4OCTA

Crystal structure of human alkbh5 crystallized in the presence of mn^{2+} and 2-oxoglutarate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
209
Chain Sequence
QKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human ALKBH5 demethylase reveal a unique binding mode for specific single-stranded N6-methyladenosine RNA demethylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords RNA demethylase ALKBH5
total genus 55
structure length 209
sequence length 216
chains with identical sequence B
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4octA00
3BU0A 3T3YA 3H8XA 3RZGA 4RFRB 2IUWA 4NIGA 2FDIA 3BI3A 4ZS3A 4NRQA 3I3MA 5F8PA 3O1UA 3H8OA 4IE4A 4IE7A 4IE0A 3O1MA 3RZLA 3RZMA 4IE5A 4QKBA 3O1PA 3S5AA 4NIHA 4NIIA 5DABA 4NPMA 2FDGA 3BIEA 3BKZA 4OCTA 3O1VA 4CXXA 3BTXA 4O7XA 4IE6A 4ZHNA 3O1OA 4CXWA 3I49A 3I3QA 4QKDA 3O1SA 3O1TA 4MG2A 4JHTA 4QKNA 4QHOA 4MGTA 2FDFA 4NJ4A 4NIDA 2FDKA 4CXYA 3KHBA 3O1RA 3BUCA 3BTZA 3S57A 3RZHA 4QKFA 4IDZA 4ZS2A 4NPLA 4NRMA 3KHCA 3I2OA 2FDJA 3BTYA 3T4VA 3H8RA 3RZJA 2FDHA 3RZKA 4NRPA 4O61A 2FD8A 3LFMA 4NROA 3T4HB
chains in the Genus database with same CATH superfamily
3L2YA 1XSRA 1MZ6A 2BGOA 5L9VA 2JX9A 3KQRA 5FLIA 4J6GA 1DBNA 3Q9OA 4E4ZA 2Q8CA 3H8UA 4XUPA 1H9WA 3IIIA 3KB5A 1FV3A 4EZ4A 3AVSA 4YLZA 5EIYB 5J98B 1W6QA 3KSCA 1W3VA 4JV4A 2Q8OA 1HRI2 2VM9A 2PFWA 3KGLA 3JQWA 1F4HA 4Y4RA 2XJSA 4AYUA 1V00A 1SPPB 3MICA 4IV1C 4PT6A 2XKOA 1QOSA 2PXJA 4RQPB 3RMXA 2WWUA 2WLPA 4Y22A 5LWBA 1SFNA 1L7RA 2BGPA 4FXGB 4GZ9A 1AZDA 3KVAA 4XJUA 4GIQA 2GNTA 4A6OA 4BH9A 4QQHA 4MV2A 3ZN6B 3MI8A 2VZUA 1YCIA 2VZSA 1RUD1 2PLV2 2WO3A 5C8CC 1RUG1 4NWVA 5A7WA 2ZS6B 5K0UA 3USSA 1LRHA 3ZM8A 2BWCA 2WWJA 3U75A 5IATA 3WNKA 3IWZA 5A80A 3I2GA 3OGJA 4OLLA 2JICA 4JCKA 4RGKA 3ZFGC 4ES8A 3LSDA 5GLUA 1N1TA 1POV0 2LS6A 4XF9A 4QGLA 5HPOA 3QOPA 2GZWA 4WM7B 2HYXA 3NO8A 2X8KA 4MADA 3CJIA 1GZWA 5GM0A 1EYBA 2XWJB 5JSPA 5JPNB 1VR3A 4RD7A 2B46X 2ZZJA 4X6RB 3W21A 1QKQA 4FCAA 5EFUA 5KHGA 3VBSA 2IXHA 1GFF2 4MOAA 4I0BA 1DP0A 1ZRIA 3VKLA 5IK8A 1C4RA 2AYHA 2VCCA 4Y1ZA 2ZGNA 1VBC3 4B4QA 3AZWA 1H30A 5BY5A 4KG8A 1UAIA 1CJDA 1O7FA 1YQ8A 2A6YA 4QKBA 1G8WA 2VL4A 2E7AA 4COUA 4XIKA 4A42A 4FSJA 1TME3 4URAA 4S2HA 4K1YA 4UAPA 4CEWA 1IKPA 2BOJA 4MUVA 3ZSMA 5JOXA 2WN3A 3PNAA 3I59A 4R4XA 5BNNA 4LA2A 2UWCA 4UOJA 4L99A 4KG0A 2GALA 4IDZA 4P5YA 5KHHA 1RUH2 4CU8A 1IG3A 2VTXA 5CZKA 2YFUA 1ODNA 3CKHA 2IVJA 2VZQA 1NCQB 2ZX1A 3FHAA 4XXAA 3ZFFB 4AE2A 3FFQA 5F5AA 3ZYHA 3OBAA 2QNKA 2YHJA 3IDAA 4K9SA 2DCKA 4MH0E 1LNSA 1UKGA 4FPEA 5CYYA 4EN8B 5D8AC 2WAAA 4M3CF 1W39A 5JVVA 2DVBA 1BK1A 2V5YA 3CIHA 3WNPA 2C24A 2W1WA 3GCXA 4YG3A 1SDWA 2FMYA 3K75B 4UWDA 2VTXJ 4X6QB 4AG4A 3CNAA 4PJYA 1DQ5A 1KXGA 2VULA 5FOBB 4FPHA 2ES3A 4IEOA 5DG1A 1FMD1 3C7HA 4PI0A 5IAVA 3I2OA 2OKXA 2QZ3A 1PVC1 1TZOA 2D3PA 3NKGA 4Y1XA 4P9GA 2DVDA 2E7QA 2E32A 2F17A 4LHLA 1RINA 3C8XA 3VBFC 2BJSA 4RR3B 3PHMA 2DCZA 4MLOA 2ZHLA 2A75A 4LHKA 2ERFA 2WSVA 5JOZA 4NN0A 4LK7A 4O9GA 5FPBA 3HR9A 4XYXA 5KXBA 4UF0B 1RVF3 4MSVA 4CXXA 1W04A 4WVVA 2ARCA 5FP3A 4FAHA 5A6ZA 1K5JA 2W5FA 1NCQA 2XMLA 3HT1A 3ZN6A 5BYNA 2RJLA 3HNMA 4YGDA 1WW7A 2FBEA 3K2OA 5C8CB 5FYIA 1ZZCA 1GQPA 1RUI3 5GLWA 1ZVFA 4CU7A 1XE0A 1GOFA 1YFWA 4NRMA 5FJHA 4OULA 3ZYGA 3ZX7A 5B2GB 5IT6A 4GB32 1Y9MA 4XBLA 3I4IA 4AVAA 4MX3A 1WMEA 3GF6A 4QAWA 5DDJ2 2RM23 3GBGA 5IK7A 2YC4A 5ERLA 4Q4W2 1S2BA 4XFFA 1X50A 5EV7A 1WGPA 2GN3A 3PLQA 5L19A 1W8FA 2XVLA 4GMP0 1RMU1 1HXS3 4UT5A 1YUDA 3I2FA 4XDQA 5JXHA 1RJ8A 1RUF1 2GMPA 2W95A 3IKWA 4OYUA 4JHZA 4K8RB 4MYEA 5D2AA 1H8TB 1XE8A 5BNOC 1UCXA 2QQKA 2A3YA 1ZZ8A 1VAKA 2UYBA 1S2EA 3JU9A 2DURA 3OBRA 1I5ZA 1SDDB 5EZWA 1VBA1 4NROA 1GP5A 4DOUA 2WABA 4SBVA 4UF0A 5A1FA 1RUE1 1JYNA 3BALA 1JZ6A 3KT4A 2VMFA 3O1MA 1YFXA 3WDYA 3CMGA 2DV9A 1I6XA 1RYYA 1VB4A 1B09A 3M3CA 4YFWA 1X8MA 5ACA3 1X9TA 1Y9GA 4QHBA 5JOYA 1DYKA 2GH2A 4Y5Z0 1D2SA 1O8SA 2OIIA 1R1A1 1LTEA 4ASKA 2Z5WA 3DPRA 4O65A 3WF3A 1TME2 2ATFA 2FZ1A 2K46A 4NPLA 1CIYA 3GHMA 4HMZA 3AKQA 4Y33A 4B3NA 4DFSA 1HJFA 2A70A 1W90A 2Q4SA 1DG6A 4ET7A 5FQ0B 4BM8A 3LIGA 3H0OA 1UX7A 5LY1A 1AR91 1AX2A 3KV5A 2IXCA 4TWTA 3EB7A 5DAPA 4L92A 3O7OA 1H0BA 2GNDA 2AREA 2PAEA 1JHJA 3ROUA 4AFCA 2VZPA 4NIAA 4KWLA 4CCJA 2XJQA 1LJ7A 2HWF2 3LDRA 4DIQA 4E27A 4U36A 1AL22 3JD73 4GWMA 2GMMA 3RYRA 4D7SA 3WHTA 4N43C 5A7SA 1AR82 4CCLA 1QXJA 1VB2A 3N7JA 5FP7A 4BK5A 3U4XA 3PUHA 2LALA 2XB6C 4GAZA 3WD5A 3WF0A 3BTYA 1HB2A 1LGBA 1O5UA 4FOVA 2UWAA 4KBZA 1R1ZA 1SBDA 5F7UA 1ZRRA 4NRPA 5JR2A 3WF2A 1R082 2BNMA 4Q1PA 5A3UA 1LOFA 1WW6A 4BQYA 4GULA 5IK5A 4AAPA 2WUHA 3H1MA 5LZ6A 3B69A 3VKNA 3I7DA 1YO8A 2WLQA 5FZ1A 4RS5A 1AR73 5FYCA 2CWSA 1W6NB 4WBBA 1YNAA 4LITA 4TN7A 2Q5TA 3OCPA 1O4YA 4ATEA 1A34A 4Y1VA 1Q8QA 4YVSB 2VZ1A 4P9XA 4N9IA 2R061 1CX1A 3HMYA 1QJX2 2YDEA 1RXFA 4Q8LA 4PHZA 2XJPA 3RGBA 3BUCA 1C1FA 2BZDA 2RR13 3DV8A 4INDA 1UOJA 4CCKA 3BPSA 2LM3A 4B1LA 4P9YA 5A7NA 4GH4A 4QPGA 2AENA 4TTGA 1ODMA 1Q8SA 1Q8VA 3I2JA 4EZHA 2HWB1 2ILMA 4FFHA 2EF6A 3CDZB 4IEYA 5FYUA 3HIFA 1GUIA 1UNBA 1FMD2 1JODA 4LHNA 1UOFA 1IPSA 3KCCA 4LOTA 4QPIA 4ARXA 2AH2A 3MZHA 2B39A 3P3NA 1AYN3 2WA4A 4A41A 3V64A 4JDOA 1W8TA 3LGRA 3RQ0A 5LCWL 1OPMA 2PYTA 3BVCA 4QGMA 2RVAA 3GCWA 3PL0A 3RYPA 2BEOA 3WW3A 4ASLA 1Q56A 5FZIA 2BNNA 1QOOA 1QXRA 4WM7C 1EUTA 1X33A 3MIGA 4P9LA 2J1UA 4PDWA 1V9U3 3IT8A 3ZMOA 4WM8B 4JTOA 1PMJX 1C3HA 5DAVA 5CA6A 4YZ4A 2VXRA 3ZSEA 4AFDA 4AEKA 1VBD3 3U1XA 3UGGA 3IPVB 4CTEA 3I3MA 2HBTA 1JBCA 3HNBM 1PGW2 1WD3A 4LKDA 4YYOA 1YXWA 5C3RA 3WLUA 2Z2SB 1LGCA 3VBHB 4L9BA 4XPVA 2A6ZA 1WA6X 2R30A 1U0AA 3KF3A 2E63A 3WNXA 1JYXA 2JDAA 1UPSA 5JPMB 1RUH3 2QTWB 4HN0A 1DQ1A 1B35A 4FQZA 4BXSV 1ALYA 3RI8A 3R05A 3HN3A 2VQUA 1GZ9A 1G9AA 2IWGB 2PHDA 2I07B 5EP9A 1FNYA 1U12A 2P3KA 4DXTA 4QU2A 2VMEA 3ZYFA 5AFBA 2ZABA 4D94A 5CBLA 3R4SA 5G05L 2OW4A 3A0NA 5DMYA 3MPBA 3PJQA 4RFRB 2GP5A 3MW3A 1XJAA 1H6XA 4K6BA 4XTPA 1BVVA 5FY5A 5GZFA 4NRQA 1PK6A 2EALA 3O1UA 1RUI1 5GJ6A 3FBMA 2QQOA 1R081 3BCWA 5SV8A 2D97A 2XR4A 3POWA 2IVIB 2QQMA 2Y6FA 4QX0A 5APAA 5FZDA 2PN5A 3FMGA 1T2XA 4HONA 3SH3A 2QQJA 1SACA 5KHJA 3O1VA 1I5PA 2P37A 1XB9A 2HWC2 3NAPB 1W0OA 1H8VA 2A6VA 3LIHA 4MGSA 2XJUA 5L73A 5I8TA 4K8FA 1APNA 2NQYA 4YGEA 2IFRA 4D7YA 1R083 2HWC3 3WINE 2PAMA 1W9YA 2EXKA 2A3WA 3NV1A 5DG2A 3VDDA 4A7YA 3ITQA 3GHNA 2MHFA 5C4WA 1LHUA 3USUB 1RUF2 4QX7A 1GP4A 4Y5TA 4EWEA 2VMCA 5I0DA 2DBIA 3W5NA 1CAUA 1FAYA 1LULA 5BNOB 1S0CA 2WN2A 3UETA 3I2HA 5FUNA 2XVGA 1ZREA 4P08A 1PZ7A 2HLEA 1WW4A 2O14A 2R043 4MVTA 4Q4V3 2C1FA 3H50A 1I1EA 3H3LA 4K1ZA 5JXIA 2VJXA 4AK3A 4F7ZA 1QJY1 2RHPA 2L9LA 2BQPA 2VZOA 1HRV1 3GBFA 4JKLA 4CU6A 2LTNA 4YZ5A 4IQPA 5K8SA 1W8UA 4GMP3 1A8MA 1WUVA 2JG8A 2P6CA 4QKFA 4CPBD 2XQXA 2FCTA 4ONUA 3KCYA 3ZFEB 1GQGA 3V65A 1F9KA 2LW8A 2UU8A 1ACCA 3M3OA 1MEC1 5JWPA 3N9MA 4HL0A 4B4PA 4DZGA 3O12A 4XAAA 3HD8B 4UW5A 1YC61 4AQ2A 1H1MA 2EXJA 1D0HA 3LA7A 4JC1A 5ABJA 2QCSB 4OI2A 5JIUA 1KJRA 3AK0A 4BMBA 2HWD2 1DGRN 3JB8A 4K20A 5BXXA 3OYWA 4TZDA 4YRDA 4A3ZA 4BQ1A 3ZPOA 2VW2A 2BYVE 2WQZC 4M4RA 3ZN5A 2ZZQA 1CAVA 2AACA 2YBSA 4CCCA 2VW1A 3A4UA 3JCIA 4XACA 2PQSA 3VBOB 2R7EB 2DCYA 2ZMKA 5FZGA 2Y6HA 3A0KA 4LBNA 3KQ4B 3UKTA 3GZUC 3ZYPA 5IFTA 1G9DA 5CADA 1CAUB 2PHTA 4M3CE 1MQTC 3J8F1 5BNOA 5LRSA 3RZJA 3ES4A 1JOBA 2ZGRA 2RJ2A 1HXS1 3ME2A 1YYNA 1OUXA 1D0GA 5C4WC 5FO8B 2XPJA 4UBGA 2P1BA 2B45X 4HN1A 4UBHA 4EJRA 2FDIA 1ZA7A 2VVDA 1MVQA 2WT0A 4LIVA 1PVC3 1QNYA 4NMIA 4ITCA 3A7QA 4PIZA 5F3GA 5FLHA 2CYFA 3WNLA 1TMF1 2ZX4A 5JR7B 1AYM1 1W6PA 1TEIA 3ASIA 1AR63 4EN6B 2DUOA 3FLPA 4IW3A 3ZFGA 4BISA 4LO8A 1EP0A 4EN0A 3TWIA 5ACA2 2HWB2 1POQA 4UFMA 5DQ0A 1LEMA 5K0UB 4FFFA 3MF6A 5F39A 1REFA 2OUJA 3J7MA 3M8LA 1V6LA 4HOOA 1AR93 4P00B 3VBOC 2WNVC 1G9CA 4XFAA 3UJOA 1Q5OA 3VBSC 4GJZA 4AQ6A 1OOPA 1V6NA 3T3YA 4B7EA 5CKMA 4C1XA 1NUKA 2WZEA 2Q1MA 1AR92 1OLME 3A22A 2KA3A 1UW8A 1JS9A 2ZX3A 3KM5A 4NHKA 3GZTB 3BU7A 3IMNA 4IE4A 4LJHA 1O5LA 1R091 1W2UA 1PO22 4YG6A 3HBKA 3CZJA 2VVFA 3MF9A 2H0BA 5JI7A 3ZYIB 5JDBA 1VRH1 1C57A 5FZEA 1VIWB 2A6WA 5JZGA 4WVMB 2W39A 2ZGUA 1JW6A 2VC9A 3WCSA 5FXWA 1RUD3 2V4VA 2C9KA 1W8ZA 2HWF3 3RI9A 4LKEA 1VBC1 3GDBA 2D3RA 3GBWA 2ZCWA 1G9BA 1GNYA 1BKZA 3F2ZA 5LK7B 4XQDA 5CKNA 2DCJA 5A32B 1JZ3A 5F9TA 2E7TA 3C3VA 3K4DA 2C6SA 3WP5A 3OF1A 1NT0A 4KU8A 4NVPA 1J83A 4XEZA 1CX4A 4AOCA 2FDKA 5FAXA 4HKWA 1VAMA 4A44A 2DBNA 1V6IA 2QDRA 1ND2B 2PHXA 1J3QA 2DFCA 2ZEWA 4AQSA 4COZA 4NE9A 3NNMA 2Y8KA 2LUWA 3MBWA 2J1AA 1OOPB 2NLRA 2XOMA 5FMBA 2WZPP 3NVCA 2Y6JA 3H1WA 1DIWA 1S1AA 1Y4WA 2JENA 2G1MA 2DWRA 4FFGA 2FDJA 2BVBA 5HV4A 4I0WB 3DXTA 1DGLA 1RHI3 3IDEA 2ZA9A 1MS0A 4RYDA 3TN91 3UK9A 5JSOA 3PTRB 1YQ2A 4GB33 3R6SA 3U07A 5A3WA 4FAGA 2R49A 3GALA 4NHXA 2VBDA 1WZXA 4V2WA 5T5LA 4Q0SA 4P02B 4FVVA 1AXYA 1XU2A 4FI9A 2W68A 4NWWA 3VBUA 4CCMA 1O6UA 4XBNA 4BYYA 2F6BA 2XLGA 3KV4A 1MS5A 1IZ3A 2GMEA 4N9HA 4E4HA 5FR3A 4RR3C 2W52A 1VBD1 3ACIA 1W6PB 4IEQA 1NG0A 2JG9C 4TXWA 1AYN1 1S4CA 4CDXA 1EPWA 3M4FA 4A2UA 4AI1A 5FK7A 1IG0A 2DDUA 4XQ4A 1G86A 3PVBB 1NLRA 2R062 3TNPB 2BERA 2ETEA 1RUJ2 4FP2A 5LBCA 3H8OA 1SMVA 2BBAA 2UWBA 3THDA 3POIA 4UYBA 1JYIA 5DAWA 4Y24A 4ZPIA 3MIFA 3NAPC 4Q29A 5CFCA 2SBAA 4KI5M 2ZKLA 4CSWA 4HXCA 1NKGA 3O1SA 3IDBB 2FMDA 4OMDA 5F3IA 2RS53 4CEYC 1MS9A 2P3YA 4QB1A 1LAJA 5GKAC 1NZCA 3I59B 4U2AA 3MV11 3PUAA 4FPFA 5FZ4A 4OVEA 1RVF1 2WZR2 3KD4A 2PLV3 5GZEA 3OJBA 3T4HB 2WA3A 1FXZA 2W0XA 3ZFFA 1SEFA 5FTTC 3ZXAC 1QJY2 4E8DA 2BFUS 3ZYBA 4QX1A 3OGSA 5IW0A 4LO4B 4FBFA 3DKWA 2WKKA 4RS5B 5FV3A 4KWJA 1W6NA 1CPNA 3KT1A 4M0NA 4Q27A 1RUD2 2PLV1 4BQ5A 5IVFA 4FTSA 3TB0A 2B9VA 1FMD3 2I2SA 2YC0A 1RUG3 5HCFA 4BCUA 1YQCA 1ZBA3 3IBMA 1PX4A 2D5FA 1N1SA 4V2VA 1BEV2 2OVUA 3O1RA 4DRRA 5FIXA 4BIOA 1JN2P 4Q8KA 5KR7A 5FZFA 2VMGA 2ZHMA 1BXHA 1POV1 1HV1A 3MIBA 5FP9A 1GZCA 1S0JA 2PELA 3RZKA 3LCPA 1ZA4A 3WQ7A 1UXZA 4Y4YA 4LBMA 1JZ2A 1ZZ9A 2TEPA 3B94A 2XVKA 2VPVA 5DUUA 2R041 2BOIA 4UXAA 5D8AA 4RS5C 5A7WB 2VUAA 1LU2A 3J4UH 2GC2A 4MXVA 1W0PA 3PDQA 3D82A 1MS1A 1UY4A 5FMDA 3JUUA 1PK6C 1H6YA 1SZBA 1JXNA 4Q2FA 1SCRA 4OFGA 1UIKA 2CGNA 2XLFA 4MHUA 4K40A 1J84A 5IVYA 4AI0A 4ZONA 5KWRA 3O1TA 1WD4A 4QHOA 2ZX2A 3CJIB 2WR9A 4XW3A 3SCGA 1XXNA 1KS4A 1NX9A 4LULA 1XNDA 4LBJA 3RZHA 1HRI3 3I3EA 1WKYA 3KF5A 1QOTA 1DGWX 2VGDA 2GAUA 1OXCA 4LXLA 1J1LA 4QX3A 2QZ2A 5T3NA 3H8XA 4L8QA 1COV3 3VD5A 4BA6A 4GMP1 4AZZA 1SFPA 4IE7A 3KS7A 1AYN2 1TQ5A 2ZGKA 3WW1A 1WCSA 4UFKA 4GALA 3VBHA 1Y3TA 4CUBA 4YVSC 4DNYA 4PLMA 4NHMA 4OCTA 1PMHX 3KGZA 1C28A 5L9RA 3LDKA 3SH4A 3K46A 5FXZA 4CCOA 4FPCA 3M1HA 3JBG1 1BK0A 1DQ0A 1ULEA 3SISA 5LEKA 1U5YA 2CSGA 3FLRA 2JKBA 3AKRA 4R8HA 2OT7A 1LODA 4FXKB 4XC9A 1AR83 3E6BA 5JXJA 4QPGC 3BTAA 1MS4A 3TEYA 1TMF3 3JXSA 3LAGA 2OQ6A 1NAEA 5LBEA 4LBQB 4JRLA 4X8NA 2UY9A 3FZ3A 3NL1A 3CQOA 3Q8AA 1XSQA 3V0AB 4QT6A 2OYZA 1LOFC 4Q0UA 3UESA 5KBFA 1EY2A 1RUE3 2YROA 4XIOA 1XQNA 3AM2A 2CDPA 3FLTA 1D4M3 1DYOA 4YZ3A 4A3XA 4XABA 2C26A 3AZYA 5FZHA 1EAH2 4IV3A 4W65A 1H4HA 5DPNA 1W8OA 1XE7A 1LECA 4IETA 4MG2A 5J1XA 3HNYM 3PIJA 5J09A 2CY6A 2DVFA 1JUIA 2VU9A 4AFBA 4Y20A 3E1F1 4R52A 3VL8A 4E2SA 1NQJA 4LQRA 2OPWA 3TOJA 5KXDA 3TAYA 1F4AA 1SLTA 4JX0A 1AJKA 1ZNPA 3ZLIA 5FPVA 1QQP3 2PHFA 2P34A 3NV4A 3RZGA 1MQTA 3T2QA 4QDSA 1XNKA 4XJZA 1ASJ3 2NM1A 3DEMA 1H2NA 2RS12 2VECA 3DN7A 1BZWA 4YM0A 5A3OA 2YBKA 1RMU2 4XDPA 4COVA 1N3OA 2Z79A 2D43A 3MW2A 3AXDA 2JE9A 3K51A 4W6YA 3VBFB 3CEWA 2BP6A 4CUCA 1KEXA 4C0BA 4EYUA 3A21A 3I97A 1QQP1 1JYWA 2XH6A 5CFDB 3IAPA 3I3QA 5EYYA 5A3LA 4OZXA 1LOBA 5C33A 4Z2WA 4Y5SA 1R093 5M0TA 3TEXA 4AI3A 2AZ5A 2FCVA 3JD71 1C8M3 1GNHA 3SMHA 3ENRA 3V56A 1HLCA 2FZ2A 3ZXEA 1ZBE3 1IS4A 1H9PA 1UO9A 2ZMNA 4NAMA 2EA7A 3NNGA 4XXPA 2Z4FA 2EXIA 4XJ8A 5FZAA 5IAXA 1JZ7A 1WLTA 3HQXA 2P5BA 2C0ZA 4J25A 1PHMA 2VE1A 1EAH3 1QEXA 5FOJB 3ETQA 3POEA 3FE5A 5FZKA 3WDVA 4CZSA 1UMZA 2JE8A 2WAOA 2XL9A 3EHKA 3SCFA 4Q4X3 5I8YA 2OPKA 1REDA 4LBKA 4AEMA 2DTYA 5EJ3A 1S2KA 2WQ4A 1AYM3 5A7QA 4UFIA 5J96B 1DQ6A 2VOTA 4JGZA 1MVEA 3PVNA 4WZFA 4OMCA 1K42A 4Q1RA 1NE4A 1ASJ2 1OQDA 2BRTA 4ZU7A 5FCCA 3NNLA 1OA2A 3MIEA 3VKOA 2QVSB 4Q4X1 5EHDA 1NY72 1QGLA 1YFUA 2RR11 3TN92 1BJQA 5FZMA 5FYMA 1VAVA 2W1QA 2GC1A 4AGVA 1GOGA 1GU3A 2XLAA 2ZHKA 3MPPG 1AXZA 2HWE1 3SKVA 2BW8A 2B5HA 4ORFA 1FYUA 4N7IA 1WLCA 2Q1ZB 4ZU5A 3S7IA 4CP9A 1QJZA 4W50A 1RHI1 3WZ1A 2V09A 1SLLA 1S0FA 5DZEA 2CGPA 3PUQA 4D3WA 3OD4A 3SQOA 1N47A 2O1QA 2WS93 3V0AA 3SHRA 4CCNA 3AZXA 3IMMA 4XMIA 4JGYB 3OSDA 2JE7A 5J36A 3UGFA 5L36A 1D2QA 3Q8CA 4AI8A 4FTEA 1BEV3 1W6QB 1XU1A 2ET1A 1TME1 1OKQA 2ZEZA 3POSA 4LBLA 1AJOA 2D93A 3D0JA 2VD7A 1PZ8A 3OUHA 1C8NA 2D6OX 4QPIC 2OZJA 4MZUA 4WV8A 1AR62 1H2LA 1ZZ6A 1JYVA 5K4LA 3PU3A 4OUSA 3N9QA 4MHRA 1NLQA 5CVRA 4XCBA 3WF4A 2WNUC 2Z69A 3IPVA 3I3DA 1YIPA 1IHMA 5FPXA 3K4AA 3N9NA 3ON7A 4Y22B 5F3EA 1HRV3 5BUVA 2WWSA 3UL2A 2NP0A 2Y6GA 4K3UA 1SLAA 2AEYA 2ZKNA 1ULGA 4IGOA 2QFEA 3POFA 1MQTB 4B8EA 2XBO2 1AR71 2VOKA 1SBEA 2VZTA 4AEJA 3SKJE 4H55A 5FBZA 3VBFA 3WQ1A 5LRRA 3CBNA 3ES1A 3E6CC 4Z82A 1VBB2 1WCKA 4DB5A 2WZR3 2N7GA 2RS51 1ULOA 4CEYB 1DFQA 1GZWB 3S30A 3U4SA 4IEZA 5LW9A 2UY8A 5F6LB 3BB6A 4NPMA 2VMIA 1HN0A 4ZY9A 3AYEA 2ZXQA 3V0BA 3FHQA 2MEV1 1XOYA 4MO3M 1HKDA 2RS32 2H6CA 3NAPA 1FV2A 2RE9A 1KDKA 2X5IB 3T30A 3ZDVA 5C9AC 4CXYA 2G9FA 1SCSA 3JB4C 4N43A 1U5XA 3ILRA 2WYSA 4QM9A 3T4VA 4D0QA 1LKNA 2WFF2 3VBRB 1T6BX 3Q8BA 1DYPA 2VNOA 4FO9A 3VGIA 4H3WA 4JDNA 1V6JA 4YVWB 1VJ2A 1YQ6A 5LB6A 4G4FA 1RB8G 4M00A 1GKBA 4UW3A 4NAOA 5A7OA 4H7MA 1OFSA 4RGGA 1KGYA 4AHXA 5FP4A 3HN1A 1IS5A 3X29B 3U0ZA 1Z7S3 3ZR5A 2VCAA 2HWE2 2VUDA 2XGXA 4LEJA 1LESA 1OPOA 1OH4A 2X29A 1I3HA 3VHNA 1QJFA 2ARXA 4FPOB 4XHBA 1NCRC 3AMHA 2EIBA 4GA9A 5JXGA 2ZGPA 4GWNA 1MS3A 4KGGA 2XBO3 1QJY3 2JG8B 4BQXA 3LWCA 5A33A 2FDHA 1NZIA 3LKJA 5A6XA 4HK9A 4E9KA 4XFBA 2P4EA 3CLPA 3R0RA 1HQLA 5LA9A 4PI2A 4EQVA 2IFWA 2VUJA 5IVBA 2QDNA 4FPGA 2DYCA 2XL7A 5CNAA 1K12A 3VZKA 4Y1YA 1JZ8A 4D6QA 1ULPA 1LU1A 2ZBJA 4BMEA 1MZ5A 1HIXA 1KRIA 3LPFA 4CP0A 1BBT1 2R1DA 4HETA 4HVQA 1OQEA 3NJYA 4RR3A 1Z0HA 1ZBE2 4JGYC 3ZSLA 2VZ3A 1FX5A 4CCDA 1FNZA 2D3SA 4I01A 2D6MA 4P9IA 4YVWA 5H9PA 2BNOA 5A3PA 2GC0A 4EV0A 5FZ9A 3VDDB 1JMUB 1ZBA1 3NV2A 1ZZBA 3EQEA 4N53A 3RZZA 1OT5A 1REEA 2VOVA 2XKPA 1YQ5A 4IGQA 2VZVA 3SH5A 2E6VA 3UGHA 1WCUA 3WV6A 2VQAA 1C5HA 2WT2A 2D5HA 4P9WA 2ZEYA 3RYKA 5FZLA 3NJVA 1TE1B 5HXVA 4EN9B 1X7NA 2RS52 5IVJA 1W6OB 4CDWA 2W94A 1BVP1 2D6PA 3BOPA 3N7LA 1YLLA 1UYYA 4BQ3A 2RV9A 4DY3A 2CV6A 5I0RA 3CO2A 4DEQA 1PIV1 4NIHA 3TN93 3ZFEA 5DZGA 1JUHA 4GD4A 2JDHA 4EE2A 3HOBA 3WX5A 5B4NA 4MXWA 1UU6A 2GN7A 4LUMA 1A8DA 1WBLA 4FP3A 3NNJA 2PMWB 3BIWE 1VPHA 1GLHA 2ADDA 1LCLA 2B42B 2QBXA 4AVVA 3S5AA 2DUQA 1CZSA 3AFGA 4RQPA 3I2KA 4JVAA 2AGSA 5JIAA 3VBRA 1DGWA 2CL2A 2GNBA 4ISRA 4IUGA 5A6YA 2W1UA 4PLNA 5JUVA 4ZXEA 4BPZA 1RL3A 3ABZA 3HAGA 1RTVA 3CJIC 3EJKA 1UKRA 4PCRA 1GYKA 3JD72 1V70A 3KLSA 4WVZA 1ENSA 1W8WA 2VH9A 1K3IA 3HQUA 4FPLA 5T52A 1PVC2 3TEZA 1CN1A 4AFMA 1D7PM 4OI4A 2E33A 3L9JT 4YZ1A 2GSYA 4FPJA 3UKNA 4AI9A 3IIAA 1BCXA 4AR2A 4B4RA 5A32A 5H9QA 3ZXDA 3I8TA 4KWUA 1MEC2 3ACFA 3EYPA 4FOWA 1E5SA 4GJYA 1UMHA 3T1MA 1MS8A 1UXXX 1W8HA 3I2IA 3DCQA 1PM4A 2PHLA 4NR1A 3PVEA 2XXZA 1J58A 1HRV2 2R0FA 4QDQA 4MXWB 2WT1A 5CFCC 2JWPA 1AR61 1MZEA 2DUPA 5L9BA 3RJRA 4BK4A 4CPBA 5BNNC 2Y6KA 3ILFA 2PTMA 4AGGA 4IEVA 2BTVC 4QMAA 3DGTA 4XFCA 5HI0A 2MEV2 2YU1A 1UD1A 3RRDA 3SC7X 3KT7A 4LMFA 4WM8A 3RVHA 2WNUA 1AL0G 3ACHA 5FYTA 3AC0A 1DZQA 4KH9A 5FLJA 2VUCA 2WO1A 2E26A 2NPIA 1QIQA 1W2TA 2Y60A 2RG4A 1OSGA 4DEVA 4Z92B 4N53B 4AW7A 5JZGB 4OHWA 2HWD3 1X9PA 1WA4A 3VBUB 1POV3 4HSLA 4XQWA 1N3PA 1W9TA 5FZ0A 1WCQA 2YGMA 2WYFA 1E5HA 2K0GA 2WL1A 4F8AA 2BPA2 1PO11 3KWVA 3UV9A 4DO0A 3H8RA 4YSFA 1UZZA 1UY0A 2CDOA 2Y38A 3AP4A 3FWEA 2HEVF 2ZGLA 2RS31 1F15A 1RVF2 3H7YA 3T08A 3MW4A 2ADEA 2O0OA 3P3PA 5IK4A 5FKCA 4LE3A 1RITA 4LKFA 4XTMA 2VOWA 5DZFA 1UU4A 2A3XA 3H7JA 1GICA 4RSUA 5FPZA 2B7YA 3ZKUA 4ATFA 4V1PA 1QDCA 2AUYA 2JKXA 3VDDC 1IQAA 3CF6E 3ZOIA 1GSLA 2YB7A 4I09A 2VOXA 2ZGOA 3N9OA 2JDMA 4Q4V2 2WNUB 2XG3A 3AX4A 1CZTA 3LF7A 3GZEA 5FY1A 3J7LA 4PBPA 1NA1A 3UT0A 1PO23 2XHNA 2WFPA 3KV6A 3RWKX 1TVGA 3MLLA 3HEIA 2WQ8A 1WLDA 2P3JA 4H2AA 4AVTA 1OH3A 3LFIA 5FO7B 4PQ9A 5C8CA 4B29A 2P3IA 3FX3A 1T6GC 2D40A 3B9CA 1VP6A 2GP3A 4GKXA 1QJU1 4IE6A 3WNMA 1OBNA 3N7KA 1O4TA 3PMSA 4XBQA 4LLOA 3U14A 1NCRB 3H3ZA 3N7MA 3CL1A 2HKXA 4IV1B 1LHNA 4JGZB 3ZPYA 1OI6A 1UZ0A 1B35C 1AXKA 1VBE3 2Y26A 4BXFA 1TMF2 1IPKA 2ZAAA 2NN8A 4XF1A 4CYDA 1U5IA 2NMOA 3I3BA 4CDQC 2VQ0A 1SFYA 2JD4A 4OHXA 4RHV2 4XMAA 2DU1A 3DXUA 4QPYA 4CDUA 3WW4A 1R64A 4R9CA 1V9U2 2VW0A 1NLSA 1VBA2 1VBE1 5EPAA 2PHRA 3VLBB 3ZKYA 4E8CA 3O1PA 1LEDA 4GKYA 3MUY1 1H1IA 1D4VB 4BLJA 5IYYA 3BTXA 2J1EA 2ZTNA 2A1XA 4DS0A 1MEC3 1OF3A 2ET7A 5JI9A 4LA3A 2B8MA 2CTVA 1PK6B 3D5OA 4FT8A 5FRAA 3OGVA 3ZSKA 2X5IC 3ZXLA 5C9AB 2EVXA 1JTZX 4BIFA 4OI1A 1Z7S2 4ZZ8A 4QWNA 5IHRA 1AF9A 1COV1 3GNEA 5IWFA 1PMIA 3MV01 4D6RA 1OUSA 3LA2A 3Q8FA 2C5DA 1BLZA 3WG2A 4L11A 5AC92 3O0WA 2RMU3 4QHZA 2PQQA 4ISQA 4QGNA 5J7MA 1UZYA 1E5IA 5CFCB 1ENRA 4JZRA 2GH8A 1RUC1 4CDWC 5C4WB 5FZOB 1LOEA 4BQ2A 4XUNA 3T0AA 1PNFA 3P1IA 3ELNA 4XVHA 3THTA 2WNVA 2YMZA 3BN6A 1N1VA 2QUOA 3VZNA 1QH7A 2WFF3 5C3OA 4AI2A 1O3SA 1FOD1 3OEBA 3AL6A 4AHYA 4BJ0A 3AVRA 3G6JB 5EXOA 2JDNA 4CRQA 4DPNA 3NRUA 1DZRA 3VBHC 3APBA 2Y0OA 4KWKA 3FUQA 1S55A 4Q4Y3 4DUWA 3VDCA 2YU2A 3POJA 1I9RA 1DQ4A 1XPWA 5LATA 3J7NA 3AYAA 4E4DX 1UMIA 1W99A 2HH9A 1DU3D 5KC6A 3DYMA 4YW3A 1ND3A 4BQWA 4NUBA 3O1OA 4BOWA 5FYBA 2WINB 1AX0A 1ONAA 2X5IA 4Q4Y1 3K3OA 3KHBA 4E2GA 1ZRDA 4PF1A 1QJEA 3BGAA 1AL21 2W1SA 2NYYA 2OX0A 3N9PA 2E51A 5FK8A 4CP2A 1CAVB 3NWKA 4O61A 5EYXA 3EO6A 2FCUA 3GZAA 4BQ4A 4G9SB 2ZHNA 3EMRA 3FBYA 3B9IA 4IXLA 4YVSA 1WMXA 4OQ8A 1FATA 4RHV1 2JB4A 1AL23 1UZVA 3RZMA 1RIRA 2P2KA 3C7GA 1ZBA2 1RUNA 4QX5A 3WNNA 3DKQA 4YGBA 3CJXA 3VBRC 2VZRA 2VR4A 4CDUB 3URFA 4N90A 4MGTA 5LEJA 4JKMA 5F5CA 3SITA 1W06A 3VKMA 1CONA 3IZOA 1V6OA 4HANA 4QXBA 1CWPA 4IEXA 4Z2AA 1PZ9A 3QLQA 3LFMA 1D4M1 2WS92 4NOTA 1GBGA 2J22A 4AF9A 5GZGA 2PHUA 2JD9A 3OTFA 1QF3A 5FBJA 1LB2A 4NHLA 1XYPA 3E5UA 1C1LA 1FPN2 1PIV2 1XYOA 3AL5A 1UYPA 1K45A 4M3CA 1OVSA 2YBPA 2YYOA 4QM8A 1LGNA 1X82A 3B93A 3S7EA 3PURA 3AFKA 3HPNA 1IQDC 2VAUA 4P5HA 2ARAA 4TYSA 4IEUA 2WNOA 5FYYA 1ZRFA 5CB7A 3AKPA 5BV6A 1O4ZA 1CZVA 2O8QA 3IN9A 4KMQA 1L3JA 5DUWA 3PJYA 2X53S 4K7JA 1W05A 5I93A 2XJRA 5A3TA 1HB4A 5JOWA 2CHHA 3ZXKA 2P17A 5GLTA 3WSOA 2JB8A 2C4XA 3FN9A 3NMBA 1YFYA 5HV0A 4CE8A 5KC5A 3O0VA 4FTBA 2MEV3 4LIUA 3POYA 1EPZA 2W3JA 3CHXA 1O3TA 1DQ2A 1QJX1 4IV3B 5F1RA 4YNIA 1W6OA 1EV11 2DVGA 3OD0A 5CFDA 5C5UA 1WBFA 2XQRA 2QE3A 1RJ7A 5BPXA 4IESA 4Y20B 1YRZA 4H7LA 2F4LA 3S57A 3AB0A 1SHWB 4UW4A 1EAH1 3WP4A 3MGUA 1NE6A 1LHVA 1GWKA 5C71A 2DFBA 4YG0A 2IZWA 4YFZA 3N3HA 4L97A 2KD7A 4I0AA 3AYCA 2G9ZA 3BI3A 1Q8OA 1GWMA 3HBZA 3O0XA 5FYHA 3S5QA 5FKBA 4W8JA 3RG0A 3ST7A 4COYA 2W46A 4CU9A 4MGZE 3OUIA 1NOVA 2J1VA 3AJYA 1X36A 4QPGB 1H1AA 1W6MB 5C5TA 1OLQA 1XNBA 1RUI2 1HX6A 3IB3A 4FOQA 2OQ7A 3ZMNA 1K5MB 3OGRA 4OZOA 5FZ7A 2VBBA 2K9ZA 3ZFEC 4QD2A 3VD7A 2HBUA 1J59A 3VB9A 3VZJA 3QH6A 2OUHA 3GGLA 3H3UA 2RDSA 3RNSA 5T5JA 2WZR1 5FWJA 4N53C 2FD8A 2JDUA 2JG9A 3R4UA 3FFZA 4J1XA 1NA1C 5AVAA 5EWSA 3ZFFC 1CAWB 2NZ9A 2IUWA 4CA9A 4ZXKA 3I54A 1YEWA 3JBG2 5C3PA 3KCXA 2G4IA 3WXPA 3PUSA 3S6PA 2BGCA 4D6SA 3H42B 2PA7A 3IAQA 5D1IA 5DDJ3 4ES9A 4PBOA 1COV2 1K5MC 2CNAA 3D4KA 3DUIA 4LBQD 4W6WA 3BPZA 2A6XA 3W59A 3I49A 4YPJA 2F4PA 1AR81 1HN1A 3WQBA 4FQ4A 4QX8A 3V0BB 5FMCA 1HXS2 4XHXA 4LKSA 5L7OA 3FC0A 3WW2A 3J26N 1RXGA 2J7MA 2XDVA 4JGZC 4AL9A 1RUG2 2ZGQA 4CEWC 4JGYA 1WCDJ 2TBVA 3B5LB 4N43B 1VBC2 4CDQA 4G3YC 4HSJA 1E57A 3VDAA 3ZXJA 1AHSA 2I74A 1M4WA 3HVDA 5CISA 3D3AA 5FREA 5IVCA 2RDRA 3VHRA 5I0UA 2HWC1 2I45A 2ARBA 4QXKA 4Q4X2 4PIXA 4TSVA 5T50A 1GOHA 2QKDA 4Q0VA 1W2NA 2R16A 5JMOA 5DUXA 3WY6A 4OHYA 2WO2A 3SLIA 1VBA3 3LOBA 2IXIA 3LQCA 3AMQA 4QKDA 3ZXFA 4NJ4A 2FDFA 3T2TA 4QQOA 1AX1A 3PMEA 1EV12 1F8VA 3WG1A 1DGRA 1UIJA 1ASJ1 3J9SA 1FT9A 1G6NA 1PGSA 1DLLA 2BUKA 1J1TA 2G19A 1O3RA 2A73B 1PVXA 2SLIA 3MDPA 4L0PA 4Y3OA 4Q4W3 5AC91 5HXMA 3BU0A 2BBVA 4A6SA 2JIJA 5FPLA 4D69A 2OA2A 3DPRB 5FY9A 1CVNA 2MNGA 4EN7B 5F5IA 4YW1A 1HV0A 3NQHA 4IEWA 5I0SA 1RUC2 5AVPA 3OOXA 4MGQA 3BKZA 1NXD1 2J1RA 3ZDSA 1FOD3 3VKFC 1XNAA 4AGRA 2JJ6A 4OHVA 1Q3EA 5D8AB 5FDBA 1CD3G 2H6BA 1VMJA 3VHPA 1ULCA 2ID4A 5A3MA 4XZPA 2Y64A 2XJTA 4OI0A 3U11A 3KHCA 1JYTA 3EXUA 4AAXA 4XURA 1VMHA 2ORZA 3AMNA 2B4KA 5DUVA 1NQDA 5LK5A 4RGAA 5EJ1B 2HJIA 4DRVA 4WVMA 1ENQA 2YZ4A 4C91A 5BNPB 2WFF1 5FZCA 4UI9L 3Q8EA 2VBPA 5TSWA 5KHKA 5DAQA 4ARYA 5FFOC 4M01A 2J42A 1RUJ3 2ZGTA 2W47A 3W58A 2W87A 3AYDA 4RA0A 2JG9B 4HT1T 5FY8A 1O59A 1W3XA 1NCRA 1KD7A 2VVEA 4LPLA 2VQTA 1WMDA 4Q26A 1SQ4A 1LOAA 3U10A 2DF7A 5CKQA 5FYVA 3PIGA 3THPA 2ZGSA 4S2FA 3PVOA 1VE0A 1ZZ7A 1CPMA 5DAXA 3ZYRA 1BBT3 1VBB1 3EBRA 1RGSA 3B02A 3K4ZA 4D8MA 4JTNA 3RFRA 3LE0A 4YM1A 5HCAA 5T54A 5JLVA 2RDQA 4R9DA 4HG6B 2EXHA 1PM7A 4IEPA 4OUEA 5DABA 1ZBE1 1BQPA 1VLNA 2A5ZA 2C9AA 2W92A 1BMV1 1TNRA 2YY1A 3D6EA 5FPUA 1PO13 4JQRA 1UOBA 1Y43B 1WW5A 1F2NA 5FYSA 4CEWB 3J7HA 4HFSA 4RHV3 4ZU4A 3S0MA 2XWBB 4D7TA 5B4XA 5IUQA 4LORA 3OB8A 2RS33 2WSUA 3BOWA 2YPDA 4GH4C 3WDXA 1OFNA 1KDMA 2NMNA 1UPIA 4LO6B 1C8M1 1QY4A 3PUIA 3H9AA 3ZVXA 1NXMA 3P6BA 1KS5A 3LOIA 4LE4A 3TYJA 4EWAA 5C8WA 2R063 2R071 5C3QA 3VD4A 2E53A 4Q0PA 3O14A 4WM8C 2Y34A 1IS6A 3VUOA 5FZOA 1G7YA 4CDWB 3ECQA 1GWLA 5K0UC 2WNVB 4JHTA 3NW4A 1W0NA 2A71A 3HJRA 2X10A 4R4ZA 4XETA 5E16A 1BBT2 4XILA 1UF2C 3OUJA 1QMJA 3WCRA 3FHIB 2V4AA 2PAKA 4R9BA 3RSJA 4N8MA 2RR12 3FJSA 5LY2A 1MPXA 3WT3A 2W9XA 2Y6LA 2MPFA 4KNCA 3RZLA 5JAXA 3O5SA 4RN5A 3WG3A 1KFUL 1GR3A 2JEMA 5T55A 4I02A 1NCQC 1R092 1BEV1 3WVJA 3POBA 5HCHA 1PO21 2GNMA 5CFDC 2VCMA 3WUCA 4XJAA 2GC3A 1W2OA 3WF1A 5A7PA 4XF4A 1HDKA 4I2OA 2QQPA 3E6DA 3IM0A 4TLGA 5FJKA 5A1AA 1F35A 1JYCA 4NPRA 5SV5A 2DTWA 2D98A 4A7KA 1DCSA 1CAXB 3WOGA 1XC6A 4NIGA 3ACGA 1OMIA 2WRAA 4BE3A 1GZTA 4XFHA 1GMMA 4PLOA 3WP6A 2IXKA 4QB6A 1C5IA 3LA3A 4NIIA 4JDMA 3M3QA 3CZUA 4HLTA 1O3QA 3ZIWA 1SLCA 1W8NA 1H2MA 2EIGA 2E9QA 2XBO1 4I30A 4LBOA 1AR72 1WLWA 4QQLA 5L7OC 3ATGA 1SLBA 3UNPA 1UOGA 2Z42A 1QJU2 3AKSA 4DUXA 3GJBA 1S0EA 2YFZA 3B7MA 3RJ2X 1W2AX 5F2WA 3ZR6A 2HEWF 5T5PA 2D6LX 2CAUA 3LEKA 3OY8A 4ZS3A 5FZBA 2JDZA 3RDIA 2VNVA 2UURA 1MZFA 2TUNA 2QQIA 1VRBA 1QU0A 3RWNA 1SG3A 2QQVA 4KU7A 2LRPA 3OG2A 5EQUA 3ZN4A 5A6QA 5IVEA 4LT5A 2XONA 1IKQA 5H9SA 3VBUC 2IC1A 1VBE2 5LA1A 4Q4W1 2QQWA 3NJZA 1VMFA 4PQQA 4RQPC 4DXZA 1NYWA 4UFLA 4XOGA 4SLIA 4AVSA 4YW6A 4W4ZA 1XRUA 1QDOA 5IFPA 1H8TA 4QPWA 1A78A 4B1MA 2Q8DA 3W20A 4IV1A 5F3CA 2EIDA 1OC1A 3MEPA 3VDBA 3B3QE 3OYWB 2XHKA 1UYZA 4AEDB 1Z7S1 2VTFA 3QACA 1KFXL 1YJLA 4Z1VA 5FQ0A 5FXVA 1UN1A 4QDRA 1CIWA 3SEPA 3WHUA 4META 3WQ0A 1LOGA 2OXBA 4LR4A 3J8F3 5CAZA 2VNRA 4PF5A 3G7DA 4S2DA 2A7AA 1HQWA 1IGOA 4JKKA 4OUMA 2KXLA 1UL9A 2Y0IA 1PNGA 1OVPA 1PIV3 1OLRA 1JU4A 3KV9A 1VALA 3BODA 3DYPA 3N9LA 4IV3C 5F37A 1RUOA 3T0DA 4YZ2A 2AEZA 2D6KA 2FHRA 3DYOA 4YGCA 2KR2A 5DXDA 3THCA 4CEYA 3JZVA 5BNQA 5C9AA 3DPRC 4CDUC 4LLFA 3GXUA 2RM21 1LENA 1IOAA 2RS11 4Q4V1 2YUEA 2BU9A 3VL9A 2AR6A 1QJU3 4M0HA 3HWJA 3C2UA 1JZ4A 4GQ7A 1ZX5A 4AHZA 3B00A 4CP1A 4E4SA 3K3NA 2XJVA 4P9JA 4QQPA 2CGOA 1OD3A 4C0HA 2G9GA 1QQP2 3LSEA 3UYJA 5I91A 3C7EA 4L2NA 2W08A 4AWDA 4P14A 2RMU2 5J3UA 4HPKA 4R9AA 4XJWA 1UWWA 1UY2A 1UYXA 3LEMA 1ND2C 2E31A 3OPZA 1C8M2 1CR7A 2Q8EA 4Z8BA 1H2KA 3DF0A 3U37A 4BDVB 5H9RA 4YVWC 4COWA 3W5MA 1JHNA 2Q1FA 1QH6A 4I3GA 1PO12 2Q0AA 1KITA 2ORXA 1J3PA 2ZMLA 3QD6A 4F3JA 4CUAA 4FPYA 4Y1UA 3KZ4C 4YARA 3P5BA 4Y26A 1OQ1A 5FP8A 1SLIA 2ZEXA 1RUJ1 5FY4A 4OQ9A 5FMOL 4JAAA 5K7PA 4ZKTB 5BNPC 3ORJA 4UFJA 4URTA 4LTAA 1PX3A 2JIGA 3E5QA 3NJXA 5C6CA 3MUZ1 2J1TA 3D0SA 4XF0A 5A70A 3AP7A 2JDKA 2OS2A 5ACA1 1Q8PA 4HBNA 4NIDA 1JH5A 1IPJA 4WM7A 4CCEA 5GZCA 4AFAA 1S0DA 1JOJA 4LK6A 3VZMA 3MHZA 5E1RA 4N7UA 4QXCA 1DZTA 3TEWA 4HPKB 3VBSB 2ZAHA 1N3QA 4IGPA 1LR5A 3M2MA 3T1LA 3WEZA 3WG4A 4QQ2A 3VV1A 5AC93 3OBZA 1ULFA 2H0VA 3D8CA 3R4DB 1O91A 4QB2A 1U5ZA 4Z07A 2LROA 1S0BA 2XUEA 3TBDA 1XNTA 1O8PA 2GU9A 3E97A 4AEDA 1ULDA 2R32A 2ENRA 2QQLA 1RC6A 1ZYBA 3JQXA 4LBQA 1CJPA 4LOSA 4Q5OA 4WZCA 4YW7A 5FXXA 5K9YA 3WR0A 4DY5A 4FFIA 1WWYA 1PGL2 2VMHA 5CG8A 5BNNB 1XNCA 4XCAA 5FYZA 5FY7A 1AUYA 1B35B 3ILNA 4KBBA 5ANNA 3WNOA 3AMPA 1W9FA 3K48A 1GQHA 1VRH3 3LDBA 1OKOA 3PTYA 2V5DA 4Q0QA 1Y9QA 4LO7A 1CGPA 4UW6A 4CP9B 4AXOA 4AVCA 4DINB 1J3RA 4GWJA 4TLFA 4HZFA 4F83A 3SNMA 3F95A 5E6HA 2BV4A 2HWF1 2V72A 5CIRA 4FOYA 2VMDA 2HEYF 3VN4A 4YWAA 4BZ4A 5JCTA 5LA0A 5E88A 1YHFA 1YI9A 4IERA 3FL7A 4HKOA 1V6KA 5A1LA 2ZOEB 5F6KA 2X09A 1H4GA 2BWAA 1PGW1 5C70A 4Q4Y2 3M70A 3QH7A 5J48A 5IJRA 2VO5A 5GLZA 1LHOA 4YM3A 5A3NA 3VD9A 2XUMA 2HWE3 3ZIXA 1R1A3 3N4MA 3PU8A 3GYDA 3KVBA 3DECA 1ENXA 4XZUG 3LEGA 3OPWA 1TNFA 3LZZA 4A4AA 2ZPXA 1WMFA 3C7OA 4HK8A 2AC1A 3E5XA 3K77A 2VG9A 3OGGA 3USUA 5KHIA 3VZLA 5FO9B 3M3EA 5F5QA 4QX2A 4MGYE 4DUVA 2VXJA 2WBKA 4JRAA 3T0BA 5JMCA 1DF0A 1OHFA 1JZ5A 1GP6A 1QXPA 4LNVA 3WDUA 2WIIB 3WP3A 3WDTA 2YC2A 4XFIA 5C7GA 1V9U1 3MO4A 2R6QA 2ZJCA 3INAA 5LBFA 1NY71 2JECA 4ZZ5A 2BVVA 1YJKA 4PDWB 5FWEA 1FOD2 1SBFA 4GWIA 1LHWA 1F5JA 2R072 1US3A 4AHWA 4H14A 2BFUL 4CDXC 1URXA 3ZO0B 5FPAA 2DU0A 1UX6A 4IL7A 1QNWA 3LD8A 4BWOA 3M3IA 1S0IA 1D4M2 2WDBA 2WS91 4IE0A 2X05A 3UJQA 5GLVA 4DXSA 4E2QA 4B7KA 3ZYJB 3LPGA 1ST8A 1AYM2 3C7FA 1XYNA 1YI7A 3LEIA 4YW4A 5ANQA 2WNEA 1S0GA 1ZM1A 3J8F2 1W6MA 4PDWC 1H8TC 1K5MA 3VBOA 3MIDA 3H1YA 2HYKA 2OZ6A 3HQRA 3AP5A 3I2DA 5FUIA 2QQUA 1JI6A 1AVBA 2RMU1 4XJ9A 5LBBA 1OOPC 1RUH1 4BLIA 4XE9A 1QJX3 2DVAA 3MYXA 1F31A 2ZACA 5LA2A 1EV13 1HW5A 2FQPA 2R1BA 3MFCA 2HWD1 1E5RA 2VCBA 3NKTA 5I8SA 5ABJB 1RUC3 5F2SA 5F8PA 5CG9A 1CAWA 4MGIE 4M3CB 2EAKA 2PHWA 5EJZB 4LO5B 2W91A 1RHI2 2D44A 3AMMA 1BMV2 1XBFA 1QWRA 1OURA 5CU1A 3MLJA 3TRSB 3WUDA 2RM22 1G9FA 2RS13 3BIEA 1UY3A 4GB31 3WDWA 3A23A 4FPKA 1L7LA 1STMA 4XUQA 4BB3A 5A33B 4YW5A 4DXRA 3ZFGB 1FPN1 2YV8A 4DMIA 3KMHA 2YGLA 5DDJ1 2CWMA 1OF4A 4BU2A 4BHPA 2ZGMA 2EIEA 2Y33A 4XUOA 3QBQA 1MR5A 2WZ8A 1DDLA 1GV9A 3POGA 1P8JA 4EWDA 1A6CA 2GDFA 2WC2A 4A45A 1FPN3 4YM2A 1YIFA 5FY0A 3ETPA 4S2GA 3MIHA 3HT2A 1BHGA 1V0AA 3LB9A 4C90A 5GZDA 4C1WA 5E89A 1QHDA 5E8AA 5I0TA 5ABJC 2O8OA 2FDGA 4GXLA 5JZGC 5DN2A 2QJVA 3AKTA 1NA1B 3ACLA 4ZHNA 1CESA 3TNQA 4MGKE 4QU1A 3GJAA 1UZWA 4JQTA 4O9EA 1RUE2 3MLKA 3UKVA 1KJLA 1UQXA 1V6MA 2JXAA 2IXJA 2V73A 2JDPA 2VNGA 4KQ7A 2KM2A 4KGQA 1DLCA 3AP6A 2EAAA 4HVOA 4I3PA 4OHZA 3VHOA 1Q43A 2W2IA 3SXWA 1IS3A 3CU7A 4J1WA 1JU3A 1RMU3 1CAXA 4LUKA 1LOCA 4WVWA 4LHSA 1YWKA 1Z78A 1A3KA 5GALA 3VD3A 2JDYA 1HRI1 3AXEA 5FUPA 3RMYA 2WJSA 1HQNA 3JBG3 5KXCA 2CAVA 1W28A 1ZRCA 1CQ9A 1ND2A 1UU5A 4CXWA 4XDOA 5LASA 4CUGA 1JOPA 5F32A 1EUUA 1VRH2 3GM8A 3AZZA 2EICA 3BYWA 3M7AA 3N35A 5L7OB 3BTZA 3T09A 1M06G 1RUF3 5JSRA 1VBD2 1US2A 2Q30A 3ALQA 1W03A 5HCBA 5CEHA 1BYHA 4M4PA 3T2PA 1MACA 3SCHA 4CDQB 1KQRA 3NV3A 4GH4B 5J37A 5FZ6A 2J1SA 2R073 3OY8B 3L2HA 2UYAA 3AJZA 3NSTA 3FUOA 1PGL1 1X8EA 3OPTA 4NO4A 1L7QA 2P6HA 1W9SA 5BNPA 1FI2A 4RFT0 3RPQA 4IE5A 4QPIB 3N36A 1OA3A 2YPJA 4XAEA 1Y7BA 2WO7A 3ZXGA 4AQTA 4A7ZA 4UFHA 1UY1A 4RL7A 4O7XA 5C3SA 1F5FA 2DCTA 2ZX0A 4HKLA 3W9AA 1R1A2 2JG8C 4XF3A 4XFGA 2R042 4EROA 2D6NA 1N1YA 4NHYA 1GNZA 2HWB3 1HB3A 5IVVA 2RDNA 3QCWA 2YXSA 3OBTA 5HBAA 3AP9A 3NNFA 4QXHA 5D21A 5G04L 2R0HA 3ZSJA 1W9WA 4CDXB 4YW2A 1SPPA 5FZ8A 4ASMB 2D7FA 4X8PA 3B01A 2CU5A 3OEAA 3U78A 1GANA 2QQNA 3MFAA 4K21A 1VBB3 5AFEA 3RS6A 1DHKB 1HJGA 2BDRA 5KXEA 5FMOS 3T2OA 3IDCB 4AEDC 1ND3C 1TG7A 4KL1A 5T5OA 4QKNA 4XUTA 2IXLA 2TNFA 3AZVA 3SEEA 3VZOA 5ISLA 1OLMA 4DQAA 4CVUA 4W6XA 4ZS2A 4AVBA 1OA4A 5FZ3A 1OD5A 3DL3A 2B9UA 4PIYA 2VY0A 2YG0A 4C8DA 1ND3B 2RJKA 1HB1A 2K2SA 4HVRA
chains in the Genus database with same CATH topology
3BU0A 3T3YA 3H8XA 3RZGA 4RFRB 2IUWA 4NIGA 2FDIA 3BI3A 4ZS3A 4NRQA 3I3MA 5F8PA 3O1UA 3H8OA 4IE4A 4IE7A 4IE0A 3O1MA 3RZLA 3RZMA 4IE5A 4QKBA 3O1PA 3S5AA 4NIHA 4NIIA 5DABA 4NPMA 2FDGA 3BIEA 3BKZA 4OCTA 3O1VA 4CXXA 3BTXA 4O7XA 4IE6A 4ZHNA 3O1OA 4CXWA 3I49A 3I3QA 4QKDA 3O1SA 3O1TA 4MG2A 4JHTA 4QKNA 4QHOA 4MGTA 2FDFA 4NJ4A 4NIDA 2FDKA 4CXYA 3KHBA 3O1RA 3BUCA 3BTZA 3S57A 3RZHA 4QKFA 4IDZA 4ZS2A 4NPLA 4NRMA 3KHCA 3I2OA 2FDJA 3BTYA 3T4VA 3H8RA 3RZJA 2FDHA 3RZKA 4NRPA 4O61A 2FD8A 3LFMA 4NROA 3T4HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU0 A;  3T3Y A;  3H8X A;  3RZG A;  4RFR B;  2IUW A;  4NIG A;  2FDI A;  3BI3 A;  4ZS3 A;  4NRQ A;  3I3M A;  5F8P A;  3O1U A;  3H8O A;  4IE4 A;  4IE7 A;  4IE0 A;  3O1M A;  3RZL A;  3RZM A;  4IE5 A;  4QKB A;  3O1P A;  3S5A A;  4NIH A;  4NII A;  5DAB A;  4NPM A;  2FDG A;  3BIE A;  3BKZ A;  4OCT A;  3O1V A;  4CXX A;  3BTX A;  4O7X A;  4IE6 A;  4ZHN A;  3O1O A;  4CXW A;  3I49 A;  3I3Q A;  4QKD A;  3O1S A;  3O1T A;  4MG2 A;  4JHT A;  4QKN A;  4QHO A;  4MGT A;  2FDF A;  4NJ4 A;  4NID A;  2FDK A;  4CXY A;  3KHB A;  3O1R A;  3BUC A;  3BTZ A;  3S57 A;  3RZH A;  4QKF A;  4IDZ A;  4ZS2 A;  4NPL A;  4NRM A;  3KHC A;  3I2O A;  2FDJ A;  3BTY A;  3T4V A;  3H8R A;  3RZJ A;  2FDH A;  3RZK A;  4NRP A;  4O61 A;  2FD8 A;  3LFM A;  4NRO A;  3T4H B; 
#chains in the Genus database with same CATH topology
 3L2Y A;  1XSR A;  1MZ6 A;  2BGO A;  5L9V A;  2JX9 A;  3KQR A;  5FLI A;  4J6G A;  1DBN A;  3Q9O A;  4E4Z A;  2Q8C A;  3H8U A;  4XUP A;  1H9W A;  3III A;  3KB5 A;  1FV3 A;  4EZ4 A;  3AVS A;  4YLZ A;  5EIY B;  5J98 B;  1W6Q A;  3KSC A;  1W3V A;  4JV4 A;  2Q8O A;  1HRI 2;  2VM9 A;  2PFW A;  3KGL A;  3JQW A;  1F4H A;  4Y4R A;  2XJS A;  4AYU A;  1V00 A;  1SPP B;  3MIC A;  4IV1 C;  4PT6 A;  2XKO A;  1QOS A;  2PXJ A;  4RQP B;  3RMX A;  2WWU A;  2WLP A;  4Y22 A;  5LWB A;  1SFN A;  1L7R A;  2BGP A;  4FXG B;  4GZ9 A;  1AZD A;  3KVA A;  4XJU A;  4GIQ A;  2GNT A;  4A6O A;  4BH9 A;  4QQH A;  4MV2 A;  3ZN6 B;  3MI8 A;  2VZU A;  1YCI A;  2VZS A;  1RUD 1;  2PLV 2;  2WO3 A;  5C8C C;  1RUG 1;  4NWV A;  5A7W A;  2ZS6 B;  5K0U A;  3USS A;  1LRH A;  3ZM8 A;  2BWC A;  2WWJ A;  3U75 A;  5IAT A;  3WNK A;  3IWZ A;  5A80 A;  3I2G A;  3OGJ A;  4OLL A;  2JIC A;  4JCK A;  4RGK A;  3ZFG C;  4ES8 A;  3LSD A;  5GLU A;  1N1T A;  1POV 0;  2LS6 A;  4XF9 A;  4QGL A;  5HPO A;  3QOP A;  2GZW A;  4WM7 B;  2HYX A;  3NO8 A;  2X8K A;  4MAD A;  3CJI A;  1GZW A;  5GM0 A;  1EYB A;  2XWJ B;  5JSP A;  5JPN B;  1VR3 A;  4RD7 A;  2B46 X;  2ZZJ A;  4X6R B;  3W21 A;  1QKQ A;  4FCA A;  5EFU A;  5KHG A;  3VBS A;  2IXH A;  1GFF 2;  4MOA A;  4I0B A;  1DP0 A;  1ZRI A;  3VKL A;  5IK8 A;  1C4R A;  2AYH A;  2VCC A;  4Y1Z A;  2ZGN A;  1VBC 3;  4B4Q A;  3AZW A;  1H30 A;  5BY5 A;  4KG8 A;  1UAI A;  1CJD A;  1O7F A;  1YQ8 A;  2A6Y A;  4QKB A;  1G8W A;  2VL4 A;  2E7A A;  4COU A;  4XIK A;  4A42 A;  4FSJ A;  1TME 3;  4URA A;  4S2H A;  4K1Y A;  4UAP A;  4CEW A;  1IKP A;  2BOJ A;  4MUV A;  3ZSM A;  5JOX A;  2WN3 A;  3PNA A;  3I59 A;  4R4X A;  5BNN A;  4LA2 A;  2UWC A;  4UOJ A;  4L99 A;  4KG0 A;  2GAL A;  4IDZ A;  4P5Y A;  5KHH A;  1RUH 2;  4CU8 A;  1IG3 A;  2VTX A;  5CZK A;  2YFU A;  1ODN A;  3CKH A;  2IVJ A;  2VZQ A;  1NCQ B;  2ZX1 A;  3FHA A;  4XXA A;  3ZFF B;  4AE2 A;  3FFQ A;  5F5A A;  3ZYH A;  3OBA A;  2QNK A;  2YHJ A;  3IDA A;  4K9S A;  2DCK A;  4MH0 E;  1LNS A;  1UKG A;  4FPE A;  5CYY A;  4EN8 B;  5D8A C;  2WAA A;  4M3C F;  1W39 A;  5JVV A;  2DVB A;  1BK1 A;  2V5Y A;  3CIH A;  3WNP A;  2C24 A;  2W1W A;  3GCX A;  4YG3 A;  1SDW A;  2FMY A;  3K75 B;  4UWD A;  2VTX J;  4X6Q B;  4AG4 A;  3CNA A;  4PJY A;  1DQ5 A;  1KXG A;  2VUL A;  5FOB B;  4FPH A;  2ES3 A;  4IEO A;  5DG1 A;  1FMD 1;  3C7H A;  4PI0 A;  5IAV A;  3I2O A;  2OKX A;  2QZ3 A;  1PVC 1;  1TZO A;  2D3P A;  3NKG A;  4Y1X A;  4P9G A;  2DVD A;  2E7Q A;  2E32 A;  2F17 A;  4LHL A;  1RIN A;  3C8X A;  3VBF C;  2BJS A;  4RR3 B;  3PHM A;  2DCZ A;  4MLO A;  2ZHL A;  2A75 A;  4LHK A;  2ERF A;  2WSV A;  5JOZ A;  4NN0 A;  4LK7 A;  4O9G A;  5FPB A;  3HR9 A;  4XYX A;  5KXB A;  4UF0 B;  1RVF 3;  4MSV A;  4CXX A;  1W04 A;  4WVV A;  2ARC A;  5FP3 A;  4FAH A;  5A6Z A;  1K5J A;  2W5F A;  1NCQ A;  2XML A;  3HT1 A;  3ZN6 A;  5BYN A;  2RJL A;  3HNM A;  4YGD A;  1WW7 A;  2FBE A;  3K2O A;  5C8C B;  5FYI A;  1ZZC A;  1GQP A;  1RUI 3;  5GLW A;  1ZVF A;  4CU7 A;  1XE0 A;  1GOF A;  1YFW A;  4NRM A;  5FJH A;  4OUL A;  3ZYG A;  3ZX7 A;  5B2G B;  5IT6 A;  4GB3 2;  1Y9M A;  4XBL A;  3I4I A;  4AVA A;  4MX3 A;  1WME A;  3GF6 A;  4QAW A;  5DDJ 2;  2RM2 3;  3GBG A;  5IK7 A;  2YC4 A;  5ERL A;  4Q4W 2;  1S2B A;  4XFF A;  1X50 A;  5EV7 A;  1WGP A;  2GN3 A;  3PLQ A;  5L19 A;  1W8F A;  2XVL A;  4GMP 0;  1RMU 1;  1HXS 3;  4UT5 A;  1YUD A;  3I2F A;  4XDQ A;  5JXH A;  1RJ8 A;  1RUF 1;  2GMP A;  2W95 A;  3IKW A;  4OYU A;  4JHZ A;  4K8R B;  4MYE A;  5D2A A;  1H8T B;  1XE8 A;  5BNO C;  1UCX A;  2QQK A;  2A3Y A;  1ZZ8 A;  1VAK A;  2UYB A;  1S2E A;  3JU9 A;  2DUR A;  3OBR A;  1I5Z A;  1SDD B;  5EZW A;  1VBA 1;  4NRO A;  1GP5 A;  4DOU A;  2WAB A;  4SBV A;  4UF0 A;  5A1F A;  1RUE 1;  1JYN A;  3BAL A;  1JZ6 A;  3KT4 A;  2VMF A;  3O1M A;  1YFX A;  3WDY A;  3CMG A;  2DV9 A;  1I6X A;  1RYY A;  1VB4 A;  1B09 A;  3M3C A;  4YFW A;  1X8M A;  5ACA 3;  1X9T A;  1Y9G A;  4QHB A;  5JOY A;  1DYK A;  2GH2 A;  4Y5Z 0;  1D2S A;  1O8S A;  2OII A;  1R1A 1;  1LTE A;  4ASK A;  2Z5W A;  3DPR A;  4O65 A;  3WF3 A;  1TME 2;  2ATF A;  2FZ1 A;  2K46 A;  4NPL A;  1CIY A;  3GHM A;  4HMZ A;  3AKQ A;  4Y33 A;  4B3N A;  4DFS A;  1HJF A;  2A70 A;  1W90 A;  2Q4S A;  1DG6 A;  4ET7 A;  5FQ0 B;  4BM8 A;  3LIG A;  3H0O A;  1UX7 A;  5LY1 A;  1AR9 1;  1AX2 A;  3KV5 A;  2IXC A;  4TWT A;  3EB7 A;  5DAP A;  4L92 A;  3O7O A;  1H0B A;  2GND A;  2ARE A;  2PAE A;  1JHJ A;  3ROU A;  4AFC A;  2VZP A;  4NIA A;  4KWL A;  4CCJ A;  2XJQ A;  1LJ7 A;  2HWF 2;  3LDR A;  4DIQ A;  4E27 A;  4U36 A;  1AL2 2;  3JD7 3;  4GWM A;  2GMM A;  3RYR A;  4D7S A;  3WHT A;  4N43 C;  5A7S A;  1AR8 2;  4CCL A;  1QXJ A;  1VB2 A;  3N7J A;  5FP7 A;  4BK5 A;  3U4X A;  3PUH A;  2LAL A;  2XB6 C;  4GAZ A;  3WD5 A;  3WF0 A;  3BTY A;  1HB2 A;  1LGB A;  1O5U A;  4FOV A;  2UWA A;  4KBZ A;  1R1Z A;  1SBD A;  5F7U A;  1ZRR A;  4NRP A;  5JR2 A;  3WF2 A;  1R08 2;  2BNM A;  4Q1P A;  5A3U A;  1LOF A;  1WW6 A;  4BQY A;  4GUL A;  5IK5 A;  4AAP A;  2WUH A;  3H1M A;  5LZ6 A;  3B69 A;  3VKN A;  3I7D A;  1YO8 A;  2WLQ A;  5FZ1 A;  4RS5 A;  1AR7 3;  5FYC A;  2CWS A;  1W6N B;  4WBB A;  1YNA A;  4LIT A;  4TN7 A;  2Q5T A;  3OCP A;  1O4Y A;  4ATE A;  1A34 A;  4Y1V A;  1Q8Q A;  4YVS B;  2VZ1 A;  4P9X A;  4N9I A;  2R06 1;  1CX1 A;  3HMY A;  1QJX 2;  2YDE A;  1RXF A;  4Q8L A;  4PHZ A;  2XJP A;  3RGB A;  3BUC A;  1C1F A;  2BZD A;  2RR1 3;  3DV8 A;  4IND A;  1UOJ A;  4CCK A;  3BPS A;  2LM3 A;  4B1L A;  4P9Y A;  5A7N A;  4GH4 A;  4QPG A;  2AEN A;  4TTG A;  1ODM A;  1Q8S A;  1Q8V A;  3I2J A;  4EZH A;  2HWB 1;  2ILM A;  4FFH A;  2EF6 A;  3CDZ B;  4IEY A;  5FYU A;  3HIF A;  1GUI A;  1UNB A;  1FMD 2;  1JOD A;  4LHN A;  1UOF A;  1IPS A;  3KCC A;  4LOT A;  4QPI A;  4ARX A;  2AH2 A;  3MZH A;  2B39 A;  3P3N A;  1AYN 3;  2WA4 A;  4A41 A;  3V64 A;  4JDO A;  1W8T A;  3LGR A;  3RQ0 A;  5LCW L;  1OPM A;  2PYT A;  3BVC A;  4QGM A;  2RVA A;  3GCW A;  3PL0 A;  3RYP A;  2BEO A;  3WW3 A;  4ASL A;  1Q56 A;  5FZI A;  2BNN A;  1QOO A;  1QXR A;  4WM7 C;  1EUT A;  1X33 A;  3MIG A;  4P9L A;  2J1U A;  4PDW A;  1V9U 3;  3IT8 A;  3ZMO A;  4WM8 B;  4JTO A;  1PMJ X;  1C3H A;  5DAV A;  5CA6 A;  4YZ4 A;  2VXR A;  3ZSE A;  4AFD A;  4AEK A;  1VBD 3;  3U1X A;  3UGG A;  3IPV B;  4CTE A;  3I3M A;  2HBT A;  1JBC A;  3HNB M;  1PGW 2;  1WD3 A;  4LKD A;  4YYO A;  1YXW A;  5C3R A;  3WLU A;  2Z2S B;  1LGC A;  3VBH B;  4L9B A;  4XPV A;  2A6Z A;  1WA6 X;  2R30 A;  1U0A A;  3KF3 A;  2E63 A;  3WNX A;  1JYX A;  2JDA A;  1UPS A;  5JPM B;  1RUH 3;  2QTW B;  4HN0 A;  1DQ1 A;  1B35 A;  4FQZ A;  4BXS V;  1ALY A;  3RI8 A;  3R05 A;  3HN3 A;  2VQU A;  1GZ9 A;  1G9A A;  2IWG B;  2PHD A;  2I07 B;  5EP9 A;  1FNY A;  1U12 A;  2P3K A;  4DXT A;  4QU2 A;  2VME A;  3ZYF A;  5AFB A;  2ZAB A;  4D94 A;  5CBL A;  3R4S A;  5G05 L;  2OW4 A;  3A0N A;  5DMY A;  3MPB A;  3PJQ A;  4RFR B;  2GP5 A;  3MW3 A;  1XJA A;  1H6X A;  4K6B A;  4XTP A;  1BVV A;  5FY5 A;  5GZF A;  4NRQ A;  1PK6 A;  2EAL A;  3O1U A;  1RUI 1;  5GJ6 A;  3FBM A;  2QQO A;  1R08 1;  3BCW A;  5SV8 A;  2D97 A;  2XR4 A;  3POW A;  2IVI B;  2QQM A;  2Y6F A;  4QX0 A;  5APA A;  5FZD A;  2PN5 A;  3FMG A;  1T2X A;  4HON A;  3SH3 A;  2QQJ A;  1SAC A;  5KHJ A;  3O1V A;  1I5P A;  2P37 A;  1XB9 A;  2HWC 2;  3NAP B;  1W0O A;  1H8V A;  2A6V A;  3LIH A;  4MGS A;  2XJU A;  5L73 A;  5I8T A;  4K8F A;  1APN A;  2NQY A;  4YGE A;  2IFR A;  4D7Y A;  1R08 3;  2HWC 3;  3WIN E;  2PAM A;  1W9Y A;  2EXK A;  2A3W A;  3NV1 A;  5DG2 A;  3VDD A;  4A7Y A;  3ITQ A;  3GHN A;  2MHF A;  5C4W A;  1LHU A;  3USU B;  1RUF 2;  4QX7 A;  1GP4 A;  4Y5T A;  4EWE A;  2VMC A;  5I0D A;  2DBI A;  3W5N A;  1CAU A;  1FAY A;  1LUL A;  5BNO B;  1S0C A;  2WN2 A;  3UET A;  3I2H A;  5FUN A;  2XVG A;  1ZRE A;  4P08 A;  1PZ7 A;  2HLE A;  1WW4 A;  2O14 A;  2R04 3;  4MVT A;  4Q4V 3;  2C1F A;  3H50 A;  1I1E A;  3H3L A;  4K1Z A;  5JXI A;  2VJX A;  4AK3 A;  4F7Z A;  1QJY 1;  2RHP A;  2L9L A;  2BQP A;  2VZO A;  1HRV 1;  3GBF A;  4JKL A;  4CU6 A;  2LTN A;  4YZ5 A;  4IQP A;  5K8S A;  1W8U A;  4GMP 3;  1A8M A;  1WUV A;  2JG8 A;  2P6C A;  4QKF A;  4CPB D;  2XQX A;  2FCT A;  4ONU A;  3KCY A;  3ZFE B;  1GQG A;  3V65 A;  1F9K A;  2LW8 A;  2UU8 A;  1ACC A;  3M3O A;  1MEC 1;  5JWP A;  3N9M A;  4HL0 A;  4B4P A;  4DZG A;  3O12 A;  4XAA A;  3HD8 B;  4UW5 A;  1YC6 1;  4AQ2 A;  1H1M A;  2EXJ A;  1D0H A;  3LA7 A;  4JC1 A;  5ABJ A;  2QCS B;  4OI2 A;  5JIU A;  1KJR A;  3AK0 A;  4BMB A;  2HWD 2;  1DGR N;  3JB8 A;  4K20 A;  5BXX A;  3OYW A;  4TZD A;  4YRD A;  4A3Z A;  4BQ1 A;  3ZPO A;  2VW2 A;  2BYV E;  2WQZ C;  4M4R A;  3ZN5 A;  2ZZQ A;  1CAV A;  2AAC A;  2YBS A;  4CCC A;  2VW1 A;  3A4U A;  3JCI A;  4XAC A;  2PQS A;  3VBO B;  2R7E B;  2DCY A;  2ZMK A;  5FZG A;  2Y6H A;  3A0K A;  4LBN A;  3KQ4 B;  3UKT A;  3GZU C;  3ZYP A;  5IFT A;  1G9D A;  5CAD A;  1CAU B;  2PHT A;  4M3C E;  1MQT C;  3J8F 1;  5BNO A;  5LRS A;  3RZJ A;  3ES4 A;  1JOB A;  2ZGR A;  2RJ2 A;  1HXS 1;  3ME2 A;  1YYN A;  1OUX A;  1D0G A;  5C4W C;  5FO8 B;  2XPJ A;  4UBG A;  2P1B A;  2B45 X;  4HN1 A;  4UBH A;  4EJR A;  2FDI A;  1ZA7 A;  2VVD A;  1MVQ A;  2WT0 A;  4LIV A;  1PVC 3;  1QNY A;  4NMI A;  4ITC A;  3A7Q A;  4PIZ A;  5F3G A;  5FLH A;  2CYF A;  3WNL A;  1TMF 1;  2ZX4 A;  5JR7 B;  1AYM 1;  1W6P A;  1TEI A;  3ASI A;  1AR6 3;  4EN6 B;  2DUO A;  3FLP A;  4IW3 A;  3ZFG A;  4BIS A;  4LO8 A;  1EP0 A;  4EN0 A;  3TWI A;  5ACA 2;  2HWB 2;  1POQ A;  4UFM A;  5DQ0 A;  1LEM A;  5K0U B;  4FFF A;  3MF6 A;  5F39 A;  1REF A;  2OUJ A;  3J7M A;  3M8L A;  1V6L A;  4HOO A;  1AR9 3;  4P00 B;  3VBO C;  2WNV C;  1G9C A;  4XFA A;  3UJO A;  1Q5O A;  3VBS C;  4GJZ A;  4AQ6 A;  1OOP A;  1V6N A;  3T3Y A;  4B7E A;  5CKM A;  4C1X A;  1NUK A;  2WZE A;  2Q1M A;  1AR9 2;  1OLM E;  3A22 A;  2KA3 A;  1UW8 A;  1JS9 A;  2ZX3 A;  3KM5 A;  4NHK A;  3GZT B;  3BU7 A;  3IMN A;  4IE4 A;  4LJH A;  1O5L A;  1R09 1;  1W2U A;  1PO2 2;  4YG6 A;  3HBK A;  3CZJ A;  2VVF A;  3MF9 A;  2H0B A;  5JI7 A;  3ZYI B;  5JDB A;  1VRH 1;  1C57 A;  5FZE A;  1VIW B;  2A6W A;  5JZG A;  4WVM B;  2W39 A;  2ZGU A;  1JW6 A;  2VC9 A;  3WCS A;  5FXW A;  1RUD 3;  2V4V A;  2C9K A;  1W8Z A;  2HWF 3;  3RI9 A;  4LKE A;  1VBC 1;  3GDB A;  2D3R A;  3GBW A;  2ZCW A;  1G9B A;  1GNY A;  1BKZ A;  3F2Z A;  5LK7 B;  4XQD A;  5CKN A;  2DCJ A;  5A32 B;  1JZ3 A;  5F9T A;  2E7T A;  3C3V A;  3K4D A;  2C6S A;  3WP5 A;  3OF1 A;  1NT0 A;  4KU8 A;  4NVP A;  1J83 A;  4XEZ A;  1CX4 A;  4AOC A;  2FDK A;  5FAX A;  4HKW A;  1VAM A;  4A44 A;  2DBN A;  1V6I A;  2QDR A;  1ND2 B;  2PHX A;  1J3Q A;  2DFC A;  2ZEW A;  4AQS A;  4COZ A;  4NE9 A;  3NNM A;  2Y8K A;  2LUW A;  3MBW A;  2J1A A;  1OOP B;  2NLR A;  2XOM A;  5FMB A;  2WZP P;  3NVC A;  2Y6J A;  3H1W A;  1DIW A;  1S1A A;  1Y4W A;  2JEN A;  2G1M A;  2DWR A;  4FFG A;  2FDJ A;  2BVB A;  5HV4 A;  4I0W B;  3DXT A;  1DGL A;  1RHI 3;  3IDE A;  2ZA9 A;  1MS0 A;  4RYD A;  3TN9 1;  3UK9 A;  5JSO A;  3PTR B;  1YQ2 A;  4GB3 3;  3R6S A;  3U07 A;  5A3W A;  4FAG A;  2R49 A;  3GAL A;  4NHX A;  2VBD A;  1WZX A;  4V2W A;  5T5L A;  4Q0S A;  4P02 B;  4FVV A;  1AXY A;  1XU2 A;  4FI9 A;  2W68 A;  4NWW A;  3VBU A;  4CCM A;  1O6U A;  4XBN A;  4BYY A;  2F6B A;  2XLG A;  3KV4 A;  1MS5 A;  1IZ3 A;  2GME A;  4N9H A;  4E4H A;  5FR3 A;  4RR3 C;  2W52 A;  1VBD 1;  3ACI A;  1W6P B;  4IEQ A;  1NG0 A;  2JG9 C;  4TXW A;  1AYN 1;  1S4C A;  4CDX A;  1EPW A;  3M4F A;  4A2U A;  4AI1 A;  5FK7 A;  1IG0 A;  2DDU A;  4XQ4 A;  1G86 A;  3PVB B;  1NLR A;  2R06 2;  3TNP B;  2BER A;  2ETE A;  1RUJ 2;  4FP2 A;  5LBC A;  3H8O A;  1SMV A;  2BBA A;  2UWB A;  3THD A;  3POI A;  4UYB A;  1JYI A;  5DAW A;  4Y24 A;  4ZPI A;  3MIF A;  3NAP C;  4Q29 A;  5CFC A;  2SBA A;  4KI5 M;  2ZKL A;  4CSW A;  4HXC A;  1NKG A;  3O1S A;  3IDB B;  2FMD A;  4OMD A;  5F3I A;  2RS5 3;  4CEY C;  1MS9 A;  2P3Y A;  4QB1 A;  1LAJ A;  5GKA C;  1NZC A;  3I59 B;  4U2A A;  3MV1 1;  3PUA A;  4FPF A;  5FZ4 A;  4OVE A;  1RVF 1;  2WZR 2;  3KD4 A;  2PLV 3;  5GZE A;  3OJB A;  3T4H B;  2WA3 A;  1FXZ A;  2W0X A;  3ZFF A;  1SEF A;  5FTT C;  3ZXA C;  1QJY 2;  4E8D A;  2BFU S;  3ZYB A;  4QX1 A;  3OGS A;  5IW0 A;  4LO4 B;  4FBF A;  3DKW A;  2WKK A;  4RS5 B;  5FV3 A;  4KWJ A;  1W6N A;  1CPN A;  3KT1 A;  4M0N A;  4Q27 A;  1RUD 2;  2PLV 1;  4BQ5 A;  5IVF A;  4FTS A;  3TB0 A;  2B9V A;  1FMD 3;  2I2S A;  2YC0 A;  1RUG 3;  5HCF A;  4BCU A;  1YQC A;  1ZBA 3;  3IBM A;  1PX4 A;  2D5F A;  1N1S A;  4V2V A;  1BEV 2;  2OVU A;  3O1R A;  4DRR A;  5FIX A;  4BIO A;  1JN2 P;  4Q8K A;  5KR7 A;  5FZF A;  2VMG A;  2ZHM A;  1BXH A;  1POV 1;  1HV1 A;  3MIB A;  5FP9 A;  1GZC A;  1S0J A;  2PEL A;  3RZK A;  3LCP A;  1ZA4 A;  3WQ7 A;  1UXZ A;  4Y4Y A;  4LBM A;  1JZ2 A;  1ZZ9 A;  2TEP A;  3B94 A;  2XVK A;  2VPV A;  5DUU A;  2R04 1;  2BOI A;  4UXA A;  5D8A A;  4RS5 C;  5A7W B;  2VUA A;  1LU2 A;  3J4U H;  2GC2 A;  4MXV A;  1W0P A;  3PDQ A;  3D82 A;  1MS1 A;  1UY4 A;  5FMD A;  3JUU A;  1PK6 C;  1H6Y A;  1SZB A;  1JXN A;  4Q2F A;  1SCR A;  4OFG A;  1UIK A;  2CGN A;  2XLF A;  4MHU A;  4K40 A;  1J84 A;  5IVY A;  4AI0 A;  4ZON A;  5KWR A;  3O1T A;  1WD4 A;  4QHO A;  2ZX2 A;  3CJI B;  2WR9 A;  4XW3 A;  3SCG A;  1XXN A;  1KS4 A;  1NX9 A;  4LUL A;  1XND A;  4LBJ A;  3RZH A;  1HRI 3;  3I3E A;  1WKY A;  3KF5 A;  1QOT A;  1DGW X;  2VGD A;  2GAU A;  1OXC A;  4LXL A;  1J1L A;  4QX3 A;  2QZ2 A;  5T3N A;  3H8X A;  4L8Q A;  1COV 3;  3VD5 A;  4BA6 A;  4GMP 1;  4AZZ A;  1SFP A;  4IE7 A;  3KS7 A;  1AYN 2;  1TQ5 A;  2ZGK A;  3WW1 A;  1WCS A;  4UFK A;  4GAL A;  3VBH A;  1Y3T A;  4CUB A;  4YVS C;  4DNY A;  4PLM A;  4NHM A;  4OCT A;  1PMH X;  3KGZ A;  1C28 A;  5L9R A;  3LDK A;  3SH4 A;  3K46 A;  5FXZ A;  4CCO A;  4FPC A;  3M1H A;  3JBG 1;  1BK0 A;  1DQ0 A;  1ULE A;  3SIS A;  5LEK A;  1U5Y A;  2CSG A;  3FLR A;  2JKB A;  3AKR A;  4R8H A;  2OT7 A;  1LOD A;  4FXK B;  4XC9 A;  1AR8 3;  3E6B A;  5JXJ A;  4QPG C;  3BTA A;  1MS4 A;  3TEY A;  1TMF 3;  3JXS A;  3LAG A;  2OQ6 A;  1NAE A;  5LBE A;  4LBQ B;  4JRL A;  4X8N A;  2UY9 A;  3FZ3 A;  3NL1 A;  3CQO A;  3Q8A A;  1XSQ A;  3V0A B;  4QT6 A;  2OYZ A;  1LOF C;  4Q0U A;  3UES A;  5KBF A;  1EY2 A;  1RUE 3;  2YRO A;  4XIO A;  1XQN A;  3AM2 A;  2CDP A;  3FLT A;  1D4M 3;  1DYO A;  4YZ3 A;  4A3X A;  4XAB A;  2C26 A;  3AZY A;  5FZH A;  1EAH 2;  4IV3 A;  4W65 A;  1H4H A;  5DPN A;  1W8O A;  1XE7 A;  1LEC A;  4IET A;  4MG2 A;  5J1X A;  3HNY M;  3PIJ A;  5J09 A;  2CY6 A;  2DVF A;  1JUI A;  2VU9 A;  4AFB A;  4Y20 A;  3E1F 1;  4R52 A;  3VL8 A;  4E2S A;  1NQJ A;  4LQR A;  2OPW A;  3TOJ A;  5KXD A;  3TAY A;  1F4A A;  1SLT A;  4JX0 A;  1AJK A;  1ZNP A;  3ZLI A;  5FPV A;  1QQP 3;  2PHF A;  2P34 A;  3NV4 A;  3RZG A;  1MQT A;  3T2Q A;  4QDS A;  1XNK A;  4XJZ A;  1ASJ 3;  2NM1 A;  3DEM A;  1H2N A;  2RS1 2;  2VEC A;  3DN7 A;  1BZW A;  4YM0 A;  5A3O A;  2YBK A;  1RMU 2;  4XDP A;  4COV A;  1N3O A;  2Z79 A;  2D43 A;  3MW2 A;  3AXD A;  2JE9 A;  3K51 A;  4W6Y A;  3VBF B;  3CEW A;  2BP6 A;  4CUC A;  1KEX A;  4C0B A;  4EYU A;  3A21 A;  3I97 A;  1QQP 1;  1JYW A;  2XH6 A;  5CFD B;  3IAP A;  3I3Q A;  5EYY A;  5A3L A;  4OZX A;  1LOB A;  5C33 A;  4Z2W A;  4Y5S A;  1R09 3;  5M0T A;  3TEX A;  4AI3 A;  2AZ5 A;  2FCV A;  3JD7 1;  1C8M 3;  1GNH A;  3SMH A;  3ENR A;  3V56 A;  1HLC A;  2FZ2 A;  3ZXE A;  1ZBE 3;  1IS4 A;  1H9P A;  1UO9 A;  2ZMN A;  4NAM A;  2EA7 A;  3NNG A;  4XXP A;  2Z4F A;  2EXI A;  4XJ8 A;  5FZA A;  5IAX A;  1JZ7 A;  1WLT A;  3HQX A;  2P5B A;  2C0Z A;  4J25 A;  1PHM A;  2VE1 A;  1EAH 3;  1QEX A;  5FOJ B;  3ETQ A;  3POE A;  3FE5 A;  5FZK A;  3WDV A;  4CZS A;  1UMZ A;  2JE8 A;  2WAO A;  2XL9 A;  3EHK A;  3SCF A;  4Q4X 3;  5I8Y A;  2OPK A;  1RED A;  4LBK A;  4AEM A;  2DTY A;  5EJ3 A;  1S2K A;  2WQ4 A;  1AYM 3;  5A7Q A;  4UFI A;  5J96 B;  1DQ6 A;  2VOT A;  4JGZ A;  1MVE A;  3PVN A;  4WZF A;  4OMC A;  1K42 A;  4Q1R A;  1NE4 A;  1ASJ 2;  1OQD A;  2BRT A;  4ZU7 A;  5FCC A;  3NNL A;  1OA2 A;  3MIE A;  3VKO A;  2QVS B;  4Q4X 1;  5EHD A;  1NY7 2;  1QGL A;  1YFU A;  2RR1 1;  3TN9 2;  1BJQ A;  5FZM A;  5FYM A;  1VAV A;  2W1Q A;  2GC1 A;  4AGV A;  1GOG A;  1GU3 A;  2XLA A;  2ZHK A;  3MPP G;  1AXZ A;  2HWE 1;  3SKV A;  2BW8 A;  2B5H A;  4ORF A;  1FYU A;  4N7I A;  1WLC A;  2Q1Z B;  4ZU5 A;  3S7I A;  4CP9 A;  1QJZ A;  4W50 A;  1RHI 1;  3WZ1 A;  2V09 A;  1SLL A;  1S0F A;  5DZE A;  2CGP A;  3PUQ A;  4D3W A;  3OD4 A;  3SQO A;  1N47 A;  2O1Q A;  2WS9 3;  3V0A A;  3SHR A;  4CCN A;  3AZX A;  3IMM A;  4XMI A;  4JGY B;  3OSD A;  2JE7 A;  5J36 A;  3UGF A;  5L36 A;  1D2Q A;  3Q8C A;  4AI8 A;  4FTE A;  1BEV 3;  1W6Q B;  1XU1 A;  2ET1 A;  1TME 1;  1OKQ A;  2ZEZ A;  3POS A;  4LBL A;  1AJO A;  2D93 A;  3D0J A;  2VD7 A;  1PZ8 A;  3OUH A;  1C8N A;  2D6O X;  4QPI C;  2OZJ A;  4MZU A;  4WV8 A;  1AR6 2;  1H2L A;  1ZZ6 A;  1JYV A;  5K4L A;  3PU3 A;  4OUS A;  3N9Q A;  4MHR A;  1NLQ A;  5CVR A;  4XCB A;  3WF4 A;  2WNU C;  2Z69 A;  3IPV A;  3I3D A;  1YIP A;  1IHM A;  5FPX A;  3K4A A;  3N9N A;  3ON7 A;  4Y22 B;  5F3E A;  1HRV 3;  5BUV A;  2WWS A;  3UL2 A;  2NP0 A;  2Y6G A;  4K3U A;  1SLA A;  2AEY A;  2ZKN A;  1ULG A;  4IGO A;  2QFE A;  3POF A;  1MQT B;  4B8E A;  2XBO 2;  1AR7 1;  2VOK A;  1SBE A;  2VZT A;  4AEJ A;  3SKJ E;  4H55 A;  5FBZ A;  3VBF A;  3WQ1 A;  5LRR A;  3CBN A;  3ES1 A;  3E6C C;  4Z82 A;  1VBB 2;  1WCK A;  4DB5 A;  2WZR 3;  2N7G A;  2RS5 1;  1ULO A;  4CEY B;  1DFQ A;  1GZW B;  3S30 A;  3U4S A;  4IEZ A;  5LW9 A;  2UY8 A;  5F6L B;  3BB6 A;  4NPM A;  2VMI A;  1HN0 A;  4ZY9 A;  3AYE A;  2ZXQ A;  3V0B A;  3FHQ A;  2MEV 1;  1XOY A;  4MO3 M;  1HKD A;  2RS3 2;  2H6C A;  3NAP A;  1FV2 A;  2RE9 A;  1KDK A;  2X5I B;  3T30 A;  3ZDV A;  5C9A C;  4CXY A;  2G9F A;  1SCS A;  3JB4 C;  4N43 A;  1U5X A;  3ILR A;  2WYS A;  4QM9 A;  3T4V A;  4D0Q A;  1LKN A;  2WFF 2;  3VBR B;  1T6B X;  3Q8B A;  1DYP A;  2VNO A;  4FO9 A;  3VGI A;  4H3W A;  4JDN A;  1V6J A;  4YVW B;  1VJ2 A;  1YQ6 A;  5LB6 A;  4G4F A;  1RB8 G;  4M00 A;  1GKB A;  4UW3 A;  4NAO A;  5A7O A;  4H7M A;  1OFS A;  4RGG A;  1KGY A;  4AHX A;  5FP4 A;  3HN1 A;  1IS5 A;  3X29 B;  3U0Z A;  1Z7S 3;  3ZR5 A;  2VCA A;  2HWE 2;  2VUD A;  2XGX A;  4LEJ A;  1LES A;  1OPO A;  1OH4 A;  2X29 A;  1I3H A;  3VHN A;  1QJF A;  2ARX A;  4FPO B;  4XHB A;  1NCR C;  3AMH A;  2EIB A;  4GA9 A;  5JXG A;  2ZGP A;  4GWN A;  1MS3 A;  4KGG A;  2XBO 3;  1QJY 3;  2JG8 B;  4BQX A;  3LWC A;  5A33 A;  2FDH A;  1NZI A;  3LKJ A;  5A6X A;  4HK9 A;  4E9K A;  4XFB A;  2P4E A;  3CLP A;  3R0R A;  1HQL A;  5LA9 A;  4PI2 A;  4EQV A;  2IFW A;  2VUJ A;  5IVB A;  2QDN A;  4FPG A;  2DYC A;  2XL7 A;  5CNA A;  1K12 A;  3VZK A;  4Y1Y A;  1JZ8 A;  4D6Q A;  1ULP A;  1LU1 A;  2ZBJ A;  4BME A;  1MZ5 A;  1HIX A;  1KRI A;  3LPF A;  4CP0 A;  1BBT 1;  2R1D A;  4HET A;  4HVQ A;  1OQE A;  3NJY A;  4RR3 A;  1Z0H A;  1ZBE 2;  4JGY C;  3ZSL A;  2VZ3 A;  1FX5 A;  4CCD A;  1FNZ A;  2D3S A;  4I01 A;  2D6M A;  4P9I A;  4YVW A;  5H9P A;  2BNO A;  5A3P A;  2GC0 A;  4EV0 A;  5FZ9 A;  3VDD B;  1JMU B;  1ZBA 1;  3NV2 A;  1ZZB A;  3EQE A;  4N53 A;  3RZZ A;  1OT5 A;  1REE A;  2VOV A;  2XKP A;  1YQ5 A;  4IGQ A;  2VZV A;  3SH5 A;  2E6V A;  3UGH A;  1WCU A;  3WV6 A;  2VQA A;  1C5H A;  2WT2 A;  2D5H A;  4P9W A;  2ZEY A;  3RYK A;  5FZL A;  3NJV A;  1TE1 B;  5HXV A;  4EN9 B;  1X7N A;  2RS5 2;  5IVJ A;  1W6O B;  4CDW A;  2W94 A;  1BVP 1;  2D6P A;  3BOP A;  3N7L A;  1YLL A;  1UYY A;  4BQ3 A;  2RV9 A;  4DY3 A;  2CV6 A;  5I0R A;  3CO2 A;  4DEQ A;  1PIV 1;  4NIH A;  3TN9 3;  3ZFE A;  5DZG A;  1JUH A;  4GD4 A;  2JDH A;  4EE2 A;  3HOB A;  3WX5 A;  5B4N A;  4MXW A;  1UU6 A;  2GN7 A;  4LUM A;  1A8D A;  1WBL A;  4FP3 A;  3NNJ A;  2PMW B;  3BIW E;  1VPH A;  1GLH A;  2ADD A;  1LCL A;  2B42 B;  2QBX A;  4AVV A;  3S5A A;  2DUQ A;  1CZS A;  3AFG A;  4RQP A;  3I2K A;  4JVA A;  2AGS A;  5JIA A;  3VBR A;  1DGW A;  2CL2 A;  2GNB A;  4ISR A;  4IUG A;  5A6Y A;  2W1U A;  4PLN A;  5JUV A;  4ZXE A;  4BPZ A;  1RL3 A;  3ABZ A;  3HAG A;  1RTV A;  3CJI C;  3EJK A;  1UKR A;  4PCR A;  1GYK A;  3JD7 2;  1V70 A;  3KLS A;  4WVZ A;  1ENS A;  1W8W A;  2VH9 A;  1K3I A;  3HQU A;  4FPL A;  5T52 A;  1PVC 2;  3TEZ A;  1CN1 A;  4AFM A;  1D7P M;  4OI4 A;  2E33 A;  3L9J T;  4YZ1 A;  2GSY A;  4FPJ A;  3UKN A;  4AI9 A;  3IIA A;  1BCX A;  4AR2 A;  4B4R A;  5A32 A;  5H9Q A;  3ZXD A;  3I8T A;  4KWU A;  1MEC 2;  3ACF A;  3EYP A;  4FOW A;  1E5S A;  4GJY A;  1UMH A;  3T1M A;  1MS8 A;  1UXX X;  1W8H A;  3I2I A;  3DCQ A;  1PM4 A;  2PHL A;  4NR1 A;  3PVE A;  2XXZ A;  1J58 A;  1HRV 2;  2R0F A;  4QDQ A;  4MXW B;  2WT1 A;  5CFC C;  2JWP A;  1AR6 1;  1MZE A;  2DUP A;  5L9B A;  3RJR A;  4BK4 A;  4CPB A;  5BNN C;  2Y6K A;  3ILF A;  2PTM A;  4AGG A;  4IEV A;  2BTV C;  4QMA A;  3DGT A;  4XFC A;  5HI0 A;  2MEV 2;  2YU1 A;  1UD1 A;  3RRD A;  3SC7 X;  3KT7 A;  4LMF A;  4WM8 A;  3RVH A;  2WNU A;  1AL0 G;  3ACH A;  5FYT A;  3AC0 A;  1DZQ A;  4KH9 A;  5FLJ A;  2VUC A;  2WO1 A;  2E26 A;  2NPI A;  1QIQ A;  1W2T A;  2Y60 A;  2RG4 A;  1OSG A;  4DEV A;  4Z92 B;  4N53 B;  4AW7 A;  5JZG B;  4OHW A;  2HWD 3;  1X9P A;  1WA4 A;  3VBU B;  1POV 3;  4HSL A;  4XQW A;  1N3P A;  1W9T A;  5FZ0 A;  1WCQ A;  2YGM A;  2WYF A;  1E5H A;  2K0G A;  2WL1 A;  4F8A A;  2BPA 2;  1PO1 1;  3KWV A;  3UV9 A;  4DO0 A;  3H8R A;  4YSF A;  1UZZ A;  1UY0 A;  2CDO A;  2Y38 A;  3AP4 A;  3FWE A;  2HEV F;  2ZGL A;  2RS3 1;  1F15 A;  1RVF 2;  3H7Y A;  3T08 A;  3MW4 A;  2ADE A;  2O0O A;  3P3P A;  5IK4 A;  5FKC A;  4LE3 A;  1RIT A;  4LKF A;  4XTM A;  2VOW A;  5DZF A;  1UU4 A;  2A3X A;  3H7J A;  1GIC A;  4RSU A;  5FPZ A;  2B7Y A;  3ZKU A;  4ATF A;  4V1P A;  1QDC A;  2AUY A;  2JKX A;  3VDD C;  1IQA A;  3CF6 E;  3ZOI A;  1GSL A;  2YB7 A;  4I09 A;  2VOX A;  2ZGO A;  3N9O A;  2JDM A;  4Q4V 2;  2WNU B;  2XG3 A;  3AX4 A;  1CZT A;  3LF7 A;  3GZE A;  5FY1 A;  3J7L A;  4PBP A;  1NA1 A;  3UT0 A;  1PO2 3;  2XHN A;  2WFP A;  3KV6 A;  3RWK X;  1TVG A;  3MLL A;  3HEI A;  2WQ8 A;  1WLD A;  2P3J A;  4H2A A;  4AVT A;  1OH3 A;  3LFI A;  5FO7 B;  4PQ9 A;  5C8C A;  4B29 A;  2P3I A;  3FX3 A;  1T6G C;  2D40 A;  3B9C A;  1VP6 A;  2GP3 A;  4GKX A;  1QJU 1;  4IE6 A;  3WNM A;  1OBN A;  3N7K A;  1O4T A;  3PMS A;  4XBQ A;  4LLO A;  3U14 A;  1NCR B;  3H3Z A;  3N7M A;  3CL1 A;  2HKX A;  4IV1 B;  1LHN A;  4JGZ B;  3ZPY A;  1OI6 A;  1UZ0 A;  1B35 C;  1AXK A;  1VBE 3;  2Y26 A;  4BXF A;  1TMF 2;  1IPK A;  2ZAA A;  2NN8 A;  4XF1 A;  4CYD A;  1U5I A;  2NMO A;  3I3B A;  4CDQ C;  2VQ0 A;  1SFY A;  2JD4 A;  4OHX A;  4RHV 2;  4XMA A;  2DU1 A;  3DXU A;  4QPY A;  4CDU A;  3WW4 A;  1R64 A;  4R9C A;  1V9U 2;  2VW0 A;  1NLS A;  1VBA 2;  1VBE 1;  5EPA A;  2PHR A;  3VLB B;  3ZKY A;  4E8C A;  3O1P A;  1LED A;  4GKY A;  3MUY 1;  1H1I A;  1D4V B;  4BLJ A;  5IYY A;  3BTX A;  2J1E A;  2ZTN A;  2A1X A;  4DS0 A;  1MEC 3;  1OF3 A;  2ET7 A;  5JI9 A;  4LA3 A;  2B8M A;  2CTV A;  1PK6 B;  3D5O A;  4FT8 A;  5FRA A;  3OGV A;  3ZSK A;  2X5I C;  3ZXL A;  5C9A B;  2EVX A;  1JTZ X;  4BIF A;  4OI1 A;  1Z7S 2;  4ZZ8 A;  4QWN A;  5IHR A;  1AF9 A;  1COV 1;  3GNE A;  5IWF A;  1PMI A;  3MV0 1;  4D6R A;  1OUS A;  3LA2 A;  3Q8F A;  2C5D A;  1BLZ A;  3WG2 A;  4L11 A;  5AC9 2;  3O0W A;  2RMU 3;  4QHZ A;  2PQQ A;  4ISQ A;  4QGN A;  5J7M A;  1UZY A;  1E5I A;  5CFC B;  1ENR A;  4JZR A;  2GH8 A;  1RUC 1;  4CDW C;  5C4W B;  5FZO B;  1LOE A;  4BQ2 A;  4XUN A;  3T0A A;  1PNF A;  3P1I A;  3ELN A;  4XVH A;  3THT A;  2WNV A;  2YMZ A;  3BN6 A;  1N1V A;  2QUO A;  3VZN A;  1QH7 A;  2WFF 3;  5C3O A;  4AI2 A;  1O3S A;  1FOD 1;  3OEB A;  3AL6 A;  4AHY A;  4BJ0 A;  3AVR A;  3G6J B;  5EXO A;  2JDN A;  4CRQ A;  4DPN A;  3NRU A;  1DZR A;  3VBH C;  3APB A;  2Y0O A;  4KWK A;  3FUQ A;  1S55 A;  4Q4Y 3;  4DUW A;  3VDC A;  2YU2 A;  3POJ A;  1I9R A;  1DQ4 A;  1XPW A;  5LAT A;  3J7N A;  3AYA A;  4E4D X;  1UMI A;  1W99 A;  2HH9 A;  1DU3 D;  5KC6 A;  3DYM A;  4YW3 A;  1ND3 A;  4BQW A;  4NUB A;  3O1O A;  4BOW A;  5FYB A;  2WIN B;  1AX0 A;  1ONA A;  2X5I A;  4Q4Y 1;  3K3O A;  3KHB A;  4E2G A;  1ZRD A;  4PF1 A;  1QJE A;  3BGA A;  1AL2 1;  2W1S A;  2NYY A;  2OX0 A;  3N9P A;  2E51 A;  5FK8 A;  4CP2 A;  1CAV B;  3NWK A;  4O61 A;  5EYX A;  3EO6 A;  2FCU A;  3GZA A;  4BQ4 A;  4G9S B;  2ZHN A;  3EMR A;  3FBY A;  3B9I A;  4IXL A;  4YVS A;  1WMX A;  4OQ8 A;  1FAT A;  4RHV 1;  2JB4 A;  1AL2 3;  1UZV A;  3RZM A;  1RIR A;  2P2K A;  3C7G A;  1ZBA 2;  1RUN A;  4QX5 A;  3WNN A;  3DKQ A;  4YGB A;  3CJX A;  3VBR C;  2VZR A;  2VR4 A;  4CDU B;  3URF A;  4N90 A;  4MGT A;  5LEJ A;  4JKM A;  5F5C A;  3SIT A;  1W06 A;  3VKM A;  1CON A;  3IZO A;  1V6O A;  4HAN A;  4QXB A;  1CWP A;  4IEX A;  4Z2A A;  1PZ9 A;  3QLQ A;  3LFM A;  1D4M 1;  2WS9 2;  4NOT A;  1GBG A;  2J22 A;  4AF9 A;  5GZG A;  2PHU A;  2JD9 A;  3OTF A;  1QF3 A;  5FBJ A;  1LB2 A;  4NHL A;  1XYP A;  3E5U A;  1C1L A;  1FPN 2;  1PIV 2;  1XYO A;  3AL5 A;  1UYP A;  1K45 A;  4M3C A;  1OVS A;  2YBP A;  2YYO A;  4QM8 A;  1LGN A;  1X82 A;  3B93 A;  3S7E A;  3PUR A;  3AFK A;  3HPN A;  1IQD C;  2VAU A;  4P5H A;  2ARA A;  4TYS A;  4IEU A;  2WNO A;  5FYY A;  1ZRF A;  5CB7 A;  3AKP A;  5BV6 A;  1O4Z A;  1CZV A;  2O8Q A;  3IN9 A;  4KMQ A;  1L3J A;  5DUW A;  3PJY A;  2X53 S;  4K7J A;  1W05 A;  5I93 A;  2XJR A;  5A3T A;  1HB4 A;  5JOW A;  2CHH A;  3ZXK A;  2P17 A;  5GLT A;  3WSO A;  2JB8 A;  2C4X A;  3FN9 A;  3NMB A;  1YFY A;  5HV0 A;  4CE8 A;  5KC5 A;  3O0V A;  4FTB A;  2MEV 3;  4LIU A;  3POY A;  1EPZ A;  2W3J A;  3CHX A;  1O3T A;  1DQ2 A;  1QJX 1;  4IV3 B;  5F1R A;  4YNI A;  1W6O A;  1EV1 1;  2DVG A;  3OD0 A;  5CFD A;  5C5U A;  1WBF A;  2XQR A;  2QE3 A;  1RJ7 A;  5BPX A;  4IES A;  4Y20 B;  1YRZ A;  4H7L A;  2F4L A;  3S57 A;  3AB0 A;  1SHW B;  4UW4 A;  1EAH 1;  3WP4 A;  3MGU A;  1NE6 A;  1LHV A;  1GWK A;  5C71 A;  2DFB A;  4YG0 A;  2IZW A;  4YFZ A;  3N3H A;  4L97 A;  2KD7 A;  4I0A A;  3AYC A;  2G9Z A;  3BI3 A;  1Q8O A;  1GWM A;  3HBZ A;  3O0X A;  5FYH A;  3S5Q A;  5FKB A;  4W8J A;  3RG0 A;  3ST7 A;  4COY A;  2W46 A;  4CU9 A;  4MGZ E;  3OUI A;  1NOV A;  2J1V A;  3AJY A;  1X36 A;  4QPG B;  1H1A A;  1W6M B;  5C5T A;  1OLQ A;  1XNB A;  1RUI 2;  1HX6 A;  3IB3 A;  4FOQ A;  2OQ7 A;  3ZMN A;  1K5M B;  3OGR A;  4OZO A;  5FZ7 A;  2VBB A;  2K9Z A;  3ZFE C;  4QD2 A;  3VD7 A;  2HBU A;  1J59 A;  3VB9 A;  3VZJ A;  3QH6 A;  2OUH A;  3GGL A;  3H3U A;  2RDS A;  3RNS A;  5T5J A;  2WZR 1;  5FWJ A;  4N53 C;  2FD8 A;  2JDU A;  2JG9 A;  3R4U A;  3FFZ A;  4J1X A;  1NA1 C;  5AVA A;  5EWS A;  3ZFF C;  1CAW B;  2NZ9 A;  2IUW A;  4CA9 A;  4ZXK A;  3I54 A;  1YEW A;  3JBG 2;  5C3P A;  3KCX A;  2G4I A;  3WXP A;  3PUS A;  3S6P A;  2BGC A;  4D6S A;  3H42 B;  2PA7 A;  3IAQ A;  5D1I A;  5DDJ 3;  4ES9 A;  4PBO A;  1COV 2;  1K5M C;  2CNA A;  3D4K A;  3DUI A;  4LBQ D;  4W6W A;  3BPZ A;  2A6X A;  3W59 A;  3I49 A;  4YPJ A;  2F4P A;  1AR8 1;  1HN1 A;  3WQB A;  4FQ4 A;  4QX8 A;  3V0B B;  5FMC A;  1HXS 2;  4XHX A;  4LKS A;  5L7O A;  3FC0 A;  3WW2 A;  3J26 N;  1RXG A;  2J7M A;  2XDV A;  4JGZ C;  4AL9 A;  1RUG 2;  2ZGQ A;  4CEW C;  4JGY A;  1WCD J;  2TBV A;  3B5L B;  4N43 B;  1VBC 2;  4CDQ A;  4G3Y C;  4HSJ A;  1E57 A;  3VDA A;  3ZXJ A;  1AHS A;  2I74 A;  1M4W A;  3HVD A;  5CIS A;  3D3A A;  5FRE A;  5IVC A;  2RDR A;  3VHR A;  5I0U A;  2HWC 1;  2I45 A;  2ARB A;  4QXK A;  4Q4X 2;  4PIX A;  4TSV A;  5T50 A;  1GOH A;  2QKD A;  4Q0V A;  1W2N A;  2R16 A;  5JMO A;  5DUX A;  3WY6 A;  4OHY A;  2WO2 A;  3SLI A;  1VBA 3;  3LOB A;  2IXI A;  3LQC A;  3AMQ A;  4QKD A;  3ZXF A;  4NJ4 A;  2FDF A;  3T2T A;  4QQO A;  1AX1 A;  3PME A;  1EV1 2;  1F8V A;  3WG1 A;  1DGR A;  1UIJ A;  1ASJ 1;  3J9S A;  1FT9 A;  1G6N A;  1PGS A;  1DLL A;  2BUK A;  1J1T A;  2G19 A;  1O3R A;  2A73 B;  1PVX A;  2SLI A;  3MDP A;  4L0P A;  4Y3O A;  4Q4W 3;  5AC9 1;  5HXM A;  3BU0 A;  2BBV A;  4A6S A;  2JIJ A;  5FPL A;  4D69 A;  2OA2 A;  3DPR B;  5FY9 A;  1CVN A;  2MNG A;  4EN7 B;  5F5I A;  4YW1 A;  1HV0 A;  3NQH A;  4IEW A;  5I0S A;  1RUC 2;  5AVP A;  3OOX A;  4MGQ A;  3BKZ A;  1NXD 1;  2J1R A;  3ZDS A;  1FOD 3;  3VKF C;  1XNA A;  4AGR A;  2JJ6 A;  4OHV A;  1Q3E A;  5D8A B;  5FDB A;  1CD3 G;  2H6B A;  1VMJ A;  3VHP A;  1ULC A;  2ID4 A;  5A3M A;  4XZP A;  2Y64 A;  2XJT A;  4OI0 A;  3U11 A;  3KHC A;  1JYT A;  3EXU A;  4AAX A;  4XUR A;  1VMH A;  2ORZ A;  3AMN A;  2B4K A;  5DUV A;  1NQD A;  5LK5 A;  4RGA A;  5EJ1 B;  2HJI A;  4DRV A;  4WVM A;  1ENQ A;  2YZ4 A;  4C91 A;  5BNP B;  2WFF 1;  5FZC A;  4UI9 L;  3Q8E A;  2VBP A;  5TSW A;  5KHK A;  5DAQ A;  4ARY A;  5FFO C;  4M01 A;  2J42 A;  1RUJ 3;  2ZGT A;  2W47 A;  3W58 A;  2W87 A;  3AYD A;  4RA0 A;  2JG9 B;  4HT1 T;  5FY8 A;  1O59 A;  1W3X A;  1NCR A;  1KD7 A;  2VVE A;  4LPL A;  2VQT A;  1WMD A;  4Q26 A;  1SQ4 A;  1LOA A;  3U10 A;  2DF7 A;  5CKQ A;  5FYV A;  3PIG A;  3THP A;  2ZGS A;  4S2F A;  3PVO A;  1VE0 A;  1ZZ7 A;  1CPM A;  5DAX A;  3ZYR A;  1BBT 3;  1VBB 1;  3EBR A;  1RGS A;  3B02 A;  3K4Z A;  4D8M A;  4JTN A;  3RFR A;  3LE0 A;  4YM1 A;  5HCA A;  5T54 A;  5JLV A;  2RDQ A;  4R9D A;  4HG6 B;  2EXH A;  1PM7 A;  4IEP A;  4OUE A;  5DAB A;  1ZBE 1;  1BQP A;  1VLN A;  2A5Z A;  2C9A A;  2W92 A;  1BMV 1;  1TNR A;  2YY1 A;  3D6E A;  5FPU A;  1PO1 3;  4JQR A;  1UOB A;  1Y43 B;  1WW5 A;  1F2N A;  5FYS A;  4CEW B;  3J7H A;  4HFS A;  4RHV 3;  4ZU4 A;  3S0M A;  2XWB B;  4D7T A;  5B4X A;  5IUQ A;  4LOR A;  3OB8 A;  2RS3 3;  2WSU A;  3BOW A;  2YPD A;  4GH4 C;  3WDX A;  1OFN A;  1KDM A;  2NMN A;  1UPI A;  4LO6 B;  1C8M 1;  1QY4 A;  3PUI A;  3H9A A;  3ZVX A;  1NXM A;  3P6B A;  1KS5 A;  3LOI A;  4LE4 A;  3TYJ A;  4EWA A;  5C8W A;  2R06 3;  2R07 1;  5C3Q A;  3VD4 A;  2E53 A;  4Q0P A;  3O14 A;  4WM8 C;  2Y34 A;  1IS6 A;  3VUO A;  5FZO A;  1G7Y A;  4CDW B;  3ECQ A;  1GWL A;  5K0U C;  2WNV B;  4JHT A;  3NW4 A;  1W0N A;  2A71 A;  3HJR A;  2X10 A;  4R4Z A;  4XET A;  5E16 A;  1BBT 2;  4XIL A;  1UF2 C;  3OUJ A;  1QMJ A;  3WCR A;  3FHI B;  2V4A A;  2PAK A;  4R9B A;  3RSJ A;  4N8M A;  2RR1 2;  3FJS A;  5LY2 A;  1MPX A;  3WT3 A;  2W9X A;  2Y6L A;  2MPF A;  4KNC A;  3RZL A;  5JAX A;  3O5S A;  4RN5 A;  3WG3 A;  1KFU L;  1GR3 A;  2JEM A;  5T55 A;  4I02 A;  1NCQ C;  1R09 2;  1BEV 1;  3WVJ A;  3POB A;  5HCH A;  1PO2 1;  2GNM A;  5CFD C;  2VCM A;  3WUC A;  4XJA A;  2GC3 A;  1W2O A;  3WF1 A;  5A7P A;  4XF4 A;  1HDK A;  4I2O A;  2QQP A;  3E6D A;  3IM0 A;  4TLG A;  5FJK A;  5A1A A;  1F35 A;  1JYC A;  4NPR A;  5SV5 A;  2DTW A;  2D98 A;  4A7K A;  1DCS A;  1CAX B;  3WOG A;  1XC6 A;  4NIG A;  3ACG A;  1OMI A;  2WRA A;  4BE3 A;  1GZT A;  4XFH A;  1GMM A;  4PLO A;  3WP6 A;  2IXK A;  4QB6 A;  1C5I A;  3LA3 A;  4NII A;  4JDM A;  3M3Q A;  3CZU A;  4HLT A;  1O3Q A;  3ZIW A;  1SLC A;  1W8N A;  1H2M A;  2EIG A;  2E9Q A;  2XBO 1;  4I30 A;  4LBO A;  1AR7 2;  1WLW A;  4QQL A;  5L7O C;  3ATG A;  1SLB A;  3UNP A;  1UOG A;  2Z42 A;  1QJU 2;  3AKS A;  4DUX A;  3GJB A;  1S0E A;  2YFZ A;  3B7M A;  3RJ2 X;  1W2A X;  5F2W A;  3ZR6 A;  2HEW F;  5T5P A;  2D6L X;  2CAU A;  3LEK A;  3OY8 A;  4ZS3 A;  5FZB A;  2JDZ A;  3RDI A;  2VNV A;  2UUR A;  1MZF A;  2TUN A;  2QQI A;  1VRB A;  1QU0 A;  3RWN A;  1SG3 A;  2QQV A;  4KU7 A;  2LRP A;  3OG2 A;  5EQU A;  3ZN4 A;  5A6Q A;  5IVE A;  4LT5 A;  2XON A;  1IKQ A;  5H9S A;  3VBU C;  2IC1 A;  1VBE 2;  5LA1 A;  4Q4W 1;  2QQW A;  3NJZ A;  1VMF A;  4PQQ A;  4RQP C;  4DXZ A;  1NYW A;  4UFL A;  4XOG A;  4SLI A;  4AVS A;  4YW6 A;  4W4Z A;  1XRU A;  1QDO A;  5IFP A;  1H8T A;  4QPW A;  1A78 A;  4B1M A;  2Q8D A;  3W20 A;  4IV1 A;  5F3C A;  2EID A;  1OC1 A;  3MEP A;  3VDB A;  3B3Q E;  3OYW B;  2XHK A;  1UYZ A;  4AED B;  1Z7S 1;  2VTF A;  3QAC A;  1KFX L;  1YJL A;  4Z1V A;  5FQ0 A;  5FXV A;  1UN1 A;  4QDR A;  1CIW A;  3SEP A;  3WHU A;  4MET A;  3WQ0 A;  1LOG A;  2OXB A;  4LR4 A;  3J8F 3;  5CAZ A;  2VNR A;  4PF5 A;  3G7D A;  4S2D A;  2A7A A;  1HQW A;  1IGO A;  4JKK A;  4OUM A;  2KXL A;  1UL9 A;  2Y0I A;  1PNG A;  1OVP A;  1PIV 3;  1OLR A;  1JU4 A;  3KV9 A;  1VAL A;  3BOD A;  3DYP A;  3N9L A;  4IV3 C;  5F37 A;  1RUO A;  3T0D A;  4YZ2 A;  2AEZ A;  2D6K A;  2FHR A;  3DYO A;  4YGC A;  2KR2 A;  5DXD A;  3THC A;  4CEY A;  3JZV A;  5BNQ A;  5C9A A;  3DPR C;  4CDU C;  4LLF A;  3GXU A;  2RM2 1;  1LEN A;  1IOA A;  2RS1 1;  4Q4V 1;  2YUE A;  2BU9 A;  3VL9 A;  2AR6 A;  1QJU 3;  4M0H A;  3HWJ A;  3C2U A;  1JZ4 A;  4GQ7 A;  1ZX5 A;  4AHZ A;  3B00 A;  4CP1 A;  4E4S A;  3K3N A;  2XJV A;  4P9J A;  4QQP A;  2CGO A;  1OD3 A;  4C0H A;  2G9G A;  1QQP 2;  3LSE A;  3UYJ A;  5I91 A;  3C7E A;  4L2N A;  2W08 A;  4AWD A;  4P14 A;  2RMU 2;  5J3U A;  4HPK A;  4R9A A;  4XJW A;  1UWW A;  1UY2 A;  1UYX A;  3LEM A;  1ND2 C;  2E31 A;  3OPZ A;  1C8M 2;  1CR7 A;  2Q8E A;  4Z8B A;  1H2K A;  3DF0 A;  3U37 A;  4BDV B;  5H9R A;  4YVW C;  4COW A;  3W5M A;  1JHN A;  2Q1F A;  1QH6 A;  4I3G A;  1PO1 2;  2Q0A A;  1KIT A;  2ORX A;  1J3P A;  2ZML A;  3QD6 A;  4F3J A;  4CUA A;  4FPY A;  4Y1U A;  3KZ4 C;  4YAR A;  3P5B A;  4Y26 A;  1OQ1 A;  5FP8 A;  1SLI A;  2ZEX A;  1RUJ 1;  5FY4 A;  4OQ9 A;  5FMO L;  4JAA A;  5K7P A;  4ZKT B;  5BNP C;  3ORJ A;  4UFJ A;  4URT A;  4LTA A;  1PX3 A;  2JIG A;  3E5Q A;  3NJX A;  5C6C A;  3MUZ 1;  2J1T A;  3D0S A;  4XF0 A;  5A70 A;  3AP7 A;  2JDK A;  2OS2 A;  5ACA 1;  1Q8P A;  4HBN A;  4NID A;  1JH5 A;  1IPJ A;  4WM7 A;  4CCE A;  5GZC A;  4AFA A;  1S0D A;  1JOJ A;  4LK6 A;  3VZM A;  3MHZ A;  5E1R A;  4N7U A;  4QXC A;  1DZT A;  3TEW A;  4HPK B;  3VBS B;  2ZAH A;  1N3Q A;  4IGP A;  1LR5 A;  3M2M A;  3T1L A;  3WEZ A;  3WG4 A;  4QQ2 A;  3VV1 A;  5AC9 3;  3OBZ A;  1ULF A;  2H0V A;  3D8C A;  3R4D B;  1O91 A;  4QB2 A;  1U5Z A;  4Z07 A;  2LRO A;  1S0B A;  2XUE A;  3TBD A;  1XNT A;  1O8P A;  2GU9 A;  3E97 A;  4AED A;  1ULD A;  2R32 A;  2ENR A;  2QQL A;  1RC6 A;  1ZYB A;  3JQX A;  4LBQ A;  1CJP A;  4LOS A;  4Q5O A;  4WZC A;  4YW7 A;  5FXX A;  5K9Y A;  3WR0 A;  4DY5 A;  4FFI A;  1WWY A;  1PGL 2;  2VMH A;  5CG8 A;  5BNN B;  1XNC A;  4XCA A;  5FYZ A;  5FY7 A;  1AUY A;  1B35 B;  3ILN A;  4KBB A;  5ANN A;  3WNO A;  3AMP A;  1W9F A;  3K48 A;  1GQH A;  1VRH 3;  3LDB A;  1OKO A;  3PTY A;  2V5D A;  4Q0Q A;  1Y9Q A;  4LO7 A;  1CGP A;  4UW6 A;  4CP9 B;  4AXO A;  4AVC A;  4DIN B;  1J3R A;  4GWJ A;  4TLF A;  4HZF A;  4F83 A;  3SNM A;  3F95 A;  5E6H A;  2BV4 A;  2HWF 1;  2V72 A;  5CIR A;  4FOY A;  2VMD A;  2HEY F;  3VN4 A;  4YWA A;  4BZ4 A;  5JCT A;  5LA0 A;  5E88 A;  1YHF A;  1YI9 A;  4IER A;  3FL7 A;  4HKO A;  1V6K A;  5A1L A;  2ZOE B;  5F6K A;  2X09 A;  1H4G A;  2BWA A;  1PGW 1;  5C70 A;  4Q4Y 2;  3M70 A;  3QH7 A;  5J48 A;  5IJR A;  2VO5 A;  5GLZ A;  1LHO A;  4YM3 A;  5A3N A;  3VD9 A;  2XUM A;  2HWE 3;  3ZIX A;  1R1A 3;  3N4M A;  3PU8 A;  3GYD A;  3KVB A;  3DEC A;  1ENX A;  4XZU G;  3LEG A;  3OPW A;  1TNF A;  3LZZ A;  4A4A A;  2ZPX A;  1WMF A;  3C7O A;  4HK8 A;  2AC1 A;  3E5X A;  3K77 A;  2VG9 A;  3OGG A;  3USU A;  5KHI A;  3VZL A;  5FO9 B;  3M3E A;  5F5Q A;  4QX2 A;  4MGY E;  4DUV A;  2VXJ A;  2WBK A;  4JRA A;  3T0B A;  5JMC A;  1DF0 A;  1OHF A;  1JZ5 A;  1GP6 A;  1QXP A;  4LNV A;  3WDU A;  2WII B;  3WP3 A;  3WDT A;  2YC2 A;  4XFI A;  5C7G A;  1V9U 1;  3MO4 A;  2R6Q A;  2ZJC A;  3INA A;  5LBF A;  1NY7 1;  2JEC A;  4ZZ5 A;  2BVV A;  1YJK A;  4PDW B;  5FWE A;  1FOD 2;  1SBF A;  4GWI A;  1LHW A;  1F5J A;  2R07 2;  1US3 A;  4AHW A;  4H14 A;  2BFU L;  4CDX C;  1URX A;  3ZO0 B;  5FPA A;  2DU0 A;  1UX6 A;  4IL7 A;  1QNW A;  3LD8 A;  4BWO A;  3M3I A;  1S0I A;  1D4M 2;  2WDB A;  2WS9 1;  4IE0 A;  2X05 A;  3UJQ A;  5GLV A;  4DXS A;  4E2Q A;  4B7K A;  3ZYJ B;  3LPG A;  1ST8 A;  1AYM 2;  3C7F A;  1XYN A;  1YI7 A;  3LEI A;  4YW4 A;  5ANQ A;  2WNE A;  1S0G A;  1ZM1 A;  3J8F 2;  1W6M A;  4PDW C;  1H8T C;  1K5M A;  3VBO A;  3MID A;  3H1Y A;  2HYK A;  2OZ6 A;  3HQR A;  3AP5 A;  3I2D A;  5FUI A;  2QQU A;  1JI6 A;  1AVB A;  2RMU 1;  4XJ9 A;  5LBB A;  1OOP C;  1RUH 1;  4BLI A;  4XE9 A;  1QJX 3;  2DVA A;  3MYX A;  1F31 A;  2ZAC A;  5LA2 A;  1EV1 3;  1HW5 A;  2FQP A;  2R1B A;  3MFC A;  2HWD 1;  1E5R A;  2VCB A;  3NKT A;  5I8S A;  5ABJ B;  1RUC 3;  5F2S A;  5F8P A;  5CG9 A;  1CAW A;  4MGI E;  4M3C B;  2EAK A;  2PHW A;  5EJZ B;  4LO5 B;  2W91 A;  1RHI 2;  2D44 A;  3AMM A;  1BMV 2;  1XBF A;  1QWR A;  1OUR A;  5CU1 A;  3MLJ A;  3TRS B;  3WUD A;  2RM2 2;  1G9F A;  2RS1 3;  3BIE A;  1UY3 A;  4GB3 1;  3WDW A;  3A23 A;  4FPK A;  1L7L A;  1STM A;  4XUQ A;  4BB3 A;  5A33 B;  4YW5 A;  4DXR A;  3ZFG B;  1FPN 1;  2YV8 A;  4DMI A;  3KMH A;  2YGL A;  5DDJ 1;  2CWM A;  1OF4 A;  4BU2 A;  4BHP A;  2ZGM A;  2EIE A;  2Y33 A;  4XUO A;  3QBQ A;  1MR5 A;  2WZ8 A;  1DDL A;  1GV9 A;  3POG A;  1P8J A;  4EWD A;  1A6C A;  2GDF A;  2WC2 A;  4A45 A;  1FPN 3;  4YM2 A;  1YIF A;  5FY0 A;  3ETP A;  4S2G A;  3MIH A;  3HT2 A;  1BHG A;  1V0A A;  3LB9 A;  4C90 A;  5GZD A;  4C1W A;  5E89 A;  1QHD A;  5E8A A;  5I0T A;  5ABJ C;  2O8O A;  2FDG A;  4GXL A;  5JZG C;  5DN2 A;  2QJV A;  3AKT A;  1NA1 B;  3ACL A;  4ZHN A;  1CES A;  3TNQ A;  4MGK E;  4QU1 A;  3GJA A;  1UZW A;  4JQT A;  4O9E A;  1RUE 2;  3MLK A;  3UKV A;  1KJL A;  1UQX A;  1V6M A;  2JXA A;  2IXJ A;  2V73 A;  2JDP A;  2VNG A;  4KQ7 A;  2KM2 A;  4KGQ A;  1DLC A;  3AP6 A;  2EAA A;  4HVO A;  4I3P A;  4OHZ A;  3VHO A;  1Q43 A;  2W2I A;  3SXW A;  1IS3 A;  3CU7 A;  4J1W A;  1JU3 A;  1RMU 3;  1CAX A;  4LUK A;  1LOC A;  4WVW A;  4LHS A;  1YWK A;  1Z78 A;  1A3K A;  5GAL A;  3VD3 A;  2JDY A;  1HRI 1;  3AXE A;  5FUP A;  3RMY A;  2WJS A;  1HQN A;  3JBG 3;  5KXC A;  2CAV A;  1W28 A;  1ZRC A;  1CQ9 A;  1ND2 A;  1UU5 A;  4CXW A;  4XDO A;  5LAS A;  4CUG A;  1JOP A;  5F32 A;  1EUU A;  1VRH 2;  3GM8 A;  3AZZ A;  2EIC A;  3BYW A;  3M7A A;  3N35 A;  5L7O B;  3BTZ A;  3T09 A;  1M06 G;  1RUF 3;  5JSR A;  1VBD 2;  1US2 A;  2Q30 A;  3ALQ A;  1W03 A;  5HCB A;  5CEH A;  1BYH A;  4M4P A;  3T2P A;  1MAC A;  3SCH A;  4CDQ B;  1KQR A;  3NV3 A;  4GH4 B;  5J37 A;  5FZ6 A;  2J1S A;  2R07 3;  3OY8 B;  3L2H A;  2UYA A;  3AJZ A;  3NST A;  3FUO A;  1PGL 1;  1X8E A;  3OPT A;  4NO4 A;  1L7Q A;  2P6H A;  1W9S A;  5BNP A;  1FI2 A;  4RFT 0;  3RPQ A;  4IE5 A;  4QPI B;  3N36 A;  1OA3 A;  2YPJ A;  4XAE A;  1Y7B A;  2WO7 A;  3ZXG A;  4AQT A;  4A7Z A;  4UFH A;  1UY1 A;  4RL7 A;  4O7X A;  5C3S A;  1F5F A;  2DCT A;  2ZX0 A;  4HKL A;  3W9A A;  1R1A 2;  2JG8 C;  4XF3 A;  4XFG A;  2R04 2;  4ERO A;  2D6N A;  1N1Y A;  4NHY A;  1GNZ A;  2HWB 3;  1HB3 A;  5IVV A;  2RDN A;  3QCW A;  2YXS A;  3OBT A;  5HBA A;  3AP9 A;  3NNF A;  4QXH A;  5D21 A;  5G04 L;  2R0H A;  3ZSJ A;  1W9W A;  4CDX B;  4YW2 A;  1SPP A;  5FZ8 A;  4ASM B;  2D7F A;  4X8P A;  3B01 A;  2CU5 A;  3OEA A;  3U78 A;  1GAN A;  2QQN A;  3MFA A;  4K21 A;  1VBB 3;  5AFE A;  3RS6 A;  1DHK B;  1HJG A;  2BDR A;  5KXE A;  5FMO S;  3T2O A;  3IDC B;  4AED C;  1ND3 C;  1TG7 A;  4KL1 A;  5T5O A;  4QKN A;  4XUT A;  2IXL A;  2TNF A;  3AZV A;  3SEE A;  3VZO A;  5ISL A;  1OLM A;  4DQA A;  4CVU A;  4W6X A;  4ZS2 A;  4AVB A;  1OA4 A;  5FZ3 A;  1OD5 A;  3DL3 A;  2B9U A;  4PIY A;  2VY0 A;  2YG0 A;  4C8D A;  1ND3 B;  2RJK A;  1HB1 A;  2K2S A;  4HVR A; 
#chains in the Genus database with same CATH homology
 3BU0 A;  3T3Y A;  3H8X A;  3RZG A;  4RFR B;  2IUW A;  4NIG A;  2FDI A;  3BI3 A;  4ZS3 A;  4NRQ A;  3I3M A;  5F8P A;  3O1U A;  3H8O A;  4IE4 A;  4IE7 A;  4IE0 A;  3O1M A;  3RZL A;  3RZM A;  4IE5 A;  4QKB A;  3O1P A;  3S5A A;  4NIH A;  4NII A;  5DAB A;  4NPM A;  2FDG A;  3BIE A;  3BKZ A;  4OCT A;  3O1V A;  4CXX A;  3BTX A;  4O7X A;  4IE6 A;  4ZHN A;  3O1O A;  4CXW A;  3I49 A;  3I3Q A;  4QKD A;  3O1S A;  3O1T A;  4MG2 A;  4JHT A;  4QKN A;  4QHO A;  4MGT A;  2FDF A;  4NJ4 A;  4NID A;  2FDK A;  4CXY A;  3KHB A;  3O1R A;  3BUC A;  3BTZ A;  3S57 A;  3RZH A;  4QKF A;  4IDZ A;  4ZS2 A;  4NPL A;  4NRM A;  3KHC A;  3I2O A;  2FDJ A;  3BTY A;  3T4V A;  3H8R A;  3RZJ A;  2FDH A;  3RZK A;  4NRP A;  4O61 A;  2FD8 A;  3LFM A;  4NRO A;  3T4H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...