4OD1L

Crystal structure of human fab cap256-vrc26.03, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
211
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNNFVSWYQQRPGTAPKILIYENNKRPSETPDRFSGSKSGTSATLAITGLQTADEAEYYCATWSASLSSARVFGTGTRITVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.03 heavy chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od1L01
3WKMH 3K2UH 1FNGB 3BQUB 2YKLH 4C56B 5FEBA 5LGJA 4JDZA 1BFTA 2CLVB 1A9EB 2GTZA 1I9RL 3OKKB 5HYJB 3BZEB 4J7RA 4KV5F 2WNGA 4JQIH 2WUCH 4WFGE 4L8SA 1NANI 4P5MA 3DUSA 5GS0D 3MXVL 1NEZG 4GAJH 3UYRH 3TC9A 3ARFB 4G42B 4R7NA 4ZDHA 3IFPB 1FFQA 1ZT1B 3U46B 4LSUL 3KLAA 4JQXA 3TBWB 2Z31C 5D7LB 2OTWA 3ESUF 2QQLL 4XCNA 2DQJH 1IVLA 1C16B 1CT8A 3MACH 5HHME 3VWJD 4KZDL 3S3JA 2EZ0D 3BDYL 5EO0B 3KPOA 3VJ6B 1FNFA 2X10A 3RX5A 4JPIA 3FO0L 1A6UL 2OQJB 2RAMA 3I75A 1I8MA 1DANU 4KQ4L 4PRBB 5T1KD 1R3KB 1MF2L 3MLPA 4HV8A 4EI6B 4XNYH 1BD2B 3MRMB 2R56L 1NGYA 5I6XC 2E7MA 1ZVSA 4X6DF 3VD9A 3WDJA 5LQBH 4OF0A 5KVGH 3BIBX 2UZIL 4LIQH 2D7MA 1LE9B 2EIBA 5HYSA 4O2EA 5IVXB 3UC0L 5EWIL 5JA8B 3MRKA 3VH8B 2D0GA 3PHOB 5HGGS 2DLFL 5C09E 3L3OA 2WBKA 2XG4A 3SDYL 5JOFA 4G3YH 2BVYA 2JB5L 1UJ3B 4RRPA 5FOJA 2ZPKL 4OLXH 3V7AG 4KRNA 5CEXB 3BMWA 1TZIB 4GQ9L 2VDMH 3WJLC 3U30C 5ELIA 1Q0YL 3AUVA 4MAYA 5D7IB 1GGCL 5B38A 5ISZD 3VFOA 2IEPA 4I18C 5CJOH 2I9LB 1WFNA 3BP7A 5SWZD 2WIIA 3PP4H 1AR2A 4FTVA 3O3AB 2ARJQ 3U4EA 4R26L 1I8KA 1YYML 2VO5A 1NFDB 4AMKL 2JKXA 1P4IH 2I07A 3TJHD 1RULH 1T3FB 3GNMH 5ERWA 4K9EH 1MI5E 2A73A 3BKYL 1RUML 4OCSH 1JRHL 3F62A 3HUJB 2FH6A 2BRRH 2AXFA 2P42B 5IM7A 4JEGB 5GS2H 4U6XB 4DVBA 2GAZA 3EOAB 1EZVY 3N1QC 4RAUB 2DKMA 3WS3A 3HE6C 4KKCC 4YPJA 1ZLVK 3AGVA 2WINB 3ARXA 3BXNA 1NCAL 2A9MH 2W59A 2ZSWB 1CGWA 4LHUG 4O00A 4R90H 3IXTB 3O9WC 1F6AB 4R4FL 2J88H 5DD1H 4YE4H 5FYJD 1DN0A 1SY6A 5F97E 5JW3L 1D9KA 1PX4A 3MRIA 4EI5D 2VQTA 1HINH 5LGKA 5DRWB 4KMQA 3FFCD 1YNTA 3QXDB 2JJTC 2FX7H 4PY8J 1E28B 4OGXL 4XNXL 3GHEL 1JGUL 2FSEB 2RCSL 3OBAA 4Y4FC 4BZ1L 1I3RB 4DUWA 3BJ91 1G6RH 5DJCA 3DI3B 5DJYA 2Z91A 1CLZH 4ZUTB 4CN4A 2L0DA 2V5MA 3T0ED 5DQDL 1CDGA 4CVZA 3M8OH 2NNAB 3FO1B 4X98A 5HI4C 5AD0B 4P23D 4PJDB 2H2SC 1X6LA 4XCYA 1V3MA 3W5MA 5LG1A 1IT9L 4XP5L 3VXRA 1FBIH 5JHDA 2ARJB 3Q3GA 1FO0B 3SO5A 4TVPH 3AMLA 4IDJL 1RV6X 4XNZC 1PW3A 1LNUA 5C0BD 3UAJC 4WCYH 4DZBB 1QD0A 1KN2H 1KENL 2EDXA 2FJFB 2CGRH 5HTSA 2LABA 4JRWA 4WNQA 2DM3A 3LD8B 3S36X 4NRYB 1F02I 4QRTB 1BOGA 1BQLL 1T0NA 1ZLUH 2IAND 3QISA 2G60H 5I1HH 2ADFH 3UO1L 1HE7A 1PD6A 3FQNA 3ULVL 1HHJA 1IC1A 3ARZA 3O11A 3S8WA 2MNUA 1CBVH 2X7LB 5IB2A 2CKBH 5I0ZA 5CP3A 1CXHA 3LEXA 1HKLH 5T3ZE 2OR8A 5CKGA 1TPXC 4GRWB 2Q8AH 5ADOL 3AS2A 1MCOH 1ETZA 3ARBA 2G75B 4JN1H 4DKAA 2BNRD 4DWHA 5ESQB 2VLRD 3G5XA 4NO0B 4QRUB 1U42A 4YDKL 4DCQB 3GMMA 4YR6A 4Y19D 3NFNB 4RWHA 1NGZB 4IRZH 4FG6D 12E8H 1GHFL 3LN4A 1RQ5A 3DRQB 1NEUA 2NY4C 5I1AB 1UWXH 4Z77A 4OLZL 4ERSH 5IHUL 4S0SD 3ET9F 3QAZB 2KZ1B 3WUZA 4BFIB 3GSVA 4Z7UB 5DT1L 4K71C 3W0WB 3WFDL 1IC7L 1HHKB 1KC5H 3I02B 2PTTA 4M6OH 2C7UB 1FZKA 5MENA 4PY7A 2E3VA 3MLZL 2R4SL 2IQ9H 2JCCB 3BZFA 3EFDL 3HNVH 2MQ3A 2PO6A 3LQZB 4TSBH 3RGVC 4HK0A 1ZHKA 4BA8A 3N1MC 3EDJA 4GFTB 4U6YB 1FLRL 3L5HA 1DJSA 1P2CB 4ZS6D 5SWSA 1V8HA 3LKOA 3FRUB 3FHQA 1L7TL 5F7UA 4CBPA 4PJGF 3SJVB 1CFNA 2HFGL 3O6KL 3BRFA 2B0SH 4JFFD 4R96B 3LKPA 3TM6A 2OR9H 5D2NE 5C0CD 4LEOB 5HVGB 4G5ZL 3DX9B 1V7MH 3LN5B 5IFAH 1ONQB 1OT1A 4XNMB 3LKNB 3X3FL 3QHFH 2X4PA 1A1OA 1S9YA 1S7RA 1TXKA 2D7TL 4LLAA 4NN5C 3C5ZD 1MEXH 4L8DB 3ABZA 4OZFH 3WFHA 3WLWD 1E4KC 3D9AH 3BPCA 5EFIB 1WTLA 4XPHL 5BS0D 1U91B 1IILE 2OMBA 1PKQB 1TZGL 2H32B 5ESAB 1R3IH 1RURL 1Q9OB 5J9PA 4YDIH 3UJJL 1T5XA 3TT1H 3OR7A 3SEPA 4MB3A 1MAML 3VWKA 4ALAH 1YEJL 4F58L 1UQSB 3WD5L 3FQUA 3UZQA 5L0QC 3M17B 3NCYS 1VFBA 5ALCL 4APQD 2IPKA 4F7TA 3MV8E 2QQNH 1OP9A 3EO0B 3QIBA 3MYJA 1A6TA 5HDLA 3AY4C 1RZ8A 5DC4B 3QJFB 4OI9A 5D5MF 2A6KA 3A6OA 5EU5B 5D8JH 2V2TB 1JWUB 5DD0H 4NFDA 4DKFH 4RZCB 2GSGA 1T4KA 2XPGA 2EXYC 2PW1A 3BGMA 3PABB 4GRLA 1ES0A 4RAVA 2FH8A 4FXLA 2D31A 1YJDL 2WK2A 4LCIL 3ARVA 4HUMB 4Y16A 4ZUWB 2DD8L 3VCLB 4C4KO 1RJYA 3NCBB 2VC2L 1HSAA 3U83A 1U3HA 2EIZB 4D9RD 1P53A 4N0YL 1IEAA 4QTIL 1DE4A 1CDUA 3C60D 1IGTB 3QA3A 4MXQC 3QQ9D 1JF5A 2NY6D 4Q6IB 4NT6B 4XH2A 5DMKB 2GKIA 2DTMH 3FT3A 4RGOL 4ZFZB 1FFPA 4IOFD 3OPZL 3GHBL 3TZVC 1WAAA 4Y1AE 4GO6B 4HK3J 4UNTA 1MCWM 5D2LE 5JOEA 5GGRY 1YC7A 4PJ9D 1Z5LA 3FJTA 4PJ5B 4EDXA 2DOCA 3BEVB 4PFEA 5JXAL 4F9PA 3DYPA 5TFSH 2FHCA 4JREC 4NSKB 4Q7DA 1ACYH 5E2VH 2WUBH 4AG4L 1HXYA 5IT2L 1HSBA 2R69L 5DHXB 2XXMB 3RWEA 4HF5H 3LKSB 4KMLB 3O2DL 2O5YH 5DD6A 3EUUA 4RGND 4ZPVB 5IG7B 1ZTXL 5B39G 5ID1B 2QSTA 4BQ9A 1A6AB 1DLHA 2V9TA 5MERA 1C5CH 3I6KA 4DN4L 4KK9C 4Z8FH 4JVWA 1AGBA 1UZ8B 3QFJD 3V8OA 3VWJB 1B0WA 3NIFE 1NMCB 3GMOA 3HG1B 5CSZB 4BUGA 3MC0A 3IU3A 4FFZL 1Q38A 4PLJC 5E8OB 4KUCF 4BH8A 5T1KB 2CSPA 3HRPA 1MH5A 4PJEE 5CBEA 5IJKC 3VGEA 1DVFD 5T3XL 3W11D 1MCPH 2VUYA 4MXVE 5LGHL 5E4EB 1P69B 2BHYA 1QHOA 3TF7C 1HILA 4J3VA 3OXRB 4NCDA 5JPMA 2D03H 3U6RA 4CUCA 2A83A 4OF5A 3MRNA 5I76A 1RSFA 1QRNE 5DFVD 4WUUA 3UTOA 5KN5A 1ZVHA 3QDHA 3CU7A 4HXAL 3SGDI 3NPSB 4LU5L 5BO1H 3QZWA 3V6BR 3KPLA 1OAZL 4PJXE 4XVTH 3T4YA 3JWOH 1A4JA 3V6FA 5ISZB 4YFLF 4XB7A 4XPAH 5SWZB 3I3BA 1WFTA 4S10A 3SE9H 4N9OB 1XF4B 5F7MC 1SBSL 3VRLE 4WTXA 1SJEB 4CVXA 1FO0H 5IIEA 2W38A 2DS4A 1NFIB 3V7AE 5L2KE 4G9DB 3MJ8A 5E2WL 3Q6FA 2XA8H 5IQ9B 3VFVB 1GGBH 3EHBD 5IW6B 4JGJA 2HT2C 1P7KA 3D0LA 3L7FB 2CIKA 4F3FB 3MJGX 3L3KA 3CUPA 4D94A 1NAMB 4ODWB 2Y5TB 2X4TA 5LVEA 2V5SA 4LLDB 5FGCB 3I84A 5F21B 4GRWH 4LOUC 2CK0H 2WQRA 3PDGA 3B5GA 2ZCKL 4Y89A 5FO9B 3R06B 5F9OL 3P9MA 2QSQA 3SKOB 2IH3A 3H9SD 5IB1B 1GOHA 1A4KB 3W39B 5GISL 4HIJA 3BP6A 3W9DA 4AH2B 3SPVA 2VZOA 3ARWA 1LEKB 4W6WB 1RMFH 1JMZA 1QEWA 1MVUB 3CXHJ 5TE6H 1PVHA 4H0IA 4EI5B 1OB1B 1ZLUK 4R8WH 1AGEB 1JNNH 2FWOB 2MCG1 3RWGA 4YPGA 4FQPA 4MA8H 3C5SB 3UZEA 4M1DL 1MCCA 3RL2A 3LKRB 4UOJA 1U8IB 3CSGA 5HPOA 5KS9E 3FTGA 1X5YA 3OQ3B 3RZCC 5CINL 1I8LC 2LTQB 1MWAA 1AGFA 2FYYA 3NZHH 4RMVA 1MRDH 3VXUE 1B4JH 3T0EB 3BSZL 1NLBH 2FIRT 4LP4A 4P23B 4Z7QF 1IAOB 2YUWA 4JFHE 2AEPH 2FLBT 3ILQD 3P2TA 5C2UB 5MI0C 3UBXA 1JBJA 1G7IA 1HHHB 2FO4A 3B5TA 5DMGD 1FN4A 1TTUA 2FO1A 1W72A 4HH8A 1EBPA 3TNMB 4TUJB 5C0BB 4YHYB 1F11B 4TUOA 1XZ0A 3V2AR 3P0YL 1KEML 5DJDA 5GIRB 3UYOD 5J7CC 5B3NA 2UYLB 4B53A 2VR4A 1JZ8A 1K4CB 5GGQH 2ZOLB 1XGPA 2KZWA 2VZVA 2QADD 5FKAB 5BVPH 2BVQA 5HPMA 3G5ZA 4YAQB 4FQIL 5BRZE 1OGAA 4LNRA 2DLGA 3Q6GH 1NC2A 1KIPA 3C9NA 4UTBL 4PRDA 3I6GB 2BNRB 1SMOA 3CCHA 2NTFA 1J05B 2VLRB 2CDGB 3BX7C 5K9QI 4ZUSA 1VDGA 1TFHA 1RIVL 1IL1B 1OQXA 4Y19B 1OWWA 2H32H 1FL3A 3GI9L 5KSVB 1T7ZA 4NWUL 4ORGB 4ZSOB 5EU4A 1EHLL 4M5ZH 2JJSC 3DVFA 2HT3D 3QEGH 4WUKL 3SOBL 1U8MB 1N0XL 3UTZA 1IARB 1JZ6A 3H6JA 4JFPA 1XEDA 1ZA6A 2V7NB 3DSNA 3QPQC 3GRWA 1B0RA 2ICEA 4P4KC 3OG4B 4H88H 1PSKH 3TIDB 5H35B 4R2GC 2VDKL 3RNQB 5HHVL 4HZAA 4UV7L 1JFQH 4FABH 2R1YB 3TVMA 5E5MB 3WXWL 1DBJH 3E8UH 5K9JH 1K8DB 5FDYA 4PD4J 5TQ0H 1YEIH 1BX2A 3ZZ1A 1H3PH 3UPAA 3U7AA 3B9KC 2Q8BH 1N7MH 4YBHA 4P2RA 3RY4A 1DSFH 4PTTA 3NAAL 5TE7H 1KYOJ 2I9TA 5IB5A 4HUNB 4HBCH 3U0PB 1XR9A 1NBYA 5IMOB 1T66C 4NN7C 4JFFB 4WENB 2Y36L 3IDJB 1XH3A 2EIDA 4NRZB 4J2XA 1QFWI 1OTUD 5C0CB 3MLWL 3SQOL 2DKSA 3I3DA 1N0LA 4NBZB 4HUWB 1N2RB 4WHTB 4PJ7A 1WEJH 1ZEAH 2ORBH 5D7SH 4Q9QH 2AI0L 3U7YL 3MV9A 2ADJA 4NIKB 5EB9A 1AHWB 3O41A 1BIIB 1UXSB 4PRHE 4UAOB 4L4VE 1WITA 4IMLB 2APWA 3C5ZB 5DTFB 5D2NC 3HAEB 2FEDC 2Y4SA 4OT1L 4U1NA 5FHAH 5BS0B 4LSVH 5KSBE 2B5IC 1BBDL 2E8YA 1AO7A 43C9B 3OKDB 1RFDH 5CZXD 2PETA 5FO7B 4PREA 4U1GC 3ZDYE 1A6WH 1KNOB 2ARWA 3E6FA 4YDLB 5LWYL 3OKEB 4Y2DC 5CD3B 2OI9C 4OIIH 1KLUB 2VLJB 1PFCA 2EH8L 1U95B 1YEKH 5EN2A 4LP5A 3S88L 5GS0H 4L8CB 1CGVA 3WIFB 5EUKB 3NA9L 1IFHH 5EZJA 4OGYL 1FG9C 7FABH 1QQDA 2GT9B 3VXSE 1C1EH 3MLXL 1CFQB 4WHYH 1N8ZA 2H2PC 2J4WL 1FNSL 2P8PB 5I9QB 1XGTB 4Y0GA 3MJ9A 1MJ7H 4G6KH 4YGVA 2HKHH 4YWGL 4YUEL 1JTOA 3PL6D 1KOAA 4NQSA 3LN9A 1H5BC 2OZ4L 1A1MB 3ARGD 1V5JA 3HI1A 1GZPB 4OZIA 3LHPH 1J0HA 4PJAA 4PIRF 4G8IB 2YC1B 4AZ8A 4Q74A 5EZOL 3HC4H 3QO1B 5EORH 5I19H 4O02H 1INDH 4H0HB 3NTCH 5AZEL 2K7QA 3P77A 5HYIA 4JG1H 5HDOA 4FQCL 1HZHL 1BHGA 4OJFL 5C0GA 4CN1A 3IKKA 1X4ZA 3C60B 5E24E 3CVHL 4S1DD 3RU8L 4ELME 1IKFH 4HMCA 2ESVA 1U8NB 1GYAA 4LFHD 5C0RH 5FGSA 4EOWL 5C0IA 1LEIA 5L88L 3X12A 3ARTA 4X8XA 2BDNL 2X70B 3MRPA 3DXAA 1WCBA 4PJ9B 1D5IH 1Q94B 3ZE2F 3RVUD 4UT9L 4E41A 5HVWA 4TUKH 3WJLA 4WJ5B 2A74A 4P2OD 5DUML 4XWOD 1JGLH 3UTTA 4I18A 4JN2B 3QNYA 1ZGLM 5KW9L 4PGBB 3KPSD 1GZQA 5KOMC 2YK1H 2GK0A 4N0UB 4YHIA 1GGYA 3NBNA 1E27B 1U8LB 3DPBA 4ZFFB 5J12B 4H25B 1F4XH 1WAAF 4LGSB 4RGNB 5DURD 5TF0A 4Z7OF 2GCYB 5FF6B 3QDGE 5M94B 2FHFA 3WE6A 4NYLB 2WBJC 1U9KA 2SEBB 1KG0B 2VLKA 1FJ1B 3LRGA 5EIVA 4AIXA 3QFJB 3DX6A 2XQBL 1VADA 1RZKC 4JZNA 4U1SA 1LE5B 4BKLA 5GSVB 3VMPA 5KANG 3P4MB 3GMRB 1WWAX 2E27H 5I1IL 3HE6A 2NY3D 1DBBH 2B4CC 3MXWL 4HFUH 3THMH 1N6QL 1A5FH 3EIFA 4ZO8A 3GSOA 4QRSA 1C7SA 3ZE0F 4HX1B 4UDUB 4LLYB 1DVFB 4P5TC 4XAKD 4GW1A 5FYJH 1A14H 3LQAH 2XXCB 4XPFL 1Q72L 3JTTB 4NNPL 2ICWI 2Z9TA 3O9WA 5ICZA 3RWFB 3DIFA 3NCJL 3PIQB 4R97C 1UWEL 5F9WC 3QWRD 3W5NA 4NZJA 2XFXA 4ESKA 3LRSA 4N8VG 5HI4D 2Z8VC 3SQBA 2VH5H 3KYMA 4EQ2A 3GSXB 1ND0B 3OZ9L 2JJTA 1G84A 4XWGL 1YNKL 3DV6B 1YN6A 5E8PA 5FCSH 5D6CB 4Y4FA 4CDHA 4OUUB 3EJJX 1S9VB 3VG9C 3X17A 5ABDE 4HULB 3BP5B 2OSLB 1CYGA 2RB8A 4J4PC 3VMNA 1CLOH 3UJIH 5FYKL 3TBSA 5ANMA 1H0DB 4JDVB 4XPBH 3R1GH 5EC2B 1LO4H 4PJHE 4BSWA 5I8CA 1NCCH 4R9HA 4C59B 1X5AA 3G5VB 2NW3B 3K0WA 3RY6C 4WFHD 3IDMB 4NRXA 4YFEA 5F7EH 1JPGB 4TOYH 2XWTA 3T2PA 3EYUH 1ZHLB 1TVHA 1NDMA 4S1QL 1PJ9A 3ZTNL 4P5KB 5HGHB 4LMQE 4P46D 3DX8B 2MPAH 3QCVL 4P2QE 5IMKA 4KDTC 3OAZH 5DK2A 5F1NA 4CNIB 1WK0A 3FB7A 1QVOB 4GBXC 1C5BH 4HIEB 3ZDZE 4NUJA 2IAMC 5IVOA 5I18H 5MEPA 4W6YB 3KXFD 2KBGA 1F4AA 4GS7B 3DNKA 1JGEB 3MRGB 1UM5H 5K59F 1QR1A 3OV6A 4CW1A 2EDOA 1C08B 4R6UA 4W70A 1RUKH 1VGKB 1S7SB 1JUFA 5HVFB 5DA0B 2H6PA 2X42A 5DJ2A 2P5WE 1YEHH 4Z0XB 3WEXB 4L8DA 1I7RB 1WGOA 1KGCD 3ZE1E 3P30H 1JGDA 1ZGLA 1SYSB 3QUYC 2FEEI 4GW4A 2WIMA 1DQML 1ZS8B 3BKML 4QYOB 4LPTA 4KKBD 4RISL 3U82B 2IG2L 4M48H 5GRUH 1S7VA 3VFMB 5D9SA 3CLFH 2QQKH 4RQQA 1Y6MR 3H0TB 4LSDA 4O4YH 4M1CC 3WKML 4X4YB 3K2UL 3GO1H 5C07E 2YKLL 1DLFH 5CKAA 2NY5H 1W0WB 2HJFB 3MA7A 4ZFOA 3RWCB 3BYYA 3RGVA 3O6FD 4NQCD 5IJVB 1KJ3H 1R0AH 2A6IA 1FVDA 1IGFH 1BJ1H 1LP9E 3DV4A 2E9IA 3S5LB 2R9HD 3SBWC 1AC0A 4JQIL 1KCVH 2AXGA 1QPPA 2UVFA 3MQIA 1FFOB 4Q0XH 1YEDB 3O3BB 4GAJL 1VEOA 3UYRL 3O8XD 5JORB 3AMKA 4L4TE 3MOAH 2YPVL 2WLYA 3QDJA 1MQKH 4X9HA 2Z92A 3D85A 3VFSB 1J9CT 3V5HB 4LPCA 1PG7H 2QADB 2JB6A 4RFNC 4KDVA 2DQJL 3MACL 4FFWC 1UCTA 3U36A 4YLQT 4NKDB 4YZFF 1INQA 3CH1B 5DFTA 2PCPB 3KVQA 1RK1B 4P9HH 3ULVE 2X4UA 4AQ1B 5CHNB 1GGIH 4M8QB 3MRLB 3D39E 2J12B 4JO3H 2X1PA 5BVJA 1E4KA 3B3IA 2AK4D 4XNYL 5ESVB 3NVQA 2CLRB 3IXAB 5DJZA 2J6EL 5LQBL 4KV5E 5KVGL 5IB3B 5HJ3A 1JYNA 4K7FB 4KK6C 2BVEA 2D4DA 5E1HB 1VENA 5ETUA 2FX8H 3WUWB 2IPTH 3ROLB 3L3DA 4IIQC 3CFJA 1WIUA 5HHXH 2B1HH 4PRIA 3RIFK 3H7BA 1PYWB 4G3YL 2EDHA 2EXYD 2PYEE 4QT5B 1EDQA 2PXYD 4OLXL 4LF3B 2VLLA 5D1QD 2VDML 1OAUH 4K7PX 4JG0L 3V0WH 3D3VD 5DEGA 1GIGH 4MNGA 4K3GA 1BVKA 2E9WA 1G9MC 3PP4L 4WFEE 3DUUA 3IGAB 3VXPB 3IRZA 1PGRB 2NMSA 1BZ7A 3WIHA 4HKBB 1UG9A 1WC7A 4X6DE 1RULL 2UY6A 1QNZL 3MRBA 4ODTH 5EUOA 5TPWH 3KWWB 4UV4H 4K9EL 5FKPB 5IV2B 5JNYB 1AJ7H 4F7MA 3OKNB 4NOBA 3P11H 3VXNB 1J8HE 1U8KA 4OCSL 4WI4A 5DUBB 5J89A 4U6HB 2HVKB 2HG5B 2BRRL 4BH7B 8FABA 3S9DB 2YPKA 3GBMH 4NZDA 3RPIA 1KIUA 2OK0H 4FFYH 4U1KA 4AM0A 1W0VB 1B9ZA 1V3JA 1ORQB 4JJ5B 4WDIB 4IRJC 4NKOA 1NJ9A 3TH4T 4BQBA 5DK0B 1MCBA 3OJMB 4OCNC 1WF5A 4QHMA 2A9ML 4NHUB 4FP8H 2BSSA 1QFWM 3TZVA 4GXVL 5LBSH 4OZHA 4HK3N 4R90L 1RUAH 2J88L 4YE4L 4WGVB 4FQ2H 2LFGA 4MD0A 2Z31B 5C71A 4PJ7F 1EEZB 1HINL 3MYZA 5C0JB 5IB4B 4EVNA 3P73B 1A3QA 4K94L 3HZKA 1QZ1A 2FX7L 4JM4H 2D9CA 1T2XA 4L3CB 3HI5H 4TVSa 1PX3A 4QXTA 3F5WB 5HHQB 2W0FB 3GSWB 3STLB 4D0BB 1CLZL 5FA4A 5BMFH 3G08B 3M8OL 2ZOKB 1Q9LA 1EJ6A 4OZ4B 4NKIH 1NKRA 1IRAY 1Q8MA 3QNZA 5IW1B 1FBIL 3PL6B 5C9KA 5E70A 2VDPH 1M7DA 1BVLB 4UTAH 3ARGB 1S8DA 5DO2C 4TVPL 5MEOB 5D7IF 1HQRB 2ZUWA 5HHOD 4WCYL 1LO5A 4YJZL 3QO0A 5IQ7H 1KN2L 3WDIA 4ELKA 2CGRL 1OGTA 5IJKA 4X9IA 3QUXD 1LGVA 3VXTB 1NFDF 3NFSH 1QFUH 4M4RA 5BV7C 2G60L 2ADFL 1IGJA 3R06A 4X5WB 1CBVL 5I1JH 3IVKA 2CKBL 3LB6C 4G43B 1HKLL 4OTXH 1JI1A 3IDUA 2Q8AL 2EDEA 1MCOL 3OG6B 1H3TA 2AJZA 2L7UA 1UCBH 2HAZA 4JN1L 4MMXC 3SY0B 4U1JA 4PLKC 3L3JA 4U3CA 4OZIF 2NR6D 3HLAB 2AV1B 4PY8I 3MR9A 3FFCA 1A7NH 2JIXD 5F72S 1S5HB 4P2OB 5TE4H 4IDLA 4X8JA 2BNQE 4IRZL 4JKKA 12E8L 4KDWA 4QHUB 4HBQA 2HT2D 2R39A 3U0WL 2EDQA 1LK2B 3FL7A 5C09A 3KPSB 4ERSL 3QDME 2RIKA 3TN0D 4Y5VC 5E6IC 2C1OA 3IFNH 3ILPB 4OFPA 2DQGH 4S1SH 1KJ2A 4JPVH 1KC5L 3EZJB 4M6OL 5DURB 4PRPD 3IFLH 1N59A 1OTSD 1WZMA 4MNHB 4HIHB 5FM5M 3JV4A 4YBLC 4JANA 3HNVL 4X0KB 3RZWA 1VKXB 1FL5B 4TSBL 2ITDB 5AAMA 2G2RB 2R2EA 2YOCA 1W8OA 1DQJB 2Y6SD 1XMWA 1OLLA 5GSRB 1F45A 3MCLH 35C8H 2WSKA 4ZS7H 2EICA 1MI5A 1R5WB 1JWMB 1J1PH 2IANA 2B0SL 1KTLB 1MWAH 1CD8A 2NY1C 1WTGT 3D2UD 1V7ML 5T3XE 4JRYD 3FONA 1HEZB 5F7KC 5IFAL 1H15A 1KB9J 3OXSA 3QHFL 3U9UB 3ARSA 3FT2A 4JHWH 2VDQH 2KUTA 2F58H 1UH4A 4NQDE 1HIMH 4V1DD 1MEXL 1NANH 2DL9A 4PJFB 5CILH 2IQAB 1L6XA 3L3IA 3RZCA 1YY8A 1I8LA 1U8JB 2ATKA 4G8GD 1R3IL 1YMME 3C08H 1N26A 4MCYA 1FLTX 2Y06H 3DVIA 5JQ6L 2Q76B 5TQ2H 4YDIL 4BZYA 4XC3H 4C4KT 3MV7E 4JFQB 3TT1L 1S7TA 4N90D 3IKCB 1LWRA 2XY1A 4WY7H 1KN4H 1KXQE 3HZYB 4JLRA 4RFOH 4ALAL 4C58B 1YUHA 5H37H 4XTRD 3VFRB 4FZ8H 2EYSA 5C0AB 1L6ZA 2UV3A 3DVNA 4GJTB 4JO4H 5JQHC 3A67H 4M62H 3WHXB 1MY7A 2QQNL 5I16B 5I75C 1P1ZB 4HS8H 5L8KB 3MGTA 3PV6A 2DQUH 2UWEB 4Z7UF 4Y7MA 2GJZB 5D8JL 1EK3A 4J1UB 5DD0L 5IVNA 4DKFL 2EE3A 3EW3B 4K8RC 4WI6A 4I4WB 1XGUA 1MHCA 3KXFB 4LCWD 2IFGA 3DVGA 4K71B 5E00A 4O58H 1IM9D 1I3GH 4F57L 5LAXA 3KR3H 4BSVB 5FECA 4GKOA 2NXZC 5JIPA 5F9JA 3EOBB 4JFDD 5EZLA 4LVNC 4TQEH 4PV8A 4M93B 4OKVB 3QWOA 3GSNA 5T1LB 2JJSA 3RFZC 2R1WA 5IBTL 4GKZB 4WW2C 2DTML 3GFUA 3HTLX 4ETYA 2D0FA 1FDLH 4JY6A 2NZ9D 4X6BB 4P4KA 3F7QA 4AJ0A 3OJ2C 5D5ME 1OAYH 3CMGA 3B2UC 3RWJA 4Z0BH 3ARQA 3GBNH 2Q86A 1VFUA 3OAYK 3RI5K 4AT6A 2DJ4A 4JGUA 1KCSH 1RVFH 2VOTA 3O6FB 4NQCB 1UM6L 1ACYL 5E2VL 2WUBL 4APQA 1QSFB 5F3HB 4KKAD 1S9XB 3P4OA 5HBBA 3B9KA 4JY4A 3X13A 3PWPD 4CADB 1U8OB 4P3DB 4JR9H 3PWUB 3GKWH 1YZZA 4Z78B 4HF5L 3O8XB 2OMNA 3PDDA 4NPYB 4KRLB 5D93C 1KPUB 2EXWD 5DZOA 3TLRA 3UMTA 4Z8FL 1C5CL 5EC1A 3L3GA 2L4OA 4QHKJ 5IHLB 2Z8SA 3SKNA 1J12A 2DQCH 3KPRE 1UACH 1CDYA 3I3EA 2OXGA 1KIQA 3L5IA 3S4SB 4M5YH 5DD3H 1YY9D 5EBWA 5IESH 1AGCA 5D2NA 1CDHA 3IF1B 4DZ8B 2HJKB 5L0QB 1MCPL 2AK4B 4KK8C 4DW2H 5IBLC 5DGRA 1LILA 5DVKA 2ZSVB 2ICWA 4KJPC 3SDCD 3MJ9H 3ULVC 2D03L 2XOTA 4HLJA 4WIQA 4Y2DA 3S35X 2JTDA 3HPJB 3NCYP 4F2MA 1RHHB 3ZO0A 4C54A 1JPFA 2PXYB 5BO1L 4HC1A 2H3NB 4XVTL 5D1QB 3JWOL 5FV2A 3D3VB 1CI5A 4HUVB 1RHFA 3H8NA 1MCKA 4XPTH 4XPAL 1TNNA 2V2XA 1A1NB 3DTXA 1AD9B 3SE9L 2GI7A 2YPLE 4YC2B 4XHJC 2GTWA 3VU2A 3UROR 1G7PB 3EBAA 2IBZX 3L95A 1FO0L 3MREB 1H5BA 4UNUA 4WO4C 5AG9A 1U0QA 3MV8A 5DVOA 4POYA 4UZGA 4LMQI 3OJDA 1MCIA 2EH7H 2XA8L 5EOQH 1GGBL 3BN3B 1JRHI 4U6VL 3V0VB 4U3XA 4YH6A 4PR5A 2RR3A 3QNXA 1DFBL 1R5IA 3MJ7B 3KPMB 4XB8A 1G1CA 4V2BA 1G7LB 3VG0H 1YMHA 1S7QB 4HKZA 4X7SH 2J3SA 2CK0L 1CICC 3QZWG 1JK8B 1YA5A 4FFVD 3NN8A 5AAWA 5EUOF 4DOHE 3VXMD 1BPVA 2YEZB 5JO5A 1RMFL 4R4ND 3WS6A 5TE6L 1UYWH 3MRFB 4R8WL 3MRJB 2NY0C 5IEKA 2FZ3B 4N5UA 1JNNL 4MQXD 4HAFA 1U8QB 1GGTA 4JVUA 4KH2A 5JXEC 4RIRB 4MA8L 4ZXBD 2IPUK 2YD2A 4Y1AA 5K9KA 3RWDB 5D2LA 2BFVL 1TQBC 4PTUA 1KPRB 4YO0B 3GEWB 2DWEA 1RJLA 1BFSA 1FC1A 1XF2A 3T77B 5I1KH 1YN7A 3NZHL 3HNTL 2IALA 1MRDL 4OZHF 1B4JL 4A6YB 4KK5D 4ZAKD 1NLBL 2WBJA 1EO5A 3CD4A 1YPZB 1T7VA 5IFJB 2XKNB 1DTUA 4GT7A 3QEHA 4QRPE 3VRJA 2QJDA 4EKXA 1NGWB 5CIPA 1CVSC 2DQIH 3K81A 2I5YL 5EG6C 5HHOB 5DJ0B 4P3WA 1MFCH 5E6ZA 5T5FH 1ADQA 3WO4C 2XKUA 1F2XK 4JFYB 5GGQL 3Q2CA 3JWNC 3K2MC 5BVPL 3STZA 3V79C 2X9YA 2VB5A 3HB3D 4M8VA 2DM2A 1X5ZA 3TCLA 3H9SA 4GAYB 3U9PH 1YDPA 4Y4KC 1GOGA 2XV6B 1NEZA 3VFTB 3Q6GL 1FQ9C 3F7VA 4MB5A 1R3HA 4S2SB 4U1HB 2HJLB 5EBMA 3T2NL 1SYVB 4M7ZB 4PJEA 5FIEA 3QG7H 4R4BB 5IFHH 1F3JA 5HD8D 1TVBB 1IEBA 3IDIA 4LHJB 2VR5A 2JIXB 2RQ8A 5HGBB 2FRGP 4ZOAA 1BLNB 3HPLB 5EO1B 3INUH 3DBXA 4J4PA 4M5ZL 3REWA 4JJHA 1QRNA 3MNVB 5I73B 3QEGL 3TN0B 1MAJA 3T65B 2W60A 3G6DH 5ALBH 1A47A 5DI8A 5D72H 4DTGH 4CU8A 3FO2A 4PJXA 4MD5B 2B20A 1KPVA 4GBXD 1MJJB 4H88L 1PSKL 3ARED 4PRPB 5F1IB 2HJFA 5KSAC 3JTSA 1Z0MA 2P8LA 4B5EA 2QKIA 5J57B 1JFQL 1OCWH 4JFEE 4JM2D 1DBJL 1FGNH 4UI2A 1CD1A 3E8UL 2F53D 5K9JL 1K6QH 5TQ0L 1JF1A 2WW8A 4NKMA 4JPWH 1EA9C 2W65B 4U2YA 1FNEB 4TTDD 4Q58C 1H3PL 3CC5B 2Q8BL 1N7ML 1DSFL 5L2KA 4Z7VB 4HBCL 5BOPA 3IJYB 1XCQB 2IAMA 4NC1E 3ULUL 4Z6AT 5C0ND 4LDOB 2J5LB 5E99H 4QF1A 3CFBB 1QLRB 2ADIA 1IZJA 1WEJL 1ZEAL 3KNBB 2ITCB 2ZJSH 1WWCA 5D7SL 4Q9QL 2GJ6E 3VA6A 3QIUD 4OGAC 3FB5B 3RUGB 4O2CA 3H7LA 4PGDA 1DBAH 1CG9A 3RQ3A 5IBUB 5DD5H 3NGBB 4YXLH 3QUYA 4V1DB 5I30H 3JSSA 1OOAA 3CX5K 3AAZB 1DR9A 1REIA 3RAJL 3AXLB 4R7DB 5FHAL 3BAEH 4LSVL 4J3WA 3SO3C 2QEJA 4OM0H 4G8GB 5GGTA 3ZT7A 3EKCA 1RFDL 3CXDH 1A6WL 5CCKL 3TO4C 3FO9B 4OIIL 4M7LH 1C12B 2BC4A 2RHEA 1GGUA 1MFBH 4L3EE 3T09A 5FYKE 1YEKL 5C1MB 4OFYD 3BHBB 3OMZA 5GS0L 2H9GA 3L5WB 5KS9A 2JE8A 3MA9H 1OD7A 5GS1C 1A7QH 3QQNA 5E1AA 1Q9KA 3VXUA 4JO2H 3RDTD 1IFHL 4I2XB 3BZ4B 4MNQE 7FABL 1IM3A 1C1EL 1YYLH 1WCQA 5INDB 5I1GH 4MJ6B 1MJ7L 4G6KL 3EJYC 2HKHL 2Q6WA 1ED3A 4MD4B 2NX5E 4WW1A 4MQ7B 4OFIA 5JW4Q 5T1MA 1K2DA 1A7PH 1AR1C 4LCWB 3VH8G 3JV6B 3CZFB 4MA3B 4BH7A 5CJBA 1HH9A 1IM9B 3HC4L 3FT4B 5EORL 3F65A 1M05A 1QLEH 2VITB 5I19L 4O02L 1INDL 4LLUA 1QSVA 3DSFH 1A21A 5DYOB 4NZUH 4JG1L 1DUZB 1UEMA 4JFDB 2APTA 5BRZA 3DMMC 3WYRA 5H2BA 2B7DT 1XGRA 1FCCA 3B83A 4ODXB 3O2VH 4P57A 5EOCH 4QOKE 3DARA 3EAKA 5IKCB 1IKFL 5H94A 4NQXB 2BCKB 1X3DA 4DUVA 4IIQA 3ECBA 4HW6A 5C0RL 2YD5A 4WFFD 3CIQA 3S34H 5AZ2H 4QGTA 1FV1A 3FB6B 2G9HB 3RVTD 3GSUB 4TUKL 4P99A 5TDOB 1JGLL 3BO8B 4M03A 4Y4HC 5CWSA 1NGXA 3VGBA 3RHWK 4FQXA 1HHGA 3QUZD 2JJUA 1F90H 1ZLWH 2HFFB 5HHQA 4B41A 2YK1L 5F1SA 4PB0H 3MCKB 2Z35B 3FB8A 3GUTB 3PWPB 2DBLH 3EYFB 4YHPA 1KCRH 1TMCB 3T0DA 2MHAB 1EEUA 1F4XL 4P59H 3RI5F 4L9LC 1UB6A 5EO9A 4NGHH 5I1DB 3VI3E 1C5DB 3VDAA 3LRHA 4NO2A 4M7KH 3MRRA 4ODVH 5GRYA 4G7YH 4J3UA 1VACB 5CGTA 1G7MA 1SBBA 5CUSH 1J0ZA 1NAML 3OX8A 2EEDA 5FV1L 25C8H 3DHJA 5MEQA 4OD1H 5EU6D 1RY7B 2P46B 4QRQA 5AEAA 4Y5YC 1DBBL 1N5AA 4HFUL 1S9KC 1A5FL 1RK0B 3MNWB 2Y7QA 2F19H 5J1AA 3SKMA 4PV9B 5JIIA 3GMNA 1NCBH 3EO9H 5EBLA 2QR0B 5F7DA 2P24B 3GJFB 5FYJL 1A14L 3LQAL 5HI3D 1EEYA 3LKQA 3EFFB 5JPNA 3SDAC 1KTDA 3ISWA 3SE3C 4MXWH 5CEZD 2VQUA 4PRHA 2E8ZA 4JZOB 3VGAC 2ENYA 3PHQA 4L4VA 1VPOH 3ULSA 3PWNB 2VH5L 4FXGB 2GEEA 3P0VH 4IJ3C 1MVFA 4HGKC 2XWBA 4PG9A 1JE6A 4LLQB 2NCMA 1KT2A 5KSBA 4XI5C 3S96B 4HJ0D 1D6EA 2DLTA 5D7JD 1D5ZB 4A6YH 1MHEB 5F6HJ 1P5VA 3MBED 1S78C 2AK1H 2DF3A 2YZ1A 2ADGB 3WLBA 4E42A 5KVDH 1U93B 2MSPA 3BH9B 1CLOL 3UJIL 3QQ3B 1J87A 1KLGB 3EYOB 4XPBL 3WN5C 1T89C 1NCCL 4MA1C 4XBGB 3O4LD 4EDWH 4DEPB 4MNHA 2OTUA 1T0PB 4N9GA 5F7EL 4D8PA 3VXSA 4TOYL 1SQ2N 3EYUL 3L7EB 2W0KA 3FHAA 4L8SC 2F8VA 4JCLA 5GSRA 1A6ZB 3EJZC 1GC1L 2VABA 4N0CC 1F4YH 2YMXH 2MPAL 3BVNA 2VN4A 5HGAB 2AS5M 1R3JB 4JQXC 4G9FB 5DGQA 3DROB 2DKUA 1C5BL 5CS7A 4QHNB 3BPLB 1UM5L 3AU1A 3VXMB 2X89A 1GAFH 4MJ2A 3MFGB 3CLEH 5SWQA 3F7YB 1RUKL 1JGVH 4OFVA 1FFNB 3M1BB 3BP4A 1WIOA 4OQTH 1YEHL 2W92A 3OGOE 1N3NB 4OV5A 3FQRB 4ELMA 4KHXH 1I1AC 3MMEB 3P30L 1OP5H 1K3IA 4ZXBB 3VXOA 4UT7H 4Y5VA 5E6IA 3L9RB 3ROOB 5CMAB 4F7PA 4GKSA 5JLZA 4C83B 4M48L 5GRUL 4I0CC 3GIZH 2CMRH 3CLFL 4LCCC 1JPSH 1BQHB 1LO0H 4OCWH 4P5TB 4ZTPH 1PG7W 4BSJA 4EN3C 1KEGH 2BHUA 4ZAKB 1FPTL 3GO1L 4I8DA 2DQHH 1DLFL 1JN6A 2NY5L 1NC4D 1OVZA 1ORSB 4GG6B 3RVVD 1KJ3L 1R0AL 2MJWA 3MX0A 4UQ2A 4DN3H 1IGFL 4JHBA 4CMHB 4DAGL 2VE6B 3JUZA 5TH2A 4FN0A 5C0DA 1KCVL 3QIWD 5DS8B 3BFOA 4QWWC 4Q0XL 4BK4A 1T1YB 4P46A 4XVSL 5D2LF 3QDGA 1G7HB 4W81A 3PP3H 4EJ1C 3MOAL 1MQKL 1XIWD 3DETC 3GIVA 3O6LH 3HA0A 3ZKNC 1EERB 1MHPH 2XTJE 3ES6A 5E94A 3GSRB 3IETA 1PG7L 4UT6H 1QOKA 1LO3H 5GJSH 2C1PA 2F8XC 2VXQH 4XCFH 1URLA 4MVBC 4Z76B 1TCMA 4P9HL 3PQYE 4EEEA 4NN6C 4EUPB 2FJHA 2F74B 2R29H 1OF2A 5HYFA 3UTSB 2A0LD 1GGIL 5B39A 2EDKA 2BVPB 4JO3L 4XXDA 3D0VB 4BQ8A 5GS2D 2UUDH 4DKDC 3W9EA 3OHXA 4HUKB 1I1FB 5IROA 2NXYC 4AL8H 3GMPB 5JHLH 1BEYH 3E0GA 43CAA 1SJHB 2VDNL 2AAVA 3NIFF 4OZGA 4J8RB 4PBXA 1RJZA 5F7WC 1ZHNB 4D0DA 2FX8L 2NY7H 4XC1H 1B0GA 5AG8A 3WFCL 3FQXA 4U0RC 3Q5TA 2AJVH 5HHXL 3E6HA 5I1CH 3RNKB 4WRLA 4UOW1 3HE7C 4X5LA 1PLGH 5GZOC 1I7UB 2NY2D 4PJEF 4HEME 4GBXB 3AREB 4N0FA 3AS3A 4LCYA 3D6GA 4ZFGH 1OAUL 3V0WL 4YHNB 2BK8A 4JM2B 5C08D 2PYFA 1NUFA 1GIGL 3O45A 2F53B 2VJXA 1AGDA 1RI8A 5FK9A 5T3ZH 4HZLB 4KXZI 1NQBA 3U48A 3C5JA 2P5EE 2X2YA 5HYQB 1EMTH 5E8DH 4YBQC 3FQTA 4KRPC 2EYRA 5E9DD 3QPXL 3NOIA 4PJXF 3IAQA 4ODTL 4UV4L 1O0VA 4HLZG 1AJ7L 1H8OA 3P11L 3PXHA 5JUEL 4OCXL 1A9BB 2VUOA 2BOCA 4H8WC 4P2QA 1WT5C 2QBWA 5FYLD 3V5KA 4TVPD 3GBML 4M7LT 4FFYL 3VRLF 4JFOA 3QIUB 4UUJA 4NM4H 3C2SA 5T5NF 4LLMB 3T4AA 1QSED 2OLDA 4NC1C 1HQ4B 5I17B 4LHUB 2XIDA 1FNHA 1QFOA 2YD1A 4X6EA 3SE8H 3NH7H 2FIKA 4WW2A 5E8EB 2YBRA 4MLIA 4FP8L 1HOCA 1HNGA 1FAKT 3HZMA 5LBSL 5I1LB 1H3GA 5A2KH 1RUAL 3CVHB 3NZ8A 5KSUA 4FA8A 3VRIA 2Z93A 4FQ2L 1XF3B 5ENWB 1K85A 4P48A 4MJID 1PQZA 1V3KA 2J8UB 3UJTH 5B21A 4WHYG 4C56E 1ZSDB 4JM4L 5F88B 2XN9D 4OLVH 3G6JB 2AGJH 3HI5L 4FQLH 5HYJE 4KJWD 5DXWA 4RBPH 3RDTB 1O7SA 5F8QC 3MOQA 4I48B 5FCUH 5C07A 3PWLB 1IAKA 3QUMB 1DDHB 3TPUB 5BMFL 4KC3B 2AJ3A 1RD6A 2IF7A 1D5XB 1Z3GH 3OL2A 4LCUB 1LP9A 2A6DB 5D7LE 5BZWA 3WDHA 4QY8A 2M1KA 1IEHA 4NKIL 3AVEA 3TBTA 1FVEB 1H3VA 2YUXA 4NO5B 3UTQA 2VDPL 2V2WB 4UTAL 3OGCB 4XBPA 1E4WH 4L4TA 3RKDD 1GPOH 2P5ED 3QI9D 3REVB 1AE6H 4PP2B 4U7KA 2VXSH 3QG6A 4YDVB 4E0RB 5FDWA 2W9LA 3GJFH 4JPKH 5IQ7L 4HGWB 4JRXD 5C0EB 5I66B 1GXEA 3MV9E 3OAUH 2B2XL 1MLBA 2AEWA 5C8JB 3RWIB 1IGIH 3QH3A 5DZLA 2XRAH 3NFSL 1QFUL 1BD2E 4NQED 4GG8B 5I1JL 4L8BB 2AEIT 3EYQD 4M4PA 4X99B 5IVXE 3D39A 2WWKO 3RJDA 4RFEA 1G0YR 1VB9A 1UCBL 1NPUA 4GLRI 4C57C 1Y0LB 1NL0H 3N9GL 4WV1A 4Y5XC 3H9ZA 4WO4D 3ZKSD 3DOSA 1T2QH 3CXHK 2R23B 1A7NL 1MCWW 5C6TH 4RIRA 1BJMA 5TE4L 4LLVB 2DWDA 1CVRA 1PEWA 4L29B 3H9YA 3TYFA 2NYYD 5IF0A 2EE9A 1DUYA 4I77H 5D7IE 3QUZB 3MNZA 1MCJA 4P4RA 4B7IA 3Q0HA 1ZWIB 3IFNL 2PYEA 1KCUH 4OAWB 4S1SL 1CICD 3BQUD 4IRJB 2OTPA 1JNHA 3OKLA 4JPVL 1NFDE 2UZXB 1CE6A 1M6OA 4HQQH 3EZ8A 1IC4H 1MRCH 3RHWF 3VWKC 3IFLL 5F6IB 1T1WB 5HYJD 4LPVA 4WHCA 1MFAH 4FQQB 2YD7A 3HUJE 5EU6B 4Q9RH 1NBVH 1U8PA 2NY0D 3AB0B 2XZQH 1KB5B 2P7TA 1IBGH 4X6DA 35C8L 5K9QG 4Q2ZB 1FNAA 4ZS7L 5BZDB 3QUXA 4F37K 4OCLC 1FZMB 1ZA3B 2FATH 5F89A 1J1PL 1J8HA 4HHAA 1NMBH 1MWAL 2HA1A 3VFPB 2BSTA 4QRRD 5C2BH 3X11A 5CSGA 2F5BH 4MZ3A 4L5FH 4Y16C 4U31A 1SYVA 1VFAA 1IGYA 2IADA 4PJIB 2F9BT 1RUQH 1RZKH 1T20A 4JHWL 2VDQL 5CGYC 2F58L 5JXEA 1UADC 1FCGA 1HIML 5CIPH 5GGSB 3DGCR 4LQFH 2C3VA 5BQ7B 2B4CH 5IP4A 3VXQA 5DJ6B 3TNNB 2DIAA 5CILL 6CGTA 3TGXA 1ADQH 4GXUN 2YSSA 3MBEB 4WTZG 4UILL 3C08L 4ZPTB 3D18B 3STBA 2Y06L 4CAGA 1HDMA 5J3HC 4X6CB 5TQ2L 5I2IA 1WZKA 2VL5B 4XC3L 3IFOA 4KMTL 4QXGH 3O4LB 4PJDE 4WY7L 5IVZB 5CD5C 5A2JH 4LVHC 1KN4L 4RFOL 5EU3A 3MO1A 2DMKA 1MUJB 3JWDC 3B5HA 2GFBA 5KSBF 4JO4L 3A67L 2DQTH 5DJXB 4YDJA 4RGMC 3MODH 3V6ZB 2BOBA 4HS8L 3ZDYF 2FB4H 1BJ1J 4MJ5B 1LVEA 1IE5A 2DQUL 5J6GA 2R0KH 1XR8A 1IKNC 2F54D 3CSYA 2O61A 3EDEA 5F70A 4Y4KA 2IMMA 4RMUA 1QLFB 1YEEH 3D2UA 1QLRA 4BJLA 3LIZH 5CGMA 2BZDA 3T0AA 2AJYH 4G8EB 4JRYA 3MLTB 3BN9D 4O58L 2D2OA 2EIEA 1I3GL 1TCRB 2G5RA 3IDYB 3KR3L 3OF6A 1S9WB 3R4DA 4I1NB 3P9LA 5JW4M 4Z7WB 1Z9SA 4E5XA 1FYTD 3T3ME 1F00I 4TQEL 3F58H 4JO1H 2JF1A 3TFKD 5C7XH 1Y18B 3WIIH 1BECA 5J0BA 2GITA 1BZ9B 4PB9H 3PGDA 1T22B 1FDLL 4HIIA 5GGSY 4PGZA 2I60H 1OSPH 1QG3A 1G7JA 3CFKB 4Z7UE 1J10A 3W0WE 3PNWA 4NQVA 5E7BA 2BNQA 5FUCE 5GGUA 1EJOH 4Z0BL 5KSAA 3GSQA 5HGDB 4UBDC 3RVWC 5FO8A 1I7ZB 3QDMA 4UU9A 4RX4D 1KCSL 1UXWB 1QBBA 1RVFL 5E08L 4ELMF 3IJSA 3T0VA 2JCCE 4K94C 1ODAA 1UGNA 3BD5A 5C0FA 2HTLC 3BUYB 4PJBB 1M7IB 5EPMA 4HJGB 2EE2A 3QIWB 4IRSD 3I9GH 4OGAD 4OLUH 1TIUA 5HY9A 3KDMB 4JR9L 3ZL4H 5CBAB 3GKWL 5DRZB 3EDKA 1OSZA 2AKRA 5J6HA 1KJMA 1XIWB 3SJVE 1MFEH 3HAEG 5HYEA 4HS6A 3RPKA 5DSCB 1AQDB 2H26A 5T1DH 1CR9H 4XP1H 3QQ4A 1PZ5B 3BPOC 3E2HC 4M1GH 4MSWA 3ZKXB 2DQCL 1UKSA 3S36H 5AWNH 5F8RC 2CRMA 2VAAB 2AQ2A 1UACL 4LAQH 1S7XA 1BOYA 3QUKB 1CN4A 3GMQB 4M5YL 5DD3L 3VFUB 2XTJC 1QO3A 5IESL 1AD0B 1FSKC 1H8SA 3WO3B 2CQVA 4YHOH 2UWEF 3G5YB 2ZUXA 3R0MA 4RMRA 1AP2B 1EIBA 5J8OA 4DW2L 2V6HA 3RTQD 1FG2B 4G8FA 4G6JH 4YNYA 1JYWA 3MJ9L 2HT4D 4PJHB 4RDQF 3QRGL 1PKQE 5EIIB 4HWZB 1WJ3A 3WNMA 1JYXA 3TO4A 4NQDA 3SCMC 4ONOA 1LO2H 3PV7A 3KJ6H 1VFMA 3QEQD 4X5XA 2NY2B 3NCFB 1F6FB 1T04A 4EQ3A 2BY3A 5JDSA 4ZOEA 1ZMYA 1I9EA 4LVOB 4WU7B 2CXKA 1U58B 1YMMA 4JZJC 3QRFM 3PWJB 4ZYKB 3QUMH 2GSIA 3VFWA 1T21A 1QYGL 5GRWA 5C08B 1K5NB 2GUOA 5IHBA 4LLWB 1WIPA 5FA3B 3LS4L 3MV7A 4XPTL 3NFPB 1YNLL 3V5DB 4OZGF 4XVUC 2DQEL 3CK0H 3FMGH 1G6RB 4G80B 4JFXA 4QHKI 1ZK9A 1CFTA 5E9DB 5INCA 2FJGA 3KYOA 1FL6B 1U3JA 1S3KH 1OTTD 2EH7L 5EOQL 2ZCHL 5CJQH 4XPGH 3SDXB 4GKNB 2A1WH 1SEBA 2P5WB 1U6AH 3ULUE 1OT2A 3T8XA 1DEEB 2DAVA 5BJTB 5DJAA 3C6LC 3VG0L 3E3QE 3DMMA 3W81A 4ZNCD 2K9UA 1QSEB 3NIDE 1G9MH 2WANA 4KAQH 1VFOA 1T7YA 4JVPA 1VGEH 3UCRA 2M26A 2YA0A 2F15A 4Y2OA 3SDCA 4WEMB 2D7OA 3DO7A 4I3GA 1YECH 2CKBB 2Y9RT 5A43C 5JZ7D 3NABH 4GW5B 5I0DA 1HI6A 1T5WB 4X6FA 2VISA 4ENEC 1HHIB 1BFOA 5TF1H 2OXHA 3FZUD 3UZVB 4JHZA 4W4OC 4RMWA 2O5ZH 4DK3A 5HVHC 1JJUA 4NKQB 4PJ5E 4Y4HA 4MJIB 4XGZA 4XCEB 4I0PC 5FM8A 2ILLA 4W4NA 1F3RB 1T1XB 3N85H 4HKXB 2XN9B 1XGQA 3ARDA 3QJHA 1Q1JH 3DYOA 1KIRB 2CDEA 5GZND 1UVQB 5D1XD 4PJCB 1UZ6F 1UKQA 5I1KL 5IHZB 5KVFH 4TSAH 4NHCH 2DQFB 2HN7A 1SEQH 2PUQT 3V52H 1J1OH 1MFDH 3D5OF 4ISVA 4N8PA 3W2DH 4J3XA 1HXMA 3ZE1F 3GMLA 3RVXC 5I71B 1DQQB 1QP1A 1KB5H 3FCTA 4WWKD 1R3LB 4XVJH 5D1ZD 3HFMH 4Y5YA 2DQIL 3QI9B 4RSVA 3ARFC 3C2AH 2VDOH 4JRXB 1MFCL 3FFDB 2IPUG 5T5FL 2Q7YB 3BIKB 4XI5D 4OM1L 4GQPH 4MLSA 1Z9LA 3IJHA 3PG2A 2P1YA 3KPRA 4UIMA 5CEZH 3GJEB 3SDAA 2HFEB 1AIFA 1AXSB 3SE3A 1NUDA 3SDDD 1LP9F 1U8HB 5GJTH 3U9PL 3DGGA 4KQ3H 4NO3A 3MROB 4OIBA 3TIEA 1XCTB 2ATPB 3H9HA 2R1XB 3QG7L 4O2FA 4OLEA 5FB8A 5IFHL 4WEUD 5C3TA 3B9EA 1WQVT 4LSSH 4WO4B 3BW9A 3CFEA 1UWGH 1CIUA 4UQ3B 4NNXB 5AUMB 1MHHA 2MOVA 3LEVH 5CSBA 4XRCB 1QA9A 2ZUVA 3INUL 3EJZD 4KUCD 4LSRH 4X7FC 4OZFB 5BV7H 1JV5B 2C3XA 3HS0B 3HCVA 5ISZE 1T0MB 3WN5A 2HH0H 3ULVF 2RGSA 5SWZE 3G6DL 3U0TB 3MRDA 1A2YB 2LU3A 5F3BA 3B9AA 5D72L 5ITFA 4DTGL 1NLDH 1CICB 3TV3H 1UJ3C 4PP1C 4IHOA 3P4NB 4G6MH 1TJIH 4HS3A 1WBXB 4OF6A 1I4FA 2X4SA 5E5RB 4LEXL 1OCWL 3U1SH 1FGNL 4POZC 5DQ9A 1K6QL 2YPLA 4QTHA 4JPWL 3T0WA 2NW2A 3B8SA 4AENB 3MGOB 2NY0B 3BH8B 2FR4B 4HG4K 2YUZA 4NJAH 5FGCE 1RZGA 4LKCB 2W9EH 2H8PA 5E99L 3DURB 3ALWA 4QRRB 3BDXA 1XGYH 3HG1D 4IS6B 3O81A 4POUB 5DWUH 4N8CH 1F8TH 5FOBA 2ZJSL 5FYJE 2YRLA 2PW2A 3GB7A 3CX5J 4MS8D 5FFLA 2BXYA 1I1AA 3FOLA 1DBAL 1Z6JT 5JDJA 3BEWB 3FFCE 3KPNB 4MAYD 5DD5L 1DZBA 1HH6A 1TDQA 4MX7B 4YXLL 1X7QB 5I30L 2W0PA 3PDOA 1B6UA 3F12B 3S5LG 5DHYA 4I3RL 3BAEL 4FTVD 4DGYH 1BWWA 5IOPB 4OGZA 5T5NG 4OM0L 5MHSD 4LSUH 1TENA 4ONHB 4LCCA 4ETQA 3ZKND 1ULVA 4EN3A 2HTKD 3CXDL 3HRZB 5TDNA 1IZKA 3T0EE 1Q0XH 3UTPD 4M7LL 3PUCA 5IMLB 1U92A 5F1KC 3RP1A 2K1MA 4MVBD 2CIIB 4H1LB 3TWCH 3MA9L 4YIQA 1MJ8H 3OB0K 4LASH 4RAHA 5TDPB 4JO2L 4Y88A 1P4LA 5TGBB 1NDGB 4ORZC 4R3SB 1R5VA 4LBEB 1YYLL 4NP4H 5C0BE 4GMTH 2HVJB 5J56B 1IGMH 1DP0A 5ICXB 1IAMA 1EGJH 1FZOA 4QRPA 2F54B 3QULB 2IANE 2X40A 1X5LA 4LARH 1D9KD 4NCC2 3GGWA 2OZ4A 3WFEH 2BNUA 4KPHH 3WUWG 5K9OB 5B4MD 2BSRB 1QLEL 5JIKA 4FRWA 2BNRE 5IR1A 3VGGA 2VLRE 3DSFL 3BWAB 3LD8C 1IC5H 3AROA 4NZUL 3MFFB 2CUHA 1FYTB 1IQDA 4KJQD 3G6AB 4ZUUA 1HWHB 2FL5B 4Y19E 3DRTA 4ZSOE 3O2VL 5EOCL 4ZG1A 3HC0B 2CXGA 1WV7T 4JKMA 3CDGA 4K8RH 4XP6H 5CP7B 5HI5C 2NLJA 3SGEI 5I8EB 3S34L 5AZ2L 4MDJB 1IAIH 3HE7A 3OKOB 3QEUB 1FHGA 3L3HB 5K93A 3VXRD 2N1KA 5JHDD 3C87A 1EH9A 4U33A 4DVRH 4HUXA 3RUGF 1JRHH 3HC3H 4QHLA 1EHXA 2CRIA 2WWMC 1EAPB 1S7UB 4ZO7A 3QAZC 1F90L 5EOTB 3L6FB 3O4OC 1QKZH 1WBYB 2EEAA 4PB0L 2V7HB 1NCUA 4IRSB 4D0CA 2DI9A 5FUCC 5DHVA 1AKJA 2DBLL 1G7QA 1KCRL 3MRHB 3UPRB 2IWGA 5CJXC 5JMOC 4R0LB 3QFDB 4JFEA 4JDTH 1S7WB 4NGHL 2DBJA 3PXJA 4M7KL 4JFFE 3DX7A 1I7TB 3TA3A 2K3TA 5FYLH 3ARBD 1KJVB 2AJUL 5CUSL 1WT5A 5C0CE 2X4QA 4F8QA 4NDMB 4S1RH 4MCZB 3ZKQD 1DQDH 4KKLC 4OD1L 5C6PB 2DDQH 5H8DA 3CPLA 3VD4A 1M71B 3CH8A 4RNRB 1LEGA 1TZHB 4PG2A 4UDTA 2F19L 3MRCB 4XNXH 5DJ8B 4LSTH 4HH9B 1BGXH 5GS1B 1NCBL 3EO9L 5B8CB 4YHKL 1K8IA 2A6JB 1R24A 3RTQB 5ID0A 4U1IA 2GJ6A 4PJGB 1OARH 5BS0E 4MXWL 5DQDH 4KGJA 4NFCA 5ICYB 1KBGH 2R4RH 1VPOL 5BCAA 3MLSH 4H26B 3D69A 4Z7NE 4WU5B 3KLHC 3P0VL 4HUUA 4XP5H 4HGMA 3CFDB 3KYNB 5DDHA 5MEND 3ZKMC 3QEQB 2E7BA 2VLJE 3UP1A 5DVNA 1FZJA 1S5IH 2PO6D 4HFWB 1PY4A 4GRMA 3MLUH 4F7CB 3PJSB 5I74B 4A6YL 3RGHA 2IJ0C 5SWSD 2AK1L 1DBKH 2BY1A 2V5RA 5KVDL 2X4OB 2VIRA 3EO1A 5DEFA 5CEYA 4L3EA 3KPPA 3PGCB 3PWVA 2AV7B 2OL3A 4EDWL 4F7EA 4MNQA 3GM8A 3P40A 2DL2A 3N0PB 4U1MA 3N1FC 4Z5RB 5KG9A 5DUPH 2QL1A 3FOMA 4PS4H 2BMKB 2I26N 4F33A 2DYPA 4XP4H 4ODUA 3RWHA 2R2HB 4PGCB 2NX5A 3GZKA 1F4YL 2YMXL 3MUHL 4MDIA 3EGSA 2RFXA 2I27N 3J8F7 5HSFA 3O3DB 4D9RE 4KJYB 3BGFB 2Z8WC 3CAFA 3R8BB 1CDIA 5F9AC 5LCVH 5K33A 3IDGB 3U2SB 3OKMA 1P7QA 2G5BB 5D5MB 3CDFA 1CGTA 3EDFA 3ULUC 2HLAA 3TH2T 5HHPB 1CGYA 1GAFL 3HZVA 1D5MA 3LAFA 3CLEL 4Y5XA 3E3QC 2VDRH 4L9LB 5IEHA 3G04A 1CFSB 1JGVL 2EKSB 5C9JB 2OJEA 3TO2B 2YWYA 3VWKD 4BFEA 5DRXB 1X5HA 4OQTL 2EDTA 4FXKA 4OBRA 3JUYA 1KB9K 4F15B 1NCNA 3KPQB 5GGRB 1EXUB 4QOKA 4KHXL 5F6HI 2HMIC 2CLZB 1I1YB 2KPNA 3KHOA 4QCIA 5DRNB 5L2JA 1W0YT 4NWTH 2VXTH 4HDIA 4Q6IC 5D7JA 1Q9WA 1WLHA 4UT7L 4BUHA 4GSDH 3QIBD 3T1FA 1WFUA 4ZUVB 4IOIA 4N0UE 4N5EC 5D1XB 1CL7H 5E8NA 1N5YH 4DGIH 2X4NB 5BXFA 2VLJD 3VE0A 3FQWB 3GIZL 3HR5A 2CMRL 1JPSL 4ZTPL 1LO0L 4JQVC 4RGNE 3TBYA 1KEGL 1PKOA 2E7LA 4WI3A 4GRLD 2XZAH 3DO3A 4AIZA 4DN3L 3QFJE 4WWKB 3X3FH 1EUTA 4XHQA 1K4DB 5D1ZB 2VQ1A 3K74B 1U3HD 4A2LA 5CGYD 1RZIA 1FVCA 3O3EB 4KRMB 4X4XA 1A0QH 5ACZB 2VTFA 4D9QD 3O6LL 5FGRA 1MHPL 2LAGB 2E7HA 4UT6L 4PGEA 5A2FA 1LO3L 5GJSL 3VWJC 4NNYA 3SDDB 2VXQL 2CDFB 4XCFL 5DQJA 3CU1A 2EZ0C 2JJWA 4HPYH 1ZHBB 4U1LB 3UJJH 3QXAA 2MKWA 2P49B 2R29L 3IDNA 3WFZA 1GJIA 1JZ2A 3IS0X 4K23L 4YFDB 3BYTA 5LGJB 4JDZB 4P2YA 4LKXA 2GTZB 4OD2A 4AL8L 5JHLL 1BEYL 5E4EC 3O6MH 4L8SB 4JAMA 1FH5H 1ZT7A 1RJCA 2J6EA 3DJ9A 3DUSB 4P5MB 3F6IA 2DMBA 2NY7L 4R7NB 4ZDHB 3TEUA 2YN3A 1QPXA 3KLAB 2AJVL 3C8KA 4H1LH 2BVOA 4BM7A 2OTWB 5I1CL 1JWSA 4UB0H 3NPSC 2XNAA 1PLGL 4XCNB 4I9WD 2Z4QA 5L9DL 2W07A 1CT8B 2XWJA 5EU7E 1NC4A 5IGXH 1LD9A 4I5BA 4PUBH 3T08A 4LSQH 4RDQG 5D7KD 4MWFA 2DD8H 3KPOB 4GXUM 4JPIB 1AC6A 1M4KA 4JY5H 1T1ZA 3I75B 1I8MB 5T3ZL 3IU4H 4K7PY 1I8IA 4N0YH 4QTIH 5E2TH 3VW3L 4KI5D 2AXJA 1NGPH 4HV8B 2XACC 1FC2D 1EMTL 1M1SA 5E8DL 3TPKA 1IKNA 4C55A 3RL1A 1NGYB 3TJHC 1ZVSB 3WL9A 5HYSB 4O2EB 3ZTJG 3GHBH 3MRKB 1X44A 4NJ9H 3H9SE 4M3JA 3MUGA 4WEBL 1CF8L 1KLFA 1NBZA 4WUUD 3L3OB 1K9TA 3MOBH 5JOFB 3K4DA 4NM4L 1EFXA 4H5SA 4WI8A 4MAYB 5B38B 5GRVK 3SE8L 3VFOB 3NH7L 4MQSB 3BP7B 1V3LA 2WIIB 4O51A 3D87B 4FTVB 3U4EB 1I8KB 2YWZA 2R2BA 3LV3A 2X5PA 4EI5C 5EOCJ 2I07B 4OIAA 1JHTA 1CGXA 5GS3A 5ERWB 1J8KA 2IH1A 3UJTL 2A73B 3D25A 2XA3A 4J6RH 4OLVL 3AM8A 3H42L 4GMSH 2AGJL 2AXFB 4FQLL 5IM7B 4NN6B 32C2A 4FFZH 3S4SG 4DVBB 2LTQC 1UJTA 2GAZB 5FCUL 4Q9BA 3WS3B 3T0EC 1YC8A 5T3XH 1TQCC 2AQ3A 2P8MA 3VA2C 4P23C 5JR1H 1Z3GL 3BXNB 1GCFA 4PRAA 4FQHA 4JGMA 4QXWA 5DMYA 1DN0B 1D9KB 4OSUH 3MRIB 1E4WL 1BBJA 5HHNA 1GPOL 2WAHA 5A16A 4YHYC 1AE6L 5IWLC 2VXSL 4JPKL 1YNTB 2X1OA 4OD3H 1QBAA 2ID5A 2X4RA 3OAUL 5JW5A 5D6DC 4X7TA 1GC1C 1IGIL 2XRAL 5D4QA 1G9NC 3PQYA 5DJCB 2EC8A 1TTFA 5DJYB 2Z91B 1PEZA 3MSPA 5HDBE 2VZ1A 3OR6A 1T5WA 3SCMA 3VFNA 4OCRH 4CVZB 1F6LL 4X98B 1NL0L 4XCYB 1O5DT 4M43H 3VXRB 5JHDB 2AEQH 4JZJA 5C6TL 1WBZA 4FG6C 3C6SA 4KY1L 1C7TA 3Q3GB 1DL7H 2C26A 4I77L 4NCC1 1LNUB 4PYHA 4LSPL 4WNQB 1KCUL 1D5BA 1BOGB 1T0NB 2F5AL 2ZCKH 4XZUA 1RZJH 3FQNB 1HHJB 3O11B 4HQQL 1UWXK 1IC4L 5IB2B 3TBVB 3LEXB 2OCFD 2EYTA 2X44D 1OGAD 3LDBB 4PGJA 1NC2D 1ETZB 1FORH 3ARBB 1M7XA 2P5EA 1MFAL 2CD0A 3G5XB 4WI9A 3C6LA 4ZS6C 1XF5A 3MRQA 3PE9A 1CGUA 4Q9RL 1NBVL 3GMMB 3EYVA 1UB5A 4GUPA 5A40E 2XZQL 4YR6B 1IBGL 2XZCL 2FEEL 4BQ6A 1YQVH 3LN4B 2FATL 4XNQA 5IMMA 3X14A 1DN2A 4NQEA 4M1DH 4Z77B 3F7RA 5C2BL 5CINH 1WISA 4ZQKA 3B6SA 3GSVB 4PJ8A 2F5BL 1OP3H 1MLCA 5J4MA 4ZO6A 5IK3A 2QSCH 4L5FL 4W4OA 1WZ1H 2PTTB 1AHWC 1RUQL 2ZZUT 1RZKL 4UAOC 3BWUC 1FZKB 3ZT6A 5MENB 4JKLA 3C5ZC 4PY7B 4I0PA 3TVMD 3BZFB 4GAGH 4LQFL 2PO6B 3WLWC 4HK0B 1ZHKB 4UMGA 1ZANL 5J13B 2D0HA 2FBOJ 4M61A 5SWSB 4P2RD 3LKOB 3B43A 4PRNA 3VGHA 3LSOA 4K7PH 1CFNB 2Y25A 4YDLC 1FNGA 3BQUA 5JW4R 4C56A 2DTSA 3LKPB 3CSPA 2CLVA 1A9EA 3M07A 4QXGL 1MCDA 3OKKA 5HYJA 3BZEA 2HLFD 1NCWH 2ERJB 1A02N 1CFBA 4OUOA 4APQC 2DQTL 3ARFA 4G42A 3IFPA 1ZT1A 2X4PB 1A1OB 1RIVH 1S7RB 1S9YB 3U46A 3MODL 4O9HH 3TBWA 5D7LA 5I9QC 2MTPA 3GI9H 4HXBL 3ALPA 4K3DH 5EH1A 2CR3A 2VL4A 3WFHB 1EHLH 4DGVH 1C16A 2R0KL 3BPCB 4WUKH 4LRNH 3V4PH 1N0XH 2AQ1A 2E5EA 2RBLA 5EO0A 3VJ6A 1AO7D 3S6CA 1YEEL 3LIZL 2OQJA 5J9PB 2AJYL 2ZUUA 2WP3T 4PRBA 1T5XB 1PZUB 1R3KA 3RJQB 3OR7B 4EI6A 1BD2A 3MRMA 3VWKB 3WXWH 3FQUB 4B7LA 2QLVB 3C60C 4JO1L 1LE9A 4J23A 1VFBB 3QQ9C 1JZ5A 5IVXA 1UEYA 2NY6C 2IPKB 5C7XL 3WIIL 4F7TB 3VH8A 1QBML 3PHOA 1IQWH 4PB9L 1CQKA 3QIBB 4IOFC 3MYJB 3KPSE 1A6TB 1NMAH 2Z31D 15C8H 1RZ8B 2YA2A 2I60L 1OSPL 1UJ3A 2A6KB 4HEPG 4PJ9C 3C8DA 5SV3A 5CEXA 3UX9B 1EJOL 2GSGB 1TZIA 1T4KB 2XPGB 2PW1B 5EA0H 1YEFH 5LXGH 5D7IA 3VFGH 4HKJB 4X9GA 3BGMB 4GRLB 1ES0B 3BKCH 4RAVB 2I9LA 1JPTH 2D31B 1BAFH 3SKJH 1OAQH 4KWUA 3WXVH 3VGFA 4Y16B 1UM4H 3O3AA 1RJYB 1NFDA 4U7MA 3I9GL 1HSAB 4OLUL 4HWBA 1U3HB 3K4ZA 5J12C 3BJLA 4RGNC 1IEAB 2LAAA 3CFCH 1DE4B 1T3FA 3QA3B 2HFTA 5IBUG 1MFEL 2PF6A 3T0BA 2PN5A 2CPCA 5T1DL 2Y07H 4XH2B 1BBDH 4XAKE 4XP1L 2ESVD 3FT3B 1FIEA 3HUJA 1FFPB 4M1GL 3BPNB 3S36L 5AWNL 3AFLA 4U6XA 3EOAA 4RAUA 3DXAD 4LAQL 5GGVL 3MUY1 1Z5LB 4MZ2A 5DLMH 2YD3A 4E41D 2X41A 4EDXB 4LVHB 3NACH 2WINA 3UTTD 2WMPA 3VI3F 1DVFC 1CDJA 1VSCA 2KDGA 2ZSWA 3W11C 3S37L 3BD4A 1HXYB 1V7NH 3Q1SL 5ILTH 2EC9U 1HSBB 4PJFE 4X4ZA 3IXTA 1F6AA 4G6JL 5B3JE 4RGMB 3RWEB 4CGTA 2OM5A 2ED9A 1KTKE 5DD6B 5DRWA 3WS6C 1RUPH 2YD6A 3ZDXE 5DFVC 3QXDA 1JF6A 2P44B 5JA9A 1LO2L 3UDWA 1A7OH 1DLHB 5MERB 3I6KB 1BMGA 1AGBB 1ZLVH 4FS0A 1E28A 2VLKD 2FSEA 1RIUH 4WVRA 1B6DA 1I3RA 4WFHE 3QUML 3GMOB 4MAUH 3QBTB 3ZYZA 4ZUTA 3HE6D 5M7QA 4KKCD 2NNAA 3IU3B 4FQCH 3FO1A 5AD0A 4BH8B 4PJDA 2MMXA 3CK0L 1MH5B 5CBEB 2CUMA 3H3KA 2M8XA 5KVMC 2UWEE 5EU7C 1SY6H 1XF1A 2EDDA 3RU8H 3O9WD 2ARJA 4K2UH 1FO0A 2OJZH 1HILB 4NOFA 5JPMB 4GLRH 2VXUH 1S3KL 4U7SA 2IBZY 5C6WH 3U6RB 3EHBC 3KXFE 4JHAH 4DZBA 2A83B 4XPGL 3MRNB 2FJFA 5I76B 2A1WL 4WUUB 1RZ7H 4ZNEE 1U6AL 5KN5B 4NRYA 1ZT4B 2ZG1A 4QRTA 1I1CA 3A6BH 3QZWB 3KPLB 4Y4FD 2X7LA 3T4YB 1G9ML 3ESVF 4KAQL 5KAQG 2ENSA 1A4JB 3V6FB 3BI9X 4FOMA 1KGCE 4GS7C 5DHVH 3V6OE 3JVGC 2AERT 2G75A 5ESQA 2R0ZH 4NO0A 4QRUA 1L4IA 2PKDA 4OZGE 4DCQA 1NH6A 2H2SD 3NABL 5A1AA 5SV4A 5TF1L 4CRPA 4N1CA 3NFNA 4CVXB 5IIEB 1NGZA 4H8WH 2O5ZL 3WNKA 3DRQA 4Q6YA 3MJ8B 4LGPB 5I1AA 3Q6FB 5KVEH 3UAJD 3B2VH 3N85L 4BFIA 4NQCE 1P7KB 3D0LB 1Q1JL 4M00A 4Z7UA 2CIKB 3W0WA 3L3KB 1QSFE 3CUPB 1HHKA 3I02A 2X4TB 2XTJB 5CP3H 5CJXA 5KVFL 4TSAL 2C7UA 4NHCL 1I85C 3MLYH 2X09A 3B8YA 3V52L 1J1OL 1MFDL 1JZ7A 2AVGA 4H0GA 3KPTA 2PTVA 3W2DL 2JCCA 3P9MB 3LQZA 5C0AD 2IH3B 4HIJB 3BP6B 3W9DB 4U6YA 4NQTA 3SPVB 1KB5L 1P2CA 1TNMA 2WQ8A 1QEWB 3FRUA 3KLHD 5DMGC 2EDWA 3HFML 3SJVA 1EO7A 2CO7B 3BIAX 2BVUA 4R96A 2VDOL 3RWGB 5ACLA 3JXAA 4YPGB 2NY4D 1WSST 3KJ4B 2QADC 4J3SA 4L9DA 4LEOA 5CEZL 2XT1B 2AK4E 3DX9A 3RL2B 4K55A 3LN5A 2OYPA 5GJTL 1ONQA 3FTGB 2OL3H 4XNMA 3LKNA 1MWAB 1AGFB 2FYYB 3I6LD 1PDKA 1UZ6E 2ZG2A 4LPYA 2R0LH 1LDSA 3OB8A 4WTWA 1MY5A 2EDYA 2H41A 4LSSL 3RGVD 1UWGL 2WBWB 5T1LD 5EFIA 1YEGH 1U91A 3UBXB 3LEVL 1G7IB 1PKQA 3ZTNH 1F58H 2H32A 5ESAA 2FO4B 1Q9OA 1FN4B 1W72B 5BV7L 2HT3C 3D3VE 2VLMD 3VD5A 4KTDH 4TUOB 1XZ0B 2HH0L 3QDJD 5DJDB 3D85D 1MCQA 4FMKA 3E1F1 2Z8RA 1NLDL 1XGPB 5HPMB 2BVQB 1UQSA 3G5ZB 4G6ML 1TJIL 1KSRA 3M17A 3IDXH 5SX4H 3NPZB 1OGAB 1QSFD 4M3KB 4LNRB 2WUCL 3U1SL 1NC2B 3EO0A 1KIPB 4JKPH 3C9NB 1KACB 4PRDB 3CCHB 2NTFB 4HG4J 3QJFA 2R8SH 3K7UA 3MZGB 4ZUSB 5EU5A 1WFOA 4TNWK 2V2TA 1JWUA 4S11A 2A38A 5CJ5A 4PJCF 4RZCA 2HMID 1FL3B 4NJAL 2PR4H 5EU4B 3PABA 2W9EL 1DQMH 1F3DJ 4EBQH 5E03A 1OTUC 1JL8A 3D48R 4ZUWA 3ZHLA 3UTZB 2BHZA 3VCLA 1XGYL 1RIHH 4JFPB 1ZA6B 4PRID 1B0RB 2ICEB 5DWUL 2EIZA 4N8CL 1F8TL 3LMJH 1BQHG 1IGTA 3UBXI 1P6FA 4NT6A 4Q6IA 3TVMB 5DFWH 1P9MC 5DMKA 5T33H 3S35H 4LIQL 4ZFZA 1MFNA 3KS0H 1BX2B 4DGYL 2YPVH 4P2RB 1OW0C 3B9DA 3K8LA 4PTTB 3C09B 4PJ5A 5D96B 5CZXC 2I9TB 5IB5B 4JQVA 3BEVA 1XR9B 1NBYB 4KU1A 5F7NC 1Q0XL 1XH3B 1FFRA 1ZV5A 3CNKA 4NSKA 3TH3T 5ITBH 2MKLC 4OLYH 1YPZE 2XQYK 1JP5A 2ZWLT 5CJOL 4FQXC 3TWCL 2M2DA 1X5XA 4PJ7B 3I2CH 4HT1H 1MJ8L 4PPTA 4LASL 1PAMA 2EDLA 4DQOH 3MV9B 2ADJB 3LKSA 4ZPVA 3O41B 3IAGC 3TYGH 4LQ1A 4EUPG 5IG7A 3A0OA 2VSCA 1N4XH 1CK0H 3VDBA 5HHOE 4MXQD 5ID1A 4NP4L 1A6AA 1P4IL 4GMTL 1P4BH 1IGML 2J6EH 1UZ8A 3EYSH 1EGJL 3GNML 1A7RH 3VWJA 3PL6C 4U1NB 3TZVD 3SGKC 4IMKC 4OFKA 3ARGC 4LARL 1X5GA 3HG1A 2E6PA 1AO7B 5CSZA 5GRVL 2ZUQB 3WFEL 4PLNC 2E9JA 4KPHL 4PREB 1QFPA 5E8OA 3E6FB 4W6XB 1E4XH 5T1KA 3JWDH 5DZNA 3A6CH 1OD9A 5EN2B 1IC5L 1RAMA 4JG0H 5FUOH 4WI5A 4TRPH 3K46A 3OXRA 5EZJB 4S1DC 5DMJB 1QQDB 5DD1L 5MP6H 4WGWB 5HDQH 4K8RL 3DLQR 1N8ZB 4XP6L 4LNVA 4GOSA 4KK9D 1IAIL 3K1DA 4YGVB 5BOZG 1QNZH 4WFGD 4K3HA 3RVUC 2VWEE 4NQSB 2YXMA 5EBGA 4P2OC 4DVRL 4XWOC 4PRPE 3HC3L 5ISZA 3HI1B 3W82A 7CGTA 5SWZA 4OZIB 4HWNA 4PJAB 1G6RL 2C3GA 4PLJD 4V2CB 5IVXF 1XF4A 2ZKHH 1QKZL 1SJEA 1JCKA 3P77B 5FUZH 5HHMD 4L1HA 5I6XB 5C0GB 1NFIA 4Z7VE 1I9IH 4JDTL 4G9DA 4ZO9A 2DN7A 5IQ9A 3Q5YA 3VFVA 3CVIH 4GXVH 3BRDA 3CMOH 5IW6A 5FYLL 2ESVB 4XMLH 4Z9KB 3L7FA 4F3FA 5C0IB 1LEIB 5E2UH 1NAMA 3X12B 4ODWA 2Y5TA 4S1RL 3MRPB 4XP9H 1DQDL 1WCBB 3DXAB 3MBXH 4JRYE 4LLDA 2DDQL 4K94H 2NY3C 2D7NA 1P84J 4E41B 5LKNA 2A74B 3U30B 3PGFH 3RUGE 5I1HL 3UTTB 5FO9A 3HI6H 4FMFA 1MJUH 4I18B 4LSTL 3QNYB 4OCMC 1BGXL 5IB1A 3SKOA 5C09D 3W39A 1A4KA 4V1DE 1GZQB 1XAUA 4AH2A 2GK0B 1LEKA 1EVUA 4YHIB 4D3CH 1A8JH 1OARL 1MVUA 3UXFA 3SKUD 4EI5A 3HUJF 1OB1A 3LPGA 1KBGL 2R4RL 4G8GE 1EBAA 3MLSL 3T3PE 1AGEA 4AEIH 2FWOA 4OLWH 1SVZA 3WE6B 2MCPH 3C5SA 2VLKB 4N90E 1S5IL 3DX6B 3LKRA 3GI8H 3MLUL 1VADB 1U8IA 4JZNB 4U1SB 4BKLB 3FN9A 3U4BH 2CRZA 1MRFH 5FAAA 3QCTH 4HIXH 3HE6B 2X1QA 1DBKL 4I2XE 3T0EA 2YN5A 2H1PH 4LOUD 2IMNA 1MI5D 3GSOB 4QRSB 4P23A 1KULA 1IAOA 3EDDA 4GW1B 1AQKH 3TBVA 1H3WM 4KTEH 5JIHA 2IQ9L 3O9WB 5ICZB 4X7EC 1MCRA 3GBLA 3TESA 3DIFB 1HHHA 2XFXB 2YHGA 4WTZA 5DUPL 3S37X 2J7LA 3TNMA 3LRSB 4TUJA 5C0BA 2FX9H 1F11A 4LCWE 4PS4L 4CDGC 5IWLA 3KYMB 2B1AH 4XP4L 5GIRA 4P46C 2UYLA 1K4CA 1NCDH 5D6DA 2ZOLA 5CLWA 2LV4A 1T03H 3GM0A 5FKAA 2D7QA 5L6YH 4YAQA 4PJDF 1YN6B 5E8PB 4N1HB 4Y4FB 2DICA 3U0WH 2OR9L 4JFDE 2O93L 3RZCD 1MCFA 2DLHA 5LCVL 3O4OB 4ODSH 1CTNA 1J18A 2QHRH 3I6GA 2BNRA 3TBSB 5ANMB 5JMRA 1J05A 2VLRA 2CDGA 3ZYOA 3OAZK 4BSWB 3HNSH 5I8CB 3K80A 2VDRL 1IL1A 4Y19A 4Z95H 2DRUA 5KSVA 2VNCA 1Y6KR 4ORGA 4ZSOA 1W72H 4S0TD 5E7FA 4NRXB 4M93C 1AXIB 5IROC 2XWTB 3D9AL 3V6OC 5GRJH 5C3LD 4NWTL 2VXTL 1QTYT 4XNZB 1TVHB 2MQ0A 4YHZH 1NDMB 4MB4A 1U8MA 4MA7H 3JZ7A 2XG5A 3RBGA 2V7NA 1A6VH 4GSDL 4GRWF 2A9NH 4KKBC 1T83A 2NTSP 4I0KA 1CL7L 5IMKB 2VDLH 1N5YL 4DGIL 3PWPE 4OV6F 3TIDA 5DK2B 5H35A 5FM4A 3VDCA 4JFZH 4XAWH 3RNQA 5F1NB 3T3MF 3FB7B 1UH2A 2R1YA 4NUJB 1TPXB 5E5MA 5MEPB 2BXZA 3VMOA 1K8DA 2XZAL 3O6FC 5GHWH 4D2NA 1QR1B 2BVTA 2R9HC 4XMKH 4CW1B 1TETH 1I9JH 4K3JH 4U05A 1JUFB 4OCYH 3G9AB 4P9MH 1Z9OA 2H6PB 3O8XC 5DJ2B 2ZP0T 3U0PA 1A0QL 5IMOA 5T3ZD 4JFFA 3IDJA 1OQOA 2BP3A 4NRZA 2NY4B 1JGDB 1ZGLB 5C0CA 3GRWH 1VCAA 4GW4B 4HUWA 3O2WH 1N2RA 4WHTA 3QPQD 2JCCF 5JQ6H 2Y5EA 4P4KD 4HPYL 1AHWA 1S7VB 5D9SB 1BIIA 1UXSA 4RQQB 4IMLA 4R2GD 4DJMA 4M7JH 3C5ZA 5DTFA 2HRPH 3HAEA 3FRPG 3MA7B 4ZFOB 3RGVB 2A6IB 1FVDB 3DV4B 5BS0A 1K3ZA 1AI1H 2OR7A 3B9KD 2AXGB 3O6ML 5L7XH 1FH5L 1W8NA 43C9A 3OKDA 2NQCA 5FO7A 1KNOA 3OKEA 5CD3A 1T66D 4G6AC 3QDJB 1ZVYA 1KLUA 2VLJA 2Z92B 3ZHKA 3D85B 2E6JA 1U95A 2XZZA 2EKJA 1T7XA 4UB0L 2JB6B 4L8CA 4HKJA 2PXYC 5TFSL 1UH3A 3WIFA 5EUKA 5IGXL 5D1QC 4PUBL 3U36B 1HCVA 4LSQL 1INQB 4F57H 2GT9A 3S3SA 1CFQA 3LH2H 2X4UB 1BWMA 2P8PA 4NN5B 1XGTA 4JY5L 4URTB 4RMSA 3RKPA 2O5YL 3IU4L 1G1YA 2FEDD 4YC2C 5E2TL 3WHE1 5BVJB 2JELH 1SM3H 1NGPL 3B3IB 2CJUH 5DJZB 1HN1A 2EO1A 5IBTH 4G9FE 1A1MA 5HJ3B 1GZPA 3SGEH 1OHQA 1X4YA 2ZNXA 5ETUB 2DJSA 2NPLX 2YC1A 4G8IA 5CLTA 4NJ9L 3QO1A 2ZUYA 1TJGH 4KI1A 1F5WA 3L3DB 4Y2DD 3CFJB 1SHMA 4TNWF 3VXME 4PRIB 4CN6A 1XT5A 3H7BB 3MOBL 5IUSA