4OCWL

Crystal structure of human fab cap256-vrc26.06, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
211
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGSTSKIGQNSVSWYQQLPGTAPKLLIYENDRRPSGTPDRFSGSKSGTSATLAITGLQTGDEAEYYCETWDGSGGVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CAP256-VRC26.06 light chain
total genus 39
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwL01
4OZ4B 3HKFA 3RKDC 5IV2A 3BWAB 4FG6C 4ELMB 2AS5M 4D3CH 1KTLA 4X99A 3QHZH 1WZ1H 4RMSA 5F7WC 1AP2B 3M45A 4NZRH 2YS4A 4QHUA 5E5MA 3X13A 4GKOA 4ZNEA 2A6DA 4XNQA 3ESVF 3CX5J 1YEFH 3GSRB 3TESA 1BM3H 2OR8A 4M8QA 4V1DB 3VDAA 4JY4B 5T1MA 1CFTA 2XZZA 5TDPA 2FECL 1MIEH 1ETZA 4G6KH 1FRGH 3OKNB 4EKXA 4PRPE 1UWXK 4EI5B 1JE6A 2VISB 1NMAL 3AROA 4HIEB 4GAYB 3OR7B 4G7VH 3A67L 5FHAH 4HULB 1OW0A 3OKLA 5L6YL 1XF1A 1XF5A 2OL3A 5BJTB 3GMQA 4PP1C 3WJJC 2AJYL 1IGYA 4LF3A 2RBLA 3ZSSA 2P24B 4MA7L 4O5LL 2D4DA 2DIBA 2HFFA 3P0VH 4JY4A 5T1MB 1MCHA 4LLUB 3T04D 1SEQL 1PEWA 2FWOB 1LP9A 4OCWL 4ODHL 4XNQB 5F1KC 3P9LB 2DQJH 3MRFA 3PWNB 3REVB 2VAAA 4Z7UF 5ACLA 4P3WA 3GSUB 1NMAH 4WFHD 4X99B 3VFGL 2X70B 3NCYP 1E4WL 1TPXC 2G5BB 5GSVA 1EHLH 2W0FB 4N90D 5D7LB 4XNZC 1X5AA 3VXME 1LE5A 3B9VA 3U7WL 2VO5A 4XVJL 1FJ1B 5KN5B 3BPOB 2J8UF 1JK8B 1X7QB 4OFYD 1SYVB 4WO4D 3ZDZE 2EO9A 4NQDE 4HIHA 4YDVA 5DQJB 3K4ZA 3GIVA 5EO1B 4TUOA 1IZKA 1CGXA 2JB5H 4JY5H 4U1MB 4XWOC 5C71A 4YHLL 4AMKL 2P49B 3ARZA 2ARJA 3OR6B 1MEXH 3VFVB 5FGRA 4BSVA 2XOTA 2X4OB 3BN9D 4KHXL 4KUCD 1MQKH 4XGZB 4GAGH 1FVEA 4YQXH 5CZKA 5JDSB 4RMQA 3GHEH 4MXQC 2NTFB 4ZS7H 4QGYA 4J3VA 5L8KB 1KTRL 1KXVC 4R4BA 4M43L 4JJ5B 2F53B 5D7IB 1I1FA 3ARYA 4D0CA 2FO1A 4LSRL 5ETUA 3QWOA 4UQ2A 1MNUH 5IOPB 2EXWD 4HAGA 4XPFL 3U4EA 3FO2A 5JQ6L 4WV1A 3L7EB 2R4SH 3RIFK 3QXUA 4A2LA 4X4XA 2Y5TA 3B2VH 5F9JB 1HHJB 3FB5A 4M7JL 4OD3L 4LCWE 1U8MB 5D71L 4HKXA 1P4LB 5ENWA 5E7FA 3SDAA 4PJDF 5GGRB 3VXQB 4NQED 4XAWH 3I3EA 3N9GH 4TTGA 2EKJA 4NUJB 5TGBA 1MH5B 2CRMA 1INDL 1OQXA 2XXMB 2Q8BL 5K33A 5K93A 3MJ9L 1UH3A 1UM5L 1AC0A 3U7YH 1DBBL 3BXNA 3FFDB 4L9LC 4Y19A 4FMKA 3U9PH 3LS4L 4Y4HD 3RWIB 4N0UA 3SOBH 3T0DA 3MREB 2FYYB 3ZZ1A 3OZ9L 4Z7WA 5K59E 1G9NC 5D71H 2EDQA 3WIIH 4UQ2B 5LQBH 3HC4H 5ADOH 5HGAA 2BERA 5DVNA 5IQ7H 4MNGE 1P1ZB 3MRLA 3WNOA 3QIWB 1INQA 4U1LB 3QUKA 1XR8B 5DC9B 5ISZD 4HUKB 1MFEL 1MSPA 4JDZB 4G8IA 4K9EH 4MD5A 4R96A 3EO9H 3JSSA 1IQWL 1KIPB 2PUQT 3KPSA 4LPCA 2XWJB 5TE4H 4NQCB 3F7YB 5BW7C 4XCYA 4PJBA 3T77B 4NJAH 2LABA 1FO0H 2ESVE 4HS8H 4O02L 3QUYD 3VXOB 3HTLX 3EJZC 3V8OA 1FLRL 1T7VA 3SKMB 5KOMC 5IGXH 3DSFH 5FUCC 4TUKL 3VD9A 4UV4H 1JV5B 3WLBB 5KSBA 1DEDA 1RZKC 2YPLB 4X0KA 2DI7A 4WFGE 4P4KD 1U8JB 4NSKA 1HK6A 3TYGH 3VH8A 4F57H 2D9QB 2Z4QB 3PGDA 3R06A 3G5VA 2XQBH 1JI1A 1U0QA 2KL6A 4Z7QF 5EOTB 1G7IA 4DN3L 1RK0A 2A6IA 5DD5H 2NY6D 3SY0B 4PRNA 1RJZA 1UH4A 3IETB 1N64L 2ZSWA 3MJ8B 5DUML 2EDHA 3WFZA 2FX7L 2WUCH 4PJ7F 5BCAA 4P9HL 2YXMA 5D7LA 1UYWH 4EIZC 3Q1SL 2FEDC 3HZYA 2XG5A 1FGVL 1G6RA 5GGUA 3S34H 3BMWA 4N8VB 4KDWA 5I74C 1PSKL 3F58H 5MP6H 5DRWA 3IRZA 4JM4H 3FB6B 5E2TL 3ARFC 5EORL 4Z5RB 2XTJB 5CILL 5JOFA 4YH6A 1FPTH 4ZFZA 2PXYC 2DKSA 5BO1L 3BRFA 3J7HA 3P9MB 2DB8A 2HJKB 1I3GL 4JPKH 2IH3A 2DL9A 4DKEH 2ZOLB 3RTQC 1JGDA 3X11B 4H0IA 4F7PB 3MNWA 1A6VH 3A6CL 4DQOH 3OKOB 3FT4A 3BKYL 5IFHH 3QXVA 4NYLB 4UTAH 4BUHA 4I0PD 2QQNL 4JDVB 2EIDA 4I9WE 1J5OL 3H0TB 4RMWA 4UTBL 1TLKA 1CICA 1LO4L 4ONFH 3K0WA 2IQAA 3ARGB 5HYJD 4XZUA 2X4QB 1YPZA 1AXIB 1QYGH 2EH7H 5GGVL 2LTQC 2QKIA 5I30L 3F58L 3QDHA 5H94A 1I3GH 5DC0A 1IC1A 1BOGB 3IF1A 1UEMA 3DUSA 4UTAL 5DGRA 2QQKL 1LP9E 3KYKH 3KPPA 1U93B 4ZFGH 1HKLL 1WBZA 5IR1A 4OCMC 5CGMA 1CGUA 4CMHC 4PJIF 2A6DB 1LEGB 4FQCH 1NGZA 1AGDB 1I7ZB 1DFBH 3F7VA 4CN6A 3H9SB 2AQ3A 2YD4A 2Z91A 2IBZX 1IEAA 3L7EA 1GH7A 3I2CL 1TFHA 4N8VG 1FGVH 2BVUA 2VLLB 5IHZB 2H1PH 4QOKD 5I1KL 5GS1C 3HI6L 3DWTA 4L8CB 4LASL 4M7LL 3VXRA 4P9HH 4OLVH 1KG0B 2ITCA 2NXYD 5BZWA 1MFAH 2WQ8A 5HVHC 4R4BB 3U4AA 1KGCD 1FLRH 2VXQL 5CIPH 5JNYA 4OTXL 2YMXL 3HC0A 1A7NH 3IFOA 2YA2A 3TO2A 2XKSA 5C7XH 1MCRA 1UWXH 4M7ZC 4HX1B 5F1NB 3GJEB 4HMEA 1F4WH 3MA9L 5CUSL 5HHOD 5AD0A 1XF3B 1QFWH 1CD0A 4Y7MA 5DMGC 5I18L 1J12A 2VN4A 4PJ7E 3FRPG 5J8OA 1JTOA 3ARBC 4EBQH 1AR2A 2JELH 4IRSC 5DXWA 4BKLA 1P7KB 1QFOA 4NUGH 1JYNA 2UWEA 4CN1A 3FO0L 1C16B 1R3KB 2VKWA 1KYOJ 4NO2A 5IB1A 1MHHB 3LMJL 3GUTB 1AR1C 4IOFD 3LD8C 4AH2B 1BMGA 4CW1B 3NN8A 1IAOB 1IAII 4OAWB 3MLYH 3C9NA 4HKBA 1NDGB 2XZAL 3BJLA 6FABH 4Q9CA 2Y9RT 3TN0C 2P48B 2HT2C 1SJEA 3NZHH 3VFMA 2VDRH 6CGTA 5JOFB 4FP8L 4U1IA 1H8SA 4LHUB 4QHNB 1WWAX 1B0GA 5F89A 3MLYL 3OHXA 1S78D 5DJCB 1S7XB 4U1GB 4HF5L 1A6PA 4O51B 1T7WA 3LV3A 4Q9RH 1JWSB 4JB9H 4I0CC 4ONHB 4BUGA 4CMMB 3NIFE 1LP9F 1T2QL 5BJTA 4S10A 4XNMB 1IQDA 1CE1L 1KIUA 2Z93A 4TOYH 3IDNA 4TN9A 3C2SA 4QCIA 5E5UB 3LKOB 2LQRA 3CLEL 3FONA 3Q6GL 4PJ8B 5E94B 3TO4D 4KKCC 5IKCA 4P9MH 1TZIB 3CC5A 4AJ0A 2Z4QA 1IGCH 3T0ED 2FZ3B 1ZVSA 3WFEH 4JFOB 1RV6X 1LK3L 5E1HB 1ZANH 4ZOAA 3OB8A 3U83A 5JHLL 3VFPB 3QIBC 5J6HA 2CXGA 3QDJE 4JO2L 5D1ZD 4EJ1C 4YX2H 2A73A 4JDTL 4S11A 2DQFB 1QFUL 3HUJF 1TTUA 4NC2B 5I74B 4HG4J 1CZ8H 2HJFA 4NHCH 1NFKA 1UWGH 4PRHD 1XR8A 4JLRB 3SCMC 3DX7A 4YZFE 3ULSB 4FXLA 3W9DB 2WBJA 4PJIB 1UJTA 5IFJB 3E6FB 1RMFH 4TTDC 3VG9C 1I1RA 3TFKD 1KCKA 1GGCH 3BHBB 5IJKC 3DRTA 2AJYH 4QHKJ 2A1WH 2OTUA 3QEGH 2J88H 3QEUB 3BPNB 4PY7B 4EI6A 1PY4A 1UEYA 3KPNB 4I48B 4S1SH 2XT1B 1G9ML 2P42B 2QR0B 4KMTH 3PWPD 1TCRA 2UUDH 1UG9A 3DO7B 4OJFL 3C9NB 4PJDA 3GRWH 4GSDH 5FGCE 1CXHA 4HZAA 4C56B 2XQYK 1FN4B 1I8MA 4OGXH 1F5WA 3MBEC 5IHLB 3WJLC 1DLFH 4G7YH 3CFEA 3WLWC 4UDUA 5DJAA 3A67H 4PD4J 1M7DB 5L2KE 5E8DH 4U6YA 3RY6C 2NTFA 3NIGF 2BNRA 1NJ9A 2IF7A 4LVNC 3BI9X 5DZLA 4Y5XC 2AJ3A 1IEBB 3ULUE 3D18A 5IHBA 5F9WB 1HOCA 4I48A 1U3ZA 2VXSL 1JN6A 3IDXL 3FT3A 3IJSB 5SWZA 3GB7B 4OZIB 1KJ2H 1T80A 1U8KA 1Y18B 2H3NB 4I0PB 4QY8B 2V7HB 4PJCB 2VZOA 1RUKL 3Q5OA 4TVPE 4UT6L 4Y5XB 5FFLA 5HSFA 3DI3B 3QDGD 4U3CA 3BEVB 3IB4A 4R3SA 1S9XA 3OAUL 4GG6E 5FDWA 4H1LA 3JWNC 1OPGL 1WK0A 1C5CL 3RWDA 3VXRB 5EU6B 3QWRD 4EDWH 4ZUSA 1INEL 4TNWF 1KJVB 4UQ3A 1RIUL 2LU7A 3HUJE 3O3DA 2HFEA 1J1PL 3VFTB 2PTVA 3L95B 4FA8A 1DN0B 3L3IB 4PS4H 4OFIA 2A9NH 3RL1A 3PQYE 2R1YB 4E41D 2VLJD 2ENSA 4Y4HB 2NY4D 4Z76B 4HJ0D 2B1HL 3RDTD 4PJGB 3BE1L 3HLAB 4PLNC 3BZEA 5INDA 4JHWL 3QNYA 5C6TL 2P24A 1S9KC 3MRPA 4N0FB 3JWDL 4L4VA 1ZT7A 3D69B 4NNXA 2H41A 5BXFB 1BOGA 1P9MC 4UIMB 1VSCA 3U46B 2Q8BH 4E41E 1MRFH 5D1QB 4L3ED 4YC2C 3L3HB 4NN6C 3QG6A 1V7NL 3MCLH 1J8HA 5DLMH 5KS9B 4P49A 3QXAB 4RGNB 1CE6B 4XRCA 1INDH 3HC4L 1LEKB 4LAQL 2V17H 4C57C 4GRMB 1OY3B 1WEJL 4NGHL 1QBBA 2EYTA 3BP5A 1N2RA 4PJFF 1FZMA 1KXTB 5I71C 2Z35B 2IPTH 1A7PL 5BRZA 1QNZL 1SJEB 2EDFA 3O9WB 4J3UA 5DHXB 4KXZH 1W8OA 3RTQA 5IT2L 3WFBH 1CXFA 5JHDD 2AQ1A 4RNRB 3MUZ1 3QUZB 4GRLA 3VA6A 4EDXB 2COQA 2PTTA 5EZIL 2FO4B 2X2YA 4LSUL 2CIKA 3BAEL 1S9YA 1UZ6F 3H8NA 3ES6A 1MREL 1SY6L 2JJSC 4C54A 1GZQB 2AK1H 4JQVA 1R5WB 1G7IB 5ERWA 3D85D 5DHVH 3GBLA 4F9PC 3PGDB 2X4PA 1T5WB 1QEWA 3OPZL 2DKUA 2VZ1A 1MI5E 5IW1A 4PBVC 2MPAL 3C5JB 3FMGH 2NY3D 3H42L 5HHVH 4OGAD 4K2UH 2C1OB 4YO0A 5ELIA 3CVIL 3T2NL 2P4AB 2CLVB 4GW5A 4XHJC 3RI5K 2HT4C 4QXWA 4J4PC 1M71A 3C8DA 2NNAB 2LFGA 3AMKA 1CDUA 5D2NB 4LDOB 3NPZB 1T4KB 5SWZE 2V5SA 3JVGC 4GMSL 1U58B 1HQ4B 3BP6B 2HRPH 2B8OT 4IJ3B 3CFIC 4NO5A 2XI9A 5M7QA 4Y5VB 3KPSB 4FQCL 2YD9A 3V5DA 5EU5A 1ZT4B 2IG2L 3LKSA 3AREC 1MCIA 5IHUH 4JZJA 4I3RL 3BMVA 5FA3B 1X4XA 4KKBD 4WO4C 1DQDH 1P2CA 3VGEA 4N0UB 3U6RB 4WHYH 5F8RC 3VXUA 3LS5H 2DJ4A 2QBWA 1NC4A 1QRND 4GUPA 1WCQA 3KR3H 1DVFD 4ZYKB 3RVUD 3K4AA 2UYLB 4DK3A 3ULVL 2IALB 4TSBL 1U8MA 2E7BA 3MRJA 1DVFB 2VC2L 5CIPB 4IRJD 4OLXH 3DUUA 4JFFB 4UUJB 1CGTA 2CQVA 3PL6D 1S5HA 3NCYS 4HZLB 1Q38A 2VNCA 1CS6A 1NCUA 1S7VB 4P46D 4CU8A 4ODUB 4XAKE 4JZJB 4BJLA 3MV9E 3RWHA 4LOUD 2IQAB 3ARGA 1AFVL 5DTFB 2WIMA 4KUZH 3BEWB 4LNRA 4ODTH 2HN7A 2UY7A 4NPYB 4QWWD 4DKEL 3W0WD 1H9VA 3TA3D 4BQ6A 2F5BH 2IPKB 3WNLA 3HPJA 3RWHB 1RZJC 3UTQA 1VACA 4KGJA 4NP4H 1VFBA 2VDOL 3LDBB 1DN2A 3O41A 4JRXD 4FMFA 4Y4KD 1Z2KA 1JP5A 2H32B 1IGIH 5HBBA 4KROB 3LB6C 2AXGA 2VLKD 4YGVA 1QFUH 4U3XA 1OP9A 3SKOA 1K3IA 4BFIB 4AK1A 5H2BB 2IAMB 3DVGA 4EUPB 3QQ9D 2X4PB 1UWGL 1YYMH 4XP4H 1SHMA 3L3KA 4I3SH 2BNQA 4IMKC 2W38A 4PUBH 3DXAD 3OJ2C 1FL3A 5IBLC 3S36L 3MJ8A 3ULUL 3UPRA 1CLZL 4WCYH 3E3QC 4O02H 4L3EE 1MREH 2Q7NA 2CDEA 4XP6L 3IS0X 1OTTC 3QULA 3RVXC 4F37F 5T3ZE 4JVPA 2W0FA 4QWWC 5IWLA 1H3PH 2AK1L 2GEEA 3G08B 1CFBA 4X4ZA 1S7RB 4TUKH 5HY9B 5E4EB 4FOMA 1U58A 4OFPA 3RL2A 1RUPL 4JFYB 3RFZC 1AI1H 1JHLH 2OYPA 1FL6B 1N4XL 3CX2A 2NNAA 4UNVA 2VDLL 5DJZA 1LO2L 5C0BD 1KEGH 4L9DA 3DX8B 4LLWB 2NLJB 3IJHB 1MCWW 4JFHD 3Q3GB 4GRMA 4FQIL 1II4E 3CUPA 4HXBL 5D1ZC 6FABL 2AGJL 5I1GL 5T5FH 1GGIL 4KZDH 4RQQA 4OGYL 4NKMB 1YJDL 3O2VH 1IE5A 5EZLA 2HH0L 2I26N 3RGVC 1T7XA 2VITA 1GCFA 2VUYA 5GHWL 2GJ6B 3IU4H 1OL0A 3BKJL 2X4RA 1DBJL 3QO1B 3QP3A 4GRWF 2KKQA 5GRJL 2F54A 5E6YA 4APQA 5I1EH 4XBPB 1KGCE 4PBWD 1RQ5A 2IH1A 1KELH 3KPOB 2ZUQC 1N4XH 3VGGA 5TDPB 4CUCA 3K8MA 4HGWB 5JW4N 3CVHA 3CK0L 3NA4A 1T22B 4PJEF 3R8BB 3OX8A 4Y4HA 1YMHB 4EVNB 4OLYH 2EE2A 3WO4B 1J0HA 1DQMH 4IHOB 1DUYB 3SDDC 3QT2A 4POYA 4FTVB 3KDMA 3LPGA 4OTXH 1P2CB 3THML 1CLZH 4WFFD 3H3KA 3HCVA 1TENA 1INEH 3QXDA 3BDBA 4AIOA 1NMCB 3KG5A 3MLUH 1L9MA 3G5ZB 1CXKA 3HB3D 1NGXA 3NTCH 3UMTA 3OGCA 1HNFA 2F8XC 4C56E 4YAQB 1RJYB 1SBSL 4PGCA 3VRLE 4OT1L 5IROC 4CAGA 1A0QH 1DQLL 2F58L 3MRBA 1T1YA 1OAXL 4B0MM 1IGIL 5HYJE 4N0YL 2H3NA 1MIMH 1CDGA 5DWUL 3UROR 2C3XA 1CFSA 4P3DB 3D9AL 4QXTA 4K23L 4QRRA 5D1QC 4ORGB 2A6JA 3G6DH 1IEBA 2A6KB 2AAVA 3UTOA 4D9QD 4G8EA 4F8QA 1BEYL 4ZAKD 4JFEB 4KKCD 3N1QC 1LDPH 4LARL 1M7DA 1YEIL 3ARBB 4G5ZH 4HBCH 3T8XA 2AEIT 5HJ3A 5ICXB 3SGEI 1GZQA 5GRZA 3MQIA 1XIWD 1CTNA 5C3LD 3LEXB 2WM0A 1T7YA 4L8DB 4BFGA 4Z9KB 5EC2A 1S7UB 1ZK9A 3MO1B 5FM8A 2CLRB 1KTDB 5HYSA 3K81A 2G5BA 1T20B 2ATPB 4RNRA 2FRGP 4R3SB 3RTQB 5KSUA 3U79A 2X4NA 3L5JA 5E8DL 1MI5A 2VZUA 1JUFB 2APBA 3L9RA 3S88L 4O5LH 3QFDB 2XY1A 1L4IA 3QDGB 4HFWA 1Q9WB 1KLUB 4G5ZL 4HBCL 2YBRA 4Q6IB 2P1YA 3RDTC 5JXEA 1W0VA 43CAB 1LGVA 4Z7OE 3CFDB 2VXVH 1ADQL 1SM3H 1XFPA 4NKOA 3EYUH 1P4BH 1ZOXA 3JWOH 4JPIB 4ZNCD 3ZYZA 2NR6D 2OQJA 3C2AL 3I6KB 3AS3A 5D7JB 3I02B 4LLVB 1HYSD 4M5YH 5C0NC 3FT2B 1UZ8B 3IDYB 1U8IB 3MYZA 4EI5C 3MACL 1KB5L 3QAZB 2VOTA 1FN4A 4P2OD 4MQ7B 3ZYJA 3G6DL 5KW9H 2F54E 1S7QB 3MNVA 2NLJA 3CCHB 4D0DB 1ADQA 3GSQA 4E5XA 1BEYH 2NY1D 3EYUL 4WEMB 5DJZB 3S36X 5FHBL 4WW2B 2LTQB 2UUDK 5CJ5A 4X7EC 3L5WA 2YA1A 4JFYA 2XQBL 4PTTB 1M05A 5I1DB 1NCCH 4Z0XA 4U6HB 3JV0A 4HJ0C 4OQTA 2N56A 1NANI 3QDJA 1S9WA 2VLRD 3G6AA 4NO0D 4PYGA 4KJQD 5IROA 1FFNA 3U2SB 2HG5A 1F90L 1ODAA 2CDGB 4PD4K 1OSZB 2GJ6E 2JLLA 4N8PA 5HVWA 4PJAE 5T1KD 3IFLH 4Q6IC 2AJUL 4P23A 1N5YL 4Y2DD 3ULUC 4LHUG 3QO0B 4YDIL 3CFJB 3DSFL 3LAFA 3DX9B 4OZGE 2L4OA 1NMBL 2NW3B 43CAA 3MLWH 5C0IB 4PLKD 2DQEH 2O5YL 2F74A 2N4IA 2R0LH 3V6OC 3EO0B 1DE4A 3MR9B 3SQOH 1MHEA 4MQXD 3HE6D 1LDPL 5HHOE 1SYSA 3TH2T 4PTTA 3K80A 1EXUA 5CSGA 3C09C 1A1MA 4I1NB 5ANMA 3FFCB 5BVJA 3SE3A 4LP5A 3QHTC 2A77H 3ZKSD 3O4OB 5IVXA 2J5LB 5CBAA 1DBBH 4PJ5A 3TVMB 3FAXA 5F96L 2Y6SD 3MJ9H 3R1GL 3RAJH 3H7LA 3G5YB 3LKPA 3G5YA 1GIGH 1LO0L 2LAGB 4JFXA 4WFGD 5ITFA 1PG7W 3LPWA 3CGTA 1OLLA 3QEQB 4K7PH 3G9AB 3I6KA 1F6FB 3MLVL 1P7KA 1YN7B 4NZTL 4OV6F 1NANH 1O0VA 1XGTB 2P5ED 4ONHA 3B2VL 3L5IA 5IEHB 3VXMD 4O51A 2A6JB 4GW1A 1U3HA 1SYSB 1FNGA 3FO1A 3VJ6B 4L8SA 4MSWB 1HHIB 3HFMH 4NOFA 5C0RL 4X4YB 3U0TB 5DQDL 4K3EH 3OB0K 3AS1A 3ZDYF 5EPMB 4JQXA 4TULH 1N0XL 1EGJH 1I7TA 1QLEH 1EEYA 2ARWA 4LSVH 1ZLSH 3U0WH 2G60L 5T1DL 4XCCH 4KVNH 1PQZB 2FBJL 3VWJD 3QO0A 2NY0C 4KI5C 1RIHH 2ATPA 4AL8H 3O6MH 4NO3B 2RR3A 3P77B 5CBEB 1B4RA 5C92A 3SKJH 2EDBA 3QI9C 3GHBL 1OSZA 4GXUN 5INCB 2EDNA 2DYPD 5C0FA 3L3DB 3RU8L 5D70L 4LSQH 4JFDA 4FQPA 1AKJB 3F8UB 4HPYL 4NO5B 4R90H 4OCSH 3J8F7 3QDJB 1IMHC 2EO1A 1TMCB 2NZ9C 1FDLL 1G0YR 2DQGH 3IDXH 3H3PH 4U6HA 4BM7A 3MNZB 5BOPA 3SQBA 1KF9B 1CN4A 4H5SB 4ZXBC 1KB5B 1KLGA 4F2MB 3O0RH 4L8BB 3L5WB 4M93B 3I2CH 2D7QA 1LE9B 2PW1A 1QQDB 3C09B 5FEBA 2C1OA 2ZCLL 5ICYA 3KPPB 3MLSL 3HNVL 2H8PB 3ZDXF 1CU4L 4PRIA 3CH1B 4LASH 5GGSB 5KSVB 2FJGB 5DJDA 2NY7H 3BDYL 4LCCC 4LCUA 4WVRA 3WSQL 1L6XA 3M07A 3TWCL 4ZUWA 1VEMA 2Q76B 2OK0H 4JRYA 2B4CL 1MCPL 5EUOB 3D0LB 3FT2A 5AYUH 3ZE2E 3W2DL 1I8LA 2ORBL 1KJ2A 3K8LA 3F7QA 4HIJA 3HI5H 1CDHA 1G7LA 1NGQH 2F53D 4YHKL 3G04A 3SDCB 1J8HE 2MJWA 4IEFB 4GW4B 3A6BL 5EBLB 4XNXL 5DT1H 4K07A 3WHE0 5JPNB 5L0QC 3KDMB 2VDPL 3TNNA 1TJHH 4K3DL 4I3RH 3IKKA 1FAIH 5FYLD 3GMNA 1UA6H 4CJ1A 1MI5B 3C6LC 4JFZL 3AU1A 2JJVA 3FQXB 5F44A 1BZ7A 3EHBC 2C3VA 3I84A 3UTTA 2EDDA 1PGRB 3KR3L 1E6JL 2O93L 4PREB 1U93A 3MFFA 5D2NC 2IMMA 4HKJA 1B6UA 1EEQA 1CICC 4K7FA 2CKBB 4L8DA 4KTYA 1YYLL 1UGNA 4H20H 5JZ7C 2CDFB 5ESAB 2A6IB 2EH8H 1C1EH 3IKCB 2JCCA 3ARBA 3L3OB 5E6IA 4HPYH 4BSJA 4XNZB 3BPCA 1OWWA 2X10A 2NY6B 4G8EB 1ND0B 4G6FD 5DUPH 2ZCKL 2ERJC 5F9OH 4UT7L 1FNEB 2JIXB 2EYSB 4HK3J 2V5RA 2HJLB 1I3RA 2OM5A 5BMFH 4DVBA 3OF6D 3BAEH 1T89A 3MV9D 4K8RH 5L0QB 3DO3A 1REIA 2HFEB 3BVNA 4H0HB 4HJGB 4XCYB 5E2WL 4P4KC 4UQ3B 2FEEL 1IBGL 3HG1A 3VXTB 5DEFA 2FJFB 1IQWH 1EUUA 4TOYL 5CGTA 3VDBA 3VMPA 2Y72A 4Q2ZA 2OJZL 4WY7L 4YHKH 2ZG3A 1B88A 3ZE0E 3ZKNC 5M94B 1OGAB 3DHJA 3DXAB 3MRDA 5I17A 4MNHA 2BCKB 2DKMA 4Z95H 3SE9L 4L3AA 3MPCA 2NY4C 4KK5D 4YDKH 3O8XA 1TNMA 1VPOL 2XPGB 3PP3H 3V7AG 5I1HH 4C83B 4ALAL 3DUUB 1U2HA 1PG7H 1U8KB 4M1CC 2HAZA 5HI4D 1TVDA 4NUJA 2D7MA 2W9EL 4MA8L 1YMHA 3VGFA 2VAJA 4V2CB 1WBXB 2NW2B 4X7DC 1U3HB 4HKXB 1BFOB 1MFCL 3VG0L 5HPMB 4FXGA 5GRJH 2UZYB 3H2WA 4OF5A 2X4UA 4Y19D 3ARWA 3WHXB 2YPVL 1VPOH 4OQ1A 2OXGA 1AR1D 1F8TH 1KXQE 1QLRA 4IOFC 3STZA 4W6WB 5A3IC 4PJ9A 1HYSC 3V79C 3TYFA 3HI1B 1H0DA 2W60A 4YHZL 4Y5YB 4PJBB 3T77A 3L1OH 3LKPB 5D1XD 1U42A 2NQCA 4HUXB 4NUGL 1G9EA 3BKML 3CZJA 1BREA 2BVOA 3SJVD 5C9JA 4YHNB 5GGQH 4Y5YA 2YN5A 3ZT6A 3VXPB 2WWMD 4ETQA 2WUBL 5F9AC 4M1DH 4XCCL 3DX8A 1ZGLB 5DJXB 3ELAT 1MJ7L 3DYMA 3QZWA 2FH6A 4K9EC 3OKYA 3OR6A 4XH2A 5GS0D 2ZG2A 1MHEB 2Y4SA 3STLB 1B6DA 3WHE1 5D2LF 1BFOA 5TGBB 1HWGB 1WLHA 3TBYA 2VWEC 2A38A 3ZDZF 1V3JA 3G6JF 2R1XA 1KCRH 3MXWL 2OP4L 5FOBA 4AIZB 2P7TB 2XA3A 4J12A 1IGMH 5HGDB 3ORJA 4M7LH 1YDPB 3BO8A 3HZMB 1OTUD 4LOUC 5J6GB 1ONQA 2IGFH 2MMXA 4XBGA 1BF2A 5IMLA 3V8CA 1XH3A 3HPLA 3B43A 4JO1L 3CNKA 5I9QC 2HJFB 1S9WB 1L7IL 3VCLA 1KJ2L 2PO6C 3LZFL 4JN1H 4KI5E 4ERSL 1VDGA 3I6LE 1NAML 4Y5VA 3BD4A 5I1DA 4MA8H 2XN9D 5LBSL 3REVA 3BQUB 3W11D 1AXSB 2VQUA 3IDIB 4FFZH 5FUZL 2JF1A 3PDGA 4X80H 5FXCH 2G9HB 4RGNC 5DMJB 4E5XB 1KACB 3D2UB 4LLYB 1CXIA 1AGFA 2DBLL 4MB4A 5K9QG 1FFPB 1HSAA 5D7JD 4U05A 4PYHA 3LRHA 1HHGB 1FNEA 3ZYIA 3C5JA 4YC2B 3GBNH 4R8WL 4XRCB 4FQLL 1UXSA 5IW1B 5ID0B 4KMTL 3EFDH 4XPHL 4U1LA 3DYOA 3QG6B 1CD9B 3FJTA 5E8PB 2AJXL 1ZLUK 4KHTH 1N5YH 4ZTPH 2Y06L 1J0YA 5ESAA 1OF2A 1JWSA 4KJWD 1OGAE 1OP3H 1MF2H 3CD4A 3MV11 1FHGA 4MMZC 1JGEA 4XP9H 3BGMA 2GHWB 5D9SB 5EOCJ 4NQVA 4V1DE 3KPMB 3O3AA 1FG9C 2R1YA 3B4NA 1GOGA 2FHBA 3FQXA 3QFJE 2ZZUT 3LRSB 4KKAD 3D1MC 4GUPB 4W4OC 4OFDA 5EFIA 3VXUB 4NZUH 3ARGD 3E6HA 1NBVL 2FWOA 3VD4A 1C7TA 3QDGE 2YUVA 1N2RB 4FQXD 4OM1L 4M4PA 3MBED 1WBYA 2GSGA 4HWZA 1ZLWH 1CLCA 5IOPA 5DWUH 3B83A 1RVFL 5DRNA 1XGPA 4M6OL 5T5NF 1IGYB 3FN0L 1OP5K 1CZ8L 1IJ9A 3TBVA 2NZ9D 4DGIH 2F58H 4NO2B 1MCOH 3V5DB 1ED3A 4KKBC 4R97C 3BH8B 5IB1B 1BBDL 4FZ8L 3OXRA 2UWEB 3ULUD 4HIEA 4D0BB 4HT1L 2EYRA 2VXVL 3O11B 3ROLB 3VRIB 4EN3A 2FHFA 3R0MA 2WW8A 4Y4FC 5ID0A 2XZQL 3ZKMC 3LPFA 4ZUWB 1CT8B 4NNXB 3R8QA 1QVOA 1F11B 3VFVA 4ORGA 3DUHA 3SDXE 3LHPL 3VFWB 1OTSC 5DI8A 1RUQL 2RFXB 2AJ3B 2FD6H 3PHOB 1T2QH 3RUGA 3KVQA 2VABB 3RL1B 4G9DA 5DURB 4WIQA 2ENYA 3ZKQD 5GRVK 5ERWB 3K4DA 3U0WL 3WV0A 5LQBL 2X89D 2CRZA 1MLCB 4G9FD 1SJVA 5CHNB 4UBDC 5E0QA 1E4KA 5DRNB 3UTPE 5I8KL 4PGDB 4PGDA 4MA3A 4WV1C 3RWGB 5MHSD 2OCFD 1XZ0A 3EOTH 3WD5H 1JF1B 3HRZB 3BO8B 3HZMA 4NKIL 1BQSA 5DJYA 4OQTH 1J05A 3GIZL 4JG0H 4AEIH 3GMOA 5A16A 3NCBB 4NGHH 1T5XB 3ROOA 1MHCB 4I0PA 3SQOL 5D9SA 3PWVB 4LVHC 3UAJD 4LCCA 4P99A 5BV7L 1VESA 3X3FH 2HFFB 3NH7H 3D48R 2O5ZL 4MSWA 2DQEL 3QRGL 2GFBA 3RIAF 2BZDA 3MV8E 5H94B 2OL3B 4LSTL 1IGJB 2IAMD 1QACA 4MA1C 4XP1H 1XIWC 3IU3A 5KVEH 4JZOA 4K8RC 3SN6N 1MFBL 1NDMB 3PIQA 4HUXA 2J12B 3O6FD 5FYLH 4S1DD 5EU7E 1FG2B 1UWEL 1IFHL 1XGPB 4HJJH 5TQ2L 4RX4A 5DFVD 3UBXI 4HWBH 4N0FA 1R5IB 2YPLE 3DV6B 1BD2D 3HC3L 3QNYB 4WDIA 2HFGL 3P9MA 2VIRB 2W91A 5E08L 2BC4A 3ZTNH 3WDHA 2XXCB 3VGAB 5J6HB 5GPRA 4Z76A 1GGTA 3ILQD 4MZ2A 2JB5L 2FJHB 3EJYC 4OLVL 1BFTA 5FYLL 5HPMA 5MENE 4ELMF 3QPQC 3MLVH 3NCJL 3IFLL 2DD8L 1XGQB 3L95A 4P2RE 3GMMA 3EHBD 4KWUA 4Z8FL 2F74B 3EOTL 4M02A 3WD5L 3HUJB 2VZTA 5J56B 3V95A 2VXTH 3GMLA 4DGYL 2BSSB 3OSKA 1A1NA 1X5JA 4XC1H 3CX5K 3CDCA 5ESQA 1M1SA 3GNMH 4IRSA 1OGAA 1S9XB 4X98A 1KC5H 3ULSA 4P2OC 4X6DF 5F7UA 5LGHH 1OTTD 3RVXD 2BSSA 4UILH 4LSSL 3EOBB 4Y2DB 3TZVD 1CTOA 5DEFB 4UIKL 3V4UL 1TVHA 2CJUH 4GKNA 4I9WD 4FABL 1W0WB 4K7PY 4OLEA 2YPLA 4ODVH 3STLA 3RIAK 4ZAKA 4Y16B 2YD2A 1JN6B 4OV5A 3WS6A 2ZOKB 4LIQH 3QCUL 4YBLB 3RNKB 3MOBH 4P3CL 3P4LA 1UVQA 2E6JA 3BUYB 3VGBA 4JGMA 3WDIA 1BIIA 4OZFG 2VC2H 1KNOA 4P5TA 2I9TB 2AJUH 1Q72H 2UWEF 3B2UD 4M8VA 4O2CB 3GSXB 3ARED 2EDEA 1EERB 4LGSB 3OG4B 2EE3A 4G6FB 3BIKB 2Z31D 3IKCA 4P2QD 1NPUA 3UC0L 5DK0B 4Q97A 1U8LA 1H15B 2FL5B 2FYYA 1G1CA 3NIGE 1HWHB 4GO6B 4NKDB 1DQDL 4HXAL 4PV8B 3RQ3A 4X6EB 1P7QB 4TPRH 1TCRB 1B4JH 4MAYA 2BRRL 4HKJB 4FRWA 4AIZA 5FOBB 1A3QA 3KJ4C 4PRBA 3D85B 2GK2A 2OL3H 1A14L 1BQHB 5ILTH 1IAKA 3VD3A 2BDNH 5BO1H 4U4BA 1FPTL 3T0EC 3LN4A 1JYVA 5MP6L 1P7HL 3NFPA 5EA0L 3VE0A 4BQ9A 3V0WH 4XX1E 2EDRA 4GG8A 2RQ8A 5A40E 9CGTA 1C08A 1KJ3L 3TYGL 1NAMB 3ARFA 2VL4A 5HHVL 4QXUL 1KTDA 1I1AA 3W39B 3EDFA 5AG9A 4TUJB 4NBZB 4JRWA 5F7KC 5D7LE 1HXMB 5DQ9A 1H3WM 1YECH 2AKRA 3MGOA 3AXLB 5I1AA 1OD7A 4L5FH 1MWAL 4H88H 1D9KA 5DD5L 5KVDL 5CHNA 5CEZL 4M9OA 1FNSH 2CPCA 3SCMD 4MXWH 4GRWH 2V9TA 4OZGA 5L2KA 4LP4A 2VE6A 3F7VB 4JY6A 5IB2A 3V0AC 2OTWB 4NJ9H 5IMKA 3TT1H 5KSVA 2A0LC 1VB9A 5F3HA 4G8GD 1N6VA 2RGSA 5D2NE 1QRNB 1RZ7L 4HPOH 4QRPB 1RSFA 4WHDA 3GMPB 2I9LB 4NT6B 3K2UH 4G8GB 5GGTL 4QLRA 3LQAC 4DZBB 4QRPD 3O8XB 3FONB 1EAPA 2RAMA 4JGJA 2IBZY 5D7SL 2GCYA 5I1AB 1F42A 3MRDB 5I17B 2VZ3A 3TBVB 4YHMH 5IW6B 4OGYH 4KRPC 2Q7YA 2DI8A 1T89C 1EO5A 4EDXA 1CXEA 5ISZA 4J8RA 4JHAL 5DHYA 3W82A 5J1SC 3GSVB 4FTVA 4HDIB 3S5LB 3S5LA 1MUJA 4LLUA 2HJLA 4Y5YC 3U7AA 3V9FA 3HMWH 4M43H 1QLEL 1F4YL 4DWHA 3DJ9A 1A21A 1IAKB 3MV8A 4TYUA 4K94H 4RA0C 4Z0BH 5L2JB 2E9JA 2X9WA 1WBZB 3O8XC 4LF3B 3LKNA 2EIBA 5I1GH 3ULUF 4WUKL 4FQIH 2UZXB 4XCEA 4X6EA 2IH1B 3D3VE 3GJFB 2QSCL 1KEGL 4QRUA 5E8NB 4GAYA 1LHZA 3D3VB 4EXPX 4XX1G 3RNQA 1A9BB 3S36H 5JW4Q 2JJTC 4BFEA 4EI5A 3QQNA 5DR5H 4K8RL 1FQ9C 1UQSA 3GJFA 3EGSB 4NT6A 4WTWA 3VI3E 2BHYA 5J57B 4XP4L 3D2UD 4OFKA 4NQDA 5FA4B 1LD9A 3GSNB 1MJ8L 3BKMH 3LS4H 1JYXA 3VWJB 1HQRA 5J3HD 3V4VL 1KN4L 4OD2B 3LQMA 3VW3L 1AHWB 5K9OA 4Y16A 3IDIA 5GGTH 1KTLB 2AQ2A 5EU6D 3SPVB 2WWKT 5DRWB 3LB6D 4JHAH 3HB3C 1EGJA 5EULV 2IQ9L 3D6GA 5C86A 4PIRF 4Y1AB 1A1OB 2DTML 1AC6A 5FYKH 4PJDE 3QHFL 5JXAH 2VDKH 4AT6B 2WINA 5I19H 4OZFH 2ZNWA 5C8JB 2ZSWB 4PS4L 5D7KD 4AEEA 1L0QA 5HYJA 4Y5XA 3RWIA 3SY0A 4A6YH 4NOBA 3ILPB 3DIFB 4NZJA 2VKXA 4B5EA 4DVRL 3KPRB 4NQEB 3DETC 3U2SA 5JTWA 1LK2B 2R1WB 2Q76A 2V2WA 4QF1A 4OCWH 4ODHH 1YMMA 3BP4B 3IJSA 4Q9BA 3BPOC 1RZ7H 4HPOL 4YDJB 4TSBH 3T0VA 1LEGA 1CGVA 2Z8VC 1BFVH 4YGVB 1NLBH 4Y4HC 2QJDA 2CO6B 2H26A 5J3HC 3MLXH 5I15H 4L8BA 1RUQH 5TE7L 1UC6A 1PLGL 5F93C 2C26A 3NIDF 1D5MA 1IKNA 4FHBD 3GSQB 3SDDA 3RA7H 1E4JA 4E42B 1DBAH 4D9RD 1R5IA 3VWJC 1BECA 4O2FB 3GSWA 2CXKA 3VRJA 2X1QA 3HPJB 3CFCH 4UV7H 2VDQL 1AKJA 4U33A 1D9KB 3UTZB 4RGMC 5C9JB 2PYEE 5C07A 4PJDB 4TUJA 1P1ZA 3LSOA 3MRLB 3S7GA 1Z3GL 1DDHA 1X6LA 1ZTXH 5IBUG 4AEFA 1IM3A 3G5XA 4XNUH 2E9WA 3STZB 3EKCA 4BSVB 5FYJE 2HP4A 1T0NB 4K3HA 1XCTA 3IT8D 4UUJA 5F9DC 2APFA 4WHTB 1OAZH 1YN6B 2CMRH 4PJEE 3FB6A 3RGVA 3EO0A 3QHZL 2IALA 4GXVL 3DRTB 4FQ1H 1RIVL 3WNPA 1P4LA 5ENWB 3QUXD 1SMOA 1J05B 2HT4D 1A3LL 1NC4B 3CFJA 3D5OF 2FDBP 4IMLA 1Z5LB 4MJ2A 3PHSA 4QHMA 4JQXC 4LVHB 5HI5C 2MFNA 1KN2L 3D25A 1P6AB 4XMPL 2FL5A 3O2DH 3DMMA 3DMMC 1RK0B 4O2EB 3TZVC 1JMXA 5D7LD 4NWUH 4ZOBA 5TDNA 2E5EA 5I1LA 3LKSB 4Y4KB 1T03L 3PHQA 4QEGA 1BFVL 4ZPTB 2APWA 4HC1H 5D7IA 3TWCH 3MJ9A 5IVXB 3KLHD 3HG1B 1E4KC 3QIUA 3T2PA 3BVNB 4HJGA 4G9DB 5GS0C 1MCSA 3MLSH 4MJ4A 4ZXBD 1AD0B 5CLTA 4RGOH 1QNZH 1A1MB 5IBTL 2CRYA 1NLBL 3K8KA 3HG1D 2AJZA 5F71A 2RFXA 1JWUA 1J1OL 4WNQB 5K9JH 4NRYA 1X4ZA 4ONGL 3EO9L 1JRHI 5AYUL 4E9LA 1ACZA 4HCRH 3FQRA 4GJTB 4X5WB 5E2UH 2R8SH 3SDXB 1CDYA 3NA9H 2FB4H 5E99L 5C0IA 1CICD 3FQTB 1BGXL 4LPXA 2R2CA 4D9RE 5GXBB 3LKOA 3H3PL 3H9YA 3HS0B 2EE9A 2A77L 4JPIA 4CN4A 3TPUA 1K8DB 4HUUA 2R15A 3BXNB 3FFDA 3NVQA 2VJXA 3OL2A 3PABA 1C12B 1UWEH 1FNAA 1M6OA 1FVCA 2DQCL 4UOW1 3MTRA 4UT9L 2W1NA 3UBXG 5A16B 1W72H 4M61B 3QI9A 1CWVA 4OI7A 3HC3H 4PJEB 1BLNB 4M3JA 1PFCA 4QRPE 4JO4L 5F9JA 5D7KE 4O4YL 1G7MA 2EECA 4ZUUB 1NSNH 3VGDA 5HYSB 2HKFH 1V05A 2QQQA 1ZLSL 2ADGA 2D7OA 2HMID 4O00A 2CK0L 4X8JB 4C59B 1M7XA 5E8OB 2NY5C 1YPZF 3AY4A 2CLZA 1K8DA 4HUUB 3V7MA 1VKXA 5E9DE 2UVEA 3GHEL 3RAJL 3PL6B 1QSEE 5CSZB 5D7IE 5SX5H 1F45A 5C2BH 2Z31C 1MJJB 2AJVH 3D39A 1NCCL 3BIBX 4LSTH 4DKDC 1RURL 1UH2A 3KYNA 1JZ8A 4N1CA 1FFOB 2YK1H 4RZCA 5DSCB 3D69A 5BXFA 3CUPB 5HHOA 3HI6H 1NBQA 1RIUH 3ZMRA 4Q9QL 5FB8B 4K7PL 2JB6A 5EUKA 5TPWH 5HDQL 2BFVL 5GGSA 1CFTB 4Y88A 1JNHB 4JFEE 5EH1A 1QVOB 4J3TA 1YEDA 1S5IL 1NCWL 1X44A 1ZSDB 1I9RL 3MRBB 5CEXA 1KB5A 4YAQA 2D31A 3ZTJG 5B8CA 2O5YH 1BBJB 1KG0A 1U41A 3BWUC 5IVZB 4KMLB 3WKML 5DJ6B 2CLRA 2ICES 1XGYH 1ULVA 2QHRL 4YDKL 3BQUC 4OUOA 1G7PA 3RRQA 5CJXA 4RGNE 4HH9A 3RWDB 1BBJA 4MXVF 1QSEA 3N1MC 5IVZA 1DUYA 3A0OA 3LH2H 4P48A 1FL3B 1R3IH 5IF0A 4RBPK 1JNLH 1I7ZA 4ZO6A 5K59F 1YECL 4YZFF 4MD4A 1IBGH 1MOEA 3DTXA 4XPBL 4YPGA 3A6CH 1OQOA 5C0AD 1DBKH 1BVLA 1D6VL 3CSGA 4WRLA 3G9VA 3LEVH 4JR9H 2WZPD 3IF1B 2DM4A 1ZKAA 2Q1EA 4EQ2A 1X9QA 3UTTE 5DSCA 1FFOA 4P2RA 4KV5F 4A6YA 1VACB 3FKUS 2OR7A 2FLRT 5EC1A 2IFFL 4UBDD 4DOHE 4IOSD 1MJJA 3MUHL 2MQ0A 1ZGLM 5DZNA 5C07B 3DVIA 4HH8A 3ARDD 2KPNA 3CDGB 5B39B 4U1KB 4JDVA 5GJSL 1WQVT 5D93B 5E8OA 4ODSL 4QXUH 2A1WL 2QQKH 2ED9A 4KI5F 1YEEL 3REWA 3MNWB 1Q9OB 1D6EA 4LCWA 4LHUD 3O3BB 2WK2A 4KVCL 4P2QB 3EYFB 1HILA 1T6VN 5DMYA 2BSED 4DJMA 3TV3H 1BOYA 3IVKA 1U8PA 3CMGA 3QAZC 1EBAA 2DQDL 4UTBH 4CVUA 3NCCB 4HXAH 2FLBT 2NX5D 5CWSB 1OM3H 4PGZA 1SBSH 3OKKA 3BT2L 3GBMH 3LCYA 3MR9A 1IGCL 1OSPH 3BKYH 2NY5H 4CADA 4ELMA 4F58H 2XYCA 4DQOL 4X9GA 3G6JE 5JLZA 4NRZB 4LCIL 4KJPC 5H37H 5C09B 2XZCH 4NQEA 4JE4B 4J3OC 1X4YA 2NTSP 2K1MA 5FYJL 3TC9A 2NW3A 1JGUL 1FYTA 1G1YA 7CGTA 5MEND 1XGYL 3V6ZB 2I5YH 3B9KA 4JQIL 5GGVH 3UPRB 3DVNA 2M8XA 3NABL 3UPCA 5CJQL 3W81A 2ESVA 3FB7B 3DX7B 3NZ8B 1E28B 1G7JB 1FZKA 2YD8A 5FKAA 4KKLC 1FZOB 1Q72L 1WTGT 2R69H 1GRWA 5B4MD 3SKOB 4JZNA 2EIEA 3HN3A 2YD1A 4AG4L 1JPTH 5EBWA 2B0SH 1QRKA 4WHCA 3ARRA 3OKDB 3TBTA 2VYRE 1N64H 3LQZA 4DVBB 4E0RA 1UCTA 1N3NA 3FFCE 4HSQA 2VR4A 3WSQH 4I3GA 3PWPA 3IFNH 4NN7B 3IYLW 2AV7A 2DTSA 1PD6A 5DA4A 1KN4H 4XP5H 4FS0A 4HV8B 4E41A 2EXWC 1J1XL 1YNKL 4YHNA 4D0DA 5CJBA 4KC3B 1T66C 3CXDH 2R39A 3KPQA 2IQ9H 3ARXA 5LGHL 1I8IA 3LKRB 1INQB 1T04A 4BSWA 4X7SH 3S4SG 4YXKH 4NNPH 1U8IA 3D3VA 4IOIA 2ZKHH 1R5WA 4K55A 1I7RA 4PJXE 4APQC 4XBEL 2OQJB 5TH2A 4W6XB 1N5AA 1HDMA 3S96A 4XNMA 4K7FB 2J8UB 4N0YH 5MERB 5LXGH 2KH2B 5C09A 4MNQE 1ZANL 1AIFB 4FXKB 1MH5A 4WJ5B 4LQ1A 4ZDHB 3T4AB 1W0VB 4GRLB 3QDAA 1BJMA 3MSPA 1JVKA 1QA9A 3SKNB 4M1DL 3IDJA 3UO1H 4ZYKA 3RGVB 4UZGA 4ZAKC 2MHAA 3IVKB 3VFMB 3C6LD 4WFEE 3QZWB 4GG6A 5KSUB 1WIOA 2V2XB 1MEXL 4KI5D 4RWYL 4IRZH 2ATKA 1NUDA 4MQTB 4K3JL 5JW4M 2ADFH 3VXPA 3TBSA 3V52H 3VFUA 2QSQA 1IEHA 4Y0GA 3R4DA 3TPKA 5IQ9B 1AD9B 1A6WL 3QPXL 3SGKA 1CE6A 4KUCF 5B39A 2D4FA 1FO0B 4OF0A 5I1EL 4HD9A 1WUNT 3UTSA 5C0CA 1A5FL 1GZPA 2BVQB 3JV6A 4OZIF 2ICEB 1BPVA 4GLRH 4NIKB 3AY4C 1CXLA 2E7HA 1NCAL 2YMXH 5GIRB 1I3RB 1D5MB 1WWBX 1I9IL 2IFGA 3DETD 4R2GD 3H9SD 3S97C 2VLRA 3CPLA 3PV6A 1MPAL 4K71C 4PJAF 2SEBB 1DVFA 3KJ4B 4YXKL 1G9NH 2NW2A 4QRRB 3I9GL 3KYKL 4YHML 4Z95L 2FB4L 1FZJB 1YMMB 3BP4A 3MNZA 3ARUA 5I1HL 3HNSH 1RU9H 1FC2D 2YN3A 1EEUA 3IFPA 3TZVA 1LE5B 3MJ6A 2LVCA 4HGMA 4XMPH 2Y25A 3EYOB 1EA9C 1KN2H 2FX9L 3ARGC 5FCUH 5DQ9B 4LU5L 3O6FC 4LLAA 4UT7H 3G5ZA 3O4LD 3HAEB 1XF2B 1QRNE 3MFFB 1NCDH 5I75C 4H1LB 3HE6A 1PZ5B 1FORH 4QYOA 5CLWA 1BZ7B 3MV7D 1MAJA 1RZJL 4MLIA 5KSBE 2F5AH 1FFQA 2V7HA 4PJCA 1WAAA 1CDIA 1CFNA 5D2NA 4I0PC 4U6XA 3VI4F 2EEAA 3OMZA 1WT5C 1A4KA 4MWFA 1SBBA 1A7QH 2BVPB 1OAUL 2HVJA 2YRZA 4MB5A 1WJ3A 3KXFB 5F9WC 1ZTXL 3QEQD 4NZUL 8FABA 1V3LA 1IC4H 4UI2A 1F00I 4M6AA 5CCKL 1DCLA 1JGLL 1U8OB 3MRCB 4XBPA 4N1HB 4NO0B 2RHEA 1T3FA 3DXAE 2J6EL 1X5YA 1I7RB 3IAQA 1OAKH 2X6MA 2XN9E 1HHKA 1KIQB 1T1ZA 4H20L 2YSSB 3QCVL 4XZUB 1SEBB 4MJIE 4QRUB 3U30C 3RA7L 5AYQA 3MRCA 3ES6B 4PRAA 2DQTH 3H0TA 3TVMA 1MF2L 1N59B 3W11C 5A2IH 3NOIA 1D5ZB 5DRXB 3E1F1 4V1DA 4X9FA 4MQXC 4OZHF 1E4XL 2AXFB 3FFCA 4ZFFA 5KTEL 2HVJB 2CH8A 3I3BA 1PJ9A 2O61B 4WI7A 1OWRM 5E56A 3KYMB 1LNUA 3O9WA 3QR2A 3ZT7A 1MRCH 1UM4L 4LU5H 5IVXE 3W5NA 4KRNA 3QBTB 4JZJC 4OF7A 1YEKL 3S88H 2G5RA 5KZCB 4GKZB 1WZMA 4HMDA 1V7ML 4ODVL 4ETYA 4OIIL 4JM2A 4P23C 4AENA 1KB9J 5CJ8A 2P8PB 4MA1B 4YGAB 3WFCH 4L4TE 2WBJB 3QNXA 3FHQA 4BZ1H 1HE7A 3ZKXC 4HIJB 1I8KA 1JNLL 5CD3B 3SDXA 5EPMA 4G8GA 4OD1L 1TDQA 3WDJA 4WTZG 2P5WA 4FQHA 2WBWB 5CWSA 5HDQH 1FNGB 3FO1B 5TPWL 5C1MB 1HOCB 1B0RB 3FQUB 5C2UB 2DD8H 2FJHA 3GRWA 2B5IB 2OTWA 3ETBF 4J3SA 2QADC 1EMTL 2G60H 5EU3B 3D87B 4H5SA 1VFBB 2PO6A 4HHAA 3QNZA 5KSAB 5KANI 5BVPL 2EZ0D 5A2FA 2HVKA 1U95B 2UWEE 3K3QA 2F19L 2A83B 2E27H 2JCCE 5C0CB 4R7NA 3UTSB 4JFDB 5C3TA 2Y7QB 4I13B 4TVPH 5AWNL 4RIRB 3S3PA 4O2EA 3VI4E 2X4SA 5CBAB 4QNPE 1CD1B 5CP3A 3IXAB 1NSNL 3MX0A 1YUHB 1MHPH 1A8JH 5IUSA 5IT2H 2APTA 3VE0B 1EH9A 2MCG1 3KPNA 1GJIA 4TULL 3MRGB 4ENEC 4QRQB 4DGVL 4UT9H 4WWKC 1J1PH 5SWZB 4CVXB 4PRHB 3L9RB 4YNYA 1QFWI 2VDNL 3UP1A 4BA8A 4KKAC 3DX9A 1A6UL 4WI6A 4CU7A 1W72L 3FB5B 5DJYB 1HH9B 4W6YB 3T09A 1IM3B 3TP4A 4LQFL 1NDGA 1HXYA 4KV5E 3W9DA 1CD1A 4P46C 1IAIH 4ZO7A 4CRPA 2BHUA 1JI2A 4KKLD 4X7CC 3PDDA 4YK4B 1D9KC 4XMKL 1ZV5A 5CJXC 4G9FB 1BIHA 3TNMB 1KCUH 4O2CA 1NMBH 1R3KA 3SHSA 3AC0A 1D7FA 4JFEA 1VEPA 4QRQA 1EDQA 1F3JB 1LWRA 2VDNH 3K2UL 4FQ2L 4GMTH 4M9PA 1N3NB 4KGLA 4AEHH 1Z9MA 3HAEH 5DI8B 3QZWG 4MJID 4FQHB 5D7JC 5E6IC 2NY3B 2C4XA 4P3DA 4Q7DA 4QXTB 3IXAA 5SWQB 4MAYC 4J1UA 3VFSA 1JHTA 4U1MA 4FQQA 1WCBA 3DOSA 1WISA 5DYOB 1V3MA 5KVDH 1A6TB 1UKSA 4KROD 3JWDH 2X4SB 1CD8A 3EIFA 4NWUL 2ZUWA 2GIYA 1MHPL 5CS7A 3KPRD 3QEQE 1CFQA 2P5EB 4DN4H 4HC1L 1VHPA 2B1HH 4EUPH 3T2QA 4NJ9L 1NGXB 4O58L 4L5FL 1A1NB 3QWQB 1S7XA 4D9LH 2H32H 1FRGL 1CIDA 4LCYB 4M62H 1RULH 3VGHA 2J8OA 4MXWL 5F7HA 2AJSL 5EOCL 2PTTB 3ULVC 3O2DA 2F53E 4HFWB 5LCVH 3MV7E 1JHKH 3E6HB 5I1KH 5K9OB 3PQYD 2BY3A 2CMRL 3I50H 3SDDD 5L6YH 1M05B 1G84A 1GL4B 1IT9L 3NAAL 4M93C 1KCSL 5DD0L 5CGYD 1JFQL 2OZ4L 1FV1A 1X6NA 3PQYB 4QNPF 3GSNA 5A43C 1BX2B 2BC4B 1A3LH 4I2XA 1PAMA 2FZ3A 5KW9L 1B90A 2A0LD 1IC5L 1Q9OA 1GGUA 2DLFL 3QDJD 1P4IL 4OM1H 3DURA 3P40A 2R0WL 5MEQA 15C8H 1XF5B 2J8HA 3V6BR 5I73B 1YYLH 3LEVL 5E8EA 1DQJB 2AI0L 5IEKA 4MZ3A 3U4BL 4KDVA 5C0EA 2RCSL 5KVGL 4R26H 4OCXH 2VISA 1KIRA 2GYSA 3HAEG 4R2GC 3I50L 5B38A 2VB5A 4P4RA 2P8LA 1ZA3B 3NFNA 4TPRL 4NRXB 3OKNA 3MUGA 5IESL 2LU4A 4WUUB 4PY8J 4CBPA 5AD0B 5B4MC 5INDB 1CLOH 5C70A 3TVMC 5I1CH 1HH6A 4PGEA 1B2WL 3A6BH 3PWVA 3BN9C 1A6VL 5CZXD 3TJHD 3QFDA 4OLXL 3MRIB 3T4YA 3HC0B 5B38G 4LSSH 1VERA 3QCUH 2BMKB 4PGCB 3BH9B 5I75B 5C0DA 4Z7QE 5BZWB 3DLQR 5HTSA 4HWEL 3C5SA 5J12C 2F8VA 4YHIA 1EV2E 4JEGB 1Q9LA 3QXDB 3GGWB 5F7DA 3S34L 4LIQL 4S0TD 4A6YL 3AS2A 2AABL 4WW1A 3HI5L 4I18B 8FABB 4M1GH 3CSYA 5D4QA 2EDJA 4MVBD 1XMWA 2Z31B 3L3KB 5FYLE 3SE8L 4MWFB 3T0BA 4NN5B 1JBJA 1TZGL 3SO3C 1QFHA 3GO1L 2VR9A 4MNQD 2JTDA 5IMMA 1MJ8H 4XNYH 32C2A 3HRPA 4ODBD 3SGDI 3CZFA 1PZ5A 5HHOB 1I85C 3D18B 3CVIH 5F1NA 3T2NH 1QSVA 3NIDE 1OAXH 1FH5L 1TVBB 4G6AC 1DQLH 1FP5A 2EYRB 3HZKA 1MFBH 3D39B 3DPBA 2C5DC 3VXSB 4G8IB 3BEWA 2LU3A 3JWDC 4M7LT 3D0VB 2DICA 5E70A 4C56A 2B4CC 1UB5B 3BRDA 1MFEH 1Q0YH 4LBEA 2JE8A 3MV9B 1MCBA 1PY9A 4HWBL 2Z91B 4OSUL 5L7XL 3PV6B 3DECA 1YQ2A 2K3TA 4FXGB 3HMXH 1CQYA 3RL2B 4PG2A 5BS0D 3PXHA 4Y4FD 3BJ91 1GOHA 3SKNA 1WBXA 3HMWL 1NFDF 3D85A 4RDQF 2AGJH 3BGMB 1MPAH 3CVHB 1GIGL 1JGEB 3EDKA 4F3FB 4PB9H 3O81A 1YJDH 5T1KA 4JRYE 5C0GA 4PJ5E 2F54B 4YE4H 5GHWH 5GJTL 5C0CE 3TBSB 3UTSE 3VFUB 5DK0A 2N7BA 3MRNB 4GQ9L 3KPSD 2EDTA 3M17B 4WW2F 2FEDD 1MCJA 5SX4I 2NX5E 4ONGH 3R1GH 1OAYH 4G8FB 1A9EB 4YHPA 1V7NH 2F53A 3KPSE 3KPQB 4RGOL 3PDOA 3HA0A 3FRUA 3KLHC 3SPVA 2BNUA 1EJOH 3BD3A 2H32A 5HVFB 1QZ1A 1PBYA 2H6PA 4WI3A 3SGKC 1WC7A 4PJFB 4WNQA 2Q3AA 1F4WL 2JELL 3MA9H 5CUSH 1DBMH 3O3EA 4ZSOA 1KEMH 4FFYL 2Y23A 4OF3A 5B21A 2NY2C 2J8UA 4KHXH 3U0PA 3BE1H 1A22B 5IJVB 2FR4B 1TETL 3F7YA 4JQIH 3QIUB 4EN3C 4JFOA 1QHPA 5FKAB 1D5IH 3Q5TA 3RY4A 1T5WA 2AW2A 1TZIA 4P59L 3ALWA 5TDNB 1YYML 5ESQB 5ALCH 4KQ4L 3DVNB 5FHBH 3P11L 5CINL 4CU6A 4FZ8H 3WN5C 4XBGB 1R24A 3IDNB 3PE9A 3AUVA 1S9YB 4XVJH 4J3XA 2MCPL 4ENED 4F3FA 3NACL 4M6NH 1OAZL 4XCNA 5CIPA 2DLFH 1OARL 4LPYA 1HNGA 1B0GB 5D6CB 2OL3L 1UB6B 1IL1B 1E6JH 1O7VA 4ZFGL 1PDKA 4MYWB 5T3ZL 1SM3L 2WP3T 3MMEB 1RJLB 1KJ3H 5J4MA 2NXZB 1WGOA 1EUTA 5GS1B 2A74A 3MV9A 1ZGLA 4XVSH 4Z6AT 4TNWK 4LCWB 1F58L 2DYPB 2ITDB 3P11H 1KB5H 3PXJA 5MEOA 2IPKA 1DZBA 2NXZD 3EDEA 5HD8C 2AJXH 1YNLL 2AJSH 2VUOA 3JUYA 5E00A 1LEIA 4QOKE 1CG9B 4HCRA 5BZDA 2X9XA 1J8HB 3SDYL 1JPFB 2XTJC 1W72A 4U6VH 3NN8B 3KLAA 3B8YA 5HGAB 1WV7T 3ARSA 5EOQH 3U30B 1IGJA 4QHLA 5I0ZA 4U49A 3OKKB 3CJJA 4XB7A 4PJ9B 4P2RB 3SDDB 4XC3L 4WU7A 1T0PB 3RDTB 2E9IA 1WFNA 4WGWB 1ETZB 2ARJB 4MQSB 3WS3A 4G3YL 1VFOA 2D7TH 1MJUH 2P45B 4YPGB 2CO7B 5I8EA 3C5ZA 1EFQA 2PW1B 4XPTH 3E8UL 3VWKA 2DQDH 2UYLA 2B39A 1CU4H 3N1FC 3DGGA 4QHUB 3LZFH 1MAML 4YFDB 1DL7L 4L3CA 1Q9KA 2A9ML 1LO3L 4LRIA 1KJVA 4UILL 4RAVB 3F62A 1WZ1L 5EU7C 2YWYA 4I5BB 4A6YB 3ARDC 3GGWA 12E8L 3UYRL 3WIHH 1K9TA 1XEDA 5DO2C 2FX7H 4G42B 3P4OA 1A1OA 2J5LC 2PF6A 2WUCL 4Q2ZB 5TDOB 2D7NA 4S1QL 3HE7B 5C0DB 1FIEA 3WBDA 3O6FB 2D31B 1YEIH 4MJ5A 4PP2A 4MAUH 4K94C 1XR9B 3T65B 1FFRA 5CEZE 2X9YA 3MRMB 1OCWH 3RVWD 1EEYB 3DTXB 4M7JH 4MB3A 1KCSH 2B2XH 3MV01 1CCZA 1GPOH 2X4OA 1SY6H 1M71B 4JR9L 1FZMB 3MXVH 4NZDA 3OAYH 4HLZH 43C9B 3QQ4A 2L7UA 4LSPL 2R4SL 2OSLA 1IILE 5F21B 5HPOA 1MIML 3GHBH 1HIMH 1U8HA 4GW1B 4UV4L 2WIIB 2IADB 2G2RA 4MHHG 2B20A 1BVZA 3MCG1 3VWKC 5B38B 3RHWF 2UVFA 4KJPD 1F4HA 5F7DB 4F57L 1UQSB 4R9HA 3C5SB 4LVEA 1SYVA 4UAOC 2GW5A 3G6JB 5B8CB 3BIKA 2PTUA 4YBHA 2CDFA 1AGBA 3SGJC 3T2OA 3RZCA 3SOBL 4L4VB 2CR6A 4C4KT 5E08H 4OZFA 5FECA 4NQDD 1OD9A 4NYLA 2AXJA 1FO0L 3BZEB 1Q1JL 1JNHA 1PYWB 5EFIB 3FQWA 3BUYA 4KTDL 4JKKA 3ZL4H 3U9PL 5C08A 3PWNA 1EVUA 3QH3A 2ZOKA 1UM6L 4RFNC 4KK6D 4Z5RA 2VMFA 3TNNB 5TE6H 1OOAA 2EYTB 1MI5D 1C12A 4OFVA 1QKZH 2HWZH 2AEPH 5HDOA 3X3GL 3GK8L 2H2PD 4LLMA 1UCBH 3HZYB 3QUML 2V9QA 3X3FL 4DGVH 1UZ6E 3EO1B 4OKVA 5E2UL 5IW6A 2C4FU 1LQSR 1FNHA 2DM7A 4JHBA 4PJIA 4WI9A 2JJWA 5DF0A 3AM8C 1MAKA 3BGFB 4NNYB 1AO7B 4QO1A 3OR7A 4OCRH 4PB0H 5FGSA 1RHHA 3BW9B 3V5HA 1CGSL 1FV1B 3QDME 1H3PL 4OCLC 4JRYB 1HI6A 2CK0H 5F1SA 4PRDB 1R5VA 5IK3B 2F15A 2AK4A 1ZT7B 2I9LA 4YHYB 1KFAH 2R4RH 4L29B 3AFLA 1P7QD 3L5XH 3OKMA 5BS0E 4Z0XB 4ZS7L 3UXFA 3TA3C 1JPST 2H8PA 4M8QB 1RPQA 2YRPA 1JHLL 4X6DE 2DQUH 3PABB 1F3JA 4LVOC 4F2MA 3FAWA 4PRPD 5KG9B 4GS7B 1YEHL 4U6YB 1WSST 4G6ML 5LJYH 2DI9A 5DD6B 3RX7A 5SX5K 4UDTB 1HEZA 3T08A 4YWGH 3BWAA 3IAGC 4PBXA 1D5BA 1I8MB 1CYGA 5D1ZA 4GRWB 3P73A 1DR9A 3EYVA 3KLSA 4NM8L 3I02A 3LKQA 4LLVA 1JPGA 1DEEB 1CF8H 3OAUH 5EO0B 4Z77A 2ZCKH 2ZUUA 2ADJA 2B5IC 3KWWB 3N06B 4WTXA 2KQMA 1OW0C 2BDNL 4X4MA 4CVZA 3O6LL 5F7FA 4PJCE 4PJ8D 3CXHK 1I1YA 4Y19B 2R2EB 3VXUE 2R2HB 1J0IA 2OR9H 4GXVH 15C8L 3FN0H 2F5BL 1HZHH 5M95B 3QDGA 3BHBA 3WJJA 2HT3C 1OGTA 4MGXA 5J7CC 3KHOA 5IEHA 4H25B 1BFSA 5HHQB 1HHJA 3E6FA 1T83C 2R29H 4MNGA 2ADJB 3EOYG 5F7MC 1UKTA 1JF1A 2FIKB 2VN7A 4Z7VE 1RHFA 4PV8A 2DRUA 3GKWL 1RZFL 5ADPH 1IM9D 3NAAH 3WFCL 1N0LA 4OAWA 3CFEB 4N90E 4RISH 3EOAB 3WNMA 2C3GA 2ED8A 4JAMB 3MA7B 1JGVH 2EC9T 1Z9OA 2MTPA 1SQ2N 4XNXH 5DD6A 3DO7A 1KFAL 4ZXBA 5EWIL 3LOWA 3M8OH 4FQ2H 4GMTL 4RISL 4UIKH 4MMXC 4RDQG 3TFKC 4ZUVA 1T0MB 3ARPA 2R2BA 2RCSH 4PJHF 4B53A 4U0QB 2JJTA 4YHOL 3SKUD 1EPFA 4Z7OF 4JRXB 3MJ7B 1EHAA 5JXAL 3SEPA 1CF8L 5F7EH 1ZWIB 4LRNH 3S3SA 3TO2B 5KAQF 2NY7L 3DX6A 5C0AB 4WO4B 2KBGA 4U1JA 4KK8D 1Y0LA 3BH8A 5DRZA 3RHWK 4BZ2L 1HEZB 2DAVA 1U95A 4CMMA 5IWLC 4P23B 1D3CA 1K8IB 1DQQB 4JLRA 3NCFB 4WI8A 4HLJA 1MVUA 3HUJA 5F89B 1N8ZA 4ZUTA 4ZFOB 1WICA 1YEHH 3VD5A 3UJTL 4ZODA 2YUWA 4Z78B 3KPMA 4YWGL 2GTZB 3C87A 2BK8A 2EYSA 1DBML 2K7QA 1I8KB 4DN4L 3MZGB 3CCHA 1ND0A 1NCDL 2BVYA 3PP4H 2WINB 5EIIB 3CC5B 3BPCB 5DR5L 2LE9A 4QTHA 3K1KC 4WUKH 4PJGF 2IPUK 2DMKA 3C08H 5KVFH 3LIZL 1YPZB 3ECBB 4Y1AD 1P5VA 5E8NA 3D39D 2R0KH 4NQUA 3V5KB 4PRHE 5JR1L 3O4LE 1MJ7H 1R3LB 4NKMA 4JB9L 5BV7B 2HTKC 4FP8H 1JNNH 2X41A 2AEQH 3IXTA 3P0GB 4NHUA 5I1IL 1RZKL 1JPSH 3VWJA 3NFSH 1EO8L 3M1BA 3WXVL 3WFDH 4X6DB 3GSNL 1G9NL 2HJKA 4X6DA 2O61A 2OZ4A 1QLFB 5DEGB 1MWAA 4NBXB 5J12B 1RK1B 4AM0B 4QHNA 5CGYC 1ZHLB 1ZT1A 1R6VA 3L1OL 4ODWB 5I8OL 3BKJH 5IMOB 5GS3A 1NKRA 2X4NB 5E5MB 1XIWB 2VLME 3QDMB 2E6QA 2YZ8A 1SEBA 3T0EE 5BRZD 3NCMA 5I1IH 1KCLA 4HFUH 4AG4H 4P5TD 25C8L 5CJOL 3TA3B 5IV2B 1GC1C 4NC1E 3G04B 4BQBA 3RVTC 4IDJH 5EC2B 3NGBB 4GRLD 4NC0B 1U91B 1A6ZA 4CW1A 1IEAB 5JHDE 5KJRL 1ONQB 4F9LA 4K3JH 4YDIH 4XHQA 2OSLB 1QFWL 2WMPA 3P4MA 1UM4H 5JOEA 4N0CC 1FZJA 2A9NL 4XC3H 4MDIB 1U6AL 2RB8A 2RIKA 2ZUVA 4X0KB 3UJJL 4YXHH 2EDOA 2FSEB 4WFED 4AY0A 5DUPL 2YKLL 4WI4A 1MCOL 3HE7A 4J4PA 5GISL 4Y8DC 1T1XA 3LDBC 1OAQL 4GBXA 3HAEA 1XF2A 4K8RD 3FRPA 1RVFH 2X7LB 4QHLB 2ICEA 1ZHNA 4OM0L 3MROB 1OAKL 1T6WA 1Y0LB 3OXRB 4WI5A 1AJ7H 1LO3H 1J8KA 2V2TB 4R96B 2J4WL 1YEEH 5JORA 5CCKH 1QTYT 2JIXD 1DL7H 5MEOB 3JXAA 3ARFB 2DOCA 3O2WH 2A9MH 1QRNA 5C6WH 5F6HI 4S1QH 3DBXA 3NFPB 3WHXA 4PJGE 3WS3B 4XNUL 3UYRH 4N0CD 1W2KT 1H3GA 3MRKA 4M00A 4M5YL 3ZO0A 2DQHL 1UB6A 3LRSA 4HAFA 1QFWM 5DJ8A 1F13A 3HZVB 4YBQC 3JV4A 4OZGB 3VI3F 2HYMA 5FK9A 5CFHA 5E6ID 4JKPL 4ZTPL 1YC8A 5EOQL 2XQYG 4DFHA 3GBML 2DLEA 5MERA 5FDYA 4OUUB 4GT7A 2APVA 5E00B 1KENH 1R3JB 1LEIB 4APQB 4L4TD 4GKSB 3U4EB 1PLGH 5IP4A 1NC2A 2VITB 4KH2A 5E9DA 3MODH 3VXRD 4F80A 3SDYH 1KEML 3LKRA 4S1DC 1I1FB 1BWWA 5CEYA 2I07A 4P46A 5D5ME 3CFBB 2NY4B 1B3JA 2GAZB 7FABH 1S8DA 3FT4B 3EDDA 5AUMA 3QJHB 3CLFL 4ZTOL 1JGDB 4F7PA 1QA9B 2R2HA 5IG7A 3VD7A 1QSFD 1UVQB 3O0RL 1CVRA 1J88A 3SCMA 1EFXD 5E95B 3TBTB 5L2KD 3QQ9C 3HNVH 3I85A 1RU9L 4BH8B 2CJUL 4FABH 2XWJA 4HW6A 4YE4L 1MQ8A 1HCVA 5EO1A 2CRIA 1CDJA 3CXHJ 3TCXA 5GQBA 4IOIB 5DVKA 3VCLB 1G7JA 1QSED 1RMFL 1NL0L 2R0ZH 3U1SL 5GRUL 4GMSH 1KCRL 3KYOA 3MXWH 3Q48A 5CSBA 2Q3ZA 4AL8L 4ZFOL 5SX4H 3TO4A 3UZEA 3IETA 1UADC 2HFGH 2R56L 4TRPH 5EU4B 1I7UB 4POZD 3BPLC 3FN3A 3PF2A 3MLPA 2CIKB 2AV7B 5CKAA 5KJRH 4NRZA 2YPKA 4OLWH 5TE4L 2YZ1A 3G5VB 4OSUH 1WC7B 4QRTB 4HEPG 1O7SA 3ZHKA 2PR4H 4IBLT 4ZAKB 1TETH 3KXFE 5DFTA 3ZTJH 5A3ID 4FZEL 4MCZA 3DGCR 5IVOA 2XTJE 5IK3A 2I25N 1WIUA 4U0RB 4HJJL 2DQUL 3OAZK 4X6FB 4RWYH 4X4XB 3UTPD 5EBMB 5A1AA 1A2YB 4P5KB 3IGAA 2OBGA 3NZ8A 3V6OE 5DJXA 2QSCH 4LBEB 4G9FE 1A7PH 1NC2B 4IRSB 1UFUA 4U7SA 5GZND 2OJEA 1BQUA 3B9KB 3IDGB 1IFHH 1FH5H 5HVHB 4NQCA 4YDLB 4K3EL 4U1KA 3GSOA 1UZ8A 4LKXB 4NKQB 1A7RH 2EIZB 4AEIL 1LDSA 2XKNA 2XA8H 3QIWA 3WFBL 1H3XA 2J6EA 4HLZG 4XMLH 2FATL 3GMMB 5J9PA 3OZ9H 4G80B 2AJVL 3MREA 1I8LC 3QRGH 1F3RB 5L88H 5DJ2A 1FGNL 3FQWB 2YBRB 4GAJL 1WWWX 1MCLA 2HTLC 4LSRH 2DIJA 5TF1L 2EC8A 1TZHB 2IPUG 2APXA 2VIRA 3H9SE 5DHVB 3I6GA 4M1GL 3DV6A 4FNLL 4WDIB 4X6CE 1JZ3A 4B41A 1Z0MA 1MY5A 3MA7A 3TN0B 4YFEA 4ESKA 5MI0B 4RAHA 5JR1H 3MLTB 4Y8AA 1VCAA 5I8CB 3I75A 2NXZC 1XZ0B 1P84K 3PJSA 4OLUL 1IC7H 2GTWA 2XN9A 1R3HB 5GZNC 4R4FH 3B9AA 3RWJA 3MYJB 2V9RA 5FA3A 1NEZG 4MNGB 4DAGH 5EU6A 1R0AL 4JY5L 4YQXL 4JN2A 1U92A 1SJHA 3KLDA 3INUL 4OZGF 1H8NA 3UJIH 1NFIA 2C7UA 3ARDB 5A2JH 1QOKA 3QQ4B 5GGTA 4LCCB 4LVOB 4ISVB 2VAAB 2NYYC 4JFFE 3S37L 4GAGL 5DMIH 4MDIA 5EO9A 1HKFA 3W9EA 1CFVL 3O8XD 4QRSA 1C5DA 4XTRC 4L8SB 4HUMB 3Q6FB 5EO0A 3TIDB 2PYFA 1V3KA 5BS0B 2W0KA 1AY1L 4YHOH 1NJ9B 3DHMA 2W9DH 2R0WH 4GS7C 1G7PB 3BESR 3WMSA 1KIRB 1ROWA 4RAVA 3BUTA 3ZHLA 4LRNL 1R3HA 1Q9KB 4DW2L 5IEKB 1ED3B 2NY2B 3OWEA 4GFTB 3VMOA 1JZ5A 3OGCB 4OB5L 1F97A 1P4BL 4FQXB 5GRUH 5C0AE 3U48A 1KULA 3MBEB 5DO2D 3JWOC 1CR9L 1FNLA 3TN0A 4AYFA 4KRPD 2NY1C 2ZNXA 1ZT1B 3C5ZB 4F7MB 1JPTL 3V4PH 3VXNB 1RI8A 2J3SA 4G43B 1EZVY 4KRPB 5EN2B 5IVNA 3EZJB 4D9LL 4TSAH 1UJ3A 4KK5C 5IVXF 1NQBA 2P8LB 3M8OL 5DMGD 4S1RL 5J9PB 1H5BC 3IDUA 4X8XA 4WWKD 2Q8AH 1JGVL 1FBIL 3ECBA 4LGPB 1TQBC 4L3EA 4LKCA 2IANA 4PJ8C 1LEKA 2IANB 4OF8A 5IFHL 4X9HA 2P8MB 2ADGB 3MOAH 3ULVH 1NH6A 4KZEL 5EZLB 1KJ2B 4AEHL 2DQHH 4F8TA 4R0LA 4RQQB 2J88L 3R0NA 1FNFA 1P4IH 3JVGA 5D1XC 3UPAA 1RUAH 4MCZB 1DANT 4N5UA 4P5MB 4WFHE 2RJMA 1C5BL 4X4ME 3NMEA 2AI0H 3QI9B 3KNBA 2PW2B 3RWCB 3WO3B 1AGFB 2NY0D 1NLDL 3PWUA 3DI2B 4QRTA 5K9QI 4PJGA 5B39G 2OX5A 1ES0A 1FL6A 1KC5L 4DN3H 3FB8A 2QADD 3QI9D 3FHAA 5JIHA 4OB5H 3BQUA 5EU4A 4J2XA 2ZJSH 5D1XB 3PG2A 3DNKA 5JA8B 1IAMA 1S7RA 1YNTB 1UYWL 1RIHL 5KSBF 1EHNA 1TNNA 2G75A 3F5WB 1LO5B 3BFOA 2NPLX 2PKDA 5IBLD 1H3VA 4FFWD 4NQEE 3WIFB 2CDEB 1PZUB 2JJSA 1ZLWK 1NUNB 1UXSB 3GJFK 5CBEA 4Z7VB 1YY8A 4DTGH 3ISWA 2X4TB 4IIQB 2I24N 2FR4A 3EYSH 2FGWH 4NO3A 4HS8L 5ALBL 1FFPA 3Q6GH 4WWID 1ZS8B 4ZOCA 4XWGH 2AJZB 2HTKD 3DVGB 5DD3L 5HGHA 5H2BA 4QY8A 4LFHG 1V8HA 5L9DH 5A2KH 2E7LC 1U6AH 1Z6JT 4EOWH 2VERN 4XI5C 1N7ML 3LEYH 5EB9A 1JUFA 1Z9SA 3C5ZC 4PJ9C 1SMAA 3GM0A 2CSPA 5E9DB 4LLQB 3MRNA 2M26A 1FCCA 1BD2A 5I8OH 2IJ0C 1UCBL 3CU7A 1AE6L 1WWCA 5FUOL 3DMMB 1IGFL 2PXYA 3CVHH 2BVOB 1MELA 3PWLB 1YDPA 3I3DA 1IAOA 2BY2A 3BYTA 3X12A 2DQCH 3GMRA 3KPLA 1PEZA 2VQ1B 2ADIA 3QA3A 2VLJA 5GJTH 1C8PA 1H0DB 4RRPA 3GI8L 1TPXB 4OFYA 3O9WD 1S5HB 4HZLA 4Y2DC 4Q9QH 4WTZA 3LIZH 2VDLH 5HHXL 1MCEA 3MRGA 1PKQE 1T0NA 3QUZD 1U8QA 4WU5A 4AZ8A 3P30L 5JDJA 4L9LA 1FE8H 2IBGA 3DBXB 3DRQA 4BH7B 5LGJA 1M7IB 2V7NB 1JZ4A 1AE6H 5FUOH 2P5WB 4QT5B 5KVMC 2GUOB 4KZDL 1JNNL 3H7BA 4YBQD 1GGIH 3VXMA 1LK2A 2R1WA 2V2WB 4WY7H 1ERNA 1CG9A 3GSOB 4KJYB 1DLHA 5K9JL 5EIQA 3QNXB 1GGYA 4POZC 5KANG 5C8JA 2DYPA 2ITDA 2V5MA 2FGWL 3Q0HA 3AREB 3TCLB 1K4DB 4XPAH 1QR1B 1RUPH 4ZO9A 2X44D 4A2MA 2X89A 4GKZA 2ZKHL 4X6FA 2FJFA 2VLLA 5IHZA 1YEJH 2PR4L 1S9VB 2BJML 2F19H 3O9WC 5FUCE 4F7EB 4IHOA 1BQHG 1PKQB 5JPMA 1NMCC 5GS0L 5EBGA 4PRDA 4DCQA 2Z31A 4QRRE 1F3DJ 5CD3A 1UJ3C 3P9WB 1MFAL 3V5HB 1MAMH 3ILPA 4NQXA 1A6ZB 4IRJA 5EZJA 3DXAA 4AT6A 2NX5B 2MQ3A 1VGKB 3TJEH 1ADQH 4OKVB 5ABDE 4OLZL 4UB0L 5IKCB 5MEPB 2FX8H 4NDMB 5T1LD 1IAIM 5I66B 3O6KL 4PJ8A 1DJSA 2Q6WA 5I76A 4MXQD 3VXTA 2FECI 4B7IA 2WNGA 4R2GB 1HYRC 1CICB 5TFSL 2Z93B 3AAZB 3BZ4A 1TCMA 1CLYH 2YEZB 2OJZH 4PTUB 4XHJD 2D7PA 4ODWA 3RKPA 3W0WA 4M5ZH 2WLYA 2DM3A 3LV3B 4Z18A 3OKOA 1KTKE 1MWAB 1TJIH 2H6PB 5IG7B 3ARFD 2BVPA 3V6FB 1KB9K 2F9BT 4NHUB 5KTEH 5F1IA 4LHUA 1OSPL 1SVCP 2VDQH 3W5MA 1J10A 4P46B 1V7MH 4OZFB 1KOAA 1WFTA 4S1SL 4F37K 5FKPB 2BSTB 1X5XA 5HD8D 1S7TB 1A9BA 5HY9A 2YSSA 2Q6WB 5I76B 3SDAC 1NEUA 1LVEA 4JFFD 2HRLA 5MEPA 1F58H 4XVTL 1GYAA 4BQ8A 2J6EH 1JWMB 3BGFC 3MRHB 2DJUA 4RAUB 1K3ZA 2DTMH 5FYKL 4XCEB 1YNLH 1NC4D 1JL8A 1S3KL 3PUCA 5JUEL 3FOMA 5E4IA 3I9GH 4AH2A 3Q2CA 1U8HB 1G7HA 4XVSL 1BWMA 4X80L 5AAWA 1FYTD 4R90L 2DDQL 4FFZL 2FBOJ 1KBGL 4M1CD 5SWSE 3RX8A 43C9A 4DVRH 2ZUQB 1F4AA 4OI9A 1NAMH 4R97B 4RRPG 3HHRB 3DROB 4NSKB 4P59H 2AXGB 4YR6B 1RZJH 5DFVC 2QLVB 1OARH 2J4WH 5FYJD 5AG8A 5DUMH 5IB2B 2YPLD 2PCPA 4JVUA 1DANU 3S35X 1ZHBA 3OGOE 3V2AR 2VL5A 3U9UA 4L4VE 5D72L 3OXSB 4QOKA 1OAUH 3VXSA 3JV6B 2V2TA 1J18A 1OB1A 3VFRB 4M7KL 4ELKB 3VW3H 2OMNA 2PYED 3QIBA 1KIPA 2FCBA 5FO8A 5T1DH 1FO0A 4LNRB 3D0LA 4NJAL 5TF0A 5EUOA 1JIBA 1ZLVK 4L8CA 1NGQL 3V0VB 3BP7B 1R0AH 1MVFA 2MPAH 4JRXA 4MD0A 1JRHL 3WFEL 4BFBD 3B9DA 2DQIH 2DL2A 1H5BB 1YQVH 5F88A 3EYQC 3INUH 4PGBA 4YR6A 1OTSD 4L9LB 3RI5F 1QQDA 5SWSB 5FCUL 3GB7A 4OZIA 3FQNB 4ZMAT 4EVNA 3U0TA 4MAYD 3E2HC 3VXQA 1T22A 4PRBB 5D5MB 1UACH 2VQ1A 3QA3B 5J11C 3H9HB 3S4SA 5T33L 4HGWA 3VDCA 3LN5A 3L3DA 4PJAB 4MAYB 4HF5H 4HFUL 5BZDB 3U6RA 4JKMA 4PV9B 2GJZA 1K4DA 1QR1A 4OQTL 1HXYB 3P30H 2GJ6A 3MLZH 2GT9A 1HH9A 3VFOA 3QUMH 3IDMB 3U36B 1ZMYA 5HYQB 1NCAH 3MCLL 3MMEA 1UXWA 3ZKND 2W0PA 1YJDC 3QG7H 3LEYL 1AI1L 4CVXA 4RMRA 3OJMB 3QEHB 1HQ4A 3BP6A 3LMJH 2HFTA 2BOBA 3ZE1E 3Q3GA 3V6FA 1FVEB 1BQHA 1YMME 5GSRB 2R2EA 4FTVD 1I1YB 4XP1L 3QUXB 4X5LA 4WEBL 5FO7B 1YUHA 2CLVA 4NBYB 4X7TB 5FCSH 3V52L 2OLDA 5D1QD 1I75A 2FD6L 5E1AA 1MCFA 1DEEA 4TRPL 1AH1A 2XY2A 1BVKB 1TVHB 1DQJA 1U8LB 3LKQB 2M1KA 2Z0BA 2MKWA 2J7LA 4JFXB 1DUZB 2GKIA 3QYCA 3F5WA 4X98B 5J1AA 4K3GA 5IFJA 5KN5A 5CZVL 3VXRE 3QCTL 5KBNC 3QNZB 1NBYA 3TIEB 4FG6D 4MNQA 4MAUL 3ARTA 4Y5VC 4OLWL 1UT9A 3BSZH 5TQ0L 4Z78A 4ZSOB 3GKZA 4LLQA 3MRQA 1VFMA 1XCQA 4UMGA 4W81A 3LQZB