4OCRL

Crystal structure of human fab cap256-vrc26.01, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
b'SVLTQPPSVSAAPGQKVTISCSGSSSTIGNNYVSWYRLLPGTAPKLLIYKNDNRPSGIPDRFSGSKSGTSATLGISGLQTGDEADYYCGTWDTSLSGGGVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.01 light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocrL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocrL01
3JWOH 3FQXB 2DQUL 4PJBE 1N26A 1FE8H 1J1PH 3RTQB 2N7BA 4KROC 2HFFB 4LSQH 3A67L 5D7IE 1MAKA 4ZPTA 4YE4L 4X7TB 1NGWA 4Z76B 4JFYA 3PWNB 3MOAL 3RIFK 4G9FB 1U8KA 5HBBA 3QUKB 2D03L 2CK2A 2BVTA 4PR5A 4F33B 1UGNA 5D9SB 4XCNB 2DDQH 5IBLC 2ICEB 3BSZH 5IB4B 2HH0H 3T3MF 5GGVL 3P4OB 2DKUA 3NZ8B 5KVGL 1QSFA 1NANI 3A6BH 1FNFA 1RZKC 1IKFH 1AP2B 3RVXC 1NLBH 4DGVH 3SDCB 3GSNA 2VDRL 1AI1L 4PJFE 1J7VR 3WO3B 2X1WL 2QQKL 3I3DA 4L3EE 4FQJL 3KYAA 2R4SL 1FFRA 1AQDA 1OPGH 1ZHKB 3GI8H 4CW1B 5C0AE 4MNHB 1I85C 4KI5E 5JTWA 4ONOA 3RI5K 3FQNB 3QDGD 2V17H 3ZE1F 2QL1A 3IU3B 1R3HA 3U6RB 4JO2H 2PW2B 4QRRA 4UV7H 2W9EH 1BM3H 2DMBA 4NQTA 4UQ2B 4PB0L 5GRVK 1MLBA 3QUMB 5FGCB 1QSEE 4OGYL 1RZGA 3B6SB 2R2BB 2Z35B 3MV7D 3QQ3A 1QG3A 1BJ1H 1DDHA 5F7EH 2H9GB 3S3PA 1VGKB 5HDBF 4DFIA 2HT4C 3WS6C 1ZT7B 4YIQA 1J0HA 4QOKA 5DJ0A 4QRPA 1E6OL 2F54D 5C9JA 4GAJL 3WSQH 5D7KD 4RFOH 1YNTA 1Y0LA 4YGVA 4P5KA 4UI2A 3BXNB 3S7GA 3UJJL 1FDLL 1OP5K 4Y8AA 4EI6A 2D4DA 1AXSB 4NQXA 4LRNH 1R0AL 4YDJA 3ARVA 3K80A 3IYLW 4QTHA 4H8WC 4LDLB 2DN7A 3T0EA 3IDJB 3K74B 2CXGA 3VDBA 1BBDH 1DVFB 5FYLE 3MRLB 4KH2A 3O6FA 5D6DA 1SM3L 4UILL 2FX9L 3L95A 1GL4B 5IG7A 3KLSA 4Y4HB 3OV6A 5FM8A 4JRYD 3JSSA 3SE9L 2IANB 4FMFA 4IIQB 5I1EH 4U1GC 3L5HA 1QSFE 3AM8A 3FT2A 3VRIB 1T80A 3OHXA 3CFBA 1KCRL 3QIUD 3P77A 4HQQL 2BVUA 2AV7B 3JUYA 5SV4A 3QCUL 4MD5A 4BELD 2WUBH 3X11A 1S9YA 2A0LC 2VIRA 1LO4L 2FBJL 3G6JB 4Y4FD 4GRWF 1QR4A 4W6WB 3AS0A 2OMNA 3RWDB 3OJDB 1X6NA 2EYSA 1VB9A 3NMEA 4GH7B 1IAOA 3QR2A 2IH3A 4WENB 4LFHG 1T6VN 2NY6C 5ISZB 3QDMD 4QRRE 3L3OA 1CGSH 2WBWB 4FFVC 4ZO9A 3ZTNL 4ORZC 3C09C 4OGZA 5TE4H 1RZFL 4LCCB 3OR6A 4E9LA 1T7VA 4HT1H 3OX8A 4HS8L 4PJ7F 5CFHA 2CGRH 3OJ2C 5TE7L 1K2DA 3LHPH 1E4XL 2WBKA 4ETQB 1G7PA 1CF8H 2ZNWA 4OI9A 3SBWA 2BNUA 3GK8L 1DQLH 1SYVA 5D70H 4JRWA 5DDHB 1VFBB 4D94A 3RL1B 1XGUA 3ZDYF 1TPXC 4QOKE 3FQRB 4QRPE 2VLJD 4LVNC 4GRMB 1MQKL 4KJWD 3UBXI 3SDXB 1F4YL 3NH7L 1XR8A 5J12B 4GKNA 1A9BA 4UT6H 5C3TA 2HJLA 2BVPB 1H3PH 5F70A 1FNSL 2L4OA 4FFZL 2ZSWB 4WW2F 5INDB 1I1AC 1P7QA 1VPOL 3QZWB 1Q8MA 3QJHB 4NM8H 4A2MA 3RU8H 3T0EE 4KUCF 4G8EA 3HFMH 5A2FA 3QXDB 3X3FH 1JWSA 3CFKA 3KJ6L 2I9LA 1F58L 4G3YH 4U1KA 2VKWA 1JHTA 2NXYD 4KK6D 3WLWC 1YYLL 4CKVX 1EEZB 2DTML 2GUOA 2VABA 3OKOB 4DW2L 1M1SA 2ARWA 3ESVF 3MCKB 4NIKB 4NWUL 3HNVL 5MEPB 1F90L 4E41E 1EDQA 1S7WB 4XCEB 4MJ6A 1TVBA 1G9NH 1SJHB 3BP4A 1JFQL 1JVKA 5E99H 5HI4C 2EO9A 4P23D 5I1DA 4KZEL 1Z3GL 5HVGB 3QPXL 2VTFA 5IM7A 5JW3L 1F3DH 3WFDH 4KQ4L 1ERNA 3W9EA 2FR4B 3UPRB 4NWTH 5JOFB 2G60L 2NY4C 4OZFH 2A73A 2RCSL 1FIEA 5FHAH 4AY0A 4GSDL 1KELH 2WP3T 2NQCA 3BUYA 1FNHA 4L5FH 5IB1B 3QBTB 2J5LC 1FRGL 1BFOB 1WZLA 1I9RL 4QT5A 2E7BA 2R0LH 2IBGA 4XVSH 3VI4E 3RWCB 1JZ3A 3DV6B 2R2HB 1QPPA 1Q72L 2BVQB 4MB4A 3LS5H 1XIWC 2PR4L 1WBXB 2BOBA 1JUFA 4JZJC 4N0FB 1KXTB 4EI5A 3C8HA 2HTLC 4AMKH 5GRXG 3U4BH 2Y9RT 1JGLH 4X4YB 1KCKA 3GIZH 1NCWL 4OJFL 1WEJL 3KXFB 1MRFH 2CJUL 4N5EC 5EU7C 2X4UB 1T03H 3EO1A 4OZIF 1U8JB 4HUMB 4LCYA 3W39B 3KS0J 1RIVH 2J8UA 1YEGH 4NKOA 5I1KL 3ROLA 2W0LA 3KPOA 1U6AH 2VUYA 1UB6A 5I8KL 2HG5A 4KY1L 5DFWH 5DJAA 1YEJH 1U8PB 2NW2A 4ZNEA 3RVWC 5LAXA 2DQDH 4OZFA 3RY6A 5C0EB 1JYVA 4U7KA 5JR1L 3MLXL 2BRRL 4DVBA 1X4YA 2VZ1A 3SKOB 2XN9A 3JTTA 3SDAB 1WWCA 4X5WA 2FX8L 4D9QD 1QKZH 4UV4H 4B53A 3CXDH 4PREA 3I50H 4WY7L 1K8IA 3IJYA 3PDGA 1B88A 3G5YA 3TVMD 2R2EB 1BQHA 1OB1B 3WLBA 4U6HB 3HZVA 3QXVA 5L88H 5HGBB 4R4FL 3LQZA 1EJOL 3ALPA 4FQCH 5GISL 3MLZH 4ZDHB 3D18A 2YD4A 4JZNB 4OM0H 3S36X 3HRZA 4L4VD 3LKOA 3QIBD 5F6HJ 1SBSH 3RPIB 3QAZB 4POUB 4KRMB 4NN6B 5IQ9B 3EJYC 4IRJC 3MLVH 2YD9A 1YECL 5HY9A 2EECA 5ICYA 2CKBA 2FJHB 2QHRL 1XZ0B 2DJSA 1NFKA 1C12A 1Y6MR 4G6AC 4MCZB 3ZKMC 1U8HB 1XF4A 3U7YL 3DVGB 1DQML 1DQJB 1FIGL 2B4CC 1RY7B 5IB3A 3PNWA 2XTLA 3N1QC 3QDAA 1T7XA 3HI5L 5B39A 2OBGA 4PJ5B 1NH6A 3O6KH 1YN6A 5L2JB 5T1LD 4LVEA 4F9PC 1ZK9A 4O00A 1HEZA 2IBBA 3HRPA 3MQIA 1DBAH 2Z92B 5EIQA 3L3IB 2K7QA 1BP3B 2FL5A 3IJSA 2LTQB 4HXBH 1U8NA 3EO9L 5D8JH 3C60D 3GBMH 4OCXH 1A4JB 4N8VG 5E94A 1II4E 1A47A 3FTGB 3JTSB 4NO2B 4JQXC 3O6LH 5J6HB 4RCAA 1JV5B 5GHWL 4MS8C 3TIDB 4AG4H 1VDGA 1F3JB 1CXIA 4MQXC 4P2RE 2P8MB 3CMOL 3GHBL 1OAZL 3QEHB 5DJ6B 3GB7B 2J8UE 1HYRC 2CH8A 5C0ND 4AEHH 5KBNC 3D2UD 3VCLA 2F5AL 3IRZA 5F6IC 2J88H 4ZNEE 1AGEA 3INUH 1OTUC 2QTEA 4RGOL 5JA8B 3MO1A 3SE3C 3QI9C 2W91A 4X5XB 1CFTB 2D9QB 4TUKL 3TJHC 3FAWA 3HUJB 4X80H 1T21B 5F3HB 4AENA 4XPTH 5D1ZC 1IE5A 1JRHL 1MCSA 3C5ZA 5K9OB 4ZO8A 2H8PA 2NY7H 1X4XA 3MXWL 1G6RB 5I8EB 5DZOA 4WTZA 5F88A 1U8LB 2OXHA 3U48A 4EUPB 3HB3D 4P2QA 1BOGB 1A3LH 1KJVA 2DICA 4P4KC 3ES6B 3ULUD 4M4PA 2AXFB 5DMKB 1DUZB 5MEOA 3GMPA 5EZIL 4J6RL 3NCJH 3QQNA 2Y6SC 2HKFH 5L8JB 1A6ZB 3FO9B 3SKJH 3M17B 4YHZH 4JHAL 2X9XA 4F37K 3EOAB 1CGUA 2IADA 3MLUL 4LQFL 2J6EL 4FHBD 3FO2B 4NKIL 1WC7B 4TNWF 1RZ7L 2DLTA 3HA0A 3DX8B 5JIIA 4JZOA 4QF1B 1T66D 4HUXA 1AD0B 4M03A 3QFJE 3ULVC 4XCCH 3GSRB 1BF2A 2B5IC 4WGWB 4I4WB 4UZGA 4RIRB 3X14B 1KLUA 4PV8B 4K7PY 1OGTA 4P5MA 4D2NA 3GJEB 3ZTJG 5DA0B 3QUZC 1ES0A 4R4BA 3SGKC 4RA3A 3UC0H 2MFNA 4KMTL 1ADQH 4MXWH 3BGAA 1L9MA 2CO7B 4HUWB 5I18L 1U8IB 5BZWB 3BKYH 1IKNC 4GG6A 4L4JA 3W0WB 1U92B 3LQAC 4HWUA 3OGCB 2VLME 4N0CD 3A6OA 1LO3L 1TETL 4ZAKB 3WHE0 4HMDA 4UBDD 4MA7H 1FHGA 1YN7A 1MIML 3MV9E 1TTFA 3L5JA 2ADGA 3NFSH 4HJGB 1E4KC 3F7VA 1A9EB 5GS0L 3QULB 3VE0B 4NQVB 4N8VB 1E28A 5GGTL 1D9KA 4OZ4A 3KDMB 1EX0A 3ZL4L 3MUY1 4XBEL 1AGBB 2DYPB 4XCYA 5I1JH 4RFNB 5H37G 1AKJD 1R3IH 3KYKL 4R2GC 3M8OL 4KVNH 4PJEB 1A7PH 4U05A 1BD2B 3KYOB 3QCTL 4KPHL 4P49A 4WO4A 3MGOA 3KAAA 2G2RA 1D3CA 1YYML 2GT9B 5D2LF 2DQCL 4OF0A 2ZG1A 5TH2B 4DZBA 4HJ0D 3STLB 1ADQA 4X7EC 2HMIC 4LCIL 4MJ5B 1JTPA 4LLQB 4P2QE 4K9EH 2VXSL 4DZ8A 4RMRA 1TQBB 1NKRA 1MAML 3QO0A 4XNQA 4RBPH 3CVHH 1VESA 1XCQB 4JPVH 1UG9A 2V7NA 3PP4L 4F7PB 4MNQD 3L7EA 5FDWA 4TSCH 2WIIB 1NAKH 1CK0L 4K8RC 4AQOA 5DR5L 4Y5XA 3VRJB 1MFEH 3ILQD 1JNLH 3FFCA 1BF8A 3M1BA 4RWHA 3HPJB 2C3VB 2F15A 4Q97A 4OLVH 1FVCA 3BP7B 2XT1B 2BSRA 2XFXB 3F6IA 4LCWA 3TBSA 1B3JA 3CH1B 3TZVC 2QADC 1H3GA 5CINL 1MREH 5I8OH 3O45A 1NCTA 2JJVA 3MV11 4JVPA 4LCUB 4N9GB 1JZ6A 2W65A 1AXTH 2GTZA 4P57B 5CSZB 2Q8AH 2VQ1A 1N4XH 2QKIA 1H0DA 5DLML 1J87A 4LLMB 2FJFA 3PUCA 2Q76A 5T1KA 3FJTA 4WFHD 3REVA 5J1SC 4NQED 4Q9CA 2JJTC 4X4MA 4HUUA 5GRZA 1JNHB 1KLGB 3BUTA 4ISVB 3G5XA 4XVJH 1G7LB 4QRQB 3JWNC 5EUKB 5C0JB 4NP4L 1L7IL 1NBYB 4GT7A 1RUKH 4N5UA 1I3RB 3GBNL 5IKCB 1N59B 3WXWL 1S7UA 2EDFA 1PZ5A 2YC1B 1CXKA 4GRWH 5HDQL 1MOEA 4R0LC 2EIZB 5EU6D 2VXTH 2DM2A 1JGEA 1N5YL 3L5WB 4F7MB 5JHDD 1KT2B 1A7OH 3S35L 2IPKA 4HC1L 3MRBB 3P4NA 3V6ZA 5ETUB 4HIJA 2EH7L 3MBXL 4YJZL 3CFDB 3DSFL 2LAGB 3MSPA 1E4WL 5CIPH 2E6QA 1TQCC 1C1EH 2QQNH 1CD0A 3CZFB 3SDDA 2GIYA 5C07B 5JXAH 2A38A 1C5CH 4J3VA 4O9HH 1HZHL 5D1QB 3PP3H 5BW7C 2FIKA 4DN4L 3F5WB 4S1DC 4OLZH 1T83C 3ZYIA 4WEBH 3T3ME 4QTIL 2VXUH 4Z7QF 5BV7L 5KZCD 4N0UA 3MRGA 1CGTA 3MRCA 4YLQT 2OMBA 1WWBX 3L3KA 4CMHB 1ACYH 4CU6A 3BRFA 2A74A 4OCLC 5DTFA 2E9IA 4IJ3B 3FFCE 1NBZA 5HTSA 4PJIB 4PTUB 2XZAH 3GMOA 1NJ9B 2RGSA 1TZGL 5CZKA 5CEXB 5ADOH 4LCWE 3GDBA 1LK2B 2JJWA 4UTAL 2E9WA 4QXGH 1PBYA 3P11H 4MJIA 3UYOD 3ZE1E 4PJCA 4JFYB 4Z0XA 4OD3H 5DO2C 3VWJA 5I75B 4HX1B 4GW5A 4Q9RH 4LGRB 2PTVA 4PR5B 4N1HB 4P9ML 4L8SA 5FK9B 1OOAA 2VE6A 4PPTA 3S5LA 5TE6H 4PJ7A 4XP1H 5DEGA 4X4ME 3UZQA 3K2UH 3MLSL 4JN2A 2HFEA 3BHBA 5GGRB 5TPWL 2J4WL 5C0FA 5ILTH 3GSNB 4EXKA 1HXYA 3BFOA 4UIKL 5FYKU 1KB9J 3PWPD 3JUZA 5HDBE 3BEWA 1T1XA 4MAYC 5EUOB 4EN3C 1NGZA 3UTTD 4KRLB 3GKWL 2E7MA 5L2KD 5BS0E 1GGCL 2HRLA 7FABH 3VXSD 5DMIH 1MCDA 2WIMA 5IGXH 3V52L 4Y7MA 4WW2A 3FOLA 1FCGA 2WP3O 3HLAA 2BHUA 5F97E 2X4TB 4RMVA 1CD1A 2C26A 3P73A 1QTYT 1MLBB 2B2XH 4R26H 1IAII 1OGAB 4AZ8A 3QUYD 5JMRA 4POZD 3VA6A 1CLZH 2AI0H 5ELIA 2COQA 4MQ7B 4M6MH 1KCVH 4YXHL 3QQ3B 1DDHB 3RX8A 2NXZD 5AZEH 3ARFD 3ME0A 2R0ZL 4Y16D 3T09A 5FO7A 1UWEL 5SWZA 4JFZL 1FP5A 3LOWA 4YIQB 3MOBL 3P9WB 4P5TB 4JM4L 5MP6H 5C9JB 4GMTL 4XBGA 3HZYA 1Y0LB 4N0UE 4YGVB 4KUZL 2AABL 5CUSH 4WV1A 4Q9QL 2D2OA 5HGDA 3D3VA 3RA7L 1F2XK 4HIIA 3RWHB 3LDBB 2C3WA 2ZUXA 5ADPH 4OD2A 2XTJB 3T0WA 1ACZA 1HXMA 4TNVF 1LE5A 1YC8A 3QDJA 4TVPL 4GRWE 3ARTA 1NDMA 1QACA 1AGCA 1UACH 1UJ3A 1L9NA 4ZTPH 4KTDH 4ENEC 1N3NB 1R5IA 2OR7A 4MJIE 4XT1C 3O6FB 3EYOB 1SHMA 5T3XL 5GJSL 2AERT 4PJCE 5DUBA 5I1HL 4K3JH 2C9AA 3L95B 4M3KB 1NFIA 5IG7B 3MYJA 1NSNH 3IB4A 3BIBX 4Y1AE 2HT2D 4NCDA 5I2IA 5IJKA 3GMLA 5J1AB 4U1NA 4XNMB 4PJ7E 3JWDH 5HHOD 3OKDA 4R90H 3FT3A 5D1XA 3FKUS 3BQUD 3OHXB 4OZIA 3C5SA 2IALA 1G7MA 4K55A 4NCC1 4MD5B 3RWEA 3X11B 1A5FH 1S9YB 4NQDD 2VIRB 3EAKA 5ENWA 1QRND 4GOSA 3EIFA 4OLYL 4X4ZA 3BDXA 4Z77A 4ZTOH 4F3FA 4AM0B 2EYSB 4I3RL 1IAOB 2HTKC 3GJFB 2Q8BL 3UJIL 3GMNB 4C58B 5F1NB 1N8ZA 3IDYC 3L3OB 2OR9H 1A4KB 2XY1A 4JPKH 5I1GH 4QNPF 5DRXA 3O3UN 3RP1A 2BCKA 1A7NL 2A2QT 1B2WL 5EO9A 4PJ8A 3LPGA 3B83A 2AAVA 4H25B 4PLJC 4YC2B 2AGJH 1EJ6A 2R4RL 3EZJB 3UYRH 1N6QL 3AREC 1KTDB 5JOPE 5HYJA 1G7PB 2XWBA 1FV1A 1JZ7A 2LVCA 1F11A 1WVZA 1J0KA 5SWZE 1A3RL 1XGUB 2QQLH 3U36A 3R8BB 2WLZA 1I8LA 4PGCA 1XR8B 4GKNB 4QO1A 5KSAA 5T1DH 3D3VE 1N64H 4XMKL 3Q5TA 5I15L 2DLHA 1HHGA 3QNXA 4RAUA 3T0XA 1MCFA 4AIOA 1S5HA 2BXZA 5IHLB 4YFLI 3ARGC 4NJ9L 2EDQA 4P3CL 3L7FA 1M05B 4U31A 1V3JA 4G8EB 1RJZA 3HS0A 3TO4D 3CFKB 4K71B 5J8OA 5F9JB 5FDYA 5IV2B 2W0PA 3I6GA 3TBTA 1MCPL 4OFYD 5FGBA 2XRAL 3U7WL 4XVUC 3WS3A 1INDL 3V0WH 1E0OB 3T77B 3QIWD 2GUOB 3IXTA 2FB4H 3QQ4B 4FABL 4TQEH 1O7SA 4AIXA 4XNYH 4U6VL 4X6CB 3RZCD 4MJ6B 1TVBB 5J11C 4M5YH 1KEMH 2J7LA 4XPBL 3BP4B 2O26U 3TYGL 3VW3H 3O0RL 2DMKA 5I1DB 43CAB 2OTUB 4FQXD 3WNKA 4OQ1A 1YNKH 4OZIE 4YDLB 5IM7B 1VGEH 2AKRA 1CFNA 1JHLL 3W9EB 4HWEH 4IS6A 4F7CA 4Z6AT 2KZWA 2YPLA 2V9QA 5FUOL 1NAMH 4FXLA 1T2QL 2P45B 3BMWA 3NAAH 5JDSB 4QWWC 4PV9A 4JM2B 2R56H 3UTQA 4OIIL 5I76A 4X6FA 3BI9X 3W82A 2R0KL 3O2WL 2BNQA 1FL3A 1W8NA 5JOEA 4FZEH 4O58L 5D72L 1ZHNA 2AJ3A 1JUFB 1U91A 3IAQA 3CD4A 1QFWM 4EI5B 1A6TB 1GRWA 3CZJA 3WD5H 3MRMA 1CTOA 1NGXA 5CS7A 5IT2L 1CGYA 3PHOA 3QCVH 3D6GA 3OR7B 1OVZA 2WBJB 5HYJE 1YY9C 2JB6A 4OT1L 3PQYA 5FECA 1CU4H 3VFGH 1GAFL 1I7RB 4ZXBC 5BZDA 4XMLH 3VXPA 1M6OA 1DQQB 3K1KC 3AS3A 5FYJL 3HE6A 2FSEA 3BYTA 3HNTH 1KGCE 2R0WL 5L9DL 5HVWA 1X5FA 4PRIB 3HKFA 4WU5B 5DT1L 4LPXA 2X4RA 1C16B 2HG5B 2DLIA 3FQTB 5DJAB 3EYSL 3CU7A 3U46B 1BZ9A 1K4DA 2NW2B 3QYCA 5LAXB 1T0NB 2X70B 1UCTA 3DXAD 4FTVB 4IRSA 1NAMA 3VMOA 2VXVH 4DVBB 3VXME 3TM6A 3LMJL 2XN9B 5HYSA 3K4AA 4LBEA 4X5WB 4BFGA 3LQMA 5I9QC 1K8IB 3IJYB 1J1OH 1X5HA 1JGUL 1F97A 4KMLB 3WLBB 4JFHE 3HZVB 3MV8E 3H7BB 3LQZB 4KZDH 2GCYA 5IFAL 5F44A 2NY0C 3LRGA 3QHZH 1NUGA 4WEMB 2J8OA 2ARJB 3HRZB 3LKOB 1T3FA 2PO6D 5A1AA 1FFQA 5B8CB 4UQ3B 2DLFH 3LD8C 1B90A 1WCBA 1LDPL 1HWGB 5HY9B 5ICYB 4YWGL 2CKBB 4K2UH 4J4PC 3MNZB 2UUDH 1C12B 1T1ZA 1P5UA 3EOTH 3UTZB 3GHEH 4G7YH 1X7QA 5IB3B 4HAGA 1CLCA 4HG4J 2YPLE 3VGEA 4UTBL 1OTSD 4XXCA 4XZUB 1FGNL 3SOBL 1QQDA 4MXVE 2N56A 1YN6B 4O51A 1KJ3L 5K9QI 1MCHA 1HEZB 2BNQE 4EOWH 1GZPA 5GQBA 2M8XA 5EO1A 2XICA 4ZFFA 2YHGA 2XKSA 3IJSB 4I0PC 5C6TL 5CJXA 1IJ9A 4L8CB 5D5MB 4MXQC 5MEQA 2JELL 1T4KB 3S36L 4XNZB 3H7LA 5GGQL 1EMTL 3SE8H 4WI5A 4WWKD 2AJVH 2OJZL 2Y07L 2DI8A 4R97C 4WVRA 2C1PB 5D2LA 5E94B 3QQ9C 3Q48A 2BERA 3WFCH 1IGMH 1RUML 2YWYA 2ESVE 2Z91A 3PQYE 1XF3A 3GO1L 3NIFE 4MQSB 1FSKC 5L6YH 1RIHL 5E6IA 3ZYOA 5B3NA 3MV7B 3LKNA 1NCDH 3QEGL 1FBIH 2CKBL 1JMXA 3MRQA 2Z4QB 1BAFL 2AEPH 4NC0B 1HNFA 4FP8L 4YFLF 2E6JA 3AXLA 1AGEB 2DD8H 4XWOD 3ZKNC 4J1UB 4M7LT 3L3DA 5J13B 5EG6C 4ODUA 4QHKI 4M8QA 4F15B 2WINA 1ZANL 2VLRE 3U30C 3O2VL 1W0WB 1UA6L 2HVKB 4W70A 3QISA 4DK3A 1AQKL 3MRDB 4YQXL 4S1SH 5F3BA 5ERWB 2QSTA 4Z5RB 1Q9KA 5HHNB 5JQ6H 4IOFD 5DHXB 5D7LD 3ZKSD 2H8PB 3MROB 3MA9H 2RR3A 3EKCA 1IRAY 4X4XB 3RPKA 5F88B 4Z95L 2GAZA 5I71B 2AEQH 1CR9H 5EWIL 5JPNA 2YD6A 4JKMA 1WTGT 3GMPB 5MEOB 2SEBA 1J8KA 5C08D 4H20L 1SEQH 4LU5H 4BUGA 3BKCL 3I85A 3FONA 2K7PA 4IMKA 1RUAL 5GGSB 3V79C 9CGTA 2HN7A 4DAGH 4EBQH 5A2IH 4KAQH 3CH8A 3KPTA 5ANME 3WO4B 2I60H 2RBLA 2RIKA 3K0WA 4ELMF 2EDOA 3LRSB 5DRWB 3BD3A 5D93B 5D2NC 1IC4L 2KKQA 3VXRD 1OSZA 4OAWB 1NLDH 1EHLL 4Y4FB 3BKMH 5F7FA 4JFFD 2JCCE 2P5EA 2F9BT 1KLUB 1TENA 1AE6L 1OGTB 3H2WA 1FORH 2DQTL 1QFWL 3C8DA 4JPIA 1XGQA 1CGWA 3FOMA 2CLZB 5K33A 2BHYA 2BVEA 1EZVY 2V9TA 25C8L 2V5TA 3QDMB 3BWAA 3LN4B 5E6ZA 3ECBA 4ALAH 3TCXA 1A22B 2N1KA 5D2LE 3IU4H 3ULVF 4GG6B 4XVTH 4HLJA 3D39A 2UYLB 5GGUB 3IKCB 5C09A 3HC3H 5EZOH 5FKPA 1UXWA 1JTOA 4U1SA 1J8HA 4OLXH 2Q1EA 1REIA 4I18B 4NSKA 5MERB 3BIAX 1YN7B 2AJUH 5D7JB 4BSVA 2VDML 3F7VB 4G9DA 5D7SL 4PRPA 3GNMH 5EORL 1TJGL 5TFSL 1E28B 2YBRA 4OZ4B 4UUJB 3OKLA 4MB5A 1ZE3C 3RVVC 2GHWB 1RZKH 1AHWB 2OI9B 1QBMH 4LASL 3WIIL 3K8KA 4JFDD 3TESA 3HPLA 3GIVA 4QY8A 3NCCB 5GIRA 5C3LD 3WDJA 5SX4H 4WO4B 3MGOB 4YHKH 3WIFA 3QHTC 4Y19D 2CQVA 4DQOL 3O41A 4DZBB 5DK0A 1QLFA 4PJ9C 1RD6A 5DFTA 4UT7H 1VEPA 1JGDA 1U95A 2AJYH 1CL7H 2NXYB 4JO3L 1P84J 1CICB 1G84A 5C92A 4XNQB 3NPSB 4P46A 4W6XB 1LO0L 5DGRA 4BYHA 3CDYA 1F6AA 3VD7A 3SO5A 4RFEA 3DMMC 3L3GB 1B4JH 3KVQA 3L7EB 4WFFD 4HV8A 4KVCL 1CWVA 5DJ2B 5CCKL 4JRXA 4BKLB 3WJJC 1VSCA 3VMPA 4NZRH 1OAKH 1A6UL 3SDYL 5HI3C 3M1BB 4JKKA 2YA1A 3VFSB 3S5LG 5M7QA 2W9DH 2EDHA 4LCWB 2IBZX 2P5EE 1MEXL 3HC0A 1A1OA 5DHVH 3P2TA 2ZJSH 2QBWA 2V5MA 2W65B 1RMFL 2GTZB 3ZT5A 3MBEC 4DN3L 2VQ1B 5CMAA 4YX2L 4ZUWA 1MJ7L 2FJFB 1MELA 2Q76B 4H8WH 1I85A 5T1KB 3O4LA 3REVB 4Z7VE 1LEKA 2OYPA 5I74B 3BIKA 4NUGL 1G7IA 4Q6IC 2B7DT 1FZMA 1G9MC 3EGSA 4MA3A 3ETBF 3G5XB 3D85B 2FYYA 2PXYC 3WFBH 4JE4B 5KSBE 5BOPA 3KJ4B 1CFQA 2ZZUT 3MA7A 1ZTXH 4OSUL 4PRPE 3LKQA 4QEGA 5HD8C 3HI6H 3CGTA 2GJ6D 5C9KA 4D3CL 4WU7A 5IQ7L 1PZ5B 2O5XL 4YEEA 1AFVL 3SJVD 2NY1C 4RISL 1NCAL 5E8PA 4WFGD 3V4UH 1XFPA 2IPKB 3WS6A 3P4NB 3BT2H 3HE7C 3B3IB 4HIJB 2X4QA 4UOW0 5DHVA 5ABDE 1W72B 3OAUL 3MUZ1 1PFCA 3RFZC 5HXMA 4PJHF 4NDMB 4Y5VC 2Z31C 2VAJA 1UH2A 1RUPL 1LEGB 4ZYKB 1KIQA 3LZFH 4JQIH 4RMTA 5EBMA 4RX4A 3VXOA 2ORBH 3ARSA 4TRPH 4L4VB 5EZJA 4HEME 5FCUH 1HKFA 4ONGL 5I1CH 1YDPA 4H88L 1NMCB 2FGWH 1HHKA 5T5FH 5FYJE 3HAEG 4BUHA 3MRGB 5BRZD 3MRCB 3DUUB 1IL1A 1TDQA 1C5BL 1KCUH 2A74B 5IFHL 2Y06H 5DTFB 5BXFA 3I6LD 2ED9A 3TN0D 1NBZB 3L9RB 1MHCA 4HH8A 4BFBD 3PGFL 3TV3L 3GMOB 4XH2B 1S78D 4TN9A 1I7ZA 1U0QA 2XKNA 5ITBL 1BBJA 4I9WD 3LN9A 2NY5C 1A7RL 3MRFB 3NFNA 4QCIA 4MAUL 2Z93A 2NY2B 1QSVA 1W72L 3BEVB 4L8SB 1OP9A 4RSVA 1FH5H 2VE6B 3S5LB 4Y2DC 2OL3A 3NIDF 4GRLD 1QP1A 1FN4A 3TPKA 2AJXL 2ZSVB 4WEUD 4EZMA 5GXBB 2HFEB 2YRPA 4OCSL 3MLYL 4XNUL 1Q9LB 2BNRB 4AH2A 4JFXA 1GGBH 1JP5A 4OZHE 5C0FB 2CDEA 3UEZA 3BPOB 3VXUD 1NGQH 4OCYH 3B5TA 1U8QB 1JPTH 4K7FB 3VFVA 3BEWB 5KS9F 4G6JL 3UTSE 1AC0A 3AU1A 4LLYA 4RGNB 1GIGH 1NGZB 4IDJH 4DGYL 2YRZA 3VFTA 1UXSA 4OCWH 43C9A 4WI3A 1PX3A 3WHE1 2ZOKA 1GOFA 4Z7NF 3NABL 3VGAC 4XC1L 4LAJH 1QHOA 3FOLB 3T2NL 2DWEA 1BFVH 4HCRH 1F00I 1CD1B 2F8OA 3EYVB 5ALBL 3P73B 1FYTD 1MQ8A 5GRUH 1OARL 4HKXB 3T3PF 1EHXA 4IHOA 1FPTH 3SCMD 1I1AA 4WHTB 1DSFL 4LIQL 5L0QC 3W11D 1S8DB 3B9KC 1YEKH 4KK5C 4NO0D 1NMBH 1G7JA 4M7ZB 32C2A 5EBLA 3T04D 3VJ6A 3WUWA 1KNOB 5B38G 1OAQL 5FO7B 4R8WH 3QP3A 4HPYH 1S5IH 2VYRE 4G5ZH 2Q20A 4K23L 4NQSA 5GJTL 4F7TA 4TTGA 3BN3B 4XBGB 3HZYB 5I19L 1UWXH 3G9AB 4JRYA 1IM9D 2DBLL 2NR6C 3WNNA 4HIIB 4RBPK 4ODHL 3FMGH 1HXMB 2F58H 1CZ8L 1Q0YH 3PGCB 1LE5B 3QDJB 1NDMB 4KRPC 1AGCB 1J1XL 4RRPA 1HOCA 5DF0A 1UJ3B 1D5MA 4JHWL 4L9LC 5IF0A 3QWRA 4Y89A 4C56D 5FYKD 4HCRA 4U1JB 2MPAH 1QRKA 1NFIB 4JKLA 1ONQB 3UBXG 1V3LA 4LSVL 1Z9SA 4QNPE 4YAQA 3MYJB 4CN4A 1LO5A 4GRLC 2D3VA 5BVPL 1FZKA 1TLKA 3QNYA 5SWQA 4XRCB 5I2IB 3QDGE 3L5XL 4S1QL 5E9DD 1DL7L 3E2HC 5JNYA 1DEEB 5DRNA 4C54A 1NCBH 4P0DA 4EKXA 2BFVH 3DRQA 1FZJA 1YEIL 3FT3B 4PJDF 2W59A 2YEZB 2XZQL 3MJ9H 1YPZF 2F5BL 2IALB 5HHMD 1XIWA 1G7MB 3BAEH 4OBSA 4JZJA 4CAGA 3QA3A 3LKSB 5ENWB 2CMRL 4RZCA 4KWUA 1B0RA 3LKRA 2HLFC 3QRGL 4B7LA 1MFNA 4LAQL 5FUZH 2RB8A 1WLHA 4Z77B 3RDTD 4BZYA 1UKTA 5GRYA 2F54E 2NZ9D 3DO7A 5D7KE 3N06B 1N8ZB 2B4CH 2ZPKL 3X3GH 4X7SH 4L1HA 5E08H 1BEYL 2BCKB 2AJZB 3S37L 3U1SH 4NQCA 4JN1L 3VFUA 4J3UA 4PJ8B 5EO9B 2FECL 4U0RC 3SCMC 1DBKL 3PL6C 3BRDA 4GBXD 1MHPL 1J0ZA 3H42H 4FXGB 2ERJC 2XWBB 3PIQB 1FV1B 4CRPA 4M62H 1JF1A 4NNYA 4XWGL 1XGRB 3TPUB 5HYSG 1GPOL 3SKUD 3F58H 1SYSB 5BCAA 4XNXL 2E8YA 1S7XB 2ID5A 3OZ9L 4HFUH 4M48H 1INEL 3V4PH 3PP3K 1LD9B 2ICWI 3MJ9A 4PGCB 1UVQA 2FO4A 4NO5A 4JRYE 2B1AH 4MSWB 4MNQB 3CNKA 5I17A 3MTRA 1WBZA 3FRPG 2FBOJ 4IRJA 1R3LA 5F21B 1GJIA 3FN9A 5B4MD 4MMZC 4HXAH 2AK4A 2FNBA 3HG1A 4HHAB 4LSPH 3IVKB 5CZVH 2HJFA 1QD0A 12E8H 2D31B 1AXIB 3G5ZB 3HS0B 4QYOA 5E2JA 4YBHA 6FABH 4GUPB 4ESKA 3W9DB 3I6GB 3Q0HA 1MJJA 5C86A 3ARDD 2BJMH 3SDCD 3CSGA 4Y4KC 2XWJA 3IXTB 3MRNB 2VLKA 3CLFL 3G04A 4DEPC 3ALWA 2CRYA 4F9PA 5ID0A 4BZ1L 3LSOA 3TNMA 2EE6A 4XTRC 1L7TH 3OXRA 5LKNA 3J7HA 2VL5B 4NQEB 4D0CA 4ODVH 1LO2H 2ZUYA 3ARQA 2AKRB 1CFNB 4U6XA 1YUHB 1QLEL 3UBXB 3BJ91 4F7CB 1CLYL 2BDNH 2FZ3A 3NA9L 1LP9F 3ILPA 1UH4A 1MUJB 1VFAA 2A77H 3V5DA 4JQXA 1U3HC 5E4IA 2CDFA 3UTPD 1Z5LB 5E95B 3UTQB 5J6GA 5I76B 4X6FB 5GSVA 4URTB 2WMPA 2ICCA 1SJEA 1FL3B 5LBSH 2VLJE 5CBEB 4HUVA 1F13A 1PKQE 5MI0B 4O4YH 4MDJA 5HGHB 3CMGA 3MLWL 2YPKA 5JHDB 5DMGD 1F2QA 4JPWH 1MCOH 5E00A 3KPRD 1NGXB 1QBLL 3PHOB 3SE3A 3QI9A 5C0IA 1C5DA 3ULVH 4XAWH 4ONHA 4DWHA 1FAKT 2R1WB 4WUKH 3D87B 3VXPB 1AY1H 1CIUA 2FSEB 5DQDL 5D1ZA 4IEFB 4TTDD 4B50A 3C08L 2GFBA 3RTQC 3LEVH 3DVNB 4OIAA 2ZUWA 3H8NA 5F1KC 1BZ9B 1DVFD 4OCRH 1PW3A 5KZCB 4IRSB 1NAMB 3NTCL 4FQ1L 4NNPL 4P4KA 1BQLL 5SWSA 2QHLA 4ELMA 4PB9H 3UO1H 5HYSB 4LBEB 2AK4E 2EXWD 3HG1E 4O5LL 1MF2L 1A6WH 4PG2C 1QZ1A 4KHTL 3DIFB 3CSYB 3JV6A 3U4EA 1C8PA 3N85H 5CWSA 5CP7A 1AIFA 5FB8B 4ZS7L 1WFOA 4MVBD 1JF5A 1K5NA 1NBVL 2ZKHL 2VLKE 3G08A 1SVZA 4JO1H 4CL7A 1A0QL 4HSQA 4F57L 3DX6A 4WI2A 2HVJB 3O9WC 1P7KA 2VMFA 5DJYB 1T1ZB 1V8HA 1IEAA 4YDIH 1ZLUH 1B0GA 3W2DH 4U7SA 5HVHB 1TJHL 3OKMB 1BIHA 2ATPA 1CFBA 3BPLC 3CFJA 3O2DL 1JPSH 3QUZA 3SGKA 1I3GH 1CVSC 3ULUH 4OF7A 3NVQA 4LSDA 4PRNB 1OLLA 1IKNA 2D7TH 5KW9L 3NACL 3KS0H 4K94L 4J12A 4DKEL 3MRKA 5DD0H 5GS1C 1Y18B 4A6YB 1J11A 4OGAC 1HSAA 2LU7A 1GZPB 2EDWA 4LSTH 5EO1B 3D2UA 1NGPL 3IFNL 1GHFH 1NFDE 3PDDA 3VXSB 1J0IA 4GO6B 4I1NB 1EXUA 2WK2A 5J0BA 5EN2B 1E4KA 1ODAA 4K8RH 1CDIA 4POYA 5MEQB 2EYTA 1P4LB 1NL0H 1MHEB 1KTLA 2VITB 3F7YB 2IFFL 3BMVA 5FHBH 4D9QE 4TOYL 5EO0A 5KTEL 3VFRB 4M43H 3QUYB 1T04A 1A2YB 1XF3B 2PYFA 3FZUC 4HIEA 4NBXB 4U33A 1T20A 1HKLL 2I5YH 5CLWA 3BGMA 3PWLB 4HGMA 4JKPH 5TQ0H 4L3CB 3V0AC 3LKNB 2BSED 2A6JB 3MXVH 4H26B 5IB2A 1ZEAL 3MRQB 3GZKA 5L7XH 4DKFL 2CIKA 4MA8L 4LF3A 1WZ1L 5ICZB 5C2UB 5EBWA 1UM5L 3S6CA 4FFYL 3AXLB 3B2VH 5ALCL 5KVFH 5H2BB 3WKNA 4PG9A 3UX9B 3N1PC 3G6DL 1A1MB 3N1MC 4ODUB 1BQSA 4Y4HC 4M8QB 3IXAB 3B2UD 4C55A 4XX1E 5E8DL 2WINB 3TA3D 1U36A 1Q94A 4IIQC 1HQRA 1RULL 3WNPA 3SEPA 1KIPA 1RJYA 3QB7C 5F3BB 5CSBA 5IVZB 3K2MC 4A6YL 2B1HH 3FQUB 2ICES 1SBBA 1Q9KB 2DQEL 3I9GH 4YK4B 3Q1SL 4ZUVB 2IQAA 3TFKD 2ED8A 3F62A 1YEFL 3WHXB 2GAZB 4NZUL 1MI5B 2FD6L 5JPNB 2F8XC 2IAMC 1SVCP 5JIPA 2VXQL 1KENL 4ZNCD 1G7QB 5C0CD 1CS6A 4YHIA 3ULVE 1JE6A 3TZVA 3FONB 3DJ9A 5HHOB 3CCHB 4S1RH 4P3WA 1EEYA 2HN7B 5C70A 1JWMB 2A9NL 5MEND 1EFXD 1Z6JT 1RZJL 2Y36H 3OL2A 2XG4A 3P4MA 3TWCL 1KB5L 1EBAA 4HULB 1S7TA 4PY7A 1KYOK 3FFDA 4ZFGH 1QRNB 2JJTA 3BDBA 2HJKB 1FCCA 2VSDA 3EFFA 1MCWM 4OF3A 1OAYL 2P5EB 4Y8DC 4HS6A 3P0YH 3Q5OA 4JPIB 1XGQB 3VXQA 4ODXA 4TNWK 1ZWIA 4XP4H 2CK0H 1S7VA 4Q6YA 1PLGL 4JDTL 3KG5A 3H9YA 5J56B 3ECBB 5E5MA 3CLEL 1WFNA 1MFCH 1KCSL 4HFWB 1P2CB 4S10A 2FEDD 2A6IA 4R0LA 3D39B 4PJHA 1OQOA 1PX4A 1QPXA 5C09B 5FKPB 2R69L 2FWOB 1J8HB 1I1YB 5IK3B 3VGBA 1RIUH 4LNRB 1D6EA 3OB8A 3AMLA 3V9FA 3SDAD 4J8RB 3DHJA 4G9DB 1CQYA 5HYFA 3QEUA 1B9ZA 2V7HA 1Z2KA 1C08A 3OKLB 1LK3L 3ULUE 4BH8B 5EB9A 2JLLA 5AWNL 5BW7A 3LH2L 1NCCL 1IMHC 1HILB 4LOUD 1T83A 3HPLB 3O4OC 4G7VL 4MD4A 5C0GB 1IC5H 2DWDB 2VDPH 5GIRB 3CVIH 4MNGA 2JJSC 3WIFB 1Q38A 1QOKA 2GSIA 4HBQA 4WHCA 2A9MH 4WDIA 5DC9B 5DK0B 2I07A 1JGDB 1U95B 2HFGL 5I0ZA 4MJ2A 2ZNXA 2D7NA 1HCFX 5E2TH 5C2BL 1HQ4A 1XGPB 4KKAD 3GRWH 4GKZA 5IFJA 3MLTA 1HI6A 2CIIA 2AS5M 3MREB 4K7PX 4OTXL 4V1DA 5EULV 3BD4A 3O6ML 1I7TA 4PJ5D 4D9RE 3OWEA 3DGGA 1DE4A 3QHFL 4X8XA 1F6AB 4YH6A 1JPGB 2VL4A 4RFEB 3SGEI 3IGAA 4UAOC 4O02H 1ROWA 4YXKL 3BKJL 2IG2L 1T22A 4CVZB 4JRXB 15C8L 1YEEH 1WQVT 4WCYL 4FQPA 4K9EC 5D7IF 3TBYA 3C87A 3H9SD 1WK0A 5KS9A 2FLBT 4GW4B 3MRIB 2MCG1 2E7CA 2Y23A 1P6FA 4AQ1B 3W5MA 4F9LC 3HC0B 3VMNA 2PF6A 3UJTH 2YWZA 3HR5A 1MFAL 3IRPX 2CLVB 4JY6B 3TT3L 3Q3GA 2VDNH 4MAYA 2EDEA 5CMAB 5DJXA 4EN3A 4LPWA 2JKXA 2DQIL 4PJFF 5BVJA 4HPOH 5EU6A 3T1FB 2O5YH 4NJAL 3BZFB 3O4LB 4PJHE 3ARBD 3BIKB 3Q5YA 1G7IB 3CFEB 3GRWA 4MA3B 1Q1JH 3CDGB 1R5VA 4DKDC 1YY8A 2DQJL 3MA7B 5IW6A 3WV0A 2WWMD 2EEAA 3LKQB 1FL5A 4DOHB 4HK3J 1PKOA 1UWGL 3QPQD 1WT5C 5KN5B 3RHWF 35C8L 5A16A 2AJSH 5HGAA 3EOBA 4LARH 1ZVSA 4P2OC 4X6EA 1RJLA 5E8PB 1ZLWH 5CD5C 3SPVB 3JV0A 2OCFD 4NBZB 3VDCA 1KPUB 3MCLH 1OSPH 5GS0D 3HMXH 1DN2A 3WNOA 3C2AH 4RDQF 2E27L 4R3SB 4C83A 1CG9A 4LSRH 1KJ2B 2YXFA 3I75A 1S3KL 1YJDH 4OZGF 1KIQB 2DJ4A 2DS4A 5EU4A 3VXOB 4O2EA 4OLWH 3I6KA 2OTWA 3IDIA 3EHBD 3NIDE 3PWJA 2UWEE 2F53A 4UDTB 1HHKB 3S96A 1BOYA 3F12A 3RAJH 1WZKA 3E6FA 3MLRH 4JFOA 2LTQC 4LHUG 1IL1B 1YPZA 1UT9A 3EDFA 5HHQB 4WFHE 1JWUA 5DYOB 5E2VH 1RZ8A 1OAXL 1SEBA 1LE9A 1MHCB 1CD9B 3L3JB 4NFDA 4U1GB 4LLWA 5CZXD 4E42A 1WWAX 3W0WD 1FVEA 2HT3C 4LPYA 3LB6C 2VJXA 3FB8A 5JA9A 5TF1H 2YA0A 2YK1H 5DA4A 3LIZH 4Y5YB 1T1YA 4ZAKD 3VA2C 4U1MA 3NFNB 4TPRH 1D6VL 2NNAA 3EO0A 5DD3H 4QHMB 2VZVA 5EU6E 5C0DA 1HIMH 3RWGA 2OL3B 4P4RB 4JAMA 4JGJA 5E2WH 1KJ2L 4FQQA 1V7NL 2NY6B 5GRJH 4AH2B 3MX0A 4M5ZL 2CDEB 3C09B 3TT1L 4OGXH 1YEHL 3V7AG 3QPQC 5M94B 5JHLH 3O3BA 5IW3A 3MNVA 2EDNA 3AU1B 1TZIA 1VADA 3AREA 3WFEH 1XH3B 1KFAL 4CUCA 2XQBL 43C9B 2L0DA 2WQRA 4Y16A 1T5XA 3C8KB 1CDGA 1UFUA 4MX7A 5DD5H 4ACPA 2NYYC 5I8CB 3T1WA 4O2FA 4KDTC 4GXVH 4YHOH 4LVNB 2FGZA 2VISA 4OUOA 1HE7A 1BVLA 4LPVA 4ZSOA 3IDMA 5HHXL 4FQLH 1KPRA 1EAPA 1I1AB 3S8WA 3ARGA 3QH3A 4CJ0A 3QEQA 3RUGF 2IGFH 1G7JB 32C2B 4N8CH 5E5UB 2OL3L 5EBLB 3OKEA 5IIEA 2H2SC 1MRDH 3DNKA 3U9PL 3VG0L 4NQSB 4M1DL 5IOPA 1JNNL 4TSAH 4QRSA 5IJKC 5DD1H 1QNZL 1SY6A 5BJTB 4CNIA 3L3HA 1SJVA 1YZZA 4JDVA 4PFEA 1JZ4A 1FAIL 3VI3F 4NM4L 5IB5A 1LP9A 5HHVH 2Y5TA 1J5OH 3QJFA 5I6XC 2MWCA 3PWPE 3KLHD 3D0LA 5IF0B 3LS4L 4QRTA 4LHUB 5EOQH 2NY4B 3UTTE 4FQIH 4YAQB 5L2KE 3DSNA 4TNVK 3V4VL 1FZKB 2N4IA 3QNYB 1MSPA 4ONFH 2J5LB 1D5IL 2VC2L 5DRNB 1EGJH 4RFNC 3QO1B 4RWYH 5C0AD 4N0RA 1J18A 1OL0A 4KI5D 4PBXA 2BMKA 4WUUA 4FFWD 1G7HA 4DFHA 3OPZL 2LFGA 4JZJB 4U4BA 1UC6A 5TDOB 3VI4F 4XP9L 4RZCB 1B0RB 3NA4A 2PYEA 1ULVA 3FO0H 3WL9A 4OLUL 4PRAA 3JWDC 5F9WC 4L4TA 4XHJD 3EJZD 3OG4B 4Z7UE 3F65A 2XA8L 3Q6GH 3VRLE 4ZXBA 3LEXA 5C07D 1DFBH 1MJ8L 1MPAH 4NBYB 5D1QD 1KEGH 3DO7B 4PJAE 3FN0H 5TDPA 2VR4A 4X9FA 4NQCB 2ZCKH 1JMZA 4QKXB 1BJ1J 1UQSA 4BZ2L 1PG7H 4BQBA 2OZ4H 4Y19B 4D9LH 1I9IL 4Z9KB 5CBAA 1IAIL 3OKKA 3GM0A 3QEQE 1T0MB 1FNEA 4X0KB 4EDWL 1JF1B 3VWKD 1H8SA 3QG7L 1WSST 2DQHH 3NZHH 3VFMA 1EGJA 3IFLL 1FO0H 2B0SL 4HW6A 1TFHA 3EYUL 5A2KH 1U3JA 1UVQB 2FO4B 1NC4B 3V6OC 5FA3B 5JW4R 5J3HC 5FYLD 3TBWB 5I17B 1W2KT 4ZOCA 3ZKXB 1WBZB 3VFOA 2DOCA 4R96A 3P9LA 4G8GA 1R3LB 2VDLL 4NO3B 3DETD 2LE9A 4X6DE 4J4PA 4X6BB 3U7AA 4W4NA 4XPAH 1BIIA 2HJFB 3TBVA 3WE6B 4NQDE 1M7DA 5BV7C 2IWGA 5CJQH 4S0SD 1JZ5A 1MH5A 3HHRB 1IZJA 2NY3C 2VZUA 1WICA 4QHNA 4XPFL 4QXTA 3R0NA 3RVTC 5TDNA 1QYGH 2R8SL 3WDHA 2D7QA 2OZ4A 1VFOA 5B3JF 5F7YC 1EO8L 4RNRA 3TNMB 4TVPD 1HINH 1JJUA 1VA9A 4D0CB 1RFDL 1P7HL 1WF5A 4I0PA 4Q2ZB 3SKNA 1PG7X 1IEBA 2P24B 4U6XB 1FO0A 4M1CC 2H2PD 1CFSB 2ICWA 4QRRD 2FZ3B 3IKKA 2J12B 2PYEE 5JPMA 2P8PB 1VFAB 3V5DB 1PSKL 1F4AA 2CDFB 3R1GL 1CFVL 5J6GB 1JCKA 3QXWA 4L4TE 4XI5C 5BQ7A 5GSVB 4AEEA 3LVEA 1XF1A 5IVXB 2XV6B 5ESAA 2ZWLT 3S34L 1H5BC 3THMH 3K7UA 3NCYS 4ODWA 2MKLC 2LAAA 3HI1A 1Y6KR 2YPKB 3S88H 4PRHA 5F6IB 2VDOL 4QRPD 4JY5H 3W81A 3P3YA 3QI9B 5C0IB 2QSCH 1I1CA 1OCWL 1F8TH 1C5DB 5A3ID 1A7QL 3KR3L 1I9JH 4IJ3C 3R8QA 4WHYH 3RKPA 2NW3A 3KPSA 2A1WL 1KN4H 1DANU 1G1CA 1MLCA 2XQYK 5K9QG 1QEWA 2XTJD 4GQPH 3RGVC 1UM4L 2P7TA 2YSSA 4HKJB 3T0ED 4I77H 1AH1A 1DBMH 1M4KA 1H9VA 1UM6H 5FCSH 2EIEA 2VDKL 3O6FD 5DWUL 4HKZA 5I30H 5BRZB 4MWFA 4P4KB 3PJSB 5E4EB 4G8GE 5SWSB 4HF5L 4ELMB 1YMMA 4HWZA 4M7LL 1TJIL 1IM3B 1JPFA 2F74A 4D0BA 5HYIA 3JV6B 3U0PA 3U4EB 3SKMA 3KNBB 1PVHA 4X9IA 5JW4Q 3DTXA 1MFDH 5CP7B 1HH6B 2VH5H 4U0QB 2AQ1A 1MFBL 1JK8A 1K5NB 2JB5H 4NKQB 5D2NA 4EQ3A 3FCTA 2H1PL 4M7JH 4Z7WB 1F3DJ 4XMPH 3DX6B 4KK8C 3BN9D 1P7KB 1QFUH 1TZHA 2HP4A 1IEAB 4IRZL 1B0GB 3CFJB 1UKSA 3O8XC 4LLAA 3AVEA 3QUXC 3AUVA 5E5RB 3HZMB 4HJJH 3WKMH 1FFOA 1DQDL 4K3DH 4PBVC 3MRPB 3VXTA 1U93B 3MRKB 4E5XB 1WIPA 1A6VL 3N50A 4U6YA 1H8NA 4J7RA 2V2TA 4U3XA 3WNMA 4YXLL 4JB9L 2JIXA 2NX5A 3OAYH 4NN5C 1EXUB 5IVNA 1N0XL 4FNLH 4PGJA 2EXYD 4G6KL 2P5WA 5INCA 3EW3B 4P5TC 1TVDA 1S9XA 4PRHE 1F4WL 1YC7A 3DXAE 3ARRA 5LQBH 1FC1A 4UINL 4NPYA 1FYTB 4GAYA 5D71H 2FATL 2PYFB 4R2GB 4HIEB 4X9GA 1T20B 3H3PH 3BGMB 5CP3H 1Q0XL 1QA9A 3S4SA 1D5BA 1MY5A 5IB2B 1MCLA 1FG2B 5F71A 1AO7A 4B41A 5DUMH 4NO0B 3MACL 4KGJA 2HLAB 3O3EA 4NT6A 5LWYH 1A7BA 1PY9A 4KTYA 5E1AB 4PG9B 1I9EA 5FO9A 1FC2D 1N7MH 4ODTL 1G9MH 5E0QA 5T1MB 1JYXA 5D7IA 1Q94B 1RURL 4YUEL 3LQAL 5JO5B 4P59H 3DMMA 4KJPD 3IDNA 4LSUH 1AR2A 1CXLA 2GK0A 3STZA 4RGMB 1OT2A 4M6OH 3RKDC 4Z0BL 4ZQKA 4JHZA 1ZSDA 1ZLSH 4UIMA 3WJJA 4OQTA 1OM3H 3DRTB 5D2NE 4JFFA 4PJFA 4HEPG 4YHIB 3B8YA 3PGDA 4XHQA 1JZ8A 3TZVB 4YHYB 4L3EA 2QADB 4UT9L 4APQC 3MC0A 1NEZG 4KQ3H 4U6TA 1EEYB 3WXVL 1RZIA 2OLDA 3G6JF 2W92A 3MBEA 3BGFC 3DYMA 4HDIB 1P1ZA 5HHMB 2CUIA 1G0DA 2MCPH 2VOTA 5AYUL 3IFPA 5IESH 2CO6B 2VDQL 4YC2C 3N0PB 1PQZA 4EI5D 4PY7B 3TYFB 2V2XA 3FFDB 4K07A 5DJCB 2WAHA 4Q6IA 3TC9A 3EFFB 2EXYC 3VGFA 2PXYA 1V7ML 1QSEA 1U8MB 5ITFA 4PLKD 3RDTB 2QJDA 4QXWA 3VXQB 4ODXB 2JTDA 5BMFH 1OHQA 1ZWIB 4PJGE 2YD3A 4OD1L 4WNQA 4XCFL 2YMXH 2NLJA 4Q0XL 3RGHA 5LCVH 4X8JA 1MRCL 4L29A 2XIDA 4AL8L 4ZD3H 3P0VL 3T0DA 4YHML 4R0LB 2DB8A 2WWKT 5FKAA 4N0YH 4JR9L 1LEIA 4J3OC 2KQMA 1TXKA 1PYWB 4OZGA 4PY8I 3G9VA 1P4BL 4LLVB 2NY5H 3SDXF 5D7LE 5DSCB 5LXGH 3L6FA 2XN9D 1AO7E 1DBBH 3HE7A 3LEYH 5DC4B 4ODSL 3NN8A 4M8VA 2X1PA 1X5AA 4RAVB 5K9JH 3CK0H 4KV5E 3GI9H 1IC1A 4CN6A 4Y5VA 5FUCE 2YRLA 1RVFH 4G8IB 1NUFA 4XBPB 5C08E 4BM7A 2FIRT 4ZS6D 3NCBB 1QLRA 1LDSA 1TNMA 4N8PA 2FH6A 1E6JH 4MD4B 2EEDA 1U58A 2C7UA 5AD0A 5E2UL 4MJ4A 4MNGB 1IBGH 2GSIB 3UZEA 3I3BA 4M93C 4QRUB 4WDIB 1AGFB 4PRDB 4KTEH 2I07B 3ARZA 3KYNA 4J3SA 4BSWA 3ESUF 3MODH 1U42A 3VXRE 3BD5A 3C6LC 3EFDL 4I3SL 4CADA 4JFFE 4YDKH 2CXKA 3ARDB 4GKZB 5IFJB 3MLTB 4JM2C 3IDXL 4V1DB 3E8UH 1I8MB 1I7TB 4JG0H 3SGEH 1DE4B 5C0BB 4BH7A 1EZVX 4XPGL 4IMLA 2F8VA 1D5ZA 1MCJA 2MMXA 3IGAB 4OB5L 5KVEL 4FN0A 5C7XH 1NQBA 2XZCL 2Z8RA 3KYMA 1U8OB 1T22B 2YKLL 3T65A 4ZUSA 4MD0A 4KKLC 4UNUA 4Y2DA 4JANA 1ZLUK 5KS9B 2C3XA 4I8DA 3IT8D 3GSOA 2WBJC 4DJMA 2ATKB 3DBXA 1ND0A 1PY4A 1HCVA 3OXSA 1NEZB 4ZOBA 4AEIH 1AD9A 2D0GA 1CE6A 1QR1A 2YOCA 1GH7A 1NC2A 1BLNA 1MIEL 4GAGL 2OP4L 4MAYB 4IOSD 3O81A 5BVJB 1FG9C 2H6PB 3QZWG 4K7PL 2DIBA 1FLRH 4JFDE 4OFDA 2X89A 4NRXB 3KPRB 5CD3A 1FZOB 4OCNC 2D0FA 1AJ7H 4OZGE 5EDXA 1FL6B 3HC4L 5HJ3B 3RUGA 4CVWA 3GSXA 3BPNC 5DI8B 1QBBA 3DURB 3K3QA 2VN7A 5F1IB 1FL5B 4GKSB 5IMKA 1RU9L 1A6PA 1UEMA 3OKNA 3C5ZD 1W0YT 5IR1A 1UZ8A 5HGAB 1KLFA 2NCMA 3B9KA 5GS3A 5B8CC 5IHUL 3QG6B 2B20A 3EOBB 3EUUA 4I2XE 4P2QD 4X6EB 5IMMA 4E0RA 1VEOA 2IPTH 2C1OB 4WFFE 3X12B 1JIBA 4Q9BA 3HNSL 3DECA 4ERSL 1JGVL 5F9OH 3QUML 1H15A 1G6VK 1KTKE 1ORSA 2V5RA 4E41A 1A1NA 4AT6A 4PJXE 1K4CA 1CG9B 4R7NB 3O11A 3BDYL 2FLRT 1UZ6E 1CE1L 4LP4A 4BJLA 5EU4B 5ACZA 4P9HH 4O2EB 1GC1L 1P4IL 3IDIB 4L9LA 1HYSD 4FG6D 1HSBB 2GITB 1KSRA 2F53B 4HK3N 4KHXH 2EH8L 5HI5D 4PUBH 3E6FB 3PDOB 4PJDB 2C3HA 4HLZH 4GQ9L 2H32H 2R23A 3P30L 1YPZB 1IGFL 2GJZA 2PW1B 4JO4H 4DGIH 1IGIH 4GRLA 1K6QL 4PJCF 1SEBB 2G5BA 4DTGL 1CDYA 3DX7A 5F7NC 4LLWB 4E42B 2YUVA 3P4LA 4G6MH 1KBGL 2CDGA 1OD9A 2BSSA 2EC9T 3FB8B 2Q7NA 3I2CL 1ZGLB 2GJ6E 1T1YB 2X7LB 5EZLA 2ADFH 5CLTA 4NHCL 2Q6WA 2NNAB 4LKXB 1Q9WA 5D7JD 5LGHH 4XXDA 3BVNB 5C0DB 5ECJE 3VH8G 4Z8FH 3SJVE 5FIEA 4WFGE 1VACB 3CC5A 5FYKH 1FGVH 1K85A 3MR9B 2ZP0T 3D48R 1OP5H 3IDYB 4NKDA 3RUGE 3STBA 3MUGA 4LNVA 4H5SA 4LSSH 3SCMA 4CMMA 4WO4D 3PL6A 4DVRH 5JUEH 3MNVB 2D0HA 1INQA 1I8IB 2H32A 4JFEA 1TZIB 1VADB 3K8MA 3HUJF 4RA0C 4HGKC 4XC3L 4LEXL 3BP5A 3T4AB 2DQUH 5I71C 4MX7B 3A67H 4YE4H 3VI3E 4I48B 3MOAH 4BA8A 1CICD 2JJUA 3TA3B 3VXNA 2D03H 2A6DA 5J89A 4LKCB 4ZUTB 1BVLB 3I6LE 4ZSOB 3IDMB 5GGVH 1KPRB 3WO4C 5KVGH 2AQ3A 3QIUC 3WN5B 1MCEA 1Z9OA 5CJOL 4NC1E 3QH3B 1A14L 4OM1L 2DKSA 2VDRH 1AI1H 3LPFA 4PRBB 2DQFA 5F96L 5JIKA 1X5KA 3FFCD 4Y4FC 2QQKH 3E6HB 1UCBL 5CJBA 1IC7L 5DHYA 3FB7A 4FQJH 5C0CB 2R4SH 5IOPB 4OV5A 5ICXB 4LLUA 4ELKA 3WEXA 4LHQB 4XPHL 4LCWD 4FQHA 4NUJB 4Y4KA 4R4ND 4GG8A 4CNIB 3GSUA 5MENB 5IB5B 1LP9B 1EFXB 2NZIA 3GGWA 2H41A 5KG9A 4PB0H 2Y5TB 3VXUE 5TQ2L 2RAMA 5T1KD 5I1AA 3MMEB 5EOCL 3D0LB 5FM5M 5E1HB 4I18C 1FVDB 4QRTB 4OGYH 4XP6L 1EBPA 4OF6A 5D7JC 3D85D 5E7FA 1TVHA 5K59E 3B9AA 3MGTA 2EDJA 5EC2B 1PG7W 3Q6FA 4P2RA 2R29L 1U3HA 5T3ZL 4KJWC 1NMAL 3V8OA 2X4NB 4PP2B 4M1GL 3JZ7A 2FRGP 1AHWC 1E6OH 3B8SA 2EYRA 4GAJH 1D5XA 3LKPA 3RWFB 4WUUB 2YUZA 3TO2A 2G5RA 3UJJH 1FDLH 4BQ9A 4GBXA 1R0AH 4EUPG 3N9GL 3V7MA 4XGZB 3VH8B 1EEQA 4JFEE 3DLQR 4M7KL 1SY6L 1IAMA 3R06B 4KK6C 4I3GA 2NXYC 5DQJA 2X44D 1BZ7B 3NFPB 3LEXB 3DYOA 1CICC 2EZ0D 1MCWW 1SM3H 4UILH 3NPSC 2FX9H 3U0WL 1UB5A 4OCMC 3FQXA 4I5BA 4G43A 5IUSA 1KC5L 3RTQA 2HFFA 3SE9H 1DANT 4JQVC 3PWNA 4P23C 1XF2A 4G9FA 3QUKA 2HAZA 2PN5A 1AGDB 5CBAB 2AEWA 2YD5A 2HYMA 1MNUL 1WITA 1FNEB 1KCRH 4HQQH 4QHUB 5IROC 3NZ8A 3QCUH 4PG2A 3VD9A 5I9QB 3C5JA 4C56E 5FYKE 1AP2A 2BY1A 4ZPVA 5KJRL 5B3JE 1LO4H 2FBJH 3OAZH 4W6YB 2XA3A 4X5LA 4BFIB 4PTTB 2P46B 1B4RA 3V2AR 2K9UA 5E9DE 4MJID 3D5OF 5IBTL 3QFJA 3LPWA 4MDIA 3ZMRA 1ZHKA 2E3VA 2G75B 2DM7A 4R96B 4UB0L 4YBQD 3LD8B 3VWJD 3MRJB 2NY2D 3WCYA 4H1LH 3U2SB 1A6AB 3ZTNH 2OXGA 3H9SB 3O9WA 5E56A 1RZFH 1BIIB 3U6RA 4HS8H 3D9AL 5TE7H 1E4XH 2BNRD 4N1EA 2IMMA 3G5VA 3GK8H 1OAUL 1R3JB 1CD8A 3D69A 2DJUA 4WJ5B 5TDNB 1F6LL 3B6SA 1X5GA 2X4OA 2YZ1A 3MV9A 2R2BA 5GS1A 2Z35A 4RNRB 4RGND 1MQKH 5I66B 1F4YH 4MXVF 3NH7H 4ZODA 2DM4A 3FRUA 2UZIL 1KULA 4P2YA 3WDIA 3ARBB 3ZE0F 4KKCD 2IQ9L 3SKNB 4M6NL 1FNSH 1FO0B 4FFZH 4AIZB 2ICWB 3B9DA 2MKWA 2CLRB 4PP1D 1VPOH 5JPMB 3BXNA 4R97B 3TVMC 4KUCD 4HWBL 1AXSA 5BQ7B 4QGYA 3KJ6H 1F58H 1EVTC 4H1LA 4NGHL 4TULL 5JQHC 5J57B 1YYLH 1S9VB 3QIBC 4ODWB 3IDJA 5HPOA 1CLOL 1XGYL 1XF5A 2DTMH 3HI1B 3NIFF 4DW2H 3FAXA 3M07A 1IGCL 4NWUH 2F19L 3HNVH 1F90H 4G9FE 1JFQH 1NUNB 3OMZA 4Y4HA 4G8FB 4KZEH 3DI2B 1Z3GH 2IANA 3QPXH 3D3VD 3U30B 1CBVL 3HMWL 4HMCA 4IIQA 4KGLA 5JW3H 2NW3B 3BE1L 3KPSB 4KQ4H 4W81A 5GZND 1QEWB 2G60H 4EIZC 2RCSH 3QDJD 1KPVA 4TYUA 4GSDH 4UU9B 4JKWA 4GMSL 5DS8B 1T5WB 4HIXL 4RAHA 4YBQC 1FRGH 3T2QA 1I9RH 2MHAA 3G6JA 3SGDH 4MWFB 1ZA6A 1GGIL 4YHLL 1ED3B 4MHHI 1YMMB 2IAMA 3GBLA 5T5NG 1Q72H 1JPFB 2PR4H 4D0BB 3C60C 3DROB 2XY2A 5DGQA 2I27N 3U0PB 5ISZA 3SKMB 4JFPA 1NCWH 5E8EA 3DV4A 5CEZL 4OJFH 1WEJH 1G6RL 2W0FA 5E8OA 2ZCLL 2CJUH 4X7CC 3CSPA 3UTPE 3V5HA 1JK8B 1KN2L 2CKNA 3TJEL 3LV3B 5FGCE 2IH1B 2OQJA 5C0NC 3D25B 5HPMA 3FCTB 1KYOJ 4LVHC 2HRPL 2DM3A 5CKAA 5I1KH 3IAGC 5CGMA 5I8KH 1VFBA 4KY1H 2B39A 5DUPL 4PP1C 5EUOF 2JCCF 5JR1H 3SDXA 3MLXH 2BRRH 2AEIT 5EPMB 3GMRA 2BVPA 2FX8H 3U0TA 5I16A 4PJ8D 3VXTB 2ZSWA 4WY7H 5LGJB 4GS7C 5INDA 1J9CT 4U6YB 2V2TB 5SX4I 5F7HA 2JIXB 2NX5B 3QJHA 5IMLA 4R4FH 5HYJD 3B9EA 1EJOH 1MJUL 3HB3C 5GISH 4EDXB 2X4SB 4KKBD 2P5WB 5INCB 3QXDA 3ULUC 1S9KC 1CL7I 3ZHKA 4LVOB 2BY3A 1YECH 1IQWL 2QHRH 5H35A 4N1CA 2IANE 1Z9LA 3U7YH 1DQMH 1FIGH 4TSBL 4HUNB 1SJHA 1O7VA 1YNLL 2JJSA 1AO7B 5F7LB 5BO1L 1PGRB 3HI5H 1T66C 4HGWB 1HNGA 2GK2A 4NT6B 1KG0A 4PJ9B 3UPRA 4WWID 4V2BA 5MHSD 4JFHD 3SQOL 5DFVD 3G6JE 5T33L 5FO9B 3KPQA 1MHHA 4PGDB 4PJBB 1GXEA 1KUMA 5IB1A 5IMOB 5D7IB 3IJHA 4QLRA 4FZ8L 4OI8A 1BGXL 3EO9H 3BO8A 5DVLA 3DMMB 4KJQD 4K3EL 3CFCL 2GK0B 5ISZE 2LVEA 1U41A 2BVQA 5FA4B 1WBXA 4JG1L 4RMUA 2GSGA 1ZSDB 4N0CC 5GHWH 1IQDB 2I26N 2XPGA 4UIMB 1KIRB 4UBDC 3MZTA 1DN0A 5FFLA 3RNKA 6CGTA 3CMOH 3GHBH 5K93A 1OAZH 1KACB 2YPLD 4HBCL 3KXFA 3CVHA 4PJFB 2X4UA 3MOQA 5AUMA 4F58L 3MFFA 2F5AH 3AB0C 2O5ZL 4F9LA 1DP0A 5FOBA 3W39A 4L3EB 1ORQB 1IFHL 2Z8VC 1N2RA 1RZIB 3VFPB 3ZO0A 2BNQD 3BPCB 4RGOH 1ETZA 5C0AB 3ZZ1A 5BS0A 4PS4L 2AK1L 3SDXE 4TUKH 4U1LB 5M95B 3QNZA 3IFPB 2E7HA 5C0EA 4IDLA 5C0RL 2V2XB 4QXUL 1TTGA 3ARUA 4Q6IB 3SKOA 1JRHH 4HJ0C 1S9WA 3SDAA 1AR1D 1GVIA 2ZCHL 5KVDL 3B5HA 2YPVL 2XWTB 2YD8A 1QSEB 3MXWH 4Z7VF 3PQYD 5AYQA 5IVOA 3V6FA 1OB1A 3PABA 1JHKL 3HE6D 4U6HA 1MWAB 1BMGA 2UVFA 5FEBA 5KSBF 1WT5A 4X8JB 4L29B 5EZIH 4HIHA 4J6RH 5ESVB 1LILA 3L5IA 5GSRB 4OQTL 3RPIA 5FKAB 5F7DB 4JHAH 1LEIB 2MSPA 3RWIA 5IQ9A 3QXAA 2NY1B 4P2OA 5GZOD 4IRSD 1YQVL 2ZOLB 3MLUH 2FJHA 4LQFH 2DL9A 4AEFA 1XZ0A 3ILQC 3HE7B 2J6EH 3VWKB 3NN8B 4NKIH 3ZHLA 4MCZA 5EOTB 1U8HA 4KXZI 3DVGA 1RZ7H 1UYWL 2B8OT 3KPNA 5EA0L 1DLFL 4Y5VB 2Z31B 1J88A 2E8ZA 3A6CL 1SJXA 1QBAA 2FX7L 1QLRB 4ZPTB 5L2JA 3WIHL 1NGWB 4KMTH 3U83A 2Z92A 1OTTD 1U8KB 2AW2A 5GS2H 3NOIA 2VAAA 5I18H 4Y1AA 5CIPA 2BK8A 5CILL 2HWZL 2WUCL 2R2CA 1C7TA 1QSFB 1MWAL 4I0CC 1LO3H 1TETH 4CADB 3JTSA 5J6HA 3KXFE 1JV5A 1MIMH 1F3JA 1UEYA 1VFMA 5GS0H 4MZ3A 2HKHL 2AV1A 2CR6A 2BVYA 4BH7B 2P8MA 3ZYJA 1DBJL 5GGTH 1D5ZB 1AQDB 3QEHA 5DJ6A 3GB7A 3TGXA 2OK0L 3LCYA 1FNAA 3ZL4H 2ZUQB 4XBEH 3VGGA 4JM2F 5HSFA 4WI4A 1JNJA 3T65B 4MD0B 1R3HB 2AP2A 3KYKH 1R24A 3M8OH 3UAJD 5I1IL 4JANB 4J3TA 4QRRB 4X5XA 3QCTH 4KPHH 4WTWA 1HHHA 4NZTL 1YYMH 3HUJA 3DBXB 2DQGL 1ZS8A 1IT9L 1DJSA 2DQCH 5FYLL 3OF6A 1T21A 4N90D 1AD9B 1F4XL 1RZGB 2EE3A 4LCIH 4C57C 4XP5L 1QUNA 5AZ2L 1NC2B 5E6ID 2VXSH 4WI6A 5DVKA 4OZHF 1EH9A 5HYEA 4K94C 4FMKA 1MAMH 5DJ8A 2MTPA 3OAYK 4M02A 5DJ0B 5CD3B 4QOKB 3PP4H 4QRPB 3VGAB 1YNTB 4FQ2L 1T2JA 4P5KB 3GSNL 3GSXB 4KDTA 1CK0H 1A6ZA 2VLLA 5DR5H 3L1OL 4EI6B 4NQXB 5GGTA 2QSQA 2VUOA 5IMKB 4YDJB 1RUQL 4QTHB 3KPPA 3OKNB 3FO2A 3T0EB 5IR1B 4PJ5E 3B9KB 3KLAA 4QF1A 5CINH 5FGSA 1WZMA 1MI5D 1F02I 3JWOL 3GSRA 1FE8L 1J1PL 5DLMH 4RIRA 3X14A 4LSQL 4PV8A 5HVHC 3GJEA 3RVUD 1H15B 3RHWK 1ORSB 2OJEA 4E41B 3SGJC 1A1NB 2ITCA 3JBG7 1K4CB 3FT2B 4HUWA 2R9HD 1U8IA 2BHZA 2DDQL 1X5XA 4NFCA 3CFBB 3P77B 3BSZL 5JZ7D 2HH0L 5D96C 5ACZB 3ELAT 4NP4H 1L7IH 1E27A 3A6BL 4KDWA 1IKFL 3OGCA 2M2DA 1NLBL 4L9LB 3GBNH 4F2MA 4DGVL 1QFOA 3WXWH 2P5ED 2R23B 5HDQH 2X10A 3QULA 2GJZB 3DARA 4NQVA 4N8VA 1YJDC 1OPGL 2IH3B 3GI8L 1N5YH 3E2HB 3S35H 1WIUA 1LVEA 4HC1H 2DYPA 4HZLA 2EH7H 1VHPA 2V17L 2YA2A 3HUJE 3MBXH 3QUYC 4POZC 3DSFH 3OR6B 2CDGB 3OX8B 5D5MF 3D39D 2BSSB 1E4WH 4JO2L 3RY5A 2CRMA 4DUVA 4UV7L 1BD2A 2W9EL 1BM3L 5C09D 1K2DB 1J8HD 2NXZC 4J3WA 5CHNA 3ARFC 1HZHH 4OZFG 2UV3A 2BNUB 3DGCR 4Y16C 2Q6WB 3V6BR 4DN4H 1Q9WB 1SYVB 3STLA 4UDUA 3ARPA 5JW4N 4LLQA 4QTIH 1EHAA 4KK9D 4IOIA 3FB5A 5F7EL 3O3DA 4HKBA 5BV7H 1BQHG 3ZTJH 8CGTA 1A9BB 2HJLB 1XCQA 2KBGA 1ITCA 3WSQL 4RFOL 3ISWA 1P7QB 3VXMA 4YK4C 2GJJA 3PL6B 3EYQD 3PHSA 1TZGH 4LGPB 3BP5B 4LRNL 2ERJB 4UTAH 1JWSB 2I9LB 3HPJA 3TH2T 4U1KB 3MV8A 1JHTB 4HC1A 2C3VA 4IBLT 2HT2C 3VXNB 1BBDL 2GY5A 4P46D 4P9MH 2VABB 5B39G 1RK1A 4N9GA 3V6OA 3S35X 1BHGA 4KROD 5CSZA 3BQUC 4LMQE 4R7DA 5H37H 3MLSH 4L1DA 1CCZA 3OTTA 5TPWH 3W0WE 4JRXD 2J4WH 5I1EL 3CXHK 4UIKH 3S3JA 5IBLD 4RMSA 1KLGA 2A73B 4ISVA 3FB7B 2VZSA 5EUKA 3MLPA 3RVXD 4AK1A 3BUYB 5ACLA 2WUBL 3GKWH 4FQHB 2Z0BA 1GGCH 4Y4KB 4QT5B 2IEPA 4GG8B 1EHNA 3V52H 3FQWA 1N59A 3K1DA 1SMOA 5F9DC 2D7MA 3GGWB 1EA9C 2BOBB 2EIZA 5I1AB 2VERN 3CSBA 3O4LD 4F7EA 4PJEE 2XG5A 1U2HA 4OFPA 1BD2E 1I4FA 1CGSL 4L8BA 5ID1A 5ETUA 5TE4L 1TVHB 3MGTB 3EO1B 2ESVA 4HT1L 4JVUA 3TF7C 4YXHH 2CGRL 4P2RB 4LCYB 3LHPL 2R0ZH 1BZQK 1UWEH 2J8UB 4NKOB 1CF8L 4JFZH 3ROLB 3MOBH 3KPOB 1DQLL 4JM4H 2VR9A 1UB6B 1D5XB 4GMTH 5D70L 1H5BA 3SO3C 4KUZH 2AABH 4Q9QH 4R6UA 2KUTA 1U2CA 4OZFB 3RA7H 3EYQC 2X9WA 4WTZG 3CDFA 4HZAA 2HT4D 4WIQA 4UT6L 4ZOEA 1WAAE 3JTTB 2VLRA 3TCLA 1IGYA 1H3PL 4TVPH 3TO4C 4PREB 1T7WA 1FFPA 3G5YB 1BQHB 1MAJA 2QEJA 4PTUA 5T3XH 5TJWK 5I1LA 4NM8L 5GJSH 3QIWC 1NJ9A 3OGOE 3RU8L 1T89C 1S7SA 5I1HH 3RGVA 1V3MA 2VSCA 5CEXA 3D18B 4RX4D 4I5BB 4G43B 1LK2A 3HFML 3X3FL 3F7RA 4NC2B 4YEFA 3RZCC 4G3YL 3V6OE 4FQXC 4HX1A 1XF2B 5AG8A 2CPCA 1J05A 5AAWA 5FK9A 4Y0GA 2X1OA 1XF4B 5FOJA 2X9YA 3NCEB 4M61A 1G9NL 1MCKA 5ANMA 3C5JB 5E99L 4ZPVB 5LG1A 3PNWB 1Z0NA 5GGRA 1CXFA 5B39B 3WFDL 4OLYH 4NWTL 3BZ4A 3ZE0E 5FHAL 3QFJB 4YNYA 4MDIB 4I3RH 4EEEA 5CGYD 1I7UA 5EUOA 2Q8BH 3UJIH 1MVUA 2A0LD 2JCCA 3PV6A 1KELL 4L5FL 2FL5B 5EC1A 1U8NB 3O9WB 1A7NH 2R0LL 1B2WH 4XVSL 3IFOA 3BPLB 2FECI 3LS5L 3O8XA 2X4TA 5AG9A 2R4RH 5J1TC 1N6QH 3QUXA 2NY6D 2P48B 2AXJA 3V5KA 5JW5A 4FFVD 3G5VB 4AMKL 5DVOA 3U4BL 1OGAA 3D69B 1JGLL 4NZDA 3GIZL 1ITBB 2X4OB 5C07E 4MQ7A 1MRFL 1VCAA 1A3RH 2H26A 3MV9B 3ROOA 1T03L 5GS1B 2P44B 5F6HI 3VCLB 1A3QA 1G0XA 3FRUB 1RIVL 1MCQA 4XMKH 5I15H 1YEGL 2VO5A 3MO1B 5DEFA 4P5TA 2XI9A 1U6AL 1NFDF 1YEJL 4NJ9H 2DQDL 4P3CH 2X1XR 3RWHA 4AENB 3GMMA 3GJFH 4PJIE 1RQ5A 3C5ZB 4H1LB 1I1AD 1QKZL 4UV4L 3CXDL 1MCPH 3I50L 2XRAH 3U7WH 2PO6C 1INDH 1XF5B 1N3NA 4P2QB 1KJVB 1EO5A 3EYOA 4FABH 5L88L 5JXED 4FQCL 3MLZL 4U6VH 4OM0L 3WLWD 3BOVA 4XPBH 3TYGH 3O0RH 1SBSL 3MPCA 4XAKE 4LEOA 5J1AA 3GEWB 4XNMA 3MLVL 2IADB 1JHLH 1OTSC 5CSGA 2BOCA 5FUOH 1KPVB 1T2QH 1DQTA 5HI4D 2QR0A 2RHEA 2EDTA 4JZOB 5CGYC 4Y5YC 4HUXB 4OIIH 3QWRD 5JW4M 4LHUD 2MHAB 1YMHA 2R0KH 3O2WH 5EUOE 2NY4D 3HZKA 3HTLX 1ZA6B 4O58H 3O6KL 4TVPE 2IAMB 5D72H 4P5MB 2DIAA 1ES0B 4L3AA 4R4BB 4WWKC 4AM0A 3GJFA 1DBAL 4LRIC 3GMNA 5T3XE 4APQA 5F1NA 3WNLA 4JFPB 5IT2H 1A4KA 5E8EB 3DV4B 4HXBL 2W0FB 5E8OB 4Z7VA 3V5HB 5KANI 5D8JL 1XIWD 4OT1H 1OGAE 3GBML 4HK0A 4OCXL 3I02A 2DIJA 4H25A 1GAFH 2OQJB 3O6LL 5HPMB 5FYJH 2X40A 5BOZG 1KTDA 2HTLD 1GSMA 4AG4L 5KSBA 2ADGB 1G1YA 1JTTA 2R0WH 3DX9A 5L9DH 2X2YA 5DT1H 5A2LH 4XWOC 4N5ED 3EYFA 1D9KB 4J23A 3EYSH 4AEHL 2BY2A 4XCYB 3K81A 5DRZA 3LMJH 2J88L 3K46A 3INUL 3GMRB 3U0TB 4NQCD 5I16B 3RIAF 3UYPA 4IOFC 1GGTA 2CD0A 3RVWD 2G2RB 1EIBA 2XTJE 2GI7A 1JGUH 1B0WA 4X80L 1TCRA 1OD7A 1CGXA 5IMLB 5IFAH 4MLIA 1M05A 4XPTL 3H3KA 5J06A 3N1GC 5FUCC 1NDGA 5JXEC 4JJHA 5F9JA 4NOBA 2UVEA 4Z18A 5B22A 4DZ8B 5IV2A 3JVGC 5EU5A 2NY7L 1LDPH 2Y7QA 4W4OC 3QO0B 3T77A 4YWGH 2IPUK 1LHZA 3QQ4A 1NC4D 5H35B 1A3LL 4PLNC 2V7NB 4EXPX 3IDUA 2NMSA 5FDWB 3ULUF 3O4OB 3SN6N 4X6CA 3AS2A 3NCJL 1JPST 3EJYD 2HKFL 4IRJD 43CAA 2OTUA 3SKJL 5TGBA 4YHZL 2AK4D 1EEUA 4UTBH 3HG1D 4Y5XB 1FGNH 3SOBH 2GEEA 3FFCB 1KG0B 4G6AD 3ZKMD 4X99A 4WI8A 1KJ3H 4HWNA 1FVCB 2BSRB 3KPQB 3C6LA 1MHHB 5JDSA 3TBSB 1PJ9A 4JM2A 3OAZK 1LQSR 3O45B 3IJHB 4MA1B 5C6TH 2VLKD 2D9CA 3AMKA 2JELH 3S36H 4TVSa 4XCCL 3BO8B 5GGQH 2QKIB 1H0DB 1EMTH 4UAOB 2MQCA 1T1WA 2OJZH 2Y07H 3UC0L 2GSGB 1ADQL 4MXWL 2XPGB 3NIGF 1RUMH 1A6TA 2XXCB 4HUUB 3EBAA 1DN0B 3GO1H 3RNKB 3BKYL 1OQXA 1RIHH 1DTUA 3OR7A 4OZHA 5J9PA 3CVHB 3QEGH 2WBJA 1XGTA 2CKBH 5AUMB 4J3XA 1BAFH 3MFFB 4MS8D 1I7RA 5FOBB 2X5PA 1DQQA 4FP8H 4MA7L 3UTSA 1N2RB 4MQXD 1S7UB 3NFSL 5DC0A 3ABZA 1ETZB 2EDLA 3MRRA 4PRIA 4WU5A 3CUPA 5BS0B 1C16A 1ZANH 3FQTA 3QNZB 3U46A 1JGEB 3O2VH 1T0NA 1UA6H 2X70A 1AQKH 4FTVA 4YQXH 1HHIA 1OTUD 4NN7C 3V6ZB 5I1JL 4H0HB 1R3IL 1S9WB 3QI9D 1IZKA 3TJHD 4KVNL 1A7PL 3T08A 3SDDB 1X5LA 4Z95H 3V6FB 2VZTA 1H3VA 3PABB 2FIKB 5D1ZD 5HYQA 3H7BA 5EWIH 1GGUA 4H20H 4HIHB 4PYHA 2ARJA 3ZKXC 2FEEI 3BKCH 4K9EL 3IS1X 5B8CA 5HDLA 4UQ3A 3RWIB 1RUAH 3PXHA 3QXAB 4P2OB 4X6CE 4N0UB 2VQTA 4P4KD 3CVHL 5SWSD 1ZT1A 3MNZA 5F7MC 4KXZH 3GSWA 4JPVL 3L3KB 4CJ1A 4QHKJ 1BVZA 3UTZA 2Y6SD 5CGTA 4TSCL 3KPNB 3TP4A 2N7AA 1IC4H 1NAKL 2FJGA 4GRWB 1EUUA 1EHLH 4XZUA 1MFEL 1JI1A 5I73C 1JNLL 2I24N 4MJIB 2EDDA 1AE6H 2DQTH 4PJCB 1QFWH 4OLVL 3K4ZA 4Z0XB 3VWJB 4GW5B 25C8H 5ACMA 3VFWA 2VAAB 4Y1AB 1L4IA 1MREL 5CIPB 5I8OL 3ULVD 1X9QA 3QDGA 4L8CA 1L6ZA 5D5MA 1AXTL 2L7UA 4PJ7B 1T4KA 2UWEF 2Q8AL 5DEGB 1N4XL 3QUZD 4JN2B 1R3KA 3T0AA 3BHBB 1QFPA 2C1PA 1S7QA 3EDJA 1HXYB 2VDMH 5D7SH 2AV1B 1OT1A 3C2SA 5EORH 4XVJL 1T0PB 1TJGH 5TFSH 1T1XB 4ZG1A 2Q86A 3RWJA 3MV7A 3F7PC 2YR3A 1K9TA 2Z4QA 2E9BA 4PRIE 1RUKL 2H3NA 1CYGA 4LASH 3WIIH 1CTNA 4WW2B 1R24B 2F54A 4J1UA 1UKQA 4PGBA 3HLAB 2P42B 1XR9A 4FTVE 3OSKA 2OM5A 1HHHB 2VXTL 2XN9E 4MB3A 1ZS8B 4DQOH 1W0WA 2HVKA 1A7OL 5GGVY 1NUDA 3MRDA 5ERWA 4R2GD 3D1MC 4Z5RA 4TUJA 5HHNA 3MROA 4JO3H 4X4XA 1C1EL 2QQNL 5DJ8B 5JXAL 1LO0H 1C5CL 4O9HL 5SWZB 1X44A 5IWLC 2HMID 5E4EC 2BSTA 3VG9C 4KVCH 4OLZL 2Z8WC 3PG2A 3GKZA 5CCKH 4WEBL 1FFNA 4WV1B 3T2OA 5HGDB 3D3VB 3TN0C 3WUZA 2VLLB 1EK3A 2VXUL 1M7IA 5GGSA 3SDYH 1A6UH 4NC1C 4OD2B 1S78C 4YR6A 3MUJA 3QIUA 3KPPB 4WGVB 1ACYL 3LRSA 5DRWA 3P40A