4OCWL

Crystal structure of human fab cap256-vrc26.06, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
211
Chain Sequence
b'QSVLTQPPSVSAAPGQKVTISCSGSTSKIGQNSVSWYQQLPGTAPKLLIYENDRRPSGTPDRFSGSKSGTSATLAITGLQTGDEAEYYCETWDGSGGVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.06 light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwL01
5BJTB 1UXWB 1ZLSH 5KS9B 3ZE0F 2E6PA 4JKLA 4P49A 3PGCB 4RFEA 3V6ZA 5BMFH 2BVYA 2FECI 3ARGA 3PHOA 3PWUB 1CGVA 4RISH 3FO0H 5FHBH 2ICES 3MV8D 2FJHA 5T3ZE 2MFNA 4OLYH 3C2SA 4IMKC 2XQBL 5DGQA 1Q94B 3S36L 3OGCB 3TZVC 4WU7B 2V6HA 4WHTB 5LKNA 3U0TB 4L3EB 1QR1A 1KELH 1NEZG 4NQXA 3VI3F 3KPPA 5DLMH 1QUNA 4CN4A 2FRGP 6CGTA 2ID5A 1RUAL 2IG2H 4LCCA 4YWGL 1HXYA 4WW2C 4WI4A 3UJIL 2H1PL 1JZ6A 3HS0B 5EZIL 4LSUL 1MIEH 1FNGB 3RTQA 5JXAL 5DHYA 3KPOB 3EGSA 3GI9H 3RVVD 3N9GL 1LDSA 4DQOH 4NZTL 3WNOA 5ESVB 4LCWE 5SWQA 4XC1L 5D93C 1D5XA 3SDXE 1T21A 4FQQA 1X5ZA 1DBJH 2MKWA 2FECL 4TVPE 5LGJA 3L3JA 3TEUA 2C1PA 5D5MA 2M8XA 1Y6NR 1IC4H 1OARH 4Z77A 1IZKA 1R3JB 1Y18A 3TIDB 3UDWA 2DQCH 2XTJC 4LPXA 3UTSA 3O41A 1XIWD 4ZUSB 3TNMB 1J05B 1YNTA 1RUPL 2VXTL 2C9AA 4BZ1H 3WE6B 4OLUH 2E6QA 1BJMA 1JRHI 2P8PB 3WLBA 2ESVB 4MLSA 1MLBA 4NKMA 3PJSA 5D1ZD 2C3VB 4FN0A 2VJXA 4ZDHA 1KPVB 5DZNA 4GW4A 4ESKA 2OTWA 4IM8A 3V5KA 1IC5L 5F7WC 1XF5B 2NY4B 4WV1A 5M95B 1IAOA 3M1BB 5D2NE 1ZT1B 1RULL 2NY5H 3D9AL 1PSKH 4PJ5D 4EKXA 3L7FA 2CIKB 3AB0C 1FZKA 3GSNL 5BV7C 4JO4H 3V4PH 4PRHD 3K0WA 3EOYG 5E6IC 2R0ZH 4Y7MA 2Q7NA 1G0YR 2APFA 1CTNA 4QXUL 1T3FB 4ZXBB 2PF6A 5C08A 1K8IA 2XIDA 4KY1H 3B83A 5ILTL 1XEDA 1LEKA 3UAJC 1KJ2B 3WXVL 2Y6SC 3ETBF 1GZPA 5E08L 2WQ8A 4JRYE 2R15A 3UYOD 2VWEC 3D69B 3QEHB 2NY6B 4MNQD 4S1DD 3ILPB 5DHVH 2WWMD 3MV7B 4ZUVB 2X4PB 4WFGD 3PDOA 1RVFH 3JWOC 4FXGB 3QNZA 4HGWB 3MRHB 4I77L 3IDXL 2EKJA 2RCSL 4GXVL 5HGHA 3CX2A 1PJ9A 1RZKC 5C7XH 4OV6F 2XZQH 1GC1C 2C1OA 4X4YB 2SEBB 3MCLL 4ODTH 4N8PA 1MCJA 2F54E 5E8DL 5E2WL 4ZNEE 4OF7A 1SYSB 4M1GL 5C6WH 2YHGA 1NGXA 5KVGH 4U0RC 1RJYA 4DGYH 4PRPE 3D18B 1D6VL 1U3ZA 2ADJB 4LDEB 1RZ8A 2CGRH 4DUVA 1U3JA 1INQB 1BZQK 3S88H 5IMLA 1MFCH 4F33A 1Q9WA 1KNOB 2I5YH 2B0SL 3BH8B 3LV3A 4M7KH 1PY4A 5EA0H 4YK4C 3RX7A 3ARGC 1HSBB 4OV5A 4AT6A 5FM4A 3VWJA 3KPTA 3MRPA 4HWEH 4NNYB 1CZ8H 3EJJX 1LE9A 2NY1C 2XZAL 3NMEA 1PG7L 2EO9A 3I50L 4NBYB 3VRIA 5EO0A 5F70A 3OJVC 3QIUB 4PGEA 3FZUD 4LCCC 1XGPA 5DD6B 3L5WA 2PYEA 5CEZL 3RTQC 2NYYD 3BHBB 1ZHBA 5SX4I 3T2PA 4JG1H 2R2BA 5C1MB 4XP1L 1NC2B 3GMRB 2DRUA 3VGEA 1R3KA 3T8XA 2Z8SA 1ACYH 1IKFL 1NDGA 5IFJA 3IS0X 1BREA 5ADPH 4AH2B 4K9EC 4K8RD 4JFEA 1CBVH 1FIGL 4UILH 3F6IA 1CGSH 4HIJB 3RWIB 1YJDC 1YPZB 4IJ3C 5TDPB 3UROR 3S37X 3SDDD 4NQVA 5AYUH 3R06B 4P59H 1LILA 3VFSA 4L8DA 3BEVA 1Z0MA 5FGBC 4DKAA 3UYRL 3RIAK 3GRWL 4UB0H 1WLHA 3UDWC 4XPTH 1KLGB 4DAGH 4YX2H 4PJCA 1AGDA 4ORGA 3GMMB 1FFOB 1OAZH 4C4KT 4LPUA 1L9MA 2GY5A 4CADA 4JY5H 2G2RA 3GGWA 3UO1L 4QRPB 2B4CC 4V1DA 2WUBL 4HX1A 1AH1A 1M6OB 5DJCB 3UTPD 1UT9A 3T0BA 5E2VH 1JF5A 4GAGH 4LLUB 3TA3B 5BS0B 4P57A 4LLVB 3WN5B 5LXGH 1QG3A 4WV1C 5FV2A 4YXLH 3C6LB 4NUGL 4G6FD 4E41E 1GSMA 1JPSL 4EUPA 3RZCB 4G43B 5GZNC 2JB5L 4N0FB 1G7JB 2D4DA 1DEEB 3HZYA 4AQOA 2EKSB 2E8ZA 4HMCA 4JZJA 3ZL4L 4HCRH 4OGAC 3BZ4B 4RGOH 2HJKB 2EXWC 4LASH 2OQJA 4NO0D 3I2CH 5SX5K 1KJ2L 1J8HA 3ZDYF 2LFGA 3LB6C 5GRZA 3CCHA 4IIQC 5DYOB 5FOBA 2HMIC 2DTML 3DX7A 4J3XA 3MQIA 3C6SB 3QCUH 1PDKA 3CD4A 3AREB 4HUVA 4HHAA 4WUUB 4K3DH 2R56L 5C0ND 1YY9D 1EEUA 3U30C 3IVKA 3MX0A 5INDB 3K7UA 2Z8RA 1LO4H 3S37L 2NX5E 4M03A 1XMWA 4GRMB 3D39E 5CHNB 4DUWA 5ISZE 1GGUA 1MHHA 3BWUC 3DRQA 3WFZA 5KN5B 2EIZA 5AAMA 3FMGH 4Z7OF 4NRYA 1NBYB 3MRKB 4YHYC 5TE7H 1HHJA 3WEXA 1BOYA 1P53A 3MLRL 1QSFA 1KPUA 2AEQL 2VDQL 4LAQH 3QDHA 1EUTA 2XKNA 5J9PB 5CJBA 3EW3B 3GJFK 4KZDH 4XNXL 4NKDA 4HWZB 4BSVB 1JWMB 2VYRE 4J3VA 3BE1L 3JSSA 2FSEB 4QRTB 4HH9A 1MJ8L 5DJ6B 4HKXA 5LBSH 3VWJC 3MODL 3OZ9L 4PB0L 1JPTH 4HKJB 4MJIB 4ZO8A 1UACL 4TNVK 3HI1B 5IHBA 5CZKA 4S2SA 2YUZA 5MEOB 4GMTL 4TYUA 1JWUB 4HUWA 3MRFA 5DR5H 3HNSL 1S5IH 1MRDL 5L2KB 3MV9A 3UTQA 3VFVB 3ZKXC 3PWVA 4D0DB 3QCVL 4AZ8A 3OJMB 1FVCA 3P77A 3HAEG 3T4AB 3MRRA 2GT9A 1CF8H 2VDOH 2V9TA 5IUSA 4YXKL 3F7RA 4F80A 2VDML 2X40A 3O3DA 2AK1L 5C8JB 4K3GA 4XC3L 2ICWB 3B9EA 5F9DC 4ODWA 3MBEA 2GITA 4GW5A 3TN0D 3NA4A 5EOCL 1Z6JT 2VH5H 2XNAB 3RU8L 5BXFB 2J3SA 5EU6B 4WJ5B 4OM0L 5CSGA 4NZUL 4Y8DC 1AFVH 3EUUA 3O9WA 1O0VA 4Y5VB 1MVFA 1XGRA 2OP4L 3U4EB 2DMBA 3TVMD 4EN3B 4ACPA 1SY6H 1VPOH 1KB9J 1UXSB 4ENED 4X9HA 4OLXL 1CGXA 3MV8E 1I1AA 4HBCH 1I3RB 3L3OB 1EEYB 1IAKB 2HKFL 1JI2A 2VAAA 5HTSA 5C6TL 5HYSB 1OF2B 2V17H 2PR4H 3LKNB 4BA8A 1QFWM 4PY8J 1N64L 3QI9A 4K23L 3VGBA 3BKYH 4TNWK 1NDMA 5IHUL 3VFGH 2A6IA 2A6DA 4DTGH 3L3DA 4GKSA 4X98B 5B38B 2ENYA 4F7PB 3LMJL 1JNHB 4NOFA 4C83A 3DSNA 4HJ0D 5J57B 5I73B 2R8SL 1U93A 1EUUA 3C5ZB 4WEBH 4NN5B 4JHWL 1IQWH 3OF6D 3VMPA 4JZJC 1RUKL 4NQCD 3EOAA 1ED3B 3MCKA 3RWEB 4DN3L 4LCYB 1KPRA 1RHHB 5A40E 5JR1H 3ZSSA 3OGOE 4MXVE 1DN0B 4R8WL 3QIWA 4EBQH 1AGEB 4XCFL 1K4CA 4LRNL 3NPSC 3VFPB 5JORA 1ZGLA 1FZOB 3OKKA 3OR7B 5SWZB 4LPCA 4Q0XL 1AE6H 4XPAH 2ZCKH 4ONFL 4IDJL 4KDTA 3D2UB 5JIHA 1IL1B 3GSOB 2IFFH 5ANME 1TLKA 4EOWL 3TT3L 3K2MC 1H3WM 4KK8D 1MNUL 1F45A 4TSCL 5EU7C 3ZE1E 3CDFA 4PLKC 3CPLB 4HJJL 3E1F1 4RWHA 1QRNA 2VRAA 4U1MA 3HUJE 5JXEA 4P46D 1BLNB 3ZE0E 1XGQA 4PJ5E 4FQ1H 3X12A 2YD9A 1F4WL 5GGSB 3WUWA 5DC4B 5EWIH 3JV6B 4JHAH 4H20L 1KF9B 1KJVA 3BDYL 1ZLUK 4KMTL 4Z76A 3GK8H 2F5BH 3VI3E 3CVHA 1NGQH 1YC7A 5HY9A 3WL9A 2DQDL 3IKCB 1ROWA 1ADQH 5H35A 1ZXQA 2HRPH 1P4LB 4NSKB 1BJ8A 5DS8A 5C0AD 3P3YA 1QLFB 5EUOB 5TH2B 3Q6FA 4TTDC 5IB2A 5F6IC 5C0RL 2EH7H 4MNQE 1F3JA 2EDLA 2GUOB 1NGYA 1B90A 3MLYH 3O11A 3V4VH 1M7IA 1MY7A 1NMAH 2CLVA 4PRNB 2N56A 3LS4L 1NBZB 1TVHA 5HGDA 3ZZ1A 1WFUA 4PJBE 1AC0A 5AWNH 2AS5M 5DJYA 4HS8L 3OKEB 3RIFF 3ZKND 5CZVH 2P8LA 3VXNB 4PJXA 2DLTA 4ZUTA 5JLZA 4PJFB 3RGVB 5DSCA 3MBEC 1MPAH 4P4RA 1U91B 4ZO9A 4PJ8B 1U8OB 4PJ9B 2ZUXA 3QDAA 1UWXH 2P47B 4KKBD 1JHLH 2R69H 1MELA 1MJUL 2APBA 3GSUA 5F44A 3VDAA 3HE7C 4Q9QL 5IVXF 2G60H 1P2CB 5HI3D 3I9GH 2X89A 4OCWH 4X9BA 4JE4B 3IFNL 4AMKH 2C5DC 4HFWA 5ESAA 5I71B 3RY6A 2B5IB 1I1AC 3O2VH 3IS1X 3OB8A 3C60A 5FKAA 2ILLA 1Q72H 1JFQH 4MNHA 3O3EB 3QI9C 5FYJU 1V7ML 1MCKA 3ES6A 5H37H 5ICXB 1IE5A 4JO1L 3FQTB 1V8HA 3L3KB 2VL4A 3GMPA 5CJOH 2AJYL 1AKJB 3BPOC 3FOMA 4IOSD 4L4JA 2AQ1A 5A2IH 1LO5A 1A4KB 1Q9OB 5IM7A 5C0BA 4AIZB 1ES0A 1TNNA 4KJPC 4O51A 2EYSA 4MVBD 3LRSA 1HQRB 2HTLC 2VIRA 2DIAA 1FCCA 1OM3H 5FUOL 1KIUA 4BFGA 2D7TL 3OTTA 1OGAB 1KB9K 2YN3A 1G7LB 3RX5A 1DQLH 3K4ZA 2ZUQC 3P30H 3ARFA 5K9OB 1DLHA 3MSPA 4FFVC 2BVUA 4XVTL 1IZJA 3G5ZA 4URTB 1RSFA 4JR9H 1JP5A 1U3HD 4U6HB 2VLJD 3EOBA 4JFDE 4WTXA 4WTWA 1R0AL 3L6FB 1JUFA 3QIWC 4YH6A 1J12A 2VDLL 1T2XA 5DUBA 2WBJB 3RWJA 2LAGB 4IRJD 4GKZA 1F8TH 1YY8B 3EYOB 4S1SL 4XCCL 1EO7A 2WUCL 4UU9A 4RFOH 5A1AA 5L7XL 3SKMB 3OKMA 3RI5K 4KDTC 1J1XH 2APVA 2UZIH 5CJQL 3UTPE 3IGAA 5AUMA 4PJHB 4M9OA 4QGYA 3T4YA 2N4IA 3DHJA 4GRWB 4QYOB 5BVJB 3GKWL 4HUUA 5GJSH 1F2QA 5J1TC 1CE1L 1RUQH 5JXEC 4HS6A 1FORL 4F7CA 3QPQD 4L3AA 5GISL 5GGVY 1UENA 2YD1A 2Q1EA 3FQWB 3GSNA 4NM4L 4GBXD 2XPGB 4XXDA 3C2AH 3ARBD 1FVDA 2EDXA 4UIMA 5K9JL 2HFEA 2P5WA 2I9LA 2BOCA 4QHKJ 5DEGB 4I3RL 5D6CB 4PS4H 3GBMH 4ZPTB 1IMHC 3O2WL 3RVXD 2W9LA 1ONQA 4PJAA 4PRBB 2DQGL 1ORSA 3RWCB 4JFXB 3QEGH 5D7SL 5C0CD 3QUMA 4HXAL 1FG2B 4JRXA 3WSQH 4EIGB 4A2MA 3MA7B 5ADOL 2FWOA 4G9FB 4PRAB 5EIIA 1D5IH 5GRUL 1E4KC 4JN1L 5B38G 2IPUG 1T1WA 4X4ME 4AL8H 4BZ2H 1C5BH 1H8SA 1D5BB 2YR3A 3BVNA 1ZA6A 5JOFA 3GNML 3QWQB 4WCYH 3T77B 1RJZA 1A9BA 5JW5B 1I1RA 1JNLL 4NC2B 4G7VL 4UUJB 2NY2C 5JHDE 1S9WA 4U1LB 5KSBF 3MLUL 4PY7A 3LH2H 4OUUA 4LHUB 4BQ6A 4OCLC 4Y4HC 1QFUL 5BQ7B 1TENA 5I19L 1XR9B 4U1NB 1CWVA 4ZS7L 4OLVH 3KPMB 4X6CA 1UXWA 2HYMA 5BJTA 3IDMB 2EDWA 3EYUL 5KS9A 3PGCA 5JNYB 5CILH 4HIXL 3QCTL 3PWUA 2HLFD 3SKJL 3RY6C 3HZVB 5HYFA 4Q2ZB 5FGCB 1Q94A 3EDJA 2E8YA 3OGCA 1TQCC 4R7DB 4WU7A 3GIVB 3NCJH 4WHTA 1BQSA 4JFFE 3U0TA 4L3EA 2AQ3A 5I18L 5HJ3B 1KC5H 2R0LL 1BVKB 1P7QB 5L2JB 3HS0A 1KV3A 4IEFB 1FNGA 1H3PH 2BNQD 3KPOA 4KU1A 5D8JH 4PJ7B 1MCSA 2X70B 4UTAL 5F7UA 1J1PH 2C4FU 2VXVL 3V6FB 3U0WL 3BD3A 3AROA 5ESVA 2R4SL 2AERT 4TUKL 3QHFL 1NANH 3LN4B 4PR5B 4YBQD 2JELH 3QZWB 4RA3A 2Z31D 1UFUA 5HYJB 3DUHA 4P2OB 3TH4T 1JNNH 3THML 1AXTL 4XPHL 1X4XA 4GS7B 4HZLB 2GQHA 3WJLC 4LP4A 5FYJL 1FC2D 3H2WA 1CGYA 1R3JA 5ALCH 2ARJB 3TIDA 1CQYA 4FOMA 3GRWA 4JM2F 2IPKB 4ZUSA 2WANA 2ORBH 3TNMA 1J05A 2APWA 4JPKL 3WE6A 3BD5A 3CSYB 1NLDH 2P8PA 3QDGB 4UT6L 3DIFB 2ESVA 3HE6B 3BKCL 1AP2B 4P5KB 3AGVA 2C3VA 1UB6B 1KPVA 4OZFB 4R4FL 5IFAL 4MXQD 1XF5A 2QL1A 5KAQF 4XT1C 5E4EC 3VH8B 2RJMA 4QTIL 2BRRL 3M1BA 1ZT1A 4FQPA 4J7RA 3IYLW 2F15A 3MV11 1U36A 2CIKA 2CQVA 4G8GB 4HPOL 1RZFL 4RAUB 2OR9H 3FT4B 5DRNB 2VAJA 2HT2C 2DQTL 2VABB 2WK2A 4PLOB 3QG7L 5D1XB 5IGXH 4NQCE 1T3FA 4ZXBA 4GSDL 5CEXB 1J88A 4G3YL 4HXBL 4ZTPH 4HSQA 3MNVB 1KJ2A 4XBEH 2DJSA 5JHLL 4HPYL 2EE3A 3H9YA 4NKIH 4X9GA 2DJ4A 4YIQB 5IT2H 1A5FH 4P9ML 5AZ2L 3VXQB 1HCFX 2J8UF 3D69A 3MC0A 3QEHA 3ILPA 4K3HA 5HXMA 3MV7A 4ZUVA 4J8RB 2X4PA 1KYOJ 1YEHH 5FUCE 4FXGA 3VRJA 4HGWA 3MRHA 3HG1B 4TRPL 5E2UL 2E6JA 4HC1H 4RMWA 3ZYIA 1IGFH 1U8NB 2E3VA 4WWKB 4Z7WB 4G7YH 4CBPA 4X4YA 2SEBA 2B2XL 1EAPB 2B39A 4XB7A 1A3RH 1SYSA 3EYQD 2CSPA 3FB6B 5K9KB 4DVRH 4YHKH 5J4MA 1PD6A 4OFYD 3LIZL 1XGYH 2W9DH 3D18A 3STLB 4FQXD 3VXSD 2ADJA 2VMFA 1INQA 1X5IA 2NY3C 3F7VB 1N7MH 1H3TA 1KNOA 3BH8A 5I8OL 3T65B 2A2QT 2CUMA 4Z0BL 1A7RL 5HYQB 1KENL 1GIGH 4PJGB 2EDHA 3B9KD 4N1EA 1HSBA 1QFWI 4YBLB 5DMYA 5BRZB 3QUXB 1A6UL 4NNYA 4QRRD 3ECBA 4R0LB 2ZNXA 3P0VL 1KEGL 2EO1A 2FBJL 3L5XH 3U0PB 2XY1A 5TPWL 5C0AE 4OQTH 2ZKHH 3QIUA 3FAXA 4A6YB 3HNVL 2BJML 3TFKC 5DD6A 3VWKD 3DETD 3ZYOA 4OT1L 2W1NA 3BHBA 3RY4A 3AAZB 2VDRH 5JUEH 1NC2A 3A6BH 3GMRA 8CGTA 3LPWA 4ODVL 2EYTB 4FZ8H 1T1XB 2FZ3B 1KCRL 1U42A 4QXGH 1OT2A 3S35H 1BQHG 3L5HA 3RWGB 4AH2A 3MLSH 3FB5B 4HLZH 3RGHA 4HIJA 3RWIA 1YPZA 5TDPA 2DQUL 1LDPL 1QFWL 5FCUH 3R06A 2PUQT 5IHZB 1CL7H 5ALBL 4OCXH 4N0CD 4KVCL 1WZLA 1VSCA 2W9EL 3DVGB 4F57H 3WNLA 1KLGA 1BIHA 4LCWB 1EGJA 2P49B 3MRDB 3CUPB 3GMMA 1FFOA 2CXGA 3QNYB 1QVOB 3CXDH 2O5YH 2NPLX 3SDXB 5HHXL 4MS8C 2LE9A 4QRPA 2O5ZH 1N0XL 1M6OA 5DJCA 2P48B 1RK1B 2J4WL 1ND0B 5C0EB 4Y4KD 4MJ5B 4MAYB 4LLUA 2AJSH 3TA3A 2H2SD 5E8OB 4UV4L 5BS0A 4ONGH 5HSFA 1QLEH 1TJHL 4LLVA 4NQDD 5DD0H 3WN5A 4JKPL 2NY4C 3C6LA 4DUXA 1IBGH 4P5MB 1AY1L 1BQLL 1KB5B 3U7AA 5I1HL 4L5FH 3RZCA 1YEKH 4G43A 4N0FA 4OKDA 1G7JA 2RFXB 5HVHC 4X7TB 1JYXA 1QBML 1DEEA 2MPAH 5IQ7H 4X6BB 2EKSA 5CZXC 1I7UB 1U8PB 4KVNL 3KAAA 1R5IB 3BQUB 1IT9L 3BDXA 5C9KA 4ZXBC 3BZ4A 4LLMB 4NO5B 2HJKA 2R0WH 5IKCB 4S0SD 2CKBH 5DYOA 3VG0H 2JF1A 2H32B 2VLJE 3C6SA 5I66B 4KROB 3AREA 3EDKA 5TDOB 4JPVL 4WUUA 1K9TA 2NY6C 5DI8B 5INDA 2VSCA 2VITB 4GRMA 5TQ2H 5CHNA 1KLUB 4X9FA 3K74B 3UJTH 2AK4D 3BKMH 1J87A 5KN5A 2AI0L 1K5NB 1JTTA 5GS0H 2EC9U 2NNAB 1TETL 1NBYA 3MRKA 1CLCA 35C8H 5IVXE 4QTHB 3VU2A 2JIXB 4OF5A 1BIIB 3GO1H 3MUY1 4UNVA 4M5YL 5J9PA 3B3IB 5HHNB 5E9DB 1FAIL 1RZJH 4HWZA 4BSVA 1FIEA 1JWMA 2Q6WB 3MLZL 3RAJH 2X09A 2FSEA 4QRTA 5DJ6A 1KYOK 1WITA 4PJEB 1RQ5A 2F54B 4Y16D 4HKJA 5J3HD 4MJIA 2XV6B 1OTSD 3QAZB 5GJTL 2VE6B 2MCG1 3TJHC 4KRPD 2OXHA 4CU8A 3HI1A 5F7FA 3SE9L 5C0CE 1UM5H 5MEOA 4DKFL 3QIUC 1JWUA 2F58H 1BZ7B 5DMIL 5L2KA 5MP6H 3WNNA 1BWWA 3VFVA 1IAIH 4D0DA 2IAND 3VFOB 5C71A 1EJOH 5E2TH 3T4AA 5FO9B 3KPRB 5I1DB 2QQQA 3M8OL 3CDGB 5C8JA 5EO9B 4I0KA 1G6RB 2ICWA 3VD9A 2AW2A 3O4LB 1BBDL 4B53A 3KYOB 4LSVH 4MDIB 4U7MA 3I6LD 5T33L 1T1ZB 3VDCA 2XNAA 5BXFA 5EU6A 4WJ5A 3QP3A 5BVPH 4Y5VA 2VXUH 3ELAT 2EDJA 4HF5L 3U4EA 4YDIL 4ALAL 5CD5D 4EN3A 4P3DB 4E42B 1UXSA 3OAUH 2JJVA 5LVEA 1W2KT 2E7BA 1K6QH 5DA4A 1I3RA 4YHLH 3L3OA 1XF4B 2JTDA 1EEYA 1IAKA 2YSSB 1VERA 5DVNA 2PXYD 5HYSA 3UTOA 1OF2A 5FK9B 3LKNA 4JB9L 4D0BB 1NL0L 2HG5B 1FO0B 1HYRC 5FA4B 1DQMH 2XQYG 3LPFA 3MFGB 1LEIB 2H45A 5DJAB 3KLSA 3TA3C 1Q38A 2PW2B 3LEVL 4UDUB 4X98A 4F7PA 5B38A 5B3JF 5KVMC 2A9ML 4NT6B 1JNHA 3SGKA 3O6LL 4XHJD 3C6LC 2F53D 1KB5L 3O6FB 1CDBA 2BNQE 2DLFH 3MCG1 2DIJA 1FDLL 3L1OH 3MOBL 1JGLL 2DM3A 2Z91B 3VDBA 1F58L 1BAFL 2V7NB 2D9CA 3C5ZA 3FQUB 2VLLB 2XYCA 3GSXB 1UZ6E 4B7LA 3RWEA 1ED3A 3IETB 5IBLC 4LCYA 4ZAKB 2F5AH 2CDGB 1RHHA 4JZOB 4OCRL 4UZGA 43CAB 4P2YA 5C0DB 4CNIB 4LPVA 1DN0A 1AGEA 5INCB 3AREC 3G04B 3TCXA 5HHMB 4S1QH 5FB8B 3VFPA 5EUKB 5GRVL 1FZOA 4KJWC 3OR7A 4NHCL 3SJVA 3VFRA 5SWZA 4Z7UF 1W72B 2H3NB 1DFBH 1NFKA 3D2UA 1IL1A 3GSOA 3DNKA 1V05A 3DTXB 5KSBE 4M1CD 1IM9D 3TYGH 3W11D 3CPLA 4AG4L 4I3SL 2J1KA 1AXIB 3QEUB 2CR3A 4M43L 1MWAB 3TBTB 5J13B 3QDJD 1BLNA 1MEXL 2Z93B 4ODHL 2CK0L 5TFSL 5I15H 3WO4B 3CDCA 1ZLVH 3JWDL 1P4IH 1F11B 2NX5B 3MZTA 3JV6A 4KJQD 2VDNH 4J4PA 3OAYH 1YDPB 2A0LD 3H9SD 4QHLB 2J5LB 1BD2D 3FQNB 1F4HA 4LARH 3IKCA 3LDBB 1CVRA 2EECA 2VR5A 1P4LA 4NSKA 5IJKA 5BZDB 2QJDA 5J11C 1B0GB 4KTEL 4O4YL 1QPXA 2Z92B 5EH1A 1QLFA 5EUOA 5TH2A 3WKMH 5F7NC 4KPHL 2GUOA 4POZD 3ULVH 1YMMD 2OBGA 2ZPKH 4RGNB 4PRNA 1QO3B 5DFTA 3S5LB 1WWCA 1NBZA 1QP1A 3LRGA 4ORZC 4FTVD 4KGJA 3U82B 3OKEA 4XAKD 1BP3B 3PQYD 1G6RL 4HT1L 3VXNA 3UPCA 4HQQH 4B0MM 3BO8B 5FEBA 3LEYL 4PJFA 3VXRE 2BY2A 4WW2F 3RGVA 3PUCA 1WFTA 1U91A 5FYLH 4PJ8A 1U8OA 4JGJA 4PJ9A 4XNZB 2A74B 2OR8A 3U46B 1TTFA 2I25N 3V0VB 4QHNB 4JAMB 3VXSE 1FZMB 2A9NL 1N4XL 1PX3A 2XICA 1CFQB 3NTCL 4Y5VC 2VL5B 3CNKA 1P2CA 4NGHL 5T5NG 5E7FA 5F1NB 4EN3C 4OTXL 5B22A 5IB3B 3U7WH 3WFBL 3JXAA 3DVFA 3OG4B 4NRXB 1GGCH 3AC0A 1A8JH 4QRRE 1A6VH 1A6WL 3B6SB 3GM8A 3P73B 3VXMD 7FABH 1FO0L 2EICA 5L8LB 1HINH 1QYGH 3O3EA 3AVEA 3W5NA 4I0PD 3I75B 3FQTA 3L3KA 5JA9A 3G6DH 2J7LA 2R2EB 1JGVL 3B2VH 1AKJA 3DX8B 1QQDB 3NIGF 1A4KA 1Q9OA 3QFJE 4AIZA 1G9ML 2MNUA 1DVFD 5HYIA 5CMAB 1HQRA 1JZ5A 2PKDA 4XNUH 2GJ6D 2KH2B 5KG9B 3C5ZC 1OGAA 5CAYB 1G7LA 4OQ1A 3SGDI 3UJJL 2ZP0T 4AEEA 1QSEB 1OP5H 2FX7H 3QT2A 1OAYL 2X9XA 32C2B 2J8UE 1S7VB 4U6HA 1I9JL 2Y06H 3L6FA 3TZVD 1X5HA 2EXYC 2WBJA 1L7TL 1KLFA 4LCIH 1YY8A 3EYOA 2D7NA 3SDYH 2IF7A 2VDKH 3SKMA 3WS6C 2DBLH 3GJFB 1QZ1A 3X3GH 1VDGA 4RNRB 3ZE2F 2IEPA 3EJYC 2HJLB 3REVB 1YNLH 2AGJL 1T6WA 1L7IL 3BPCB 4PJHA 3RA7H 1MWAL 1VEOA 4QYOA 3D5OF 1Y0LB 1DR9A 1IGML 5BVJA 3KLAB 2CH8A 4U6VL 4KK5D 1EHAA 4IRZL 3FQWA 2F9BT 3AMKA 4RAHA 1MRCL 1MFDL 3KYAA 2Q8BL 4YHOL 4YDKH 1WF5A 2XPGA 1MCNA 4M7LH 3CFCH 2NY7H 5ANMB 3NACL 4FABH 4J4PC 5EULV 2CIIB 1C16B 4BQ8A 3D87B 2NCMA 4OLWL 4PPTA 4NJ9H 1INEH 5DEGA 5IBTL 5IBUG 2NY0B 4ZPTA 1D9KD 1DBML 5I1LB 4PRBA 3RWCA 5IJKC 4JFXA 3B5TA 3HFMH 3REWB 1FG2A 1OAQL 3MJ6A 4NN7B 3UC0L 2BNUB 5F9OH 3MGOB 4OIAA 1T7WA 4HFUH 3MA7A 1BBJA 1KCUL 4ETYA 4G9FA 4PRAA 4LOUC 1E4WL 3MJ9A 3K8KA 4Y19D 2GFBB 3OKYA 4ZFOL 3P40A 1P4BL 2M1KA 3QQ4B 3WBDA 4LVHC 3OR6B 4Z7VF 5IV2B 1D5BA 2QQKH 1UWGL 1F2XK 3T77A 4XP6H 3RGVC 1A7QH 4UUJA 4U1LA 1ZANH 1LO3H 4LHUA 3AS1A 1KXQE 3C8KB 4PJ8C 4RIRB 4MNQB 4PJ9C 5E6ID 1SJVA 5BQ7A 1XR9A 1IFHH 3G08B 4U1NA 3NZ8B 3H9HB 3KPMA 3IDMA 3WDJA 5CP7B 1NMBL 5IVNA 4XVJL 4PJBB 1MCRA 5JNYA 1HWHB 3UAJD 5I71C 4Y88A 3V9FA 3HZVA 4Q2ZA 5B39B 3VI4F 5EU4B 4R7DA 4ZS6C 3VGHA 3GIVA 1X3DA 4KTDH 4RMTA 2ZUWA 4BZYA 4GLRI 4XRCB 3H42H 5AYQA 5HJ3A 1U95B 4YHNB 4KAQL 2CD0A 5D5MF 3W9DB 4M6NH 3K2UL 2WBKA 1P7QA 1KN2L 4LSQL 3BRFA 1WZKA 2XN9D 5L2JA 4G6JL 2HT4C 4Z78B 1CDGA 3MBXL 2OJZL 1JGUH 5CCKL 3P0YH 4R3SB 2XT1B 2B1HL 1JF6A 1RJLA 2IANE 2UUDH 4PJ7A 2X70A 3MGAA 1F6FB 3BKJL 2H41A 2WW8A 3V6FA 3CLFL 1U0QA 4MJ6B 4KV5F 3ARDB 3VXOB 3F12B 5E1AB 1JZ3A 1CIUA 3LN4A 4PR5A 3QZWA 5HYJA 5KAQG 1J0YA 3I6LE 4P2OA 4KMLB 1ZHNA 2H9GB 3WS3B 1P84J 5L8KB 5JZ7C 3O4OC 4YFLI 3MLPA 1X7QB 4OGZA 4HZLA 3UZQA 2UV3A 2IBBA 1TJIH 3DYMA 4KZEL 3ARGD 4U4BA 1R24B 3QRGH 4NKOB 1KCSL 4WI5A 4KXZI 3VFUB 2ARJA 2FD6H 2Y07H 2IPTL 2FGZA 2NY1D 1JE6A 4ZD3H 2IPKA 4MDJB 2K1MA 5T3XH 4YHPB 4OD1L 3CSYA 4K7PH 2V2TB 3QDGA 3DIFA 1OVZA 3HE6A 4OSUH 5DUPH 1AP2A 3UTTB 4P5KA 4W6YB 1P7KB 1X6LA 1UB6A 4OZFA 3RTQD 1DQTA 3SGEI 3S5LG 5GRJL 1JL8A 2XQBH 5I76B 4H0HB 4JFDB 3VH8A 3E6FB 3GB7B 1IEAB 5T1DL 4QRUB 1MRFL 2F53E 3EYSH 5FYKD 1RJCA 4G8GA 4DGVL 1U8JB 4RAUA 4POYA 3FT4A 5DRNA 2VABA 1HXMB 1LP9E 5GGVL 1F42A 5ICYB 4ONHB 5D1XA 1FP5A 4G8FB 5D7JB 3QQ3B 4O5LL 5JXAH 2DD8L 5CEXA 2RIKA 2FIKB 1J0ZA 1A0QH 2JE8A 3N9GH 3OPZL 4WWID 2LU3A 4MWFB 4M8QB 3MNVA 2V2WB 4DGIL 3Q48A 3BGFB 4LFHD 4XC1H 4YIQA 3UTSD 2LAAA 4P23B 4EVNB 1ZVSB 3VXQA 1YNKL 3HRZB 4J8RA 3O6ML 2X9WA 1T03H 1F02I 4EDWL 2FO4B 4UT9H 3T0DA 2WMPA 3HG1A 4PJDB 4NNXB 1TTGA 4AENB 1U8NA 3HI5H 4WWKA 1N3NB 4MSWB 4Z7WA 3O3AB 1EAPA 1RUPH 2VXTH 5GZND 3FB6A 4HULB 5K9KA 1A3LH 3L95B 3F7PC 3QDJE 3TBSB 4H1LG 1OWWA 1PY9A 4PV9B 3C09B 3V2AR 1QBLL 4NBXB 2DN7A 1DN2A 3KPNB 4OGAD 1KXVC 3F7VA 5KVFL 4WIQA 1IC5H 1S7UB 4XMLL 5C0IB 2O5XL 5C08D 3T65A 5T3ZH 2EXWD 4FQJH 5HYQA 2YA2A 3D9AH 3LB6D 3H9SE 2HMID 5HDLA 1BD2E 3IT8D 1HOCB 5BRZA 3QUXA 3QHZL 4R0LA 4NQTA 4K71B 3PP4H 1S78D 5JHDB 5ETUB 5B3JE 4F7EB 3U0PA 4PGZA 4WI7A 2XA8H 2XXCB 4JFQB 2GI7A 3U2SA 1AHWA 4A6YA 2JJSA 3M45A 4YDLB 3OX8B 1NAML 1YMME 1I7TA 1KTRL 2VZUA 3KYKL 4KHXH 1VA9A 2BHUA 3QO1B 4PJCF 3AAZA 1JRHH 4CN1A 1XZ0B 2GY7B 4WFHD 5E5RB 4FTVE 2IAMB 2EYTA 4XAKE 3FO2B 1T1XA 2FZ3A 4JFFB 1MFEL 2DM7A 4PJIB 4EZMA 1B0WA 3RWGA 1I3UA 3PGDB 1A4JB 4TVPH 3ARUA 1HZHH 3FN0H 2YUWA 3FB5A 3IDXH 4ODUB 2RCSH 4GXVH 2LQRA 4P2OC 3KVQA 3QQ9C 3INUL 3MXVL 5IHZA 5SV3A 5D96C 1HH6B 4GS7C 1AJ7L 2FATL 5E8DH 4I5BB 1MQKH 2ICWJ 3PNWB 4Z7UE 3DVGA 3VWJD 5DMGC 5IVOA 2DOCA 2Y72A 4UAOC 4M7LT 2FR4B 1S9KC 3SE8L 3P4NB 4LCWA 3CUPA 4XHQA 3MRDA 3QNYA 4JO3H 1QVOA 3SDXA 3HHRB 3D85B 3TN0B 5EZOL 4J23A 1H0DB 3ROOB 3HE6C 2B0SH 5I9QB 2NLJB 1RK1A 5C0EA 1ND0A 2KZ1B 5KZCD 4MJ5A 4MAYA 1KT2B 5E8OA 4WVRA 3U4BH 4P3CL 4U1GB 3N1FC 1WEJL 1NEUA 4OCSL 4CDHA 2XZAH 4P5MA 3GFUA 1LK2B 1PG7H 3I50H 1KB5A 1P84K 3L9RB 2F19H 5KTEH 4XAWH 4XCYB 5E70A 2RFXA 4GH7B 1A1OB 4X7TA 3OXRB 2GJ6E 4JFED 3AS0A 4L4VD 4X6BA 3F58H 1I7UA 1U8PA 3KS0J 5A2KH 1F13A 1NC4B 1NFIA 1R5IA 3BQUA 3E2HB 5FGSA 1MCBA 4LLMA 2ZOKB 4NO5A 4XP1H 5CKAA 5IKCA 2GW5A 2H32A 4UTBH 2AJ3B 5I66A 5B39G 1DBAL 5TDOA 1OSZB 2YD7A 2ADFH 2YRZA 4Q9BA 5DI8A 5L9DL 2BSED 5DUMH 5JIKA 4V1DD 2CJUL 2VITA 2OJEB 2FH8A 1FHGA 4GAJL 2Q8AH 1KLUA 1RUMH 1WT5A 4HEME 2AJXL 3UYRH 5DMJB 2VB5A 4WWKC 2PTUA 2OL3B 1K5NA 4JVWA 2NNAA 4M48L 1B4JL 4EQ2A 5EBLB 4PY8I 4QTHA 5I1GL 3WFCL 2JIXA 3ROLB 1EBAA 1A47A 2DQFB 2WUBH 5GGTH 1BIIA 3GI8L 3O6KH 4AEIL 3O8XB 4U2YA 3HAEH 3B3IA 5HHNA 1P69B 5E9DA 2Q6WA 3QXUA 2E7MA 3F62A 3ULVD 1N5YH 1J8HD 4PJEA 2F54A 4N5UA 4Q74A 1UA6H 3QUXC 2VE6A 2CLRB 4MLIA 4R0LC 1WGOA 3ZDXF 1QBBA 3BMWA 4W68A 5IR1B 1OAUL 2J88H 2DWDB 3NIGE 1DBBL 1AHWC 3NA9H 2JJSC 4I9WD 1BZ7A 2CO7B 4OGYL 4PLKD 3IAPA 3VFOA 5F7EL 5FYKU 1X5FA 3G6AB 2ITDB 1YYLL 3SO5A 5FO9A 1Z9MA 1LEGB 3KPRA 1R3IL 5DQDL 5I1DA 2ZG1A 5K33A 2BFVL 4LSDA 2R56H 4QHMB 3CDGA 4YC2B 1FRGL 4XVSL 5A3IC 4HIEB 4YEEA 5EO9A 5GGQL 1G6RA 1MLCB 1IC1A 3MA9L 3S37H 1GGTA 2DLGA 3IAQA 5C0AB 3O4LA 3KYOA 5AZEH 4MDIA 1JMZA 2VXQL 1T1ZA 3T3MF 3QDMD 1U58B 4DFHA 2OZ4L 5C2BL 5E03A 4KKCD 3MOAL 2VO5A 5M7QA 25C8H 3NGBB 5GHWH 2ED7A 5HHOD 5FHAH 3HB3C 1BZ9B 4P3DA 4E42A 3EDFA 2VXSL 5GS2H 3ZE2E 3QG6B 5CSZB 1XF4A 5K9QI 2AEPL 4KDVA 1DQDL 2YSSA 4TTDD 3PG2A 3ORJA 1FVEB 2Q3AA 2VWEE 2CR6A 5FK9A 1S7RB 4D0BA 1WQVT 1J0KA 2HG5A 1A7NH 4H25B 3S97C 1FO0A 1L9NA 1RURL 1LEIA 3MV9D 4MAYC 1MJ8H 5DJAA 2XN9E 3MODH 4FQ2H 2PW2A 5GPRA 3BPNB 4UDUA 4CMMB 1OD9A 1TTUA 4HK3J 4NT6A 3TGXA 1ZK9A 3O6FA 4QHUB 1GHFH 4L8SB 2Z91A 4UI2A 3K8MA 4GMTH 3MBED 1NBQA 2V7NA 4OB5H 3FQXB 3HNSH 2WLYA 3FQUA 2VLLA 4YFDB 3GSXA 3BGAA 4KRNA 4LCUB 4LNRB 5CKGA 1G7MB 1M7DB 3IETA 3HE7D 3GJEB 1FNSL 4ZAKA 5F96H 2CDGA 4JZOA 4R90L 5FUZL 4JPWL 43CAA 4HWBL 1L0YA 5C0DA 4CNIA 2YN5A 4HS3B 2DLEA 2VDMH 4PP1C 3CFEB 3WXWL 4MCYB 3DMMB 3MREB 1AR1C 1I1AD 1NLBL 4JGUA 4JJ5B 4KROC 5INCA 5C86A 3G04A 3MRGB 1H8NA 5FB8A 5EUKA 1AO7B 3RU8H 1RU9H 1DBKH 3S7GA 5FAAA 4KWUA 4NZUH 3QI9D 4Z7VE 3IDJB 1W72A 4E5XB 4OZIB 2H3NA 3QISA 3NAAH 4GMSH 2JKXA 4H8WL 3FKUS 2OSLB 3DTXA 1EHLL 4DCQB 1WT5C 3V4UL 2OL3L 5TE4H 2H8PB 1R5VB 5IESL 3TIEB 3QEUA 4KJPD 1MWAA 3TBTA 2HTLD 5AEAA 1VCAA 4JJHA 1MFAH 2Z93A 1BVZA 1TJGL 5GGUB 4KUCD 2BMKB 2R4RL 5IHUH 1F11A 5F89B 1G7PB 2NX5A 3NBNA 3JWDC 3VI4E 4RBPH 3DOSA 4FFVD 3ARZA 4NJAL 1V7NL 1YDPA 2YPVL 4QHLA 3FQNA 4M6OL 2BZDA 4DN4H 4XNYH 5ID1B 2HA1A 1GC1L 3QIWD 4WNQB 3QAZC 1UWEL 5BZDA 4JHWH 1B0GA 2Z92A 4KHTL 4O2CB 3UTSE 5GQBA 4DN3H 4BK4A 2EZ0C 3K4AA 6FABL 3VXPB 5I1JH 4GBXB 5A16B 2OX5A 4YO0B 3IFLH 5FF6B 3BESR 1RZ7H 1QO3A 5DHVB 3S5LA 2QBWA 2GAZA 3S6CA 2X7LB 4OM1H 5I2IB 4LRNH 5JXED 1MJJB 1XGTB 4LSRL 3BO8A 1ACZA 2HH0L 2KBGA 4XP5H 4Q0XH 1ZLWH 5EOQL 3BAEL 1VFOA 4D8PB 2A74A 3U46A 3TT3H 4U1IB 4QHNA 4JAMA 3V0VA 3GSQB 1FZMA 4Y5YB 1CFQA 3LY6A 1R5WB 2VL5A 4LSSL 2ZCLH 4YHZL 4KJYB 5C08E 1FH5L 2GKIA 5F1NA 2UWEB 4BUGA 1ZLSL 5IB3A 2YUXA 5CD3B 5BMFL 3ULUL 2GIYA 5K9QG 4NRXA 4RISL 5FHBL 3FO0L 4OLYL 4Y4FB 3B6SA 3FRUA 3P73A 2ARWA 2VC2H 3TF7C 1GXEA 4H20H 4K9EL 3ALXA 4Z7NE 3KNBB 1G7IB 2X4QB 4QHKI 4OLZL 1KELL 4ETQB 4X7FC 5DLML 3I75A 1ZLVK 2ARJQ 3PABB 2IG2L 2R2EA 3D1MC 5CJ5A 2RBLA 3KPSD 3DX8A 4X6DF 1QQDA 3UZEA 1MIEL 3O6FC 3OAYK 3DXAE 5CMAA 4WFHE 3GI9L 4DQOL 1BHGA 1T6VN 2NY2D 1Q0XH 5KG9A 1KUMA 4Y4HD 4BSWB 1U2CA 2ZUUA 5EORH 1YQVH 3VRLF 1QSEA 4ZAKC 32C2A 2DBJA 4HS8H 1S7VA 4G5ZL 1U8MB 1C08B 3CMGA 4DOHB 1OB1B 1IC4L 2NW2B 2W07A 2G75B 2NR6C 1F6LL 1HN1A 2XY2A 1BECA 3T04D 2OI9B 5LAXB 4JREB 2AQ2A 1W0WB 2GJJA 2CKNA 3GJFA 4OLUL 4X5XB 1J18A 3V5DB 1Z3GH 5I75B 2HJLA 4PJAF 3REVA 3DYOA 3OKNB 4X7EC 1S9XA 3KGRA 3T3PF 4FMFA 2OMBA 2DI7A 5C0BD 1Y0LA 3KLAA 4YHIB 5J13C 4D9RD 3T0VA 1A02N 2NY5L 3GKZA 4FHBD 3Q5OA 4O2FB 3WO4C 1V7MH 2WZPD 5JQ6H 1EBPA 2YEZB 5KW9H 4JO1H 5CP3H 4L4VE 4DWHA 2X41A 4JO4L 5ANMA 4D3CL 2CIIA 1C16A 2UZXB 5IIEB 1BPVA 2LABA 5F1IB 4N8CH 5I1CH 5D2LB 4HKZB 3WDHA 1CDIA 2ATKB 1WJ3A 3WIHH 3WHXB 2VLKD 4KY1L 4ERSL 3SE3A 3LDBC 3MTRA 1S9YB 5I1LA 2ICCA 4Y5XB 1ZS8B 2BDNH 2RB8A 1DP0A 1QFOA 4C57C 3REWA 4N0UB 4FQIH 4X6CF 1F4XH 5B3NA 2BNUA 3MGOA 5KS9F 4XVTH 1KFAH 3QB7C 4IRSB 1LO2H 3EO1B 2FLRT 4V1DE 1O7VA 4RGNC 5DF0A 1RVFL 1HKLL 2IQAB 5I6XB 2GFBA 4LQFL 3HZKB 4NZRH 2R23B 1NUFA 3QSKB 1OP5K 3QQ4A 3OR6A 1RK0B 1ZEAH 5C7XL 5IV2A 3PDDA 2IC2A 2XZQL 4K7FB 1EVTC 4S1SH 1ZHLB 5L7XH 2MKLC 2HT2D 3C8KA 3FT3B 4RIRA 4MNQA 5KVGL 4XNZC 1JYNA 4DGYL 3G08A 3HC0B 1IC7L 1A21A 3RPIB 3NZ8A 3H9HA 4FFWC 2CGRL 3L7EB 5CP7A 3VE0B 4PIRF 5CJXA 3S88L 1H5BB 4PJBA 1MFCL 4TOYH 2I5YL 1P1ZB 3ULVE 4M7KL 3ARSA 3T0EC 2Y5EA 3BP4B 4R26H 2A38A 5EA0L 4BKLB 1J8HE 2AEIT 2FJGB 5B39A 4BK5A 4FQLL 2L7UA 5EU4A 3VXRB 4Y2OA 2AXGB 1CDJA 3BW9B 2EDTA 3DSFH 4HWEL 4JRXD 2BOBB 4XRCA 1HYSC 1U95A 4YHNA 3W9DA 5K9JH 3VXSB 1DDHB 4WHCA 4I9WE 4HDIB 5D7LB 3D3VD 4LLQB 1MJ7H 2BY3A 3TYFB 4Z78A 2XWTB 1RZIB 2CUIA 4ZTOH 3O2WH 4R3SA 1CLZL 5EU7E 3OHXB 1FFRA 2DQGH 1EFXB 1GYAA 4LK4A 5LGKA 4JEGB 4MJ6A 4QRRB 4K8RH 4YAQB 3NCEB 3ARDA 5D71H 3VXOA 3F12A 5E1AA 1MI5B 3AS3A 1FYTB 1ACYL 3EZ8A 3ESUF 5ADPL 1LGVA 2NY3D 2VISB 1BFOB 4NUJB 3QDME 1CBVL 2H9GA 3WS3A 5GRUH 1OAKL 1CGSL 1X7QA 3SDCB 3DGCR 5AYUL 4P59L 1R24A 3QFJB 4NKOA 4FRWA 4X8XA 5HHOE 3OL2A 3VFUA 2BSRB 4Q7DA 4G7VH 2OMNA 4ZQKB 4ZFGH 4JN2A 2V5MA 4MDJA 1CLOH 1NCDH 1QFUH 2HLAB 2HWZH 2QEJA 4QXWA 3D0VB 4XPTL 4YHPA 4BJLA 4YX2L 1NFDB 2YRPA 2V2TA 1OAZL 5JW4R 3TFKD 3K1KC 3UTTA 1A2YB 4JY5L 1P7KA 3QCTH 5CEZD 1WFNA 4HEPG 4EEEA 5I76A 2AV7B 4JFDA 4GAGL 3E6FA 3GB7A 1IEAA 3QIBD 4XZUA 4QRUA 4NC0B 4YXLL 2LVCA 4XH2B 1OTUC 5I18H 2VR9A 1FFNB 1FG9C 1U8JA 3WDIA 5D72H 4RSVA 1CGTA 4I48B 1HXMA 4X7CC 2VUYA 2CXKA 5ICYA 4ONHA 1EH9A 1OPGH 4G8FA 1WZ1H 3QQ3A 5D7JA 4LPWA 2FIKA 4Y4KB 3T09A 5I74B 1WBZB 4RGOL 1VGEL 2NY0C 4MWFA 4M8QA 2R4SH 1GPOL 1J9CT 2V2WA 1FNFA 4LASL 4XX1G 3I2CL 1IGIL 5GGSY 4P99A 2LU7A 5IQ9B 1Q9KB 4XXCA 2UUDK 4P23A 3FQRB 4EVNA 1ZVSA 4NN7C 3HRZA 2ZWLT 3RL2B 4MS8D 3QUZB 1AXTH 3DVIA 4K3DL 4O9HH 4XPHH 2XZZA 2ZCHH 4OUOA 2FO4A 4XWGL 4GW1B 4PJDA 5FYJH 4NNXA 4D2NA 2DQJH 4MD4B 1S3KH 2Y36H 4AENA 2D0FA 2CRYA 1N3NA 1QRKA 4MSWA 4CJ1A 3S3JA 3O3AA 1MCDA 4JPKH 4DVBB 4F37K 3O2DH 3FMGL 3L95A 1IJ9A 1SVZA 4Q58C 2Y23A 1JF1B 3IRZA 4PV9A 5CZXD 4PBWD 4M7JH 4PYHA 3DHMA 2WWMC 4QNPE 4R4FH 4WEUD 4XBGB 3KPNA 1KBGH 5IW1B 5IFAH 1CD8A 4LEOB 1E4XI 4PV8B 1AQDB 5C0IA 1S7UA 5D70L 3UTZB 4XP4L 2WP3O 3ZO0A 5CJXC 1G0XA 2BRRH 1GAFH 4RX4A 5GIRB 3EO9H 3RUGB 4KZDL 1CLYH 4X4MA 1DUZB 4U33A 4H26B 1HOCA 1TQBB 3P4OB 3JV4B 1DLFH 1F00I 5ACLA 2QV2A 1T1YA 4HPOH 1NAKH 5LBSL 2DQTH 5JHDA 5ETUA 4F7EA 3MV7D 4JFQA 1WSST 3CU1A 3MUGB 1ZT7B 3OX8A 1OD7A 2QSTA 4PGDB 4G3YH 2RAMA 4KC3B 3BXNB 5DR5L 1S5IL 1UM6H 5F8QC 1NBVH 3QO1A 4JY6B 4HPYH 1W0VB 4PLJC 1XZ0A 3KDMB 4RAVB 3GBLA 1T0MB 1RHFA 3CAFA 2IAMA 3CK0H 1JBJA 4WEMB 2FYYB 4NDMB 5AZ2H 3FO2A 1CF8L 1CXLA 2VDOL 4JFFA 4PJIA 5IOPB 3ARDC 4KRPB 3PGDA 4TSAH 4P2RB 4FQCH 4ODUA 4TRPH 2QHLA 1QBAA 5L88H 4YZFF 1H3UA 2VH5L 1VHPA 1D5ZB 1X5GA 1HH6A 2B2XH 3UXFA 1YEFL 4I5BA 1I9RL 2X1QA 4TQEH 5DQJB 3PNWA 2HJFB 2I27N 1HH9B 3PL6B 2R2CA 2E7LA 3ARWA 1BVLB 4KI5C 2YA0A 2EE6A 3LIZH 2FR4A 1T0NB 3TJHD 3G5VB 1JI1A 3CMOH 3P4NA 3SO3B 1CGWA 1URLA 4HBCL 3D85A 3QIUD 1H0DA 3ROOA 5I8OH 4JFZL 1WZMA 5GZOC 1FAKT 2NLJA 2BVPB 2V17L 2DDQH 3WIFB 1KT2A 3CXHJ 3BKYL 1N59B 1K2DB 3IAGC 2YKLH 3RQ3A 3KPSE 1NC2D 4FFZH 3BP7B 1LK2A 1X5XA 1NCWH 4G9DB 3MYZA 3L9RA 2KUTA 3IDYB 4PBXA 4CN6A 4XCYA 1A1OA 2VLRB 3CJJA 1LVEA 4IBLT 3OXRA 2O93L 2BJMH 1A7BA 2PXYB 1QFPA 3GSRB 3EZJB 4M62L 4WEBL 1NC4A 2YPKB 5D7JC 4IOFC 2NZ9D 5HPMB 5K59F 3DRTB 3R4DA 1ZOXA 2ZOKA 3NZHH 1GOHA 4D0CB 5HYEA 2F53B 2ZNWA 5KVEH 2AJ3A 2P42B 3BGFC 2CRMA 1OSZA 4LSPL 4XXCC 4P23C 1RZGB 4EBQL 5HD8D 1PZ5B 2DQUH 4M3KB 4ELME 1LDPH 3GBNH 1LP9B 1CICB 4KRLB 1MQ8A 3OF6A 3MLTB 3VFTB 2OJEA 5ALBH 5DRZB 2MOVA 3TA3D 1AE6L 1YEGH 2W9EH 5KOVC 2ZCKL 5CGTA 2IFFL 5EN2B 1B6DA 2MCPL 3C6LD 5DT1H 2OL3A 2V5RA 5EBLA 5C0BE 1AGFB 5EOTB 3VD7A 1FQ9C 1OSPL 3ROLA 2DQFA 1N0XH 4C54A 1E6OH 2FIRT 4JY4B 3U1SH 3F5WB 4IDLA 3C09C 3O8XA 1A7PH 4FQ1L 4X6FB 2A83B 5IBLD 2DQEL 4UV4H 1JIBA 4C56D 5EWIL 2DI9A 4PB9L 1J0HA 3STBA 4JHAL 1I9IH 1T89A 5HHQB 5A2JH 1UM4H 3GK8L 2KQNA 2VLKE 2CLRA 3ARED 4GG8B 4K71C 3QDJB 4WUUD 3T0XA 1HK6A 1F4AA 1MY5A 4OD3L 5IR1A 4X6DE 2DWDA 2HRPL 4KJWD 2EDFA 3CSPA 3FRPA 4HK0B 3T2NL 1IT9H 3SPVB 3VFNB 4H88H 1YYMH 1T20B 4YDLC 1ZAGA 3MOQA 4S0TD 3EIFA 3MLYL 3V4VL 4Y2DD 1NMAL 3HR5B 4M02A 4B5EA 3G6AA 1BD2B 1BJ1H 2ITDA 3QULB 3BZEB 1LEGA 3ZT7A 1A14L 2IAMC 3ME0A 4QHMA 5AWNL 3OJDB 5TF1L 4HIEA 1MLCA 3MXWL 4G6MH 5CZVL 5C0AA 1WICA 5IWLA 4NCDA 3WJJA 1PEZA 2UYLB 1GGIH 1U58A 3H3PL 1QFHA 1K8DB 3N50A 3CX5K 2HVJB 2H6PB 2R69L 3VGGA 1MCPH 1IAIM 4WGWB 4I4WB 1BZ9A 5GGRY 3CFJB 2G60L 4FTVB 3PWPB 2E7LC 1ZKAA 3I9GL 1GOFA 2UY7A 4OCWL 4XPBH 4O2EB 4PBVC 4BELD 3QG6A 3G6JB 3UBXB 4AMKL 2OS7A 4PJAE 5CSZA 1UKTA 2Y25A 2P43B 1FVEA 3RHWF 2GYSA 2R9HC 1S7RA 3A67H 1IEHA 4H25A 5I9QC 3F7YB 3WUWG 3B5HA 3BIBX 5L2KD 3KJ4B 1JFQL 4WO4C 4LLAA 3D3VE 5IF0B 4CMMA 4U1GC 2ADGB 4UMGA 4QHUA 2ERJB 5CJOL 4L8SA 3BN3B 5C07E 2PYFB 4DKFH 4OFIA 3PWNB 4BFEA 3FQXA 5DMIH 4LCUA 4LNRA 4K2UH 1G7MA 1M7DA 3LS5L 3GJEA 3E2HC 3BUTA 5GSVB 2BHZA 4X6CE 2J8HA 3CSBA 1Y6KR 5KS9E 3OWEA 4EN3D 4HS3A 3MJ7B 3CFEA 4MCYA 3DMMA 3MREA 5EZLB 4JR9L 4P0DA 5KVDH 4JJ5A 5J12B 1DVFB 4D9LH 3N85L 2Z8VC 3MRGA 3CXHK 1J1OH 1AO7A 4M4RA 1FGVH 1S7WB 2KPNA 2Y9RT 4E5XA 4OZIA 3BD4A 1F8TL 4ALAH 2OSLA 2PETA 4DCQA 4RFOL 4H8WC 5F9JB 3LZFH 1J1XL 5CEZE 2BY1A 1R5VA 3DBXA 2FGWH 5EUOF 3TIEA 5GRXG 2P5EB 3RDTB 4KGLA 1NL0H 3QUML 5GJSL 4FS0A 5GGUA 3C5ZD 1RUQL 2BMKA 4W4NA 5F89A 1G7PA 3EKCA 3O8XC 4X9IA 1T83A 3BWAB 1D5MB 2A9MH 4P2QB 2V5SA 2D31B 4U1SB 5DJXB 3C2AL 4PJFF 1T89C 1CD0A 5ID1A 1PAMA 1EERB 1JGLH 3MNWB 3UZVB 4WNQA 5HDOA 2F8XC 4WFFD 4AQ1B 5EPMB 4PS4L 4OGXH 1MFNA 4YHMH 5F9WB 2PTVA 4NNPL 4O2CA 4WENB 4F15B 3SJVD 3QEGL 4NBZB 5SWZD 4YGVB 3VXPA 4GBXA 5A16A 4YO0A 4I2XB 4GXUM 5FF6A 4KQ3H 3EJYD 5DHVA 2X7LA 2L0DA 5I2IA 4Y1AD 1D9KB 4QT5B 2GTZB 1MJJA 3H6JA 1XGTA 4YC2C 4CU7A 4NHCH 4MMZC 1YQ2A 1HIMH 3KJ6H 4BZ2L 1C5BL 2F74B 2C3HA 5FO8B 2GJZB 5IWLC 3WJJC 4WCYL 1T2JA 4D8PA 1E27B 3LH2L 4U1IA 3GSQA 4J4PD 4PREB 2WNGA 5FGRA 4Y5YA 1R5WA 3NGBC 3IB4A 4KJYA 4M43H 1NANI 4WW1B 3TM6A 2UWEA 4LVOB 4ODHH 5CD3A 3BN9C 2CK0H 1C7TA 5E5UB 1JPFB 3WO3B 4HLJA 3UPAA 3ULUC 3D0LB 4Y4FA 2X42A 3DECA 3KNBA 3NCJL 1G7IA 2X4QA 3MV7E 1X4ZA 5JMOC 4ETQA 1HNFA 1RY7B 3PABA 4LOUD 4X6EB 1BFVL 1NGPL 4FG6C 3ZSTA 3UEZA 3W2DL 2J6EH 4L8SC 2FJFA 4O4YH 1CU4H 2YPLB 3ZDZF 1CXKA 1J1PL 1T5XB 3RGVD 3EOTH 5I1EH 1SBBA 4PJ8D 3VXUA 5LQBH 3BOVA 4PJ9D 4BSWA 4TSBH 1WBXB 4PJHF 4RWYH 2ITCB 5I30L 4GRWF 2JELL 4Z6AT 2XN9B 4ZG1A 1JNNL 1CFNB 3QEQA 4U6YB 1QHPA 1U8MA 1IILE 1C08A 2EIBA 4KQ4H 1KEML 2AABH 3DMMC 5DK2B 1H9VA 1MCQA 1I1CA 1OB1A 4LBEB 3KPQB 5E1HB 5E99L 2IADB 5LGHH 4ONOA 4ZS6D 2NW2A 1FL3A 2G75A 1IGYB 5IFHH 5ALCL 2C26A 4PGCB 5EC2B 5ACMA 2A9NH 5LAXA 3VW3H 5DO2C 1W0WA 1HNGA 3U36B 1ZLWK 2P7TB 4NGHH 4X5XA 3V5DA 2HT4D 3DV4B 1NLDL 4YNYB 1I75A 5FM8A 3HZMB 1WBYB 3OKNA 1AKJD 2D0GA 1FZJA 2E9WA 4HD9A 4YHIA 1N6QL 1JGEB 3ABZA 5IMOB 4JHBA 2OK0H 3U9UB 5HGAB 4E0RB 1YEIL 4L8BB 3MRLB 4O58L 1OGAD 4K3EH 5MEPB 2NY5C 1QLRB 4Z7VB 2VZSA 5KJRL 2YEZA 2VDPL 5CINL 1KG0B 1T83C 2OR9L 3K1DA 3MFFB 1JGVH 5JZ7D 5DK0B 5IIEA 3PF2A 5F1IA 5D1QB 5D2LA 1G9MH 5IGXL 4HKZA 2ATKA 1RIUL 4HCRA 5FYJD 3WHXA 3CFKB 1S9YA 4Y5XA 1ZS8A 1EO8H 4ZTPL 3UPRB 4XBEL 2DKMA 5EU5B 4PG9B 3WV0A 4N0UA 2CKBB 5CFHA 3UJJH 4NKIL 1PKOA 1A5FL 2MMXA 4IRSA 3EO1A 4LPYA 1JHTB 1OAYH 1DE4B 2D0HA 3S35X 1YEHL 2EDBA 2IQAA 1UJ3B 5TF0A 4JQXA 4JM4H 3HZKA 1B4RA 3GUTB 3HI6L 4HC1L 2WWKO 2CRZA 2Z9TA 1RK0A 1L7TH 3WNPA 4K7FA 4G7YL 2JCCA 2DL2A 3O41B 1ZHLA 4ODBD 1A3RL 1YEJL 4M6ML 1RIVL 4WI8A 3FT3A 1RIHH 4YHKL 3S34L 4HV8B 4NZJA 1XGYL 5IW3A 1MSPA 2W9DL 4PJ7F 3HC0A 4QY8B 3RPIA 4Y5YC 1L7IH 4MQ7B 4JLRB 1K85A 1TVBB 4KKAC 3L7EA 3VE0A 4C56E 4GW4B 3ARPA 1H5BA 1N26A 4Q9RL 4JDZB 4QOKB 3Q3GB 1G9EA 1P1ZA 1UH3A 3BP4A 3WFHB 4BKLA 3V5HB 2FJGA 1VADB 2IH3A 1EK3A 3VXRA 1MRCH 2AXGA 4Y4FC 5HDQH 3BW9A 5EIVA 2BOBA 4F7TB 4MA1C 3VXSA 3X14B 2J8OA 5JA8B 1DDHA 4KKLC 4MA8H 2I9TB 1CDCA 1A1NB 2ZKHL 4HDIA 4LLQA 4OQTL 5D7LA 3TYFA 2XWTA 1RZIA 4G9FD 5IBTH 3B4NA 5E8PB 4NQUA 1P5VA 3GIZH 4ZOBA 3OHXA 4N90D 4F58H 2H2PC 4IIQB 2IMNA 1EFXA 1MAML 3RBGA 5HVFB 3IXTB 2VDRL 5K59E 4QRRA 3UC0H 5JUEL 4YAQA 2XWJB 4Z8FH 1EGJL 1I8IB 4HWNA 4QF1B 2LV4A 1MI5A 4LHUD 4NRZB 1FYTA 4IMLB 4QXGL 1JZ4A 5CUSH 4OIIH 3S35L 1CXFA 1V5JA 2VISA 3QNZB 3MLSL 1E4WH 3CFDB 4JANB 1BFOA 4NUJA 2DTSA 3HRPA 4P9HH 3FHQA 3SDCA 1EX0A 1P4BH 5MEND 3I3EA 5GS1B 5FCUL 3QFJA 4V2CB 3DXAB 2R1WB 1PFCA 12E8H 2DYPB 4MJ4A 2BSRA 2E7CA 3LQMA 4L1HA 4OCXL 3TBVB 4ZQKA 1T5WB 1G7QB 1X6NA 4F57L 1SY6A 1I7RB 1IGCL 2HLAA 3D0VA 2FH6A 4CVWA 2OI9C 1NFDA 3NABH 1S9VB 2N7AA 4JREC 3CXDL 2O5YL 3BPLB 1A2YA 3OKOB 2ZUSA 2O5ZL 4LF3B 3OMZA 1U8LB 1R3LB 2AV7A 2AJSL 1H15B 4MA7L 3VFMB 4U05A 4ONGL 4M4PA 1QLEL 3LSOB 3QA3B 1JHKL 2R2HB 4UT7L 4XH2A 1HHIB 2JJWA 3R1GH 4YDJB 3HMXH 5DDHB 5J89A 1FFNA 3I02B 3I6GB 1KN2H 1YEKL 4I48A 4LSTH 4LSQH 3TV3H 5HYJD 2X1WL 3S8WA 3RVUD 4P2OD 2MPAL 3QQ9D 4Z7WF 5IQ7L 5A2LH 4N0RA 1JYWA 4Y4KA 4XTRC 5H2BB 4X80L 2W65B 1KOAA 4K94H 1CI5A 2Z0BA 3MRJB 1WBZA 3SCMB 1EEZB 3CLFH 4X7SL 5DMGD 4H1LH 1T7YA 5DWUH 2R0WL 2AV1B 3LKSB 4Y5XC 5T5FL 1ZVHA 1Q9KA 2CKBL 4L29B 3VG0L 4MD5B 3FQRA 3LOWA 1I3GH 4RCAA 4Z18A 4YXHH 1D3CA 3QDGD 3RL2A 4L4VB 3HE6D 3QUZA 4IRSC 3VGDA 5MERB 1MCHA 2ICWI 2D7OA 4GW1A 4PRHE 3H7BB 5DQ9B 4JQXC 4GLRH 4MD4A 1OCWL 2IPTH 2C3WA 2DLHA 2IWGA 3HC3H 3UJTL 3BKML 2K7QA 3DVNB 4DVBA 1CD1B 5GS0L 4FQHB 4G8GD 5C09B 35C8L 1JF1A 4N9OB 3P11H 4PRIB 4R6UA 3B2UD 1G7HB 3EO0B 3SBWA 5L0QB 1VKXB 4J3OC 4XBGA 5IW1A 2JK5B 4LEOA 4PV8A 1AQDA 3UTZA 2V9QA 4WFGE 4PUBH 3P4MB 3GHBL 2V5TA 3NFSL 5HI5D 1H5BC 2X1XR 5GIRA 4YPJA 3G5XB 5T1DH 1RZJL 4YUEH 3RUGA 1MRFH 1U8KB 1DUZA 4NC1C 4H26A 2YRLA 1V3LA 3P4OA 1SHMA 3JV4A 1MCWM 2RHEA 4WFFE 1IKNA 5GGVH 1MH5B 1ADQA 1QNZL 3MUGA 2F8VA 1ZT7A 4KXZH 1UG9A 3SJVE 5SWZE 4YFEA 1P7HL 2DIBA 3HG1D 5IK3B 1UM5L 1YA5A 4L9LB 4PGDA 2WINB 4P4KB 3ZTNH 2F58L 2ZOLB 3O9WC 4MXWH 5DJZB 1JGDB 4JY6A 1O5DT 1CR9H 4WWKD 1W0VA 5SWSB 4RAVA 1IAIL 3KDMA 1I4FB 1T0MA 3BT2L 3BJLA 3SDXF 3SQOH 2YXFA 2FYYA 5TGBB 1Q0YH 1EJOL 4NDMA 3KR3H 1TZHB 4Y1AE 4Z95H 1YNKH 2JJTA 5F21B 4Z9KB 3H0TB 5IOPA 3O6MH 4X5WB 3SGEH 5DJDB 4P2RA 3PDGA 3K46A 1C12B 2DM2A 4QO1A 4LSVL 4D94A 5KANI 1D5ZA 3S3SA 3BP6B 3SDCC 2CMRH 5DQJA 2VXUL 2HJFA 4UBDC 4UDTA 1HH9A 3PL6A 3BIAX 3TJEH 4WTZG 1HCVA 4X4XB 1J8KA 3QUXD 4F2MB 1T0NA 3G5VA 3LQAL 2W38A 3RKDC 2BVQB 4U7KA 1A6TB 1QBLH 2QSCL 1K6QL 5T1LB 4LLDB 5I16B 4N0YL 1BEYH 5T5NF 5D7IB 1EO5A 2O61A 5KVFH 1AD9A 2GSGB 2QLVB 4M1DH 3QDMB 2RGSA 2BVPA 2CDFA 5E4IA 3WIFA 1F4YH 2W0FB 1N59A 1K2DA 1DQML 4Y89A 5HHOB 3DARA 2DM4A 3QHZH 3BP7A 3BX7C 4G9DA 5A3ID 2WIIB 1BGXH 3LHPL 4FNLL 1MHCB 4XGZB 2VLRA 3EHBC 4PJFE 3QPXH 1NAMH 2PXYA 3NCYP 3RNQB 4ZSOE 3KYKH 1PQZB 2YPKA 5E6YA 4L9DA 4Z0XB 5HPMA 3DRTA 1CG9B 3R8BB 5I74C 1FE8H 4QRQB 4D0CA 2F5AL 1QKZH 2F53A 2XTLA 1L0QA 2EDYA 3JTTB 3X17A 4AEHH 3X3FL 5FKPB 5L6YL 1RZGA 1I85A 4X83A 5TJWK 5I8KH 5E24E 4N5EC 1PZ5A 2Q20A 3AM8A 5JPNB 4M7ZC 1ZA3B 2PNDA 4S1QL 1LP9A 3GDBA 1CICA 3QUZC 3MXVH 4MJ2A 3MLTA 4PJEF 1RV6X 5BO1L 4TN9A 3VFTA 5DRZA 2FATH 4MAYD 3HE7B 4CW1B 1CK0H 1E4JA 4OZGB 2X1OA 5EN2A 5TE6H 3QO0B 4PD4J 3TYGL 2BNRB 3NVQA 2YUVA 1AGFA 5EOTA 4CUCA 1OT1A 5EZOH 4JFPB 4XP9H 1NCCH 3WKNA 1ZLUH 4JY4A 4NQEA 3F5WA 1QSVA 4OI7A 4X6FA 3SKOB 4YEFA 5I15L 3SBWC 5HYSG 2A83A 1S7QB 4P3CH 4N8VB 4OCSH 1J5OH 3RVWC 1WWAX 5JW4Q 3V95A 4PP1D 5HHQA 1X5AA 1GVIA 3LCYA 3G5YB 1AR1D 1T7XA 2AJUH 4KROD 5FYJE 5KBNC 4GG8A 2XWBB 1GL4B 3QDJA 4WGVB 1IKNC 4P2CG 1S7SB 1SEQH 4P48A 3KLHC 4OZHF 4DFIA 4HK0A 3VFNA 3SPVA 1CFBA 3CLEL 1T20A 3WKML 3ZDZE 4NWUH 1F6AB 5C3TA 3JVGA 2WP3T 3D6GA 4P5TB 2ZPKL 3BDBA 4LMQI 3HR5A 1A64A 1BD2A 3QULA 4LU5H 3RVTC 3BZEA 2A1WH 4PJHE 2FDBP 4GRWE 1EPFA 4LGRB 3OJDA 2JIXD 1NEZB 2CJUH 4XWOC 5DD3H 3HMWH 4HQQL 3C60C 2UYLA 4X99B 1SEBB 5KANG 5FYLL 1K8DA 5E9DD 1KIPB 1DJSA 2D4FA 2HVJA 2H6PA 4BFBD 2Q86B 5EU3B 3Q6GH 4I4WA 1B4JH 3ZLQC 3ZYJA 3CFJA 1QTYT 2AJVH 1U8QB 4FTVA 3PWPA 3WFCH 3PL6C 1REIA 4O2EA 4LEXH 3TESA 3G6JA 3UBXA 1G0DA 3JTSB 2VR4A 5GGRB 3SO3C 4AEIH 5FO7B 1GGCL 2EZ0D 3EFDH 5JQHC 3ZDYE 3F7YA 4K55A 2B8OT 2UY6A 3MRBB 7FABL 5DEFB 1NUDA 3ARFC 1PKQE 5F3BB 5IF0A 4G9FE 4GG6F 4L8CB 2ADGA 3KPRD 5CD5C 4KKNA 3AFLA 3G6DL 3B2VL 1OAUH 2PYFA 5DD1L 5EBMB 1IAMA 2COQA 3IDYC 2QADB 5FOJA 3O4LD 4LAJH 3PWNA 3KWWB 4XNUL 5C0GB 2PXYC 4WHYG 2X4NB 2D03H 3EFFB 4Z7OE 5F7EH 1W8OA 5GSVA 1GCFA 1UKQA 1R3IH 3PWLB 1AXSB 5CIPH 2BFVH 4POUB 5C92A 5I1KH 5J7CC 2B1AH 3KPSB 5MENE 3MJ7A 5FECB 5EZLA 2FX8L 5GGQH 3MA9H 1OLLA 2VZOA 4LVNC 4XVUC 1DVFA 4RZCB 1IEBB 4G8IB 5DK3A 4JGMA 4GQ9H 2NY2B 1I85C 4OFKA 1HHKB 4NIKB 1S7WA 3AM8C 1CFSB 4U31A 5LCVH 2OZ4H 1CICC 4Y4HB 5J06A 3MOAH 1ZV5A 4LCIL 3QWOB 5TQ0H 1B2WH 3GSUB 1N6UA 2WIMA 2DWEB 5F9JA 1ZT4B 2E5EA 2VDKL 2VXSH 3RRQA 4J1UB 3X3GL 3TCLB 3O6FD 1YNLL 4PTUB 4MZ2A 2P4AB 4PJ7E 2P5EA 3RDTA 1DQDH 3RA7L 1NKRA 5CSBA 3T0AA 1NCUA 4ELMB 1E28B 2ZG2A 3DGGB 4HG4J 4L4TD 1EAJA 3BWAA 1EZVX 4ZAKD 1D5MA 3RIAF 1W0YT 1NCBH 1T66C 2IGFH 4P2QA 5F8RC 5DD5H 5J56B 2D31A 4U1SA 2GTWB 3CFCL 2NY7L 3MJ9L 4M7LL 3QFDB 1HHHB 3G9AB 5DJXA 1MFBL 3M17B 3IDGB 3MNWA 3O0RH 1A9EB 1INEL 4MB4A 1KCLA 4XPGH 5EPMA 2NR6D 5HBBA 5HHMD 4M9PA 4N9GB 3WFDH 3B43A 3AMLA 4JQIH 1AQKH 1AR2A 3L5IA 3NFNB 2L4OA 4YGVA 4PD4K 4UIKH 3QDGE 4ODSH 4I2XA 5F9OL 4HWBH 4JM2D 4HFUL 1ERNA 4XCNB 3WFEH 2VLKB 1D9KA 4QT5A 2GTZA 2LVEA 3FL7A 1A1MB 4HC1A 2ZJSH 2Q7YB 3DX6B 5BV7H 3LKRB 4GRLB 3MLXL 2AKRB 4JO2H 4X6DB 1IM3B 5FO8A 2QQKL 1A6PA 2GJZA 2NTSP 4G8GE 5D9SB 4XP6L 1A7QL 4LGPB 2JLLA 1E27A 4U1HB 1ZANL 3RIFK 1U6AH 1LO3L 3SEPA 4PREA 1HKFA 2YOCA 2FB4H 4NYLB 4OAWB 5IESH 3PV6B 1IFHL 1P6AB 2NXZB 4WW1A 4APQB 1VFBB 4EI5B 4XNQB 1C1EH 5EB9A 5CGYC 5B8CB 1CQKA 1JPFA 2P45B 2QQNH 4ZFFB 1X4YA 3D0LA 4N68A 1SM3H 3C08H 3JWOH 4LIQH 1U2HA 4NQSB 4KTDL 3H42L 4RGND 4MYWB 1RZKH 1VESA 3KJ4C 4UV7L 3HG1E 4M6NL 4OQTA 1GC1H 4X6EA 5FIEA 4NO2B 3IFOB 4OCYL 5F7LB 1JGUL 2DQHL 3P0YL 4Z7WE 2BP3A 1FFPB 4KHTH 1TXKA 2YPLA 5D6DA 3ZKMC 1T5XA 5HVGB 4JVUA 3FFCD 6FABH 5ESQB 1CE6B 1M71B 1YC8A 1WBXA 2ITCA 5IP4A 2L7JA 4FFWD 2XN9A 4S1RL 3D3VB 4G42B 1PGRB 3QJFB 2EE9A 2W0PA 1CFNA 4MX7B 4N8VG 4U6YA 4U3CA 4TNVF 3T0ED 4S10A 5DK2A 5C07B 4YQXH 4LBEA 2PTTB 3KPQA 4MAUH 1DVFC 2IADA 4YFLF 3QRGL 1IGYA 1NSNH 2Y07L 4PGCA 1SBSH 5EC2A 1HYSD 3WIIH 5JDSB 4ZD3L 4PFEA 5DMKB 1ZTXL 5T3XL 4YHZH 4LHUG 3U36A 2P7TA 5DURB 3DV4A 4YNYA 1FBIL 5JOEA 4XB8A 4OSUL 3HZMA 3S98A 5DUPL 1XF2B 1RMFH 1WBYA 3ULUH 5C9JB 3PV7A 5FYKH 5D2NB 3RDTC 1JGEA 4KH2A 4K9EH 5IMOA 1T2QH 4N1CA 3TBWB 2EDEA 2IALB 3MYJB 3W0WD 3U9UA 3TP4A 4ODXB 5HGAA 2Z8WC 3EYSL 4E0RA 4L8BA 1YJDH 2OCFD 3MRLA 4OLZH 5MEPA 3R0MA 1QLRA 4Z7VA 4ZYKB 5GS3A 1X5KA 1KG0A 3MRCB 1QSED 3MFFA 5ITBH 1OAXH 5DK0A 1EVUA 3NH7H 1FC1A 3ALWA 5D1QA 2HFGH 3U6RB 2EEBA 4WTZA 3KHQA 1QACA 3CFKA 1A0QL 3QIBB 4GKOA 3UPRA 1PX4A 4XPFH 4KK5C 5EU5A 4TNWF 4PG9A 2K9UA 2CKBA 4JRYB 5F9WC 5J1AB 2B4CH 4PGBB 1RAMA 4F15C 4DJMA 4RQQB 4PJBF 1JHTA 1DE4A 3QZWG 4B41A 3JV5A 4G5ZH 1T03L 2A77L 5C0FB 1TMCB 1UJ3A 4UT9L 2R1XB 5FGBA 4HG4K 1D7FA 3GUTA 2QSVA 2MSPA 1WTGT 1D9KC 1CXHA 1OTUD 3HI5L 2EC8A 3TBYB 3O3UN 1WV7T 1GRWA 4PRPB 2Q76B 1A3LL 1AI1H 3CVIH 4A6YL 2VZVA 4HV8A 4ZUWB 2HT3C 2N1KA 3VJ6B 2AJZB 4QY8A 1Q1JH 1GGYA 2OTPA 4MQ7A 4JLRA 1TVBA 1CN4A 3HAEB 4JDZA 4HKBB 3Q3GA 4QOKA 4OZFG 4LVOC 2NY0D 5CGMA 2VQTA 5T3ZL 3WFHA 4FQJL 2WV3A 3V5HA 1VADA 5EG6C 3V7AG 1VFAB 3VH8G 5DFVC 4R2GB 3IU4L 2CK2A 1UYWL 5HVHB 3U79A 4F7TA 1PG7X 4D3CH 3PP4L 5JPMB 2HVKB 3T08A 2OLDA 4U3HA 3X14A 1GGBL 2XA8L 2I9TA 1FFQA 1A1NA 1C5DB 3NIDF 1WTLA 5F93C 1A6ZB 3K3QA 3V6BR 4KI5F 5E8PA 2V2XB 4ERSH 4OCNC 2VNCA 4M8VA 1KCVH 4KHXL 4IIQA 4WI2A 1UCBH 1F3DH 3N1PC 3IXTA 4Q9CA 5JDJA 1JRHL 3KXFD 4U6TA 5D6DC 4EQ3A 2XWJA 1I8IA 4QF1A 4WRLA 2ZZUT 4NRZA 1AGCB 2DLIA 4W70A 4IMLA 5BZWB 2GHWB 3LKOB 3SOBH 4DKEL 1F5WA 1HKLH 4TVPL 3CFDA 4JANA 1HZHL 3FN0L 3TPUB 3VRJB 3IRPX 4LQFH 5F72S 4CAGA 5KSAD 5E9DE 4U7SA 5GS1A 5DJ0B 4M5ZL 2NXYD 4DZBB 3DXAA 2R1WA 2DYPA 3WN5C 4PJEE 5IW6B 1MQKL 3TBVA 1IGJB 1T5WA 3QXWA 1G7QA 1I7RA 3RZCC 2X2YA 2WLZA 1IC7H 1S9VA 3V52H 5CWSB 4JO3L 4GUPB 3OKOA 3IDIB 4LF3A 2P44B 1U8LA 1R3LA 2MWCA 4PLJD 4FQLH 1H15A 3VFMA 3U4BL 1YEEH 5GSRB 4Z5RB 3BSZH 3KPRE 3LSOA 4E41B 1M1SA 3QA3A 2R2HA 1DEDA 3ECBB 1HHIA 3RY5A 4HZAA 3ARDD 4PRDB 4YDJA 5DDHA 4PJDF 3I02A 3I6GA 2F19L 3L3IB 5KTEL 2XOTA 3O4LE 4XAWL 4K3JH 5T1KD 2PO6B 4ISVB 2IFGA 2W92A 1G9NL 1CLZH 3F58L 5GRYA 3QUYB 5H2BA 4C59B 5D1QC 2W65A 3SDAB 4OZHE 3MRJA 3SCMA 1KJ3H 1EEZA 3F6LA 4FZEL 2E7HA 3JV0A 4HUNB 1NCAH 4LL9A 1BX2B 1V3JA 4KI5D 2AV1A 3LKSA 1MCOH 1EMTH 1WCQA 4L29A 4WY7H 4MD5A 4UTBL 4R4NC 3VGAB 1DUYB 3FO1B 5J6HB 2P24B 3TH2T 4OJFL 3QJHB 4L4VA 2ADFL 5GGSA 1OAKH 5GZOD 5MERA 3UTTD 4I1NB 5A2FA 5EBGA 3D39B 4J6RL 5DUML 3H7BA 5ISZB 5DQ9A 1C8PA 1UJ3C 3B8SA 4JFDD 2Q8AL 2I24N 5E5MB 1RUML 4CDGC 2XRAH 2QHRH 4EUPH 3DVNA 1CD1A 5ENWB 4DW2H 4C58B 4FQHA 4LLWB 5C09A 5HDBF 3U4AA 5GS0C 1SVCP 3IFPB 1MUJB 4TPRL 4CKVX 4PRIA 4BH8B 4RRPA 1G7HA 3EO0A 1INDH 5D7JD 1VKXA 4IOFD 5GGTL 2JK5A 1N5AB 4L4TE 3O6KL 1D6EB 1RD6A 2UVFA 3P4MA 1UEYA 3G5XA 1U8KA 4PJIF 3C8DA 3QXVA 2WWKT 1RZJC 5F6HJ 4HIIB 1N5YL 1MHPH 1WAAF 5CLTA 3CZJA 4P23D 1UA6L 2IH1B 4HAGA 3RI5F 4S11A 3U7YH 4R4BB 5HHME 4GG6E 1MH5A 1I9EA 1U8HB 3SN6N 2R0KH 2D7QA 3LAFA 2EH8H 2J88L 4JFOB 4FFYH 4NWTL 4O02H 5IK3A 2YK1H 4L9LA 4C56B 2WINA 3NA9L 4GT7A 4P4KA 4AK1A 1VGEH 2ZOLA 1DANT 1GPOH 5DJZA 1JGDA 3CSGA 1IGIH 5SWSA 1I4FA 1KN4H 2GCYB 5TGBA 4IS6B 2YMXL 2I60L 1TZHA 1BF2A 4J2XA 4XI5C 3W39B 3H0TA 4X5WA 1S78C 5DJDA 4XWGH 3MZGB 1JPGB 1G84A 2I07B 1C12A 5FFLA 5AZEL 4H0IA 5ICXA 1QD0A 2OYPA 3TO4B 3BP6A 4RX4D 5GS1C 4Y2DB 3RL1B 5IG7B 4R97B 4DZ8B 25C8L 4X4XA 5GHWL 5FV1L 3SGKC 5FHAL 4F2MA 3FAWA 5MI0B 3MV8B 2VZ1A 5JHDD 1JZ8A 4MNGE 2BVQA 5I73C 1A6TA 1CGUA 3LQAC 5T1LA 5I16A 4LLDA 5D7IA 5HHPB 2GSGA 5D70H 1MF2L 3IU3B 4XP4H 4UQ2B 3QDMA 4NN5C 3S9DB 3BPLC 1II4E 3E8UH 4RGNE 1A7NL 5K9OA 5DRXB 2W0FA 1JZ7A 2X9YA 1TZGH 5H94B 5HHOA 3A6CH 5HHVH 2IAMD 4FQ2L 1UQSB 2WIIA 3RNKB 4JFFD 3FTGB 1MHCA 1GHFL 1IGTB 4XGZA 5J11B 3UMTA 3FFCE 3RNQA 3V6OA 4I18B 4KUZH 4NM8L 5J6GB 4OB5L 1W72L 2ATPB 3MJ8B 1PQZA 3HCVB 3MLWH 2O26U 4TUJB 3KYMB 4F8QA 2X44D 4Z0XA 1CG9A 1ZSDB 4QRQA 5F96L 3SCMC 2R39A 1UWXK 1XR8B 4IHOB 3T0EE 3ZTJH 3JTTA 4NQDE 1E4XH 3GMNB 3C8HA 4ZOEA 3MLVH 5FKPA 1VACB 5JPNA 2R9HD 3D85D 1ZA3A 5C3LD 1XIWB 2K3TA 5F7YC 1AIFB 3FB8B 1Y6MR 1T4KB 1KTDB 1RU9L 1DBKL 4WO4D 1YEFH 3HE7A 1I9RH 4CW1A 4OZGA 3NAAL 4GMSL 4HUXB 3OB0H 5D1ZB 1LK3L 1HE7A 2X4UB 2DQIH 3QO0A 2BNRA 3HUJB 5TE4L 5D6CA 3A6OA 3N1QC 3AUVA 3W82A 1PLGH 5JW3L 5KSUB 2A73B 2XTJD 2KQMA 4JFPA 2E27H 5D7KD 4JFZH 4PJ5B 4U1JB 1CYGA 4LPTA 4BH7B 3W0WE 1MFAL 3JUYA 5DC9B 1FPTH 1JMXA 3SKOA 1WK0A 5L0QC 1NC4D 3TWCH 1S7QA 4PRHB 3RJQB 1U41A 2R29L 3V0WH 1QSEE 2EDKA 1YECH 4N8VA 4MGXA 1CDHA 5EIQA 3G5YA 1CXEA 2AK4E 1QR4A 4DN4L 4XNYL 3SY0B 5MEQB 4W6WB 2XWBA 3ZHLA 2IQ9H 1S7SA 3RPKA 4M62H 5DTFB 1JK8B 3O45B 5JW5A 4JDTH 1RFDH 3MRQB 3GMLB 1OTTC 1CS6A 1F6AA 4L9LC 1WC7B 4W6XB 1AC6A 5I1JL 3HNTH 4P4KC 4P5TA