD4K 1EEZB 1F2XK 1JYWA 2GQHA 3L3HA 5E6IC 5GS0L 1UADC 1MPAL 3QQ3B 5GGSY 3GBMH 1JTTA 1ORQA 5KANG 4Z9KB 4PRBA 3VGAC 3VFWA 4NO2A 5CSZB 5D93B 3RDTA 5E8NA 3I6GB 3V5DA 1QVOB 4X9IA 5F9DC 4LPYA 4ONFH 4BQ8A 3QEGH 3GIVA 1D5IH 4LGPB 4PIRF 4CKVX 4PJIB 1B90A 5DUPL 2YPLA 4OCNC 3KPNA 4HQQL 4KROC 4NDMA 2CKBH 1NLBH 3MJ8B 3NBNA 5F7MC 2P5EB 3WO3B 4YDKH 2Y25A 4UTBH 5DHXB 5AYUH 4P2CG 4TPRH 1ZOXA 1UB6A 3MYJA 3P9MB 1FZJB 4EDXA 4TUOB 2MCPL 5HYJD 1V7NL 3MYZA 4PV9A 3FHAA 4UILL 4U1MB 1X6NA 1JZ5A 3SY0A 2AJVL 4OLYH 1S7SB 5DF0A 4G43A 4YE4H 5BJTA 4I18A 4LKXB 1NFDB 4M7LH 3VD7A 4RFNB 2D31A 2YUXA 1KENL 4L8SC 1V7MH 4OZ4B 5E8EB 3N0PB 3ORJA 2DQIH 3DRTA 1G0XA 1VACB 3ISWA 5EBWB 4QO1A 3RIFK 2D4FA 2QADB 4NKDB 5DYOB 4X6FA 3SKJL 4L8CB 4OD1L 2PYFA 4OQTH 1MHPL 3OV6A 4MMZC 5FO9A 4XWOC 2J8UE 1CD0A 4JY4A 1U8QB 3TC9A 1XIWD 2PO6A 2BDNL 5EIIB 5HYJE 2MCG1 3BZ4A 1KXTB 3U0PA 5D5MF 3NMEA 3F7YB 3P4OA 1X5FA 1VPOH 2P24A 3FT3A 4H26A 4LLWB 2EDQA 3M8OL 4K8RC 4MLSA 2Z8SA 5I1JH 1AI1H 2WM0A 3L5JA 3CX2A 5DJXA 3SOBH 1LNUA 3VXSD 2DL9A 4ELKB 2ARWA 1JGDA 2CIKA 4P4KC 4UQ3B 2ZSWA 2CRZA 2HWZL 4C56A 1I3GH 1QRKA 2XZZA 4X6EB 3OPZH 4XP1H 2HJLB 5E4IA 1CL7H 4APQD 3QIUB 5E5MB 4UU9B 2IFGA 4JHBA 4PJAE 5I1LB 4WFGD 3BZEA 2RHEA 1AFVH 2XKNB 1MI5D 1YY8B 3W9DA 3AMKA 4UB0L 5KW9H 1CXLA 3LS4L 4ODVH 4FZEH 3OJMB 3U0WL 1RUAL 3DYPA 4PRPA 4NKOB 1D5ZA 2EZ0C 1MJ7L 4JM4L 3W2DH 3ZKXC 4JO3H 3O11A 1TVHA 3F12A 4Y19A 5TE7H 3WNPA 3TO4B 4F8QA 5INCB 2VXSL 3JV6B 5D7JA 3VXQA 4KUCF 1FG9C 2JJSA 3L5XL 4JKWA 5EU3A 5JDSB 2GTWB 2ZSVA 4BSVB 1MIMH 4XNYL 5FGCB 5IMKB 2KQNA 3QIWA 1VCAA 2BVOB 3FQRA 4YFLF 5CFHA 1KEGH 4U1HB 4TOYL 1S9XA 4JM2D 5F9WC 3BQUA 1HSAA 5IM7B 5DK2A 2VZSA 1MI5E 2VQ1B 2Q7YA 3SO3C 3DECA 4TUJA 1I1RA 4WUKL 4N8VB 3TBTB 4ZUTA 4M1CD 3I02B 3C5JB 1QSVA 4JDTH 1BQHB 3C8DA 5KSAA 1JFQH 2DQFA 4YC2B 1TENA 4JY5L 1WFTA 2FEDC 4U1SA 4WW1A 1DQQA 1I1AC 3TN0A 2BC4B 1QA9B 3RAJH 3WUWG 1S7XB 4D0CA 1QBAA 2HTLD 4HGMA 3RA7H 1J0ZA 5IMOA 5IKCA 3QFJE 1VFAA 3QRGL 1QBLH 4EOWL 2N1KA 4E9LA 4I13B 3S98A 3EFDH 2F8OA 3X12B 4G80A 4QXTB 3DTXA 2HKHH 1KB5H 4XGZA 3NIDF 3OX8B 1HI6B 1B4JL 2DF3A 4JJHA 1BIHA 1DBKH 1UEYA 2HFTA 4W4OC 5KVGH 3IU4H 1N2RA 3VFMA 4OZHE 5LGHH 5M94B 4O5LL 3GSUB 5SWQA 4K8RL 4P2RB 2QSVA 2WBKA 3QIBB 1FVEB 4B5EA 2J6EH 3GMNB 3VFUA 1Z0NA 4N0FA 4EI6B 5C70A 4TULH 3C5SA 5D6CB 2OJEA 4KQ3L 3PHQB 4OAWA 5FOBA 1IFHL 1CZ8L 2XTJB 1C5BH 5CGYD 4Z77B 3GHEH 5CCKH 5CEXA 4EN3A 1PBYA 1WGOA 4ODWA 1P7KB 2ZCKH 5F72S 5AUMA 4LLAA 3CCHB 2PR4H 1LP9B 1OHQA 3DSFH 1ONQB 2QSCH 1HINL 4GXUM 4KJPD 2EXWD 4WEUD 4ACPA 1C1EL 1S9KC 4M7ZB 4QTIL 3RL2A 1S7TB 3MRRA 1LK2B 3VFOB 3QA3A 1UJ3C 5ISZA 3QJHB 5T5NG 1MFAH 1VADA 2ICWB 3REWB 4G8GA 2RR3A 4OUUA 3SCMD 5HHNB 4G8IB 3NIGE 1NBYA 4JFFB 4Q2ZA 1F02I 4GW5B 5GIRA 4S1QL 3BE1L 4TRPL 3MFFA 2CDGA 3IXTB 3BGFC 3MRBB 5FUOL 2H2SD 4PTTB 2C26A 4H1LG 2XV6B 3RWDB 4QKXB 1FVDA 2D7NA 2X4OB 5I74C 2R1XA 4QRTA 1DQLL 3MACL 1ZK9A 2H9GA 3ZTNL 4M03A 5FYJL 2CLZB 3RVWD 3CFJB 1H5BB 1B2WH 2NXYB 2Y7QB 1AD9A 2JJUA 4K7PX 1YEJL 4UUJB 4LDOB 4HQQH 4UINH 2VYRE 4LCCC 3OKLA 1T80A 3TF7C 4M5YH 2B1AH 2NX5D 3PGFL 4S0SD 3UPCA 2N7AA 2VZ1A 1P4IL 3RL1B 3Q2CA 2R1WB 3G5YB 2ITDB 3ES6A 4NZUL 1QNZL 3IDIA 1NCWL 4YHML 4DEPB 1I7TA 1PQZB 5IBTL 1PKQB 3HNSH 1DR9A 4NQED 5K93A 2F54D 1BHGA 3QEUB 3OKEA 5SX4I 5ACZA 4LHQB 1V3LA 1X7QA 3P9LB 2VXVL 2YRLA 2OLDA 4N5ED 4WU7A 3LKRA 4P23C 5D2LF 4G42A 3HUJE 4AMKH 4MD0B 4UDTB 3DETC 3UBXG 1ZEAL 3CDCA 3SKJH 1WBXB 1MHPH 1CTOA 3CVHL 3ROLA 3DRQA 1J05A 2NX5E 4RMRA 4WGWB 5ABDE 3MV9A 4I5BA 5HGDB 4OZFH 2UWEA 4S1SH 5ITFA 1NANI 5JLZA 4ZNCD 1K4CA 1H3VA 4M48L 4D0DB 5FYKU 3UTOA 2VOTA 3BIKB 5SWZB 2ORBL 4NQEE 4ZUUA 3DXAA 3LQZB 2X5PA 3GB7B 3M8OH 3MRDA 3IDXL 5FECB 4U1GB 1EFXD 3HN3A 5GRJL 2NY3B 4Y89A 4OZGF 5HHVH 3ARSA 43CAA 4BQ9A 1RZGB 2E7MA 2EDOA 3OF6D 4YFEA 5D93C 1A1MA 4LP4A 4IS6A 5JMOC 4MNGE 3MUGB 2Z92A 4G7YL 3EDFA 4WV1A 4Y4KB 4YFLI 2VZTA 1AGCA 2AEWA 4XT1C 1W72B 4OLVL 4RRPG 4JQVA 4QXUL 1HXMA 1RJLB 1CTNA 1FP5A 3O6FB 4MDIB 1BAFL 1M71B 2LU3A 1WUNT 1WCQA 3GSRA 3LS4H 5ADPH 5EPMB 5J3HD 4Z8FH 1RUPH 4ZD3L 3U0WH 1F00I 2BJMH 4JM4H 1VB9A 4JHWL 1P6AB 4HIIB 2C4FT 1QTYT 3WUWB 3B2UD 4Q9RL 4XPBH 2VXSH 3RU8H 3QO1A 5GGRY 3FQNB 2HT2C 4WFFD 3VD9A 4OGAC 4RFNC 3SEPA 4NBZB 1H0DB 4NM8H 4F7PB 5E9DB 5A16A 1E28A 2PNDA 1HN1A 1A6PA 4R26L 4X6CA 1K6QH 5JIHA 4ETQA 3EYSL 3RKDD 3H9YA 4TOYH 3MRMB 4KRLB 4HLZG 3FL7A 2QADC 2HMID 3WN5B 2WWKO 3NZHL 4JFQB 1UZ6E 1HEZB 3E8UL 4WUKH 2DMCA 3G5XA 1NDMA 2D7MA 1AP2A 1TCRB 3O4LA 1UKTA 4POUB 1U8PA 2AV7B 4HJGB 3IYLW 3KYOA 3T65A 4WFFE 4JGUA 3GSWB 3FRPG 2XXMB 3QDGB 2BFVL 1A3QA 1DSFL 4ETYA 4JO4L 4R90L 2NY4D 4JZOB 4KDTC 2OL3L 3L7FA 1N59A 3MNWB 2ZJSH 4XXCA 3RWIB 3K81A 2WP3T 1AGDB 5I8EB 4XAKE 3G5VB 4YQXL 2BOBB 1IGJB 3RX5A 3D0VA 4ZFFB 1JGLL 3MLTB 4Q58C 3QIUC 2NY7L 3HNVL 4QRRB 2Q6WA 4HUWB 5CWSB 5IWLA 1B4JH 1G7JB 2YPKB 1J5OL 5HGBB 2H41A 1JF5A 2EO9A 2Z91A 1XF3B 3I3EA 4I0KA 1XGTB 2ZZUT 4E42A 1IAIL 4CGTA 2ADGA 5CZVL 2ATPB 5AG9A 4K3DH 4O5LH 4HKBA 1BOGA 1KJVB 3LKNB 4KHTH 1QSZA 2AJSL 4F7MA 3TO4C 4JANB 4WW2A 3TPKA 4HIJB 2X7LA 4MZ2A 4YPGB 3O3EB 5C08B 3BEWA 4LNRA 4X4XB 4G7VL 4HS8L 4L3CA 4PJXB 2IAMA 3HKFA 4RMSA 5D7LA 5HGHB 2FJHB 1UQSA 1EHAA 1BVLB 3CZJA 4GLRH 4KC3B 3KLHC 1HOCA 1KIRA 2DM3A 2VSDA 2X09A 4LHUG 1R3JA 3SKNA 3TBVA 4R4NC 5KS9F 3MRGB 3RQ3A 1CFSB 2HG5B 1ZHKA 5KVDL 3V8CA 3G9VA 3HE7A 1DL7L 1CDHA 4FFYH 4RWHA 1UCTA 5JW5A 2E6QA 3D3VD 3UC0L 2VDMH 4K94C 5C0ND 4AH2A 1U8JA 4YC2C 3IDJA 4FMKA 5T1LD 4QNPE 1UZ8A 3RX8A