4OCWL

Crystal structure of human fab cap256-vrc26.06, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
211
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGSTSKIGQNSVSWYQQLPGTAPKLLIYENDRRPSGTPDRFSGSKSGTSATLAITGLQTGDEAEYYCETWDGSGGVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CAP256-VRC26.06 light chain
total genus 39
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwL01
1NEZG 3DV6A 5BW7A 2XA8H 1KPUB 3UJJL 4WJ5B 4M1CD 3UTPD 4D8PB 3FCTB 4ZODA 1CLZH 3L3HB 5T1KA 4QRRE 1MHHA 5D7SL 3ULUE 4WHTA 1BGXL 3VRJB 5J6HB 3U83A 2HTLD 2DJ4A 1KG0A 4PGDB 4X7DC 3KVQA 3HC0B 5DMJB 2FX9H 3MCKB 2BOBB 3GIZH 1H8OA 3MLVL 3VI3E 3QNYA 3SE8H 2W65A 3VGHA 1I8LA 4OUUB 1WCQA 5C0RH 3IDGB 3V4PL 3SBWA 1MCRA 4QHLA 1MJ8L 5DD0L 3LCYA 2C9AA 4XCFL 4DKEL 4WHTB 1LILA 3RX7A 3TNMA 5DWUL 4HFUL 1W2KT 3CFEA 2EH8H 1A1NB 3CVIL 5IT2H 5H2BA 1W72H 4FXLA 1RJZA 4ODSH 4X5XB 3O6FD 3WIIH 4JN2A 3RNKB 3SKJH 4ZQKA 5JW4N 4FFVD 4CAGA 4TOYL 1XCQB 3TCLA 5DQJB 4BKLA 1RJYA 2WINA 5D5ME 5LCVH 1EMTH 2DQUL 4HS3B 5JXEC 2VR9A 1R3KA 1PSKH 3PL6A 4FFVC 3IFLH 5AZEH 1X4ZA 4XP9H 4NO5A 2H9GB 3O2DH 4G7YH 5GISH 5DA0B 3UPCA 5GGRA 1WFTA 4L4VA 3GI9L 3WFHA 3GKWH 4HS8L 4MAYB 1IGTB 2DBLH 3MROA 1RFDL 2YEZA 1CL7H 3LKPA 4LCCB 3VXRE 3G6JA 2VQ1B 3EDDA 4LCWE 4UT9L 3E1F1 3TN0D 2ZUXA 3I6GB 2YSSA 3TPUB 5JLZB 4W4OA 4O5LH 3BW9B 4WCYH 3GMMB 2BCKB 5HHPB 1U95B 3QDJE 4IMLA 43C9B 3MRKB 4NRYB 1ZLWH 2HTLC 2N4IA 2ADGB 3BPOC 3GUTA 3BDXA 5MEQB 2X4OA 3DIFB 1B2WL 4ERSH 4F7MA 1I9EA 3I6GA 3RX5A 3ARVA 4TUOA 2P42B 3PHOA 5JLZA 4I0PC 1HSAB 4HWZB 4P5MA 1G0YR 4XGZA 2VLKE 2E6QA 1D5ZB 4P2RE 2FX7H 2RAMA 2Z31A 3WN5B 3EDFA 4BH8A 1FGVL 5D2LE 5IF0A 1HYSD 4MSWB 3HPLB 2X41A 3GMPA 4LLYB 5F1NB 3H2WA 1FZOA 4UIKL 2I60H 5D5MF 5I1HH 1HKLH 4M8VA 5IJKA 2B1HL 3EJYC 3BJLA 3BZEA 5KS9A 1DCLA 2X4NB 3V5DA 5DDHB 1CE6A 5AWNL 1NCTA 1IKNC 3FAXA 3WHXB 5L88H 4Y2DA 4LCIH 5GGTA 4N8PA 1NKOA 3T3MF 1UZ8B 3HE7A 4PRHB 5IVOA 4IRZH 3QXUA 3BPCA 1SMOA 3MUGB 2PW2A 4S0SD 2NYYD 1QVOB 5JOFA 2CRYA 4CMMA 4YXHL 3MV9B 3EO9L 2Q8BL 3N9GH 4FFYH 4K9EL 4KMTH 5JW3L 2OBGA 3DX7B 4OCWH 3QXAB 4LGSB 4PJ5A 3CMOH 1JF6A 2R2EB 2CMRH 4BSJA 2LAGB 3BPCB 4Y19A 4XZUB 4YHNB 3T0EB 2RQ8A 2CRIA 1LP9F 4P4KA 2JCCA 4UB0H 5MEOB 2VWEC 2JCCF 3QDMA 5DJAB 3HAEG 2Z0BA 3TVMC 4JHZA 2H8PA 3VXSA 4PLJD 5EDXA 1XF4A 3RWGA 2NW3B 4EBQH 3E8UL 4WTZA 1J05A 5I1IH 4OFDA 3NIFE 5HHVL 3PWVB 1WISA 1JNLL 2Y36L 2CLZA 5GRWA 3MRGB 3P2TA 4LSTH 3HR5A 1LE9A 3O4LD 4W6WB 4YBHA 4JPKL 4TSCL 3MREA 3LZFL 1PYWB 4NC1C 5DR5H 1GRWA 4KJQC 2AJ3B 4IOFC 4G8EA 2WWMD 4MA8H 4YQXL 5CCKL 3ROOA 4NP4H 4Y5XA 5E6IB 4IMLB 1MI5D 4G8GE 3SGKC 1C5CH 5MI0C 1DQJA 1NDGA 3UBXB 5B38G 2P7TB 5MENB 2R0KH 2NR6C 1FVCA 3QWQB 4MAYD 3EJYD 2YPVH 1RUPL 2Y25A 3WJLA 1YEHH 3I9GL 3MRIB 2D3VA 3DUSB 5GRVL 4JLRA 2AJ3A 3GNML 2AP2A 1Q1JH 3ROOB 1F4WH 1GGBH 1IQDB 2VITB 2VZVA 1AXTL 5E9DB 5C0CE 3UJTH 1KJVA 4BH8B 4HUWB 4PV9A 2Y07H 1VADB 2VE6B 3QWOA 2ERJB 5CEZH 2XKUA 4LLQB 1YA5A 4N90D 4MXVE 3TBYA 1NCNA 3ZO0A 2D7TL 3C60D 5BOPA 3T1FA 4JY6A 3WHXA 2P5WA 1J9CT 4TVSa 3UTZA 1HILA 1KEGH 5D2LA 2HLFD 5F9JB 3VWJD 4JFZH 2ZUVA 4ZUTB 5EU3A 1IRAY 5IB5B 3B9DA 3VD4A 4TRPH 3SDXB 5JDJA 2OTWA 1KCRL 2O5XH 5GS2D 2DI9A 1E4WH 4Y19D 3K4ZA 1QRNE 4O02L 2XTLA 5GS3A 3QDMD 2RJMA 4OFVA 3T1FB 4JDTH 3TZVA 3GSVB 3O6KL 2FJFB 3VW3L 1TTGA 1J5OH 1FH5H 5GHWL 4JM2A 2F54D 4DN4L 5C6PB 3W9DB 4Z6AT 5DZOA 3MBXH 1GOGA 1P7KB 3OQ3B 4BQCA 2NXYC 2X70A 1AGCB 3JV6B 4L8BA 5IUSA 3QUML 3V5KA 3JZ7A 5I16B 1HHJB 1B3JA 1J0ZA 4NWUL 4NZJA 2A6DB 1WWCA 2WWMC 4ZFOL 3AY4A 4V1DE 4KK8D 3L3JA 4HFWA 2FBJH 4XMLH 4HCRL 5MEPB 3KPOB 4JO4L 1UKSA 2DQIL 3HG1A 2Y5TA 5FYLD 2EYRA 1BREA 2WUBH 2ATPB 5C0AD 5L8KB 4YDJB 4WTXA 5CIPH 1WGOA 1PVHA 3RIAF 3MREB 2VDKH 4QRQB 5K9QG 4CDHA 3NMEA 2OL3H 2WK2A 3DX8A 1HWGB 1N0LA 2UVEA 1UM4L 4WDIA 1A7PH 2L0DA 1WC7B 1AR1C 1FAIH 1I7RA 3DGCR 3QIBA 4WI5A 2FEDD 3RX8A 1D6EA 5CZVH 1F42A 4OZIF 1KJ2A 2IAMA 4Z78B 4OT1H 4Q9RH 1DQJB 4OZGB 3ULUD 4DJMA 3VXUD 2ARJB 3QH3B 2EKSB 5DZNA 2NY6D 2UY7A 3UTQB 3S98A 3RAJL 5IB1B 3FO1A 5K9KA 4Y2DD 4OGAC 3SGDH 1PD6A 5CBEA 1H5BB 3C60A 4HWBL 5BMFH 4LK4A 2EKJA 3FT4A 5HHME 1IKFL 3OPZL 2XKNB 3VGDA 2NY5H 2A9NL 4N8CL 4LFHG 2A6KA 5IQ7L 3O3EA 2B2XL 2QV2A 2IANE 1KJ2B 4B53A 4GRLA 4S1RL 1P4LA 4W70A 1OW0C 3QO0B 4JO1H 4M03A 1ZMYA 1KXVC 3QQ4B 2NTFB 3JVGC 4APQD 5J11C 1U91B 4DGVL 2VUOA 2HTKC 2EDHA 1MEXH 3R4DA 3FFCD 3FZUC 3PABA 1LO2H 1YPZF 4G8FA 3EUUA 1G6RL 1Z5LB 5B38A 3RUGF 5EU3B 3U0PB 4LL9A 3VFPA 4KVCL 3TNMB 3T08A 1RZ8A 2BNRE 3BYYA 2MJWA 3VGAB 1P7QD 4P2YA 1Z0NA 2HYMA 1KB5H 4FQPA 1BQHA 4DQOL 4WUUB 4C56E 4F8TA 4OV5A 2ICWB 2A9MH 1TZHB 5ENWA 2FIRT 2YN3A 5FB8A 1ZXQA 4XPFH 4ZQKB 1BF8A 3H42L 4G8FB 2C1OB 5KN5B 3O6FA 4BSVA 3P3YA 3ARDB 5ETUA 3OSKA 4PJFE 4UU9B 5HVWA 1LEIB 3BESR 3VFVB 3VRIB 3RJQB 1W72B 4KI5F 1JPSH 1SJHB 3U4AA 4HMDA 3KPPB 2BSTA 1SEBB 1BFVL 4LKXA 4TSBL 1JHTA 1NBVL 3J8F7 5T3ZL 2HN7B 4MNQD 1I8KA 4FZ8L 1BQLL 3A6CH 5SV4A 3G5YB 4QF1B 2YC1B 3BH8A 3PWPB 3NFNA 1BQUA 1A14L 1Z3GL 2P8MA 3FB5A 1JRHL 4U1MA 2H9GA 1NUFA 3NCMA 4YBQD 2MCPH 4NJ9L 3ULSA 3U7WH 4IDJH 32C2B 1BQSA 4ZSOE 5HHXH 4X5LA 5ESVB 2F8XC 2BOCA 4TNVK 4CN1A 4X6CE 4PRAB 3UBXI 2HG5B 4HLZH 4JY4B 3ZYZA 3EO9H 3KYOB 4OZHB 5DURB 5IG7A 2ZUQC 2XYCA 1NAMA 5MP6L 3IYLW 1AY1H 5C09E 4NRYA 1ZTXH 5I18H 2Q7YB 4X6DB 1T89C 1G7HB 1HH6B 2FZ3A 1KLGA 5DGQA 3UTQA 4IDJL 3GIVB 4ELMB 4AT6A 5DHVB 5J1AA 1BQHG 1IGJB 2BVOA 1UWXH 5DJ8A 1UQSA 4HV8B 4OGXL 4UUJA 5GGSB 5IV2A 1VACA 4LCYA 2I60L 1N6VA 4HCRH 1DVFC 4JZNA 5K9JH 1EIBA 2XKNA 3KPQA 4QKXB 2MPAL 3MUHL 2FATL 2Q7YA 1G7LA 1P5VA 2A6IA 2V6HA 4PRPD 2WBWB 1NL0H 1GGCH 2ED7A 2CKBL 4G6AD 5TE6L 3GRWH 4MLSA 2XZQH 4IRSA 3DROA 4K9EH 1XCTA 3FQUB 5B38B 1VFBA 2O5XL 1R5VB 3DXAA 5DI8A 3O6KH 1AHWB 2KDGA 1F3JB 5ID0B 4OQTA 4JE4B 2J6EA 2P46B 5TE7L 4GW4A 5AD0A 5DJ0B 3GK8H 4AMKL 2H1PH 3QBTB 2LE9A 1G1CA 2EXWC 2VB5A 5BJTB 5ENWB 1S7QB 3NIDF 2GTZB 2VYRE 4MJIE 4JFXB 1BP3B 1MY5A 2BNRA 3NBNA 1ZANH 5DI8B 3OKNA 1BD2E 1LEIA 3EFFB 4XMLL 4MJ6B 3UTSB 1AHWC 2QQQA 3S37X 2X9YA 1FGVH 3BD3A 2FWOB 1ZT4B 4AEEA 3FO2B 4GQ9H 1RURH 4LHUD 1J05B 2DTMH 5F9DC 3L3GA 4G9FE 3BUTA 1UH4A 1DQDL 4U1MB 3C2AL 4YHZH 4H1LG 4M9OA 3T65A 4L4VD 1AP2B 2ADJA 4UBDC 5D72H 3MRPB 4MGXA 1K5NB 3EFFA 3O4LB 4GT7A 2MFNA 4PJ9B 5DJXA 5AUMB 4NO3B 2GFBB 3W0WA 5C07B 5IHZB 3CCHA 3LKQA 5EU4A 4LPVA 3QRGH 1FG2A 2VAJA 4G8EB 4HC1A 4JQXC 3L3GB 2YD1A 1I3GL 3RPKA 5E6YA 5DC9B 2AV7A 2B8OT 3GMNA 4OFYA 1C12B 2VXQL 1BD2D 1KB9K 2XWJB 4FTVB 1Q8MA 3BSZH 4LVOC 5AUMA 5DHXB 5I1JL 3H9YA 1FJ1B 5I1IL 5EPMB 3WIFA 1DBJL 3HZMB 1CFTA 5AZ2L 4B41A 4X98A 4NCC2 4OZFB 4KHXH 5JO5B 3H7LA 1KYOK 1S9VB 4F57L 4LVHC 3P9MA 4EZMA 2Z8WC 2V5TA 5EC2B 4Z7QE 2AQ1A 1P7QA 3VFTA 1FDLL 1D5IH 5F7KC 3UPRB 3EOBA 4YUEH 5ICXA 3NA9L 2A74B 2UZXB 3C6LA 4M61B 1ORSA 1EBAA 4GKNB 5BZDA 4ZUSA 5TDOB 1A9EB 4L29A 4QHNA 3BP6B 4X6BB 2YN5A 1KIPB 1DDHA 4ORGA 1HQ4A 3IJYB 3BGAA 3BWAA 1YEGL 3FQTB 1ZAGA 2F74B 2NNAB 3IAQA 2BHYA 3N9GL 4FFYL 4OZGF 7CGTA 3OKLA 2YK1H 2C7UA 4MA3B 1I1AB 2NTSP 4GKNA 5BZDB 2PO6C 3QXDA 4U6VH 4I2XB 4JFOA 1WIOA 1CD1A 4YHPB 2GTZA 1AGDB 2CR6A 3GHEH 3HMXL 3STZA 3CFIC 2JK5A 4OM0H 4NO0A 5IW6A 3BPNC 1OD7A 4QRPD 3ARBA 4NKDA 4IMKA 4P99A 5TE4L 1MI5E 4BYHA 3T4AB 4NBYB 2AJZB 3V7AG 4CADB 4M3JA 2J2ZA 3B8YA 1CD1B 5DHYA 5F44A 5TF0A 5JQ6L 4RMUA 1YPZB 1Q9LA 2ATKB 5EUOB 1UM6H 1T1YB 1XIWC 1TCRB 2X5PA 1A3RH 1QSVA 4ETQB 3NCYS 4H0HB 2EECA 2OYPA 4ZD3L 4KRPC 2GT9B 3CCHB 4NP4L 3PHQB 4LSPH 4QTHB 1PJ9A 1UJ3A 1H9VA 2R9HD 4LHQB 4DKEH 6FABH 4QTIH 5KSAC 1QFWL 4MXWL 4NUJA 1V3LA 4JFPB 1JIBA 1NJ9B 3ZE0E 1WBYB 2ZCKH 1XIWB 4HF5L 1IGCH 1C12A 4EUPB 3UZEA 4XBGB 5BXFA 2EXYD 4BA8A 3RDTA 4LNVA 1Q9WA 1KCUL 4ONHA 4M6OL 2ITDB 4NM8H 4L8SA 5DD1H 5JO5A 1ZVHA 1NMBL 3ZDXF 2OTUB 3KDMA 5B4MC 5GGSY 2ICWI 2DQUH 3QDGB 1A0QL 2JIXB 2A6KB 1SY6L 2EDFA 3P77A 4WWKD 4YK4B 3QNZB 2IBZX 4HQQH 5D8JL 4MQ7B 4TQEL 2VIRB 4EOWH 1XF5A 1JRHI 5ACLA 3ULUF 1XF1A 3DGGA 5EO0A 5GRVK 3FTGB 2ITDA 1HCFX 1U8PB 5F7HA 4WO4B 4LAQH 4PP1C 1INEL 3X12B 3K8KA 3CDYA 1JGVL 5JOEA 1IFHL 3MLYL 2BDNH 4K23H 2JB5L 5INDA 2AXFA 3F58H 3HZYB 1ZV5A 3K4DA 5T3XE 2DQHH 4HIXL 2GJJA 4Y16A 3RWCA 1A3QA 5L0QB 1QPXA 3VDBA 5F7YC 4WI8A 3MRLB 1BHGA 5J56B 2MSPA 5J12B 2EDOA 2ADFL 2ZG2A 1KENL 1AI1H 3WNLA 4IOFD 5CP3A 5DJCB 3ZE2F 3RWEA 5HYJA 4HIHB 1BFSA 3TH4T 1T1WA 3HZYA 1MJJA 1MSPA 2APVA 4RDQG 8CGTA 1SEBA 5C1MB 1NCBL 2DKUA 3L3KB 1HK6A 1AI1L 1FLTX 2PF6A 4UT6L 1AGEB 4R3SB 3FB6A 1U8JB 1ZHNB 4PREA 1I9RH 1EMTL 4RMRA 4RGNB 5C08A 3C6SA 3OXRA 4E41D 2NPLX 4NUGH 1CF8H 4HEPG 4KUZL 5C0AA 3C5ZB 3EYSH 2VDRH 4JRXA 4H5SB 3X13A 3DMMA 2QQLL 3IDIA 3WS6A 3QYCA 5I1KL 4QTHA 4WFHE 2R56L 3UTTB 5ESAA 3M1BA 3QIBD 5T5NG 4M7JH 2EYSB 3SE8L 4HFUH 4PG9B 4JFYB 4U0RB 4AIZB 4ZMAT 1NGYA 4HQQL 1JZ2A 2KL6A 1QBBA 4X6DA 1RZGA 4GRMB 1RUKH 3IVKB 1JGLH 5FXCH 4R7DB 3PP4H 4E9LA 4P2RD 2ZWLT 2DKMA 2IC2A 4KK6D 1UQSB 3FN0H 3BMWA 3IDIB 1CN4A 4NCDA 3QHZL 3VXMB 5BS0E 1EZVX 4M7ZB 4X4YB 3ZYOA 3B6SA 1JL8A 2BVQB 4U1KB 2GK2A 4IHOB 4XXDB 5DD5H 3ULVE 2HH0L 1T03L 1V3MA 4NT6A 2A2QT 4LPYA 4NRZA 4XP1H 4YJZL 1A3LL 5ACZB 2KUTA 3BKYH 2ZCKL 3WUWG 5IEKB 4WW2B 1KN2H 1U3HD 5DSCB 5HPOA 4G6AC 3JV4B 4FQIH 1JE6A 3V4VH 2CGRH 5K59F 2HVJA 3CSYB 5IFAH 4HSQA 3VA2C 2QEJA 3O81A 5JORA 1BVLA 3MV9D 1H3TA 1FLRH 3H0TA 1JWUA 3OKDB 3GSXA 4QHKJ 5TFSL 1A1OB 3FO9A 2R2HB 3H9HA 4U1NB 1JTTA 5D2NB 2FGZA 3HMWL 4XHJD 4XCCH 4L8CA 1BBDL 4NQSB 4JHBA 1TFHA 3P73B 3L7EB 2DI7A 1OT1A 3QFJB 1L0XA 4MJID 5JORB 1KLUB 1T4KB 3QEQA 2XPGB 3S36H 3TYGL 3HNVL 4L4TD 3SJVE 2F54E 4HIHA 1U92A 5IR1A 4P5TC 1CBVH 25C8L 3DIFA 2HRPH 3K46A 1BD2B 4L8CB 1WWBX 4P2RB 5HY9B 4QHMB 3QUXC 3ZZ1A 3NN8B 3HFML 4R3SA 4MS8C 1B4JL 1NC2B 2IQAA 2QQLH 4P5MB 1EEYB 4K23L 3TIEA 4AEFA 4C56A 3CIQA 1T66D 2ZKHL 4IIQA 1OCWL 1INEH 1L6XA 3NZ8A 3QEUB 4XP6H 5TF1L 3MYJB 1PEZA 4R7NB 3SDAA 3QRGL 2HMID 3HI5L 5DLML 2OMNA 1X3DA 4P2RA 5E94B 3MNVA 5I8CB 5F89B 4D0BB 2CKBB 3JWDC 4PJ7E 1XF2A 5FOJA 2DQFB 1ZT1B 5E4IA 2VDMH 4WV1C 5C0RL 1XGUA 5C9KA 1GYAA 1VKXB 3A6BL 4MNQA 4PJIE 3BQUA 4YFLI 4XRCB 2HFEA 4EJ1C 5HYIA 4HJ0C 4OCSL 4JHWH 3EYUH 4O2FB 1A0QH 2AQ3A 1C5BL 4YPJA 5L9DH 4QHKI 2OMBA 5SX5H 4AEIL 1HDMB 1GOFA 3U4BL 4Q9QL 2QKIB 3VCLB 4JB9L 3JWNC 4KDTC 4XZUA 3VXSD 1HEZA 5J13C 3QDMB 5DJAA 3D0VA 5CEXB 2BXYA 1M7XA 5D7IF 1N0XL 1C5DA 4PBWD 3MGOB 1JYXA 5TDOA 1VGEH 4TULH 3FT2B 4M1CC 5E00B 1YEGH 5HYQB 3O2VL 4HWUA 3GSQB 1B90A 1HDMA 1OTSC 4WW1B 2CSPA 2PR4L 4PRID 4PUBL 2R4SL 3U36A 2FX8H 4HJJL 2QKIA 3QR2A 3HE6A 4UIMA 3H0TB 2J4WH 5JA9A 1EEZB 4MX7B 3S88H 5JNYA 1F3DJ 4YDVB 3FO9B 3QCVH 2XWTB 5E8DH 3I50H 3LPGA 2FDBP 4ODWB 1ZLWK 4Z8FL 4POZC 3VU2A 2G5BA 2EE3A 5DC0A 2GTWA 5H37G 4L1DA 3MRBA 4IS6A 5LAXB 2J8HA 1EXUB 1EJOL 1NFKA 4EKXA 3OXSB 4HKXA 5BRZE 3BE1H 2J1KA 2EYTB 5I0ZA 3BP5B 3A6OA 5DJDB 1K8DB 1EHNA 3RY4A 1KF9B 2X1OA 1FZKA 1EFQA 4GXUN 1AGBB 2ZJSH 3IFOB 4N8VA 4P4RA 4W81A 2MMXA 4Z95H 3REWA 4QO1A 4I3SH 3U9PL 3GBML 1P7HL 4WTWA 3MGAA 1HINH 5EUKA 1S7SB 3MUZ1 2R56H 4OLXH 3W9EB 2DQHL 4HIXH 2AK4D 1XT5A 2YD2A 1OAQL 1FSKC 1QR1A 3PP3H 5MERA 4FN0A 1NEUA 2IH1A 3V4UH 1AIFA 3T2OA 3KPRE 5ECJE 3TO2B 4HKJB 1JNHA 2FHBA 5IVXF 1LD9A 5EZJB 1PKQB 4LSQH 4J6RH 4LCWA 4M7KL 2HJKA 3EO1A 3INUH 2P5WB 5KSAD 3B2VH 4Y4KD 1QBLL 4OQTL 1TCMA 2LV4A 3MMEA 5FCUL 1RUMH 4UINH 2GYSA 4MNQB 1DQMH 4JZJB 4P46C 4XH2B 3PL6C 3SO3C 4K3JH 5EFIB 1OF2B 4ONHB 1ZA3B 3ZE0F 3QXVA 4PRHE 5DK2B 1T6WA 4GG6E 4XWGH 4ONOA 3GSVA 5IMLB 2CH8A 1RY7B 2X40A 2XNAB 1BZ9A 5CP3H 5I66A 3T3PF 3TJHC 4FG6C 4APQB 1PW3A 4MNGE 3QQ3A 3F12B 4JR9L 3MLWL 3H9ZA 4JO3H 1TJIL 1LO3H 3OWEA 3QJHA 2EDJA 1CXFA 1OSPL 5D7JA 1RZ7H 4TTGA 3ILQD 4N0YH 4L3EE 4F15B 4PG2A 1G7JA 3P9WB 1BZQK 5JHDD 5ITFB 4ZDHB 3MXVH 4JVUA 1E4XH 5E0QA 4AYFA 1SM3H 3T4YA 3F12A 1M7IB 2H3NB 2YD5A 2FLRT 5F7LB 2VQ1A 4DKAA 3SJVB 1FC1A 4OLZL 1F6FB 5CJBA 1FL3A 4QXWA 4R0LB 5EZLB 1M71B 5HGGS 4CN4A 4N1CA 3MACH 4HZAA 1HSBB 1G7JB 5JR1H 3F7PC 5D1QC 5DK0B 4KQ3L 1F11A 3RRQA 5EBMA 1LK2B 43CAA 3EYQC 2D31A 1DANU 1NMAH 3VMPA 5KG9A 5IVXA 4P4RB 5C7XL 5FHBL 5D2NC 3V6ZB 2KPNA 2SEBA 1Q9OB 1RIUH 3EJZD 1PAMA 1XZ0A 4OT1L 4UNVA 4Q9RL 4JKWA 2FHFA 4XPHL 5DK0A 3E6FB 3ZDYF 1MRFL 3W9EA 3BD5A 2ICEA 3P40A 3HI1A 5IESH 4K2UL 4Y4KA 5IF0B 2QHLA 3QUYD 1BWWA 2VISA 1XGPA 2D7QA 1I9IL 4MD4B 2DLFL 1FHGA 2EDKA 4WU7A 2X4NA 5GQBA 4GRWB 5ABDE 1DSFH 3DV6B 4JCMA 4HZLB 2DQIH 2DQCH 4JY5L 3FCTA 3E6FA 4QXGH 4JO1L 1NCAH 2DBJA 1CE1L 1U8IB 3OG6B 4IRJC 5FECA 1A6ZA 4GRMA 4PGEB 2OI9B 4V1DA 1S7TB 1NGXB 2IJ0C 4CMMB 1Z9LA 2I9LA 4DEPC 2X1QA 1AO7E 1T5XA 3OHXA 1LO5A 3L5HA 4WU7B 3T09A 1MCOL 2EDWA 4C4KO 4JAMA 1DBJH 3MTRA 2EE9A 4IRJD 4WWKC 2GSIB 1FYTD 4KVNH 3ARDA 4OCXL 5ETUB 3SGEI 4KZEH 1RHHA 1J5OL 3VRIA 5ACZA 2YR3A 1NGXA 5MEOA 1MIEL 2NY1D 4PBXA 9CGTA 5KS9F 1MPAL 2IMNA 3TN0C 3CLFL 4LSUL 1FNGA 4NQED 4HPYH 3SGKA 1IAMA 1CGYA 4LBEA 4YDKH 1N2RA 4F2MA 4ZUVA 1A7RL 3DRQA 4E5XB 2FHCA 3IU3A 4UTBH 2VLRA 1DBBL 4PJCA 5IHUL 3NZHL 2H6PB 2PYEB 5JXAL 5KVFL 1H15A 5IMKB 1KULA 5IEHB 5SWZB 4POYA 1O7SA 3BIAX 1JMXA 1T4KA 3QEQB 2KH2B 2HT3C 3W81A 3U4EA 1R3IL 4K07A 1KBGH 3RBSA 1NDGB 4OFYD 3UBXA 2VO5A 5I73C 2YEZB 1JP5A 1ED3B 5LVEA 3QB7C 4NZTH 1QEWB 5JXAH 4LCCC 2FJGB 2DWEB 5FGBA 3FN3A 3MBEC 1CXKA 4IEFB 1MI5B 2O5YL 4HBCL 5CZVL 1SJEA 2V17H 5EOCJ 1BAFH 4I9WD 5CZXD 1XZ0B 3O2DA 5HHPA 3WEXB 3ZSTA 4XPFL 1YNLH 4JDZB 5DD6A 1JHKL 2JJWA 1NH6A 3EKCA 4OBSA 4PJAF 4FQJL 4L9LA 1BWMA 1WWWX 4XI5C 2E9IA 5C6TL 3QG6A 2G5RA 1DFBL 2VLKA 3IRPX 4PB9H 4MB4A 3R06B 4G80A 3TZVC 1I1CA 2BC4A 4POZD 5IKCA 1I85A 1ES0B 2IANB 3RJDA 2Q20A 3O8XB 4S1RH 3MGTB 1GGYA 5GSVA 3WN5A 4JHAL 1I3RA 3MV11 1YJDC 4X80L 5GS0H 4KXZH 3CFEB 3E8UH 1BFTA 3V0AC 5K9OA 1KEMH 3FHAA 1KTRL 4HX1A 1OAZH 2GUOB 2BFVL 4ZSOA 1NLDL 4XCEA 1OT2A 4J7RA 5F93C 3C09C 1ES0A 4LRIC 5HI3C 1IAII 1YEFL 4JRXD 5IHBA 1U8HB 2F53B 1FAIL 2PW2B 3LHPH 2ZOLA 5IMMB 2HT4C 3TJHD 5CEXA 2A9ML 3C5SA 3L3OB 4ZO6A 3OJVC 4K8RC 4ZS7H 4R4BB 1NGQH 5LBSH 3QUMA 3DX7A 1MJUL 1QSED 2V5SA 3CFKB 4PJ5B 4RGMB 5IJVA 5LG1A 5D2LF 1P4BL 3FN9A 1BIHA 1KPVB 1BJ1J 1T83C 5EB9A 4ZO7A 5DVNA 4OFKA 2CQVA 4QOKD 3HG1B 1K9TA 3RY5A 4LLDB 4ZUVB 3W0WD 4G9FA 2X4QB 3PG2A 5I1AA 1S8DA 3IAPA 4QOKB 2GJZB 1OPGL 1JBJA 4OZ4A 4PJCB 3VFNB 1TVHB 1AXTH 2DQDL 4H1LA 5GS0D 5KVGH 1CVSC 2LFGA 4C55A 2NY5C 2QR0B 3LEYL 3RGHA 4XBEH 4O00A 1J0KA 1UB6A 4OZGA 3S34L 2BY3A 4PR5B 3DV4B 1BM3L 1CK0H 2QQKH 1E4KA 4X5WB 4X9IA 2DIAA 4OCLC 3LSOA 1EA9C 4PP1D 2Z93A 4ORZC 3V6OE 4D0DA 4F3FA 1RZJC 1Q94B 5I30H 2Q1EA 4TYUA 4XNUH 5C07D 3E6HA 5C0IB 4OGAD 4OIBA 5I6XC 4X6FB 5JUEH 3U7YH 3SDAD 4UI2A 3MXVL 5FYKE 3C8HA 3HAEB 3S5LA 1VGEL 2DD8L 4PRIE 3MNWB 4U0QB 3N1FC 2WWKO 4OJFL 3DUSA 4TTDC 4FQQA 4XX1G 3T77A 4HDIB 5I17A 1JGDA 1FYTA 2IALB 4JJ5A 1KIPA 1XGQA 4L4TA 3GB7A 2Y07L 3E6HB 5EH1A 2GCYB 3WFDH 2OR8A 2R29L 4OZIA 1MFDL 1VADA 2Y6SC 5D7KE 5I71B 2PKDA 5I6XB 3LVEA 1YEEH 3V0WL 3W2DH 1ZWIB 5I1CH 3UTZB 1F3RB 1WUNT 2F54B 2M1KA 2GCYA 2CUHA 4K55A 5FYLL 1AQKH 4OGYL 4X7CC 3L5JA 2VLJE 2BNQD 4Q6IB 4WHCA 4Y19B 2OTWB 4YHYB 3O2WH 3MRJA 2BSTB 1MHCB 4IOSD 4JDTL 5JTWA 4M6NL 4PJHB 5JDSA 4WY7H 1A1MB 1KNOA 5DQDH 1QRKA 1F90H 2MKWA 2FJFA 5E7FA 3O3DA 3MJ9H 2P8PB 3VGGA 2X2YA 4XP4L 5HI5C 1EFXD 4G43B 4HKZB 5KVMC 3PXJA 4Q6IA 4HUVB 3MODL 3MRGA 3PHSA 4M1DH 3NCEB 4HS3A 4KHTH 1IGIH 1AGCA 3CU7A 1QHPA 3JV6A 2FD6L 2I5YL 2H2SC 3S97C 4LARL 1HHJA 1DVFA 2ICES 3MYZA 4XVJL 4GS7B 5ICYA 3HUJB 3X11A 5A2FA 4C83B 1WBYA 4G42B 4GO6B 4XTRC 4XMPH 3D18B 4F7PB 1F4WL 1GZPB 2NXZB 4F8QA 4GKZB 5EOQH 3LV3A 4ZFFB 4WEBL 2EIEA 2M8XA 5E8EA 2C3VB 1S7UB 5L7XL 3X3GL 5F70A 3TP4A 5IV2B 3VXTB 1KJ2H 2AV1B 1N8ZB 1QSFA 1EBPA 1UCTA 5CLTA 1OTUD 1L7TL 2DIBA 1YYLH 1INQB 2CO7B 2IAMB 4S2SA 2R4SH 2VERN 5JW4M 3OB0K 3HS0B 3U46A 3ZDZF 3MCKA 4MD4A 5L88L 4S1DD 2OSLA 5EIVA 2B0SL 1QSEB 4ODXA 4PJ5D 1HXYA 1E0OB 3WHE1 3QUZD 3TT3L 1XGQB 4L4TB 1A7NH 2CK0L 3P0YH 2VXTH 4KTDL 4OB5L 1MCOH 4I0PB 1G9MH 1JYVA 2XZZA 1U93A 2OP4H 1AGFA 1EUTA 4J4PC 4GW4B 5AD0B 5DUML 4Y4FB 4NGHL 1WSST 3IJSB 1A7QH 5L9DL 4PJFB 5JR1L 2E8ZA 3CMOL 4FXGB 1QSEA 4ODXB 5E8DL 1CFBA 1U8QA 1S7VA 4IBLT 5C09D 1IQWL 1VERA 3AREA 3RUGB 1KT2B 4HH8A 4U7SA 5BZWB 2VZ3A 3BKMH 5C0BD 5JZ7D 2EICA 1WZ1L 1V7ML 4GRWE 4GAGH 4TULL 4HXAL 3LS5L 1CTNA 3HG1E 1KCRH 1A8JH 3LKSA 2WUCL 5C8JB 4JQXA 2ICWA 5JPMA 2XN9D 1NBQA 4R8WH 1JJUA 1JGEB 4XNYH 3BP4A 4KROB 4HS8H 5FIEA 3PP3K 2I24N 4UU9A 5FKPA 1IEHA 1BX2B 4G7YL 4MAYA 4U6HB 4UT9H 5FDYA 1RZKL 1SJHA 1NQBA 1FORH 4QNPE 2G2RA 2H26A 4H26A 1MAMH 3B9EA 4GW1A 1S78D 1FN4A 3HLAA 2WIIA 3S35H 1ZLSL 2YC1A 3BH8B 4KQ3H 4M48H 3AUVA 4MLIA 2AS5M 5BO1L 5C0AE 5FK9A 3LIZL 4D9RE 3MACL 3PV6A 3D39A 5D1QD 2DWDB 2DOCA 2CLZB 2JF1A 3VXUB 1JNNL 3KHOA 3LV3B 4ZUWA 3C6LC 4GRLD 1D9KD 4P57B 5IOPB 2X4OB 2I9TA 2EC9T 5K9KB 4PJBA 2Z92B 3FQRB 1K2DA 3PQYE 2HTKD 3VXTA 1MI5A 4N1HB 3MRRB 1AJ7H 4OLEA 2C4FT 4MA1C 1LP9E 1EK3A 1NCWL 5FFLA 4N0YL 2YRPA 4EDWH 1JWMB 1MFCL 4OLXL 1T0MB 2P7TA 5GZND 5MENA 5DHVA 3GBMH 3DVGB 4EIZC 5D71L 4HS6B 4XP9L 4M8QB 2FX9L 5DD5L 3RKPA 1PX3A 4NO2B 1GGIL 5TH2A 3D3VA 3NACH 3OAUL 3AROA 4ZTPL 2AI0L 1FIGL 2DL2A 4IMKC 4MXVF 3KPLA 1DBAH 1HHHB 4FQHA 1T20A 4PP2B 1ADQL 3O0RL 1YMHA 3HA0A 1F4YL 3VWJB 4I5BA 2R0WL 1QR4A 1FE8L 1C16A 3VFOB 3E0GA 3VFWB 1QRND 1FZJA 4Y4HD 2ADIA 3O6ML 4NQSA 5IIEB 5DFVC 4I0CC 5DMKB 3I6LE 4WU5B 2XOTA 2AKRB 3O6FB 4UNTA 1AXSA 3OAYK 1FLRL 4P9ML 2VDOL 4OKDA 1CFQB 3LMJH 3IT8D 4NFBA 5HGBA 5IBTL 3PDOA 4OF3A 1QFWH 4MXWH 3B4NA 1EFXB 5E08H 3WKMH 2X4UA 4M93C 4KAQH 3MJ7B 3WE6B 5FYJL 4LKXB 1KN4L 4OGZA 3D2UA 3VFWA 1UJ3C 1VFOA 3RTQC 3SCMD 1B4JH 1MCFA 2JJUA 3CJJA 3LMJL 1CU4L 3ULUC 4IRZL 3UTSE 4L8DA 1NC2A 4Y5VA 3O3BA 3B43A 3O6MH 4UT6H 2FEDC 5HYSB 4S1SL 2V5MA 3HNSH 5KOMC 1CL7L 4OCMC 2ZSVB 1T66C 3RDTC 1ZT7B 2B1HH 2G75B 5FKAA 1ZVSA 1CDUA 4BFIB 5TDNB 5DVLA 4XP1L 1S8DB 1YEJL 6CGTA 1L4IA 4Z7NF 2ORBL 2E7LC 5TE4H 3BN3B 4BELD 3HTLX 3L3DB 3MA7B 3O4LE 1QA9B 3TV3H 4BQ9A 1KTDB 3L5IA 1T3FA 2A6JB 3C5JA 2VC2L 1LDSA 4OM1H 3BQUD 3QJFA 4M7JL 1HH6A 2BRQA 1UB6B 2VDML 3NTCH 5HI4C 4TNWF 3U9UB 2BDNL 4PJBB 4PJ9C 1A7BA 4PJHF 5HPMB 4UUJB 5GGSA 3WJJC 4JLRB 3L3DA 5HVFB 4PJIA 2ZG1A 1RULH 1WZKA 3F58L 3QUYC 2JTDA 3VD9A 5DT1H 1KYOJ 4JFQB 2VXSL 1PX4A 4ETYA 4Y16C 1ITBB 3X17A 1T03H 4M6MH 4UV7H 4FQCL 5TPWL 4LCUA 1TQBB 4PY7A 5B4MD 3HFMH 1RZFL 1IGMH 5E9DE 5C0CB 3NTCL 2EIBA 3IDJA 3BKYL 4GH7B 4WFFE 5D7LE 4DZ8B 2AK1L 4JRXE 4JY6B 3RZCB 3OJMB 4ZPVB 4U1SB 1JFQL 1AH1A 3ZMRA 5F88B 3PGDB 5C0BA 4ZFOA 1FAKT 2VDNH 3HRPA 3KPLB 5J9PA 1P7QB 1I4FB 2J8UF 1YC8A 4NC1E 4Q7DA 3VFTB 4LVNC 2EIZA 4ZYKA 1A4KB 1T0NB 5LKNA 4WRLA 3FFCA 4LF3B 2EDLA 3MLSL 4WWID 2Z8SA 4OLVH 5T5FL 1SJVA 4KUCF 1CXLA 1GC1C 1X4XA 4P2QA 3MRBB 5LAXA 3RZCC 3MJ9A 4KV5E 2B4CC 3DO3A 4K8RD 1NDMA 3I6LD 2VLKD 4I13B 5A2JH 4DGIH 4QRPE 1H3VA 5SX4I 2YUVA 3WFCL 1M1SA 4QXTB 3TA3D 4L8BB 3EHBC 4XXCC 4N9OB 2F5BL 4MA3A 3EOYG 5DRNB 1CLYL 5F6IB 2L7UA 3O6LH 3CXHK 2E7MA 5BQ7A 3OBAA 2VABA 3QT2A 1U8JA 3C08L 3KPTA 1HOCA 1MCBA 4ONFL 3STZB 1PY9A 2YWYA 2F19L 3S96B 4MCYB 1DBMH 4KI5C 5EWIH 5T3ZE 5IBUB 3DX9A 4MMZC 5FKAB 4MXQD 3TIDA 4RMQA 4Q9BA 3RI5K 1SY6H 5JQ6H 4O2CA 4ZO9A 4PJFF 3IGAB 4ZXBB 4MNGB 1CQKA 5HHOE 4QRQA 5JIKA 5EZIL 4LCWB 3KJ4B 5E5UB 2NW2A 1CFSA 2VABB 3THML 3B2UD 3MXWH 4AIZA 2K7PA 4ISVA 1E4XI 1V8HA 4YZFE 3RHWF 2F9BT 1PEWA 3NGBC 3O3AB 3PQYD 2O5ZL 4AJ0A 4HUMB 3GMOA 2DL9A 2BOCB 1IJ9A 4GAGL 1L7TH 2R0LL 4HULB 3WLWC 3IFPA 2UWEB 2BNUB 3N50A 1I3VA 4EOWL 1LDPL 1YN6B 2JELL 3ET9F 3JUZA 5EC2A 4N0CD 5M94B 1EVTC 2GJ6D 3RVVC 5F7DA 3VJ6A 4D0CA 3C2SA 4G9DA 4Y4HA 5DHVH 3GI8H 4H88L 5CGTA 3C6LB 4M61A 2QSCH 3DYMA 2YZ1A 3LDBB 4LQFH 4YHOL 2BVOB 5I9QB 3RWFA 5DUMH 4LCYB 1TJHL 2R23A 4CVUA 4F33A 4QWWC 4OZGE 3CSYA 2IPUK 5ITFA 4PJDB 1OL0A 3ES6B 5EOQL 3TCXA 4U6YB 1GIGH 3GMRA 3OKDA 3MOQA 4L3EA 3D2UD 4NN7C 3BO8A 3L6FA 3SCMA 1I3UA 2A1WH 2JJTC 3CVHL 1IBGL 1DN0B 3RWFB 4K3GA 1DQLL 4ZNEE 4BQ8A 2NZ9C 4ZFGL 5L6YH 2EXYC 4IIQC 3ISWA 3NFPA 3V7MA 4PJ8A 4NKOB 5H8DA 3GMRB 4PJAA 4PLKC 5E8NA 3ARBB 4NKDB 4YFEA 1X6LA 3VFUA 1NGQL 4M00A 3L95B 3T2NL 3KLHC 3T0WA 1WBXA 4TUKH 5I30L 3QUXB 1V7MH 5K33A 5EU7C 3V6FA 4CADA 2OQJB 3NFNB 5AYUL 4OCNC 2ATKA 1XGYL 1OAYH 4OF6A 1QACA 1OAKL 5CUSL 1YYML 5IVNA 2RCSL 3WFEH 3HI1B 4IIQB 1DANT 1N26A 5HYJB 1NCBH 4G7VH 5HDQH 1FNSH 3F7QA 3NCCB 3EFDH 5AZ2H 5I74C 1DBAL 1MFDH 2FWOA 1V7NH 2EC8A 3W11D 4AK1A 5CGYD 5KJRL 4MNGA 2PTUA 2CKBA 2X1XR 2WQRA 1SEQL 3KG5A 3IXAA 1NBZB 1S9WA 1MCWW 5DS8A 4X6CB 2DWDA 3HZVA 2OJZH 4DOHE 5JOPE 5EU5B 3ZTNL 4XNXH 2HT2D 2I9LB 3QIWC 1Q9WB 4R8WL 1JPST 5C0DB 1FYHB 4KV5F 2D7OA 1CGTA 5EU4B 4JN2B 3RNKA 3G04A 3IKCB 3LS5H 3CFJA 3UTTA 1YYLL 5LQBH 1U3YA 3ARDD 1MQKH 3MSPA 1MLBB 2BK8A 3U7YL 4Z7VB 1NGWB 2XZQL 3LHPL 4R2GD 1ZGLA 4ZAKB 3C2AH 3ZT6A 3TH3T 4MNHA 1R3KB 3MRNA 3CMGA 4HK0B 4QRTA 4MD0A 3WXWH 5DUBB 3GSNH 5IP4A 2BZDA 3VXNA 1CZ8H 3BDYH 3DGGB 4KTEL 5C86A 2HKHH 4Z7WF 5C0EB 1I9JL 2Y23A 3W39B 1OLZA 1Z2KA 3ARGD 1TVDA 5I8OH 3GSQA 2J5LB 2ZNWA 3ES6A 4I2XE 1FO0L 4NM8L 2VZ1A 3HI6L 4PJGB 3PQYB 4NN6B 5ID0A 5CJXC 1B0GB 2WNGA 4P5TB 1KCUH 4XNQA 4NZUL 5E6ID 3EOBB 4WFGD 1CDIA 3X3FL 2PYEE 1QSFE 2Y5EA 1PDKA 4WW2F 3U1SH 3WO3B 1IC4L 3P4OA 3WLBB 3DBXA 5IB4B 2HKFH 5IMOB 3CVHA 1DE4B 3IRZA 2VNCA 1TZGH 3MRKA 4PJ8B 4KRPB 4N0FB 1ODAA 3SKMA 3IDXH 4AQOA 5D72L 2PETA 3KYKL 3GSRB 3CC5B 4AH2B 5C0NC 3Q6GL 4H20H 5FO9B 3QXDB 2IBGA 2MCPL 3P73A 1I8IA 3SQBA 1SJEB 2I26N 2HFFB 1FQ9C 1SJXA 4KK8C 3DSFL 4FG6D 2BFVH 5HD8D 4QGYA 3OB0H 3GJEB 3UAJD 3DJ9A 5E8OB 4LSSH 3DURB 5ISZB 4YDIL 4DK6A 4NJ9H 1KB5B 5J06A 3NAAL 3V8OA 2W92A 3C8KB 2EH7L 5GS1C 4L3CA 4LEXL 3X13B 4EI5D 4K3DL 1GGUA 2CK0H 1IAIH 1A7OL 2I5YH 2PTTA 5FM4A 1S9WB 2APBA 1EEYA 1OPGH 5GSRA 1FFOA 4M1DL 1AD0A 3MRMB 1BMGA 3ULUH 5HVGB 1KPRB 3GMQA 3IVKA 2NY6C 5HDBF 2XN9A 1FJ1A 2ZUWA 2AGJH 5F8RC 5ID1B 4CU7A 4PG2C 1TQCC 1CFTB 4KJYA 1F6AA 3S3SA 4OIAA 1XR9B 4KKCD 1DLHA 4RBPH 3T0EE 1RIVH 4Y5YB 5HXMA 4JFEB 3QZWA 4NQTA 2W07A 3O2WL 2ESVA 5FEBA 3JBG7 4HK3N 2F5AL 3X3GH 3RPIA 4Y16D 4GKOA 4U05A 5FYLH 2W60A 3ZTJH 4QYOA 2DIJA 1O7VA 3TEUA 2O5YH 3BISA 2UV3A 4J3XA 1K4CA 1A9EA 5IROC 4H8WC 1R3LA 3BEWA 1A47A 3KYMA 4WHYH 5D1QA 4JQVA 5IK3A 3FO0L 3WNNA 5DRWB 4Y5YA 3LQAL 1NGZA 2DMBA 5HYJD 4EI6B 3KPSA 5D7LB 4QOKE 4XNQB 2JKXA 1F97A 1KUMA 3EIFA 3GMLB 4J3SA 2CUIA 4EEEA 5B3JF 1WAAF 1YN7B 3BKCH 5D2NA 4NQCE 5IB4A 1D6VH 1QNZH 3R8BB 1HSBA 3WS3B 1BZ7B 5MENE 4PRPA 3SDCC 2OL3L 2R8SH 2D7MA 5CLWA 3OKMA 1KB5L 1XR8B 1IT9H 5C0JA 5JNYB 4NQEE 1NPUA 3RU8H 3MBED 1D5BB 3GSRA 15C8H 4CU6A 3Q3GA 4FQ2H 1JRHH 5F9WB 2ZCLL 3RWIA 4XVTH 2BNQB 5TE6H 4NZUH 5F21B 3G08B 1NL0L 1PKQE 5ALBH 1SEQH 1YMMD 2D0FA 1OHQA 3OKMB 3QIWB 1I75A 3OGCA 4E42B 1MJJB 3K2MC 4NZRL 1FV1B 1OTSD 2VLJB 1Q1JL 5HGDB 5JHDA 3N85H 3RWIB 5ALBL 1GVIA 3LQZB 4YDKL 1ZHNA 5F9JA 5GGUB 3B9VA 3CFDA 4XVTL 3VXME 1KB9J 2DYPA 1I9IH 3IS0X 2X4TB 3S3PA 4NNYA 1NKRA 4XBGA 1AY1L 3ZKMD 5BXFB 2YS4A 4KK9D 1LNUB 5TE7H 1GAFL 4HUNB 1LO5B 1PG7L 4PD4J 3E3QC 1MIMH 2NY3C 2DLFH 3QIUC 3SE4A 4LAJH 1CD9B 1FNEB 1M05B 4KMQA 4KI5D 1QFPA 1A6TB 5GGUA 1U9KA 3EJJX 3LKRB 4RAHA 3DTXA 5D6CA 1NGYB 3U1SL 5B8CA 3ARSA 4EI5B 2X4SA 4G6KL 1TDQA 2GJ6A 1L6ZA 2UY6A 4XNZC 2BVPA 3TBVA 4LVOB 4KWUA 3RL2B 4Z0BL 3DRTB 4KROD 5IGXL 3KYMB 5D1QB 4WO4A 1UT9A 2X4PA 1DQML 4QHUB 3ECBB 4X6CF 4GMSL 5BRZA 2XRAH 4TN9A 3WFBH 3DRQB 4E5XA 2UWEE 3D85A 4ZUUB 3CD4A 1QTYT 3QHTC 3Q1SL 1TPXC 5FGBC 3MBEA 3CPLB 3G9VA 1JZ5A 1IEBA 3RWDB 4EDXB 4OD2A 3PWJA 2Q86B 4PB9L 2C4FU 4WDIB 5EU6A 2WMPA 4TRPL 2GITA 5LBSL 2OR9L 4F15C 4G6ML 2IFFL 2VQUA 3KYKH 3BPOB 1A7PL 3D18A 4F7PA 2CDGB 4PRDB 4U49A 3A0OA 1J11A 1FGNH 5E8NB 1ZSDA 3VXSE 1PFCA 4PJ8D 5GS1B 4L4TE 3SJVD 1EGJL 3TLRA 3MOBH 5IB1A 1CD0A 5D7KD 1EZVY 4N0RA 2IFGA 4MA8L 1T7WA 3G6DL 1I85C 5F7UA 4AIXA 4OD2B 3SDDC 3LZFH 4LPUA 4AEHL 3QFJA 35C8L 5EU6B 4A6YL 4TPRL 2I27N 1OAZL 4F37K 4JDZA 2OI9C 4S2SB 3IJHB 1YQVL 3UROR 3H9SA 4OCSH 1F13A 5MERB 1YQ2A 4D9RD 5FCUH 4P2QD 3U6RA 5FV1L 2B5IC 2VDPL 4Z0XA 2HRLA 4UILH 1U91A 1HNFA 2AJSL 2SEBB 4G6JH 1U8LB 4KI1A 4QRPA 3RZCD 4ERSL 3M1BB 3MCLL 1U8OB 2GQHA 4PRHA 4OD1L 4WUUE 4C56B 1QP1A 3D3VD 2HJFB 2Q8AH 4Y4KB 2R69L 3RL1B 4C57C 4D9QD 4DQOH 4OLUL 4X4XA 3VFMA 1RZ7L 4BZ1H 5I2IA 2V2WB 3K0WA 1QQDA 4RGNE 5E95B 1ZHLA 2VUYA 1MQKL 1A6PA 2GUOA 3UX9B 4GRWF 1EERB 5I8EA 1N0XH 2FO1A 2OTPA 2YWZA 3RUGA 4HMCA 4N5ED 1K8IB 2AK4B 1RFDH 5HD8C 4WFHD 4APQA 3O8XD 1MUJA 3FQNB 4TSCH 4M9PA 2NXYD 5CP7A 2XXCB 3C5SB 4YX2H 2P5WE 1LEGA 5KZCD 2V9RA 2AEPL 2NY2D 2A9NH 4JKPL 3HRZA 3W39A 1P9MA 1IL1A 2Z31D 4QLRA 2WZPD 4P49A 2CK2A 2YKLL 1PLGH 4RA3A 1SQ2N 4QHUA 2YRLA 1G9MC 3OAZK 4L3ED 4UQ3B 3Q6FA 2VN4A 3IETA 3VG0H 4D9QE 4M7LH 2NZ9D 3UJIH 4FHBD 3MBEB 2W59A 3FB8B 1C5DB 1RMFL 4WI9A 4RGOL 3RWDA 4HPYL 5FUZL 3VGEA 4WI7A 3TO4B 1YEDA 1B2WH 3LS4L 2ITCA 1MAJA 4ZOBA 3Q0HA 1E4WL 4U1IA 2OL3A 3HE6B 4UIMB 4JRWA 3L7FB 5EBWB 3VFGH 4UOW0 4ZUWB 4XB7A 1IAIM 5DR5L 2O61B 3MV7A 4U6XB 1S9KC 2A0LD 3ZYJA 1DTUA 4G3YL 2RB8A 1IGJA 3DXAE 3V4PH 4D0DB 2DAVA 2QL1A 3S9DB 1VACB 3E2HC 4FQXB 1R0AL 4HPOH 3T8XA 3HZKB 4JZJC 5E8OA 1HZHL 2VKWA 3MOAH 4X6FA 3QUMH 2APFA 3SDAB 4LSSL 5EZIH 3PDDA 2FGWH 5E5MA 4L3CB 2XACC 4DK3A 3L5XH 3QXTA 3HMWH 1F6LL 3HNSL 4HDIA 2C1PA 1Z9OA 4QHLB 3T8XB 1FFNB 5KSUB 2P5ED 3DVIA 4EVNA 1KPRA 3GMQB 4Q97A 2DICA 5DJ0A 2J88H 1ZS8B 2NY0B 1OP3K 5JA8B 4FZEL 2JIXD 4CW1A 3KXFD 4MCZB 1T1ZB 1U2HA 4GAYA 2R4RL 2WANA 4JAMB 4JFEA 2BNRB 2BX5A 3BZFA 5C7XH 4Q6IC 5BRZD 1A3LH 1XF3B 3TBWA 3VCLA 1FFPB 1TPXB 2ESVD 1Q0YL 1I8MA 4PTUB 3PWNB 2W0LA 4QYOB 3T3ME 1TVBA 3L9RB 4WFED 5KTEH 2YBRB 5EFIA 4AENA 3TA3A 3P11L 4PJHA 5JDSB 3FT3B 3JWOL 2WQ8A 2ICWJ 4O58L 5EU6D 1X9QA 5HGHA 3ARGA 1WEJL 2UYLB 1QYGL 1VGKB 2KZWA 4I77H 4NKQB 2X7LA 4BZ2H 4M62H 3TFKD 1KIRB 1TMCB 3MLZH 2BSRB 5J6GB 2BY1A 1NC4A 1JZ7A 2EDBA 5EIIB 4FQCH 4TOYH 5D7JD 3EJZC 5EC1A 1LE5A 2YPLD 2ZZUT 3JWOC 1DBML 2GAZB 3WL9A 1BLNA 1CU4H 3TA3B 3W0WB 3B9KA 5LWYL 1S5HB 1XF4B 4JFHE 1RZKC 1T7XA 3MPCA 3BH9A 4NHCL 5JMOC 2XTJD 4LQ1A 5BOZG 3BW9A 1GH7A 4YBLB 4LASL 5EIIA 2AV7B 5IVZB 1EVUA 2LU4A 2BVTA 4OLVL 1M4KA 5T5FH 4LHUA 1MCNA 1OB1A 4F7EB 1KCSL 5F9AC 2DWEA 2FO4B 1PYWA 3T3PE 4PJCF 1N7ML 1JF5A 1MJ8H 1KJMB 3R0MA 1CCZA 5DD0H 5ESQB 1PSKL 3BFOA 3VG9C 3UC0L 4IJ3B 3MQIA 3UBXG 4HWEL 3MFGB 4X9FA 4Y7MA 5CJQL 4U1JB 1NMBH 3EFDL 4YBLC 5I71C 4L9LB 1VFAB 4XPTH 1VEMA 5EBMB 2E9WA 2DMKA 1ND0B 3PWUA 3O45A 4Z7NE 1N7MH 5MI0B 3QPQC 4J3TA 3NFSL 3CDGB 4HKJA 3BIBX 4QRRA 4Z7QF 3SGDI 3QDJB 1R3HA 4IM8A 3IF1A 4P23B 3AREC 3H3BC 4GLRH 1W72L 1DDHB 5LCVL 3QISA 4NBXB 1BBDH 4NPYB 4KKLD 5I1KH 1MCCA 1A6WH 4HUKB 3GGWA 4YHLH 3VI3F 1I4FA 3VFRA 4ELKA 4OTXH 5D2NE 5HHNB 1AR1D 4ODSL 4NQCA 3H8NA 1XMWA 2AAVA 5B39A 3ZE2E 1UA6L 5D9SA 1DUYB 3IDYB 1HINL 4G6FD 2HLAB 2O5ZH 3BIKA 3IDMB 3I2CH 3RVXC 4BSVB 4P5KA 4NO0B 4MAYC 4HJGA 1P5UA 3TBWB 3WIHA 5FECB 4P9MH 1I8MB 5FGCE 4B7IA 3MV8D 3O9WD 5ITBL 3VXUE 4M48L 1QD0A 4Z77B 2IGFL 1JHTB 3VD5A 1RVFH 3MUJA 4V2BA 5EBLA 4Z76B 1C08B 2V5YA 3RVXD 1IARB 1FE8H 2VXVL 5HGHB 4GMTH 5BQ7B 2AJXL 1N5YL 3AM8C 1KIRA 1CGWA 4KJWC 3AAZA 4OD3H 2V9QA 2XQBH 4OAWA 3OJDA 4UV4L 1RJYB 3I2CL 3RVTC 2FEEI 3OKOA 3ULSB 5FM5O 2E7BA 3MV7D 3D3VE 1RZFH 5EC1B 1ZOXA 2A0LC 3LN9A 3CZJA 4L4VE 4PY8J 4Z76A 1C08A 4FZEH 4LDLB 3PWJB 1XGRA 2AXJA 3V6OA 4NFCA 4EDWL 2JB5H 3ARYA 2PXYB 1LO4L 3OKOB 2B4CH 1H3PL 1UYWL 4J1UB 4ISVB 1U41A 5D7IE 5HYEA 2WLZA 2VLRD 4YE4L 3GSNA 1G7QB 3UYRL 2RBLA 3DUHA 2I9TB 2XZCH 3LN5A 2H2SD 1VEOA 3K4AA 5C09A 2CO6B 3FOLA 4PRIA 3MLSH 1ONQB 1I1YB 4F58L 4ODUB 3TO4C 2Z31C 1CR9L 3L3HA 5T1KB 1A9BB 2OR7A 4HUWA 2VXTL 4KTDH 5CSZA 1HKFA 3ZHDA 4NWTH 1BJ8A 4OM0L 2UVFA 5IJKC 1NAKH 3F6LA 3LH2L 5ISZE 2BOBA 3MNWA 5DD1L 3U6RB 1ORQB 5I73B 1CFVH 1UACH 4HS6A 1OVZA 4I3GA 2IPKA 2G9HA 4JM4H 4S1SH 4YIQA 4R4FL 4ZTOL 2EZ0D 4GLRI 3BT2L 4AM0B 1T80A 1HHHA 3ULVF 3AVEA 2GIYA 3U46B 1JGVH 3ROLA 2XA3A 4MS8D 3CAFA 4WI4A 3AS0A 3G5XB 3RVUD 3R06A 4G80B 1GHFL 1MHEA 5ILTH 1FZJB 4HMEA 4LAQL 3CH1B 4S0TD 4X7SH 4WU5A 1NC4D 3F6IA 4KUCD 4PIRF 1BF2A 1H3GA 3MNZA 1D5MB 1NAKL 4LLMA 3O8XC 4P4KC 1KXTB 1UB5A 4OD3L 2YKLH 1B0WA 1EFXA 1W0YT 3MLVH 1W8NA 3RTQB 1U6AL 4FXKA 1RK1B 4Y4FA 4XVJH 2MNUA 3QHZH 4XPTL 1FL5A 1YQVH 5D5MB 4RA0C 3V5KB 5CKAA 3TNNA 4F9PA 1FORL 5ICZB 1DR9A 1A1MA 3QCTL 4ZSOB 3MX0A 3P4MB 2C1OA 5KN5A 2AVGA 2QQNL 3UYRH 3EYOB 4UV7L 4DZBB 1IM9B 4QGTA 4P4KB 4KRPD 4PJ9A 4OV6F 4XNMA 2Q76B 1CGSH 1WZ1H 3LKSB 4ZD3H 2GY7B 1I1AD 4B5EA 4G6MH 4Y5XC 3KLAB 5HYFA 1L0YA 3RZWA 3MZTA 3MRQA 2WUCH 3BUYB 4MNQE 3QQ9C 4KUZH 1P6AB 1HYSC 1T21B 1DUZA 2PYFB 5F9OH 1LP9B 2B1AL 1NMCB 4PS4L 4Q0XL 4U6XA 3VD3A 1QKZL 5C09B 4G8GA 1GGCL 2BNRD 2WIIB 2GJZA 1CICC 4HWNA 4NQDD 4R0LC 5JZ7C 4KK5C 1A2YA 2BSED 4HD9A 2VLLB 1QYGH 1JVKA 1XAUA 4I77L 4HCRA 4BZ2L 5A2KH 4NT6B 3PJSA 1EJ6A 5F3BA 4U2YA 1ZANL 2BRRH 1L7IH 4LLAA 4P57A 4U6VL 5IOPA 3MLXH 1ORSB 4HV8A 4GBXB 4IDLA 3RZCA 3IFNH 4RMTA 4Y2DB 3GSWA 3RA7H 5I18L 1NGPH 2V7HB 3HE7B 2HT3D 5SV3A 1RZJL 3QI9C 5DJZA 2CIIB 2DDQH 4BFEA 1U93B 4EVNB 1A1OA 5DEFB 5EN2A 1A4KA 1QVOA 5JOFB 3S37L 1SY6A 3D69A 3HC0A 4FA8A 1MREL 4Y19E 4ZOEA 2Q6WA 3DBXB 2AABL 1LQSR 1CI5A 2CD0A 3TT1L 1A3RL 4NRXA 2IALA 4JJ5B 3K2UL 1IEAA 3U7WL 2QBWA 4NBZB 3VGFA 1XCTB 1RURL 3FQUA 4JM2C 5LGKA 4M02A 1KLUA 4DAGL 3D9AL 1OARL 1FBIL 2APWA 4POUB 5IB5A 2R0WH 4EN3B 3VFVA 3AS2A 4HG4J 4L9DA 5DEFA 5EN2B 5SWZD 3T2QA 4I18B 2R1XB 4I3RL 1FL5B 3VWJC 1WT5C 2XY1A 3AY4C 4LOUD 4HIIB 4A6YH 1BEYL 3O9WC 4QY8B 4KK6C 4KQ4H 5IIEA 4HPOL 5DHYB 1I8IB 2P8MB 2PW1A 4E0RA 1IEAB 3G6DH 2K7QA 1SBBA 5J6GA 4V1DD 2ZCLH 4RFNB 1PG7W 4MCYA 3S96A 3EYOA 2EC9U 5I1JH 3W11C 1KC5H 2X4UB 3I84A 4LLVA 4Y88A 1H0DB 1YECH 5JW5A 5IFHH 5I76A 4CMHB 1FN4B 3HLAB 2EEBA 4PGBA 1VA9A 1NBYA 5E94A 4NN5C 4G8GD 3EOAA 4FP8H 4XC3H 3EGSB 4H25A 3NVQA 3L3JB 4HFWB 2IAMC 4DCQB 3RGVC 5CMAB 5FYJD 5I1CL 4L1HA 1WK0A 1CK0L 1A6UH 5IVZA 3MV8E 1VKXA 1DVFD 1DUZB 3MROB 3KPRD 3QEGL 3ESUF 2FB4L 5T3XL 4BFBD 4HHAA 3PWPE 1NLDH 3C60C 5JW5B 5ID1A 2R1WA 2Z92A 5T1LD 4R4NC 1DVFB 4YHZL 1SYSA 2B2XH 3S35L 3GMMA 4JKPH 1D6EB 1T3FB 1KELL 2A6JA 3C5JB 2DLHA 3TWCL 4Z78A 1GZPA 4LARH 2FECL 3JVGA 5CIPB 4O51A 4OF8A 1IGCL 1RZIA 4XX1E 1R24B 3H42H 1FP5A 3KWWB 3PWLA 3V52L 2ESVE 5CBEB 1QRNA 5EO0B 3ARED 4OZFA 3GKZA 3DUUB 4NSKA 5J7CC 3UMTA 4WW1A 1LWRA 4WIQA 5D7LA 3H3KA 1YDPB 3B5GA 3BGMB 4OZIB 3SDXF 5INDB 3FRUB 5D1XA 1BJ1H 1D6VL 1QNZL 3S4SG 2WWKT 1WZLA 1C16B 3VFOA 1T22A 1U0QA 4OLUH 3KPSE 4XNUL 4DZ8A 3V5DB 5DDHA 5DZLA 1VENA 2D0GA 4NZTL 3RIAK 4OGYH 1GPOL 4OCXH 4WHYG 3V52H 1V3JA 1AXSB 2K9UA 3GRWL 3FONA 1Z5LA 1NC2D 5AEAA 3WV0A 1IAIL 5HGBB 4HC1H 4GFTB 3FMGL 5I1DA 2WBJC 3W9DA 1MFAH 4QXUH 5DJ2A 4DKDC 3GBLA 1LO0L 2W9EL 4PB0H 2AEPH 2OK0L 1A14H 1Z3GH 1I1AA 3ELAT 4PJFA 2OJEB 2FR4B 2ZUQB 3CSPA 2PW1B 4E0RB 2P5EA 4RGNC 4Z0BH 1DN2A 1A02N 5KAQG 2CJUL 3QFJD 1GOHA 2FJHB 4PFEA 1J0JA 1OGTA 1FL6B 5I19L 4RZCA 1KFAL 2YMXH 3T0EA 4NDMB 3MJ8A 3Q5TA 3AB0B 4LLVB 1S7WB 4UDTB 5FOBB 5FUCC 1Q72L 4OUOA 1FO0A 4PV8A 3TVMB 4WUUD 5J4MA 3D87B 4WFFD 4YXKL 4KJPC 4UDUB 4BK4A 5HHQB 1YPZA 2R69H 2XTJC 4PJEA 4PLJC 4Y1AA 4NFDA 5C3LD 1UXSA 3LQMA 1OGTB 3BXNA 5CEZD 4WHDA 2OZ4A 3ZT5A 4GW5B 5I9QC 2DTML 5GGVY 1A6VL 1PG7X 1G7IB 1DL7H 3OR7B 3D39D 1UH2A 1X5KA 3BKCL 5E2JA 1FNFA 3HI6H 4QT5A 4ZXBC 4OQ1A 4KI5E 3UJTL 4P3DB 1IVLA 1FRGH 1MLBA 4HWBH 5JPNB 3IXTA 3ZL4H 4K7PY 4CVXB 4TPRH 3GBNL 1MH5B 4RISH 3UPRA 2NY5L 4N8CH 3GRWA 5FYJU 1KLGB 1DL7L 4EXPX 5IEKA 1OAXH 2X9XA 2YD3A 5T3XD 4JO2H 1RUAL 5D1XD 5DUBA 5E8PB 4MZ2A 5CFHA 4U2ZA 1UVQA 1WZMA 3BP6A 1HXYB 4JPWL 2UWEF 1IGYB 1E4XL 2GEEA 1ZTXL 1QZ1A 2EZ0C 3LKOA 2F5AH 4QEGA 4NN6C 4P3DA 3TYFA 2WSKA 5IW1B 5F88A 3PGDA 4ZFOB 1ETZB 4AM0A 2XWBB 4LMQE 2N7BA 2PCPB 4OCYL 4YQXH 4XVSL 5CCKH 1YDPA 1RUAH 5FCSH 4ZFZA 4C59B 1OAUH 2VQTA 5DEGB 1M7DA 1KCKA 4B0MM 4M8QA 4CJ0A 1CIDA 5KVDH 3DI2B 4FQLL 4F33B 1YEFH 4IOIB 1WFOA 1AGDA 3TWCH 1OQOA 4PJDA 1NAMH 4GG8A 4KQ4L 2BRRL 1AHWA 2PCPA 1J0HA 1NDMB 3MJGX 5GRZA 1V7NL 1TJGL 4FZ8H 3SCMB 4L5FH 1M7DB 1AE6H 2VDLL 4WI6A 2AJZA 2QLVB 1NAML 5IFJB 5I8KH 2YPVL 3P4MA 3BVNB 2AKRA 5LGHL 1A6UL 3NABH 4OJFH 1AO7A 1TCRA 3VWKA 1ACYL 3MRFA 4KGJA 3OKNB 4NQCD 3VXRD 3VDAA 1BX2A 4MJ6A 1URLA 1P84J 1WFNA 3MJ7A 1XGPB 3WE6A 4XB8A 1BPVA 5ESVA 3QPXH 4I18C 5I16A 2ARWA 4Z0XB 2BVUA 1CVRA 5T1LB 3QDME 4JFZL 3K8MA 3JUYA 2NW2B 4L8DB 1OTTD 4PJEB 4PREB 4Y1AB 3SKOA 1BM3H 1YY8A 2QQKL 3SPVB 1ZEAH 4EUPA 2E9BA 4DUWA 3U2SB 1JPTL 3VFMB 3O3AA 3I85A 5IROA 3GBNH 4XRCA 2P49B 5GGRY 3LB6D 5KVGL 4U4BA 4Z7WA 4JPIA 2XFXA 4K3JL 5I8EB 5IQ7H 1CG9B 4YO0B 4NWUH 5AG9A 1J8HA 1JPSL 1KTDA 1TJHH 5L2JB 2APTA 2XG5A 2IH3A 4YHIB 3QJFB 3RPIB 3GDBA 2CMRL 3MV01 4YR6A 2ARJA 3QH3A 4HGKC 5CP7B 3QNZA 4WNQA 1LEGB 1GPOH 3IDXL 5DRZB 5F7FA 2EDNA 3HZMA 2EXWD 1ZLVK 4LPCA 4F7TA 2CLVB 4JFDD 1FFRA 5T5NF 1U3JA 4Z7VF 2IADB 4PJ7F 3D3VB 1X5YA 4P2OC 1KEGL 4B7LA 4O02H 3OG4B 2ZOKA 1WIUA 5IESL 1YN7A 3VFSA 3BN9C 3MRNB 1MRCH 1S7XB 1H8NA 2NTFA 4JJHA 4LCIL 2ILLA 4ZUSB 2CJUH 4JZOB 3O3UN 2H6PA 4KC3B 5FUCE 4F7TB 4IS6B 1HXMB 1AKJB 3GI9H 4MDJB 1KBGL 4PJGF 4FFZL 2C4XA 5B21A 2OL3B 4RWHA 2EH7H 2EDTA 3BEVB 2EEAA 3GSNL 4MJIB 4NC0B 1OARH 1ED3A 1JI1A 1EDQA 4MB3A 4WUUA 3KJ4C 5I8OL 2FL5A 1GGBL 3WIHH 1X5AA 3QUKA 4HLJA 2V7NB 4NIKB 4MA7H 3P30H 4UINL 1NFDA 3BRGC 1AP2A 2ADJB 2XPGA 1AR2A 1K5NA 1ZT7A 2YRZA 4N0FA 4H20L 2E6JA 4TUJA 3NPZB 4NQDE 3C5ZA 1ZVSB 4P5TD 3B83A 1JGUH 1AIFB 1FNAA 2R0LH 5DD3H 5DYOB 3TF7C 4NKIL 5JHDB 3S37H 3I3BA 2W0KA 3T2NH 3M17B 2QADD 2GKIA 4R97B 4P46D 4DGVH 1RIUL 5FYKH 5E6ZA 4UIKH 2X1PA 5FO7A 4X4ME 3UO1L 3L1OH 1RD6A 2XTJE 3BKJL 4CW1B 4M1GL 2LU3A 2R1WB 4L8SC 3LQAH 1ZA3A 3JTSB 3MNVB 2J6EH 4WO4C 1CFNA 4OQTH 4X83A 2JLLA 4X4YA 4P9HC 4Y0GA 5JIPA 3CU1A 1FNSL 3ILPA 1F2XK 1X5JA 3K8LA 4ONFH 1D7FA 1QBAA 2ZOLB 4CGTA 5IMMA 1E27B 4ELMA 5CAYB 5DJ8B 5D7JB 1UFUA 1IAKB 2A83A 4LDEB 3LEXA 4GQPH 4KZDH 4BQ6A 5C2BL 3CFKA 5IJVB 1BECA 5T1MB 5TQ2L 2IADA 4H1LH 3RKDD 5JMRA 2R15A 3M8OH 3GSXB 3KYNB 5BV7C 2DM3A 2P8LB 3D0VB 5IHLB 4G5ZH 2I07A 3FB7B 4NQEB 5B3JE 1VPOH 4UMGA 5ANMB 4KY1L 4ZAKD 2EIDA 4UTAH 2AEQL 3EDKA 3EO0B 4I3RH 5H37H 3DETD 1W0VA 5I74B 1U92B 4LQFL 3ESVF 3SOBL 2AK1H 3RWCB 2Z4QB 1AC6A 1EJOH 1EH9A 5TPWH 1PKOA 2MHAB 1FZMB 4EIGB 4PRBB 4OLYL 5CZKA 5TFSH 5LJYH 4P59L 1GZQB 3NFPB 3QCVL 3K81A 5JHLL 5I1LB 5IT2L 4R9HA 4S1QL 1S9YB 4Z7UF 3O45B 1U58A 5CJ8A 4M93B 5C08E 1OP3H 1UJ3B 1CFVL 1JGDB 1FYTB 4X7FC 3IAGC 1JCKA 5F9WC 4CVZB 3T65B 4AG4H 4XVUC 5HHOB 5C08B 1QLFA 3CZFB 1HNGA 3GGWB 2P48B 1CXEA 4CJ1A 2PXYD 3JTTA 4XNZB 4DUXA 3V5HA 4GW5A 2NZIA 1QQDB 1BGXH 3IU4H 5C07A 5IHZA 1N6QL 5D9SB 1P9MC 2GHWB 2VDQL 1KTLA 3SO5A 2HLAA 1YJDL 3GIZL 2DM2A 1IC1A 1LK3L 4P2OB 3KDMB 3HB3D 3QZWB 3R1GH 1K8IA 3NIGF 4YWGH 4PYHA 3ILPB 5F6HI 3K2UH 3H6JA 5HGAB 5JW4Q 1CDGA 4YHOH 1RZGB 4AG4L 2YA1A 3DVFA 1SM3L 1MCEA 4M7KH 2R4RH 5C9JA 1ERNA 3WIFB 2DLGA 4X98B 5E00A 1DQQA 5HYQA 2DQGH 3AAZB 1CXHA 5IW1A 2E9JA 3H9SD 4Z7VA 2HP4A 4PJXB 4HUVA 1UWXK 3ZKQD 2V5RA 4W68A 3OTTA 4XAWH 2D4DA 4WW2A 1MJ7L 2P24A 4YDLB 5DVOA 2AJXH 3WLWD 1N5YH 3VXNB 1TQBC 2GY5A 1Z0MA 3WXVH 5I1HL 4JFFD 4ORGB 4YHML 1INDL 4OSUH 4M5YL 5SWSE 2BY0A 4P5TA 1A22B 2DMCA 5EU6E 3UTOA 4S11A 4JKLA 3RWHA 4DKFL 5D70L 5DXWA 2X9WA 2C7UB 4OI8A 4J8RB 4F58H 3QUXA 3VH8G 5F9OL 4U1HA 1JK8A 2ZG3A 3DOSA 2F19H 4U1GC 5DUPL 3ARFB 1N3NB 1IGML 3FB6B 3HG1D 3TPKA 4J6RL 4MXQC 4KMTL 5JW3H 5EUKB 3S88L 1GZQA 3DYPA 3EDEA 4NKMB 4J2XA 2B39A 3SDAC 1NCDH 3OGCB 2DYPD 4AIOA 5C2UB 4JRXB 1U58B 2A77H 5DMIL 2OSLB 3GO1H 3DMMB 4ZFGH 5HY9A 3BZ4A 2IPKB 2XZAL 1G9NC 3ARFA 3WMSA 3RQ3A 4WV1A 4YHKL 2VL5B 4G8IA 1Y0LA 5GRXG 2VXVH 4PG9A 1LK3H 4P46B 4IJ3C 3IJHA 5FHAH 3MFFA 1A7QL 3MUGA 4UV4H 4NNYB 1KG0B 4PGDA 4HWEH 3MYJA 4ZTPH 4O58H 3QO1B 4NCC1 1ZLSH 3MOAL 1N5AB 4ODBD 3SE9H 5KW9L 2VKXA 3G04B 1GSMA 4HUUA 4P23C 4C4KT 2VL5A 4G8IB 3DTXB 4FFWD 1YMME 2IH3B 3MRMA 5DO2C 1FFPA 2A77L 2MQ0A 2XZCL 3GJFB 5EU7E 4URTB 3BQUB 5I2IB 3QO1A 1YUHB 3IKKA 3M8OL 1RK1A 4FXKB 2B20A 3QJHB 4OTXL 4MD0B 5H2BB 3D39E 2E7CA 3C9NB 1XR9A 2EDYA 2YXMA 5JPMB 1VGKA 2HVJB 1DQQB 3AGVA 3STBA 1KJ2L 3PQYA 1ZKAA 4RRPG 5BRZB 2ZOKB 3R1GL 2P47B 1EHLH 1LE5B 4N90E 2R2HA 3H9HB 1TENA 4J3WA 5E2WL 4H26B 3SJVA 4AZ8A 4HT1H 3P4OB 1ADQH 3O0RH 3THMH 2F58L 4EDXA 4YGVB 3OMZA 1G6RB 1WCBB 3IS1X 3VI4F 1HXMA 1PZ5A 3D5OF 4M6OH 2HVKA 1T2XA 2H41A 1F4YH 4WEMB 4LLWB 5ELIA 4JREC 3QDHA 3GM0A 3LKNA 4HF5H 1IZJA 2YZ8A 3BP7A 2M2DA 5E4EB 4HH9A 2DJSA 2KQMA 4TNWK 1REIA 1H15B 5IMKA 1PZ5B 1AO7D 3VWKD 5GRJH 3PXHA 4KKBD 3WBDA 1G0XA 2CR3A 4MQTB 4PJ7A 1MHHB 4RDQF 1NFIA 2E3VA 3CVIH 2EDQA 1EAJA 5JOPD 1JZ4A 3QIUD 4U6TA 4LLQA 4OLWL 3WUWB 2C3WA 5T1KD 5SWSD 3DPBA 4LNRA 2Y72A 3Q5YA 4D3CH 2J88L 1WF5A 1R3HB 3QDJA 3KLSA 5E4EC 5F89A 3VE0B 4D0BA 5DFTA 1AGEA 1S5IH 5B39G 2E27H 1F4XL 1HSAA 2PTTB 3X14B 2VDQH 4HKBB 1WEJH 1FG9C 2DQTH 4JG1L 4XGZB 2IG2H 5E24E 4P46A 5HHNA 3I75B 1T04A 3AMLA 4Z7OE 3D69B 1FZOB 3ZSSA 1YJDH 3TO2A 3LRSB 4KKLC 1ZHLB 3BZEB 3RP1A 2ADIB 3AM8A 3LB6C 3ZT7A 2AQ2A 3PP4L 1MWAB 3WFDL 4P3CH 4WUKH 2BHUA 5IKCB 3M07A 2X42A 4NOBA 1SMAA 2EYSA 3NH7H 1PZUB 1HH9A 2FLBT 2GSIA 1I7ZB 2ADFH 3P0VH 5C6WH 4XAWL 3TT3H 1MWAH 1I3RB 3HUJE 4JFEE 1C8PA 1UXWB 3WSQL 4KZDL 5D7IB 4ODHL 1RK0A 3UYOD 4BZ1L 5DK2A 4XAKE 2X05A 1KNOB 1UM5H 4JFDA 3V6OC 3HRZB 3BD4A 1RMFH 3O3DB 5ERWA 5GZNC 1ZA6A 1CF8L 3B6SB 3MRCA 4U1KA 4XXDA 5IWLA 8FABB 5H94B 5I75B 3KPOA 3MCLH 2HFTA 3IETB 2JCCB 3CSBA 1Y18A 3T0ED 5TDNA 5T3ZD 5CEYA 3HAEH 4RRPA 2G5BB 3QUZC 3LY6A 3NA9H 3EOAB 4LKCA 2AEIT 4FTVE 1JPFA 2NCMA 5ANMA 1ZK9A 1TJGH 43C9A 1IGIL 35C8H 3JXAA 1XR8A 4I1NB 1D5BA 1I1FB 4FQLH 4HIJA 4LSRL 5C0BE 3WUZA 2HWZL 4ENED 4O9HL 3QSKB 4PRHD 2H1PL 4CRPA 1C1EL 3QDJD 4FQ2L 2BNQA 4LSDA 1J10A 4YEEA 2VXQH 4XHJC 2W1NA 2WIMA 2HFGH 2VR5A 4Y4KC 5E6IA 3ZKNC 3TJEH 5IVXE 4DUVA 3MLTB 4PJXF 4ELME 1MF2H 1FC2D 5L2KE 2WP3O 4NKIH 4PGCB 5ADOH 1MAKA 4GXVL 3QQ4A 5E5MB 2VLJA 5HGDA 1Q38A 5IVXB 3B2UC 5ALCH 4DGYL 4F3FB 3FOMA 4YIQB 2RIKA 3O8XA 1U42A 4PTTA 2I25N 5C0FB 1X44A 1KJVB 2LTQB 4KMLB 2LVEA 1AGFB 4Y4FC 4F9PC 2DM7A 1HIML 2FCBA 4RX4A 2AEWA 1BQHB 4UOW1 3G5XA 1Y6MR 3RNQB 4FXGA 2O26U 4WWKA 3FOMB 4XP4H 5INCB 3QXAA 5CWSB 3ARDC 3TC9A 4Y2DC 1F02I 1T7YA 2R2EA 3MNZB 3UAJC 2NY4B 1I7ZA 3ARZA 5DQDL 3HE7C 2VSDA 4LLMB 4AEHH 2J8UA 5B8CB 2AJUH 3VFRB 1H8SA 4PTUA 4EI5A 3HKFA 4A6YA 5GRUH 2CRZA 3NPSB 3STLB 3RTQD 2IPTH 4N1EA 3PGFH 1OTTC 1TETL 3CNKA 3TNNB 1RK0B 1P4IL 2AJVH 3QUMB 4I4WA 2DJUA 2QJDA 1AQKL 5INCA 1JGEA 2E8YA 3KXFE 5CHNA 2LU7A 3WIHL 5FUZH 3PWVA 1KFAH 2AJSH 1NC4B 5H94A 3S8WA 1IILE 4C54A 5LGHH 1OM3L 5D8JH 1KTKE 1Q9KA 2DLEA 4ZUUA 3OB8A 3N85L 5C71A 1CLCA 2G2RB 1S7WA 2H26B 2IBZY 2V2TA 1BLNB 4LPWA 1JWSA 4R0LA 5EZLA 3NCBB 4Y1AD 1BFVH 2AEQH 4OZHA 5IG7B 2Z35B 2GITB 2F53E 3TN0B 4HIEB 2MOVA 2H32H 3PV6B 2Y7QA 4JFFA 5B3NA 4G6KH 3BKJH 4NJAH 4K9EC 4YX2L 2OCFD 4W6XB 2PYFA 2QSVA 3LKPB 4LCCA 3GIVA 5EOCH 2AXHA 3NIGE 3QDGE 5F6HJ 3Q48A 2VLJD 4U1HB 1DFBH 4CMHC 1MCKA 3MRRA 1NCCL 1CS6A 1Q9OA 1YEKH 2HAZA 3RI5F 3WDHA 4CU8A 3NCYP 4FQJH 1U95A 3KPQB 2P4AB 1K85A 3CFCL 1UM4H 1KJ3L 1NEZB 2ERJC 1JGUL 5DD3L 5IB3B 3LN4A 3VRJA 5T1DL 3EZ8A 4RIRA 3RHWK 4JDVA 1T0MA 4JRYA 4RGOH 3PWUB 2AW2A 1S7UA 4CNIA 5A16A 4JREB 3MV7B 4G9DB 4Y4HB 2G60H 2D7NA 3PGCA 4R96B 1XIWD 4TVPE 4LGPB 3B3IB 3IFOA 3VG0L 5SWSB 1H5BA 3C09B 3C60B 4JFED 4OD1H 2YUZA 3WJLC 1ACYH 3U48A 2E6PA 4PTTB 3E2HB 1R5VA 2GW5A 2CKBH 1VSCA 2ZUYA 5IM7A 2P5EE 3MJ6A 4JDVB 5DFVD 3VWJA 1LEKA 1WT5A 4NQCB 2JJSA 5A3IC 1ZEAL 3MV8A 3O9WA 4LEOA 4QRSB 2Q6WB 3OHXB 3MBXL 4XC1H 1UKTA 4F80A 3GJFH 4RGMC 3EO1B 4IOIA 1UWGH 2MQCA 3H3PH 4QNPF 2IANA 1ZGLM 1QUNA 5DQJA 3SKNB 5KSUA 3ETBF 3SY0A 5C6TH 3HCVA 3E3QE 3ALXA 3MMEB 1XEDA 3Q6GH 4PJAB 2V9TA 4XH2A 1KV3A 1QFWI 5K9OB 2BP3A 3MV8B 3O9WB 4LEOB 4QRSA 5JUEL 3D2UB 3ZE1F 3W5MA 1CLOH 2VZSA 1U8KB 4MCZA 4QY8A 2YD9A 5JIHA 2CDEB 2J8UE 4RFNC 5CHNB 2Q8AL 4M43L 2FSEA 1T83A 2VLRE 3PDGA 3L3IB 3MLUH 1YEIL 3SY0B 1ZHBB 4XCNA 2ZSVA 3WFHB 3N1GC 3CUPB 5BZWA 1BVKB 1KCLA 1G7PA 2Y5TB 3GSOB 4Q6YA 4BH7A 2DRUA 5E7BA 1ITCA 3DVNA 1I8KB 5DJYB 5EIQA 4ZPTB 4F57H 3AFLA 3QCUH 4X9HA 3VH8B 5DA4A 1JYWA 3IXAB 2VZOA 1BQLH 5IEHA 5DO2D 3JWDL 4KJQD 3TVMD 4YC2B 1YY8B 3SPVA 3WNOA 3L7FA 3OPZH 1G7PB 1E4KC 1RIHH 3T0DA 2ADGA 2Q3AA 1G7QA 1OM3H 3VI4E 2NLJA 2UUDH 4C56D 4HHAB 4GW1B 2Q76A 4YNYA 1FL3B 3B9KB 3MO1A 4N9GA 4KPHH 2DD8H 2R2BA 2X10A 4DVBA 4GXVH 4JPIB 4LVHB 4TUOB 1ONQA 3MLUL 3KYOA 4OZHF 4NQVB 3VXOB 1BVZA 3OX8B 3WNMA 4HBCH 4X6DF 4YHIA 4R4ND 3QIBC 1N64H 4WI3A 3LD8B 1RZJH 1NUGA 2CIKA 4YR6B 3HPLA 1YNLL 4KXZI 1MPAH 3DV4A 2NLJB 4JO4H 5EO1A 3SHSA 1FPTH 3SDXE 2VLKB 3D6GA 3OF6D 4GUPB 3MLWH 4PJGE 2BC4B 5SWSA 1FRGL 1S7RA 3V6ZA 4JO2L 3VXOA 3L5WA 5I1GL 1JHLH 1BEYH 4ZOCA 4D8PA 5DFWH 3OX8A 4TNVF 4Q58C 1B0GA 5DJ6A 1RZ8B 5IM7B 2VE6A 5T3ZH 1I1AC 4K3DH 3BDYL 4DN4H 5EO1B 2C3HA 1B0RB 3IJSA 5I1GH 4OV5B 4M43H 1U8NA 4JG0L 2QSCL 4GBXC 1HILB 4HZLA 3WO4C 3AREB 4ZUTA 1F00I 2YPLE 4OF0A 3T0EC 3KXFB 1MREH 5DJ6B 2AGJL 1YMHB 1K6QH 2EDXA 4B50A 1I7UB 1FCGA 1UM5L 1MVUB 2B7DT 4PJ9D 4YXKH 3T4AA 1OWRM 3VD7A 3FT3A 3SQOL 3ZTNH 3I3DA 4JFDB 1EGJA 4KROC 2YD6A 4NNPL 5C70A 4OCRH 1RAMA 4GG6A 1A5FH 3L3IA 4K94L 4I3SL 1U3HC 3O6FC 2Q87A 4X7EC 4OIIH 1OAXL 2RFXA 4AQ1B 4EN3A 4PGZA 2FNBA 4NM4L 3TIDB 4PJXE 4ELMF 2D0HA 4XNMB 3FMGH 5CEYB 4Z77A 4NQUA 4XHQA 4I48B 4FRWA 3DVNB 5DJYA 1F8TH 3QA3B 3NPSC 3WHE0 3PHQA 2X89D 2IPUG 4QXGL 3RWJA 3PE9A 4NQDA 1MQ8A 4OGXH 4NO5B 4PJAE 4U1LB 5IHUH 5HYSA 5GGRB 5FUOH 3QAZB 1F45A 1XGYH 1E6OL 4PJDE 5FO7B 2CLRB 1FVCB 2GFBA 4OCWL 1I1FA 1MFEL