4OD1L

Crystal structure of human fab cap256-vrc26.03, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
211
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNNFVSWYQQRPGTAPKILIYENNKRPSETPDRFSGSKSGTSATLAITGLQTADEAEYYCATWSASLSSARVFGTGTRITVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.03 heavy chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od1L01
3DO3A 2R0LH 4N0FA 4JO2L 1IEHA 2W65B 1D5MA 2DICA 2WIMA 1XGUB 2J8UB 1S78D 5HHOD 3TLRA 4OFIA 4PRBA 4PTTA 1XF3A 4B0MM 1EFXA 1BD2B 4ETYA 4HIEA 3EFDH 1MIMH 3VXPA 1PLGH 3GMPA 5C0BA 4K3EL 3NCYP 3UPAA 2HTKC 3MO1A 2OQJA 1KT2B 4XVSH 1BVLA 3H9YA 4NWUL 3PGDB 4FQQA 3S3SA 3NA4A 4PY7A 4RX4A 4WFFE 1DCLA 1G9NC 2VABB 3RL1B 3BJ91 3LB6D 4IIQA 2VLJB 1OY3B 4P3DA 3TT3H 3RVWD 1QG3A 1GIGL 4IOIB 5IV2B 1EHNA 4TNWF 5EZOH 2CPCA 2YR3A 2J8HA 2DM4A 4NRZB 4HG4J 1CQYA 3CZFB 1G9NH 1KUMA 2P5EB 1UADC 4NKOA 5ICXA 4YBLB 2EZ0D 3HI6H 3HTLX 43CAB 2ADFH 3SDCC 5EBWA 3CU1A 4U6YA 4XPAH 5F7MC 2AV7B 5GZOD 3HE7A 1UM5H 5DFTA 1FL3B 5EU6A 4KAQH 4KQ4L 5KS9A 3H9SA 1QKZH 4KJQC 1QZ1A 1KJVA 1SEBB 1M05A 3CLEL 3ZL4H 3RVXD 1ZLWH 3KLSA 1GGTA 1VEMA 2W0FA 4UILH 1LK3L 2WINA 2P7TB 3PGFH 5IR1A 1JZ3A 2AEPL 2B4CL 4LPWA 3O2WH 3NH7L 3VW3H 1K8IB 4MXWH 2AEWA 5EBLB 1ZHKB 2VERN 5I1AA 4WW2C 4S1RH 3ZDZF 4HJ0D 1CI5A 3U7YH 4OKVB 4NQUA 4Q6IA 2YHGA 2MHAB 4JRYB 1E6OH 5CS7A 4JKPH 2BZDA 3V4PH 3DVNB 2H26A 4HIJA 3V8OA 5I1HH 1NCNA 3STBA 3LH2L 32C2B 5DZNA 4ZSOE 5C0FB 2ZUQC 2P8PB 4KJPC 3X3FH 1V7MH 1QUNA 4H26A 3MV8E 4ZFOB 4Q9RH 5CJQL 3MV11 5TQ2L 1JPFA 5BOZG 4X4YA 3U9PH 2HP4A 1FG2B 4YHPA 1OGAA 1I7RB 3L3JA 2V5YA 4QYOB 3DXAD 2X44D 3O6KH 1IAOB 3VH8B 1FNSL 1MWAL 5JW5B 2ILLA 1NBZA 1SBSL 1TLKA 3DBXB 5ILTH 3C6SB 1CXIA 3F58H 3UDWC 2V9RA 5J57B 4XX1E 4DKFL 4PRHE 4PJDB 1Q9OB 5C0CE 3VFOB 1DBAH 5GIRB 1AKJA 2AJ3B 1E4KA 5E8NB 1RZKL 3WHE0 2CGRL 3FQNA 1AE6H 3N85L 4P2RD 5IVOA 1UM6H 4EN3A 1T0PB 4FQPA 4M7JH 3VXMA 2OZ4A 4MXQC 2XZCL 1AGCB 1L7IL 3Q3GB 2Z35A 4H88H 4MWFB 1ITBB 4OLZH 2E7HA 4JFHD 4V1DB 3A67L 4EEEA 4XH2B 1JFQH 3AS1A 5IBTL 4G9FD 1SVZA 4YR6A 3SDAA 4Y5VA 1OPGH 5LG1A 4D9RE 1EEYB 2VIRB 5GRJL 4GQPH 1CDHA 1N0LA 4JY4B 5CAYB 3ULUF 5KVFH 3EGSB 1DBKH 3I84A 2W9DH 2JB6B 2VXQL 4RGNC 3VFPB 1P7QA 3MZGB 2C4FT 1N8ZA 4LGSB 5CCKH 2BRRL 4XC1H 3OJDB 1DN2A 5AZEL 1INQB 2NZIA 3BIAX 2I27N 4CN4A 4UMGA 2BNQD 4HGKC 1YEIH 4Z76A 3P40A 4X4ZA 5CEYA 4LPYA 3H3PL 12E8H 4WW2B 1HNGA 4YFLF 2XZAL 4TUJA 4M5ZL 3S3PA 1A3RH 1KG0B 3RTQA 3OR6A 3K1KC 5CILL 1MJJA 1A2YA 1OTSD 2YUWA 5CJ8A 4FABL 3BYYA 4GQ9H 5J13B 5KSBE 1AR1D 2Z31C 2ZUQB 1KBGH 2VDKH 3EJZD 4OCLC 4LSSH 5TGBA 3K4AA 2F8VA 3CCHB 1HKLL 1BVZA 3ARYA 5IEKB 4HKZB 4Z0BH 3NCCB 3I6KA 1S9YB 4JR9H 3DNKA 4GXVH 2R1YB 3WFHB 2WP3T 4M02A 1MCNA 3O9WB 4N0YH 4UNTA 2VUYA 3LEXB 3ZTJG 1CFSB 3QUYB 1MF2L 5K59F 3VD9A 3G04B 1UVQA 1HIML 1Q0XL 2DOCA 5DF0A 3WJLC 3MX0A 1I7ZA 1MUJA 4QNPE 1G6RH 1T03L 3MRFB 4X6FB 4UINL 2W38A 4JPVH 3IF1A 4U1MA 4L9DA 3IYLW 3RZCA 1HHHB 2C3HA 2LAGB 3MV9E 4PJGB 4Z9KB 4LVOC 1OTUC 1H3UA 3ORJA 1VEPA 4U1IB 1XZ0A 3WMSA 2D9QB 1LVEA 2FO4A 5D7IE 1XF1A 4GRWE 2DLGA 3CH8A 1MCIA 4PP2A 1OHQA 5T1KA 1S5HA 1ZKAA 3NACH 2V2WA 2YRZA 1K4CA 3V0WL 4APQD 2FATL 4JCMA 1R3KA 1G0YR 3VXUE 5D6DA 5F7LB 4GSDH 4S2SA 4LGRB 1CTNA 1MRDL 3BQUA 4OV5B 2GY7B 4Y4KD 3RWGA 2XG5A 5DJ6A 35C8L 4KVCL 3GRWA 1S7XA 4C83A 5T33H 4IDJL 1N3NB 1F3RB 4QXUL 5CGYC 2IC2A 4WDIA 5EPMB 2XZZA 4RGNB 2SEBB 1OSZA 4W6WB 3SHSA 5E8OB 5IW1B 2LTQC 1PG7L 4ELMF 5EO0A 3LY6A 4ALAL 5E4IA 3TH2T 3WD5H 3PWPA 5AYUL 2APWA 1UCBL 5K93A 5GGRY 3KR3H 4JM2F 3GMOB 1QSED 4ZQKB 1XIWA 5DUML 5BCAA 4XMPL 5IHLB 1A1OA 3PWVB 4OTXH 1FNHA 1FE8H 2CIIB 4PJCB 4P5KB 1WFNA 1DVFD 3D48R 4EDWH 4MJIE 2MMXA 1ONQA 4IIQC 3PDOA 4DFHA 1JNLL 1T3FA 2Z31B 4LCYB 4PIRF 3HRPA 3BEVB 5DMKA 2BX5A 4M1GH 3VFNB 2X2YA 2VH5H 4FG6D 4RWYH 4N8VA 2F53B 3TN0B 3RWDB 1KJ2A 1RZ8A 3E3QE 2G5RA 3UO1L 1G6RB 3O2VH 1T1XB 2ESVA 1AY1L 4DQOH 5ADPH 4JHZA 5FCUL 2M2DA 3BWAA 4OCSL 4LCWA 3FO9A 4MNGA 5GISH 4WI6A 3CVIL 2YEZB 2A9MH 3OMZA 3HE7C 1J1OL 4LARL 5EN2A 4ZFGH 1JYVA 2HMIC 4PJAB 1JF1A 1ZEAH 1T2QH 4KROD 4MAUL 3U7AA 2YA2A 3AROA 1FZOA 1E4WL 1G7QB 4UUJA 5A3ID 5LQBH 4RFOL 1UWXK 3HNVL 3QP3A 3DIFB 5JHDA 1KELH 3OPZL 1BF8A 2JTDA 1EEZA 4U49A 3CFCH 4JFYA 4Q6IC 3ULVC 3T2OA 5C1MB 3MGAA 2ICWJ 4LLDA 1GGYA 1DQML 2FHFA 3VXTB 3MLSL 4E9LA 3DRQB 3V4VL 3FCTA 4NUGL 3N1QC 3K46A 4QTHB 3LPGA 3ULVH 5DDHA 2XN9E 5J1TC 1D5MB 1NGYA 1CS6A 4CDGC 1WIUA 2JKXA 3MACL 1EJ6A 3EYVA 4NT6A 4KI5D 2VL5B 5EULV 5MEOA 5T3XD 2BDNL 3HMXL 2X09A 5EU5A 4OLVH 2UYLA 4HIEB 3FB6A 1C12A 4AY0A 1KN4H 3MO1B 2OQJB 4QRRD 2ADIA 1IEAB 3NCMA 1BVLB 4AMKH 5B38B 3EYOA 4Y88A 3TBVA 3VFTA 2M26A 4XP5L 4EIGB 4ODHL 1YMHB 4EN3C 5KVDH 4LU5L 4WUUE 2W0PA 1E0OB 1BP3B 2DQTL 4JY6A 1YEFH 4UTAL 1Q9WA 1T04A 4K7PL 2OZ4H 3DVFA 5F9AC 2AAVA 4HWZA 2LAAA 3NIFF 1PFCA 3V5HB 3SDAC 4Y5VC 2CUMA 2X4TA 2BVOA 1M7DB 3P0GB 1C5BL 2A73A 1X5AA 3HE7B 1F02I 4YAQA 5EU6B 5KS9B 5B21A 3H9SB 1C08A 1M05B 1YNLH 1JHLH 4ZUVA 1DDHA 3MYJA 3BPLC 3N50A 5DEGA 4LLQA 3OB0K 4X9IA 1NGQH 4XNMA 2W0FB 3KPNA 5DTFB 2X6MA 4JFFA 4P2OD 4Z77A 3F62A 2K7QA 3GNMH 1O7SA 5B4MC 5I1AB 2NLJA 5D2NE 2AEIT 3MOAH 3QHFH 2QADD 1U8QA 3RTQC 3EYQC 5ITBH 3DECA 4NN7C 5IM7B 4XP1H 4LVHC 1BOGB 4KXZH 5FYLD 4BK4A 1H5BA 4HIJB 2ICWI 2R8SL 3GM8A 4U6HA 4MD4A 3U46A 5ABDE 5GRZA 2J3SA 4H26B 3UEZA 1Q0YH 1ERNA 1NMBL 4MD0B 4PY8I 1JPFB 1UGNA 3HC0B 3LKRA 4X7EC 5DJAB 4ZUTA 4UDUA 1E4XH 4LGPB 1FGVH 4QHMA 3QDJD 2IH1B 3MV7E 2JE8A 4YHKH 1VDGA 4P5TA 1XH3B 2P45B 5HHOA 1NBZB 4J6RH 4N5ED 4HULB 4LLVA 3MJ6A 4PJ5E 4Q9CA 1WWBX 4LCIL 1TETH 1AKJB 2A6IB 5DI8B 4QHLB 3RZCC 3U2SA 2VLLB 3FQNB 2C7UA 4ODSL 3WSQL 4X7TB 3QEGH 5EORH 3SJVA 1OM3L 5CHNA 5D70H 2CUIA 4EN3B 1HDMA 3VXMB 3QJHA 4YDIL 4AENA 1DBJH 3DLQR 1LO0H 3T0BA 3JUZA 4HW6A 5L6YH 1W0WA 2QQKL 5T5FH 5L2KA 1TZIA 4P9HL 2CDGB 5D6DC 4QRPA 5C0JB 2ATKA 2EYTA 2JJSA 4DCQB 3QFJB 1A7PH 3BQUC 1UB6A 5I1LB 4PJXF 4YGAB 4LHUD 4XX1G 4FQIH 4MS8C 4Y5VB 3SDAB 1YMME 4NKDA 4F9PA 2XKSA 5GS2H 5HYSG 1P84K 4JLRB 5I0DA 3TT3L 3FOLB 4XP6L 5D7SL 3CX5J 3ZE0F 1P7QB 1FGNL 4KUZL 3DVIA 4IRSA 5C08D 5KJRL 3BPLB 3GRWH 2IBGA 3T09A 1HQ4A 1OOAA 3P73A 4Z76B 5IF0B 1XIWC 4R97C 5CEYB 5CMAB 4RGOH 3BGFC 2RGSA 4WHYG 1BFVL 4TSAL 3CFIC 3RTQB 4ZTOH 1UM5L 2XRAL 4JN2B 4KAQL 4NN7B 3UXFA 1MJJB 3ILQD 1A2YB 3S34L 2B0SL 4GG6F 1NGZA 5IJVB 4X7FC 5FECA 4JG0L 4NUJB 1KCSL 3IXTA 3WJJA 3QEQA 4G3YH 1FZMA 4I5BA 4JFPA 5TGBB 4PP1C 3R8QA 2IWGA 2QR0A 1ZGLA 1NEZG 1KPVB 5ID0A 3ME0A 4WFGD 5GGQL 1PG7X 5IQ9A 4JFZL 3C9NA 1PEZA 2BSED 1FORL 5C07E 2X4RA 1UVQB 4X9GA 5BZDA 3BFOA 1OP5K 3MRGA 4KGLA 1KJ2H 3HUJA 3X3FL 3KS0H 1QRNE 4PD4J 3MCLL 5IB2B 4YLQT 43C9A 1CD8A 5DJDB 3L3HA 2X1WL 4E41D 2B5IC 3IF1B 4U1MB 3RWCA 2EDKA 1Z0NA 2LV4A 5I30L 3O4OC 3HE6A 4X7SH 1YN7A 2FO4B 4PP2B 1S5HB 4NZRH 2V2WB 5I1GH 1A9BA 1JK8B 3BP4A 4UNVA 1B0GA 2Q8BH 3CJJA 4NFDA 4H20L 4P2RA 1IGMH 2VXSH 2DIJA 4S2SB 1MEXH 3BQUB 2CD0A 4G8FA 1DN0B 4WY7L 5KW9H 3RWGB 5JW4N 5DJ6B 5E70A 3U36A 5T3ZE 2YC1B 4ODVH 1VFBA 4C83B 1HK6A 1T7YA 4NSKA 5HHQA 3C08L 3X3GL 3LMJL 3JWDL 3MJ8A 4WDIB 5HDOA 3VFGL 1JGUL 5EO0B 5SWSD 1E6JL 4DGIL 3IDJA 5DJ0A 1Q8MA 5DT1H 2JCCE 1JFQL 3PWPB 3U6RB 3QXUA 3RUGE 1E27B 1M71A 4NKQB 3LKSA 1A1OB 1QSZA 5TF1H 2EDLA 2YD6A 1U8HA 2GJZB 4J7RA 1FDLL 2UVFA 2G60H 3D85B 5IB3A 4LP4A 2DLTA 3O81A 4U1KA 1BGXL 5FDWA 1B0RA 1A7RH 4RAHA 1T3FB 1JV5A 1HILB 1QSFA 5CZKA 4N8VB 2PYED 2BVTA 1YEKH 4OI7A 1KJ2B 1RZ8B 4UOW0 2AXGA 3LHPH 5DVNA 4I18B 3CDYA 5CZVL 4LCWB 3FO9B 4MNGB 5CEZL 1F90L 3PP3K 3V52H 2NR6D 1TNMA 1JF1B 2X1OA 4PRPB 5IVXF 1YUHB 5HDLA 4QY8B 1YNKH 2ZZUT 1FFPA 3FRUB 4X98A 2ED8A 4UUJB 5I18H 3D87B 1J0KA 1IGFH 4OCYL 3GJEA 5SV3A 5JHDB 3SE9H 4K23H 1KCKA 1EEZB 1NLBL 2OTWA 5IROA 1RI8A 4OGYL 1IEBB 2XXMB 4KH2A 4POZC 1LO3H 5JIPA 3RX8A 1H5BC 3LKPB 3ZKND 5TE4H 3FCTB 3X13A 5D72H 3INUH 3F5WA 4UQ2A 3T0XA 1JNJA 1T22A 1NGYB 2YPLE 2H8PB 4FFYH 3H3KA 2ARWA 4KJYB 4M6OL 5DO2D 1T2JA 1OQXA 3UTQA 4MMXC 3CMOL 1AO7E 4Y4KA 1JTOA 2FDBP 4KPHH 3Q1SH 2HT4C 5EU5B 4D0DA 1NFKA 3FB6B 2X4QA 5ANMB 4P5TC 3FAXA 2HFGH 3JWNC 1ITCA 4IMLA 5ENWB 1OTTD 4IM8A 2VAAA 4KFZC 25C8L 1X4YA 2ADIB 2FSEA 2ZCKL 2WUCL 3K2UH 1MHPH 3VFTB 4BA8A 5BMFH 1DSFH 3UJIH 2E8YA 3MLZL 1EK3A 4YE4L 4PYGA 4XTRC 4ZYKA 1A7QH 1HZHL 2MCPL 2J6EL 4WEMB 1DLHB 4NDMA 1FRGH 1S9VA 4WFEE 4PPTA 1AQKH 4JY6B 5E00A 4D9QE 4NKIH 4YPJA 4R4BA 3ZSTA 4NO5A 1Q9WB 1T04B 4YDKL 4NZUH 1DVFA 1FNGB 2JJSC 2X4PB 1U8NA 3RL2A 4LAQH 1R24A 5I2IA 1MLCA 1GHFH 1MFCL 5E8EB 3F6IA 3TBYA 4O2CA 3UZQA 4F9PC 3NCBB 4C4KO 3EZ8A 3D9AH 2OJZH 3BPOC 1WBZA 4YAQB 1JNNH 2EXWC 3RY4A 5E9DE 1C08B 3QXTA 3KPLA 1FV1A 3VXRE 4PJBB 2HVJB 4ZUVB 2HLFD 2HJKA 4IRSC 3MYJB 4Q6YA 5DEGB 2D4FA 4LLQB 1IRAY 3SDXE 4G6FB 2NX5E 5ETUB 5GZOC 3KPNB 2AJYL 3C87A 4OT1L 5EIIB 2YRLA 1MCFA 1IAII 5F93C 5BW7A 1DLFH 1IQDA 1U8QB 1WTGT 3MRMB 5LGJA 4E5XA 1JGDA 3QWRA 3RVXC 5EUOF 5LXGL 2ZUXA 4CADA 1JBJA 1WCBB 3HR6A 1MCOH 5KSAD 3T0EB 4RFEA 1H5BB 4FN0A 4QOKD 1OP3H 4U6HB 4HJ0C 2XFXA 4MD4B 2R0KH 3WJJC 1RJYA 3MLUH 2YD7A 4JB9L 5KVEH 3FRPA 4NZTL 4FNLL 4ZUTB 1A6AB 4PGDA 3ARTA 1S7VA 4UT9L 3KDMB 2BJMH 4I3RH 4HSQA 3FT3A 4YZFE 1KC5H 2ADGB 5FUOL 3D39A 4B53A 5HHOB 3SE8H 4PBWD 1S7WB 1KFAL 3P77B 4IMKA 3TH4T 1CVRA 4X6CA 3ROLA 3JTSA 3SQOL 3HG1E 4KDVA 3IDIA 3W0WA 1F58H 4WENB 4IS6B 1OAKH 5FUZH 4B7LA 3DROB 5CZXC 2D2OA 3HAEG 4LSTL 1PG7W 2P24A 3HE6C 4PV8A 2C7UB 4P4RA 3QXWA 2QEJA 4NBZB 4Z7VA 5FKPB 4KDWA 1FBIH 1FLTX 5C6TL 5E24E 4ODTH 4QRRA 2FX7H 5C71A 1G0XA 3P4NB 5GGSB 3MV8D 4EDXB 1UG9A 3NZHH 4P4KD 1IC5L 5D6CA 2ATKB 4GS7C 3T8XB 3HMWH 2P5WD 3G08B 1QEWB 4O51A 5J9PA 1U0QA 1Z2KA 4NKDB 3D69A 4EI5A 4X0KA 3PGCB 4XNYL 3BPOB 5C0CD 1J8HD 1UYWL 1XCTB 4GFTB 4JM4L 3MMEB 1OD9A 4OQ1A 1MRFL 5I1KH 5JOFA 5IW6A 4RAVA 5LGHL 4TNVF 3BZ4B 2O5ZL 4NNYB 1JJUA 1HQ4B 5TE7H 1PX3A 3HI5H 2DQCL 4O58H 2ITCB 2MPAH 3MROA 3P73B 5F96H 4E0RA 3I02B 4MQTB 1I8IB 1PKQA 2VQ1A 4YHML 1NFDF 4KY1L 3KVQA 4MGXA 1JUFB 2E7BA 2GTZB 4P2OA 4WI3A 5D71L 1U3HD 3ZDXE 5A1AA 4IRZL 2W1NA 5I1CH 2WLYA 1NGZB 1QYGL 4OF8A 1KEML 5FECB 1HXYA 1Z9SA 1HH9A 5F88A 3BJLA 3IXTB 4HHAB 2EDRA 2FEDC 4MZ3A 3ZDYE 1FZMB 4I5BB 4JFPB 3IS1X 2UV3A 3QNZA 5SV4A 4M00A 2QR0B 3FONA 1PJ9A 5K33A 1OT1A 1WAAA 5ITBL 1H8NA 3C9NB 4YHIA 1N6VA 2XY2A 3HB3C 3EJZC 1JYWA 5HGDA 2X4RB 2BERA 3QYCA 5BZDB 4HAFA 1NSNL 3B2VL 2CMRH 4PJEE 1A7NH 4XWOD 4Z95H 1U9KA 4K94C 2Q86A 2R69L 2V6HA 3HUJB 2A1WH 5SX4H 3BP5B 3L3HB 2GFBB 3DXAB 3RWCB 2CR3A 3AXLB 3L3OA 2CLZA 1TNNA 1FYHB 1JZ2A 2Z9TA 1WEJH 1HHIB 3ALPA 5DS8A 3TV3L 4K94H 4YJZL 4XXCA 3WXVH 4JM2D 2GJ6E 2N4IA 1RIHH 3FFCE 4LEOA 3BP4B 3W82A 5DVLA 5I73C 4NM8H 5IROC 4XT1C 2WM0A 4P2RB 4OIBA 1KIQA 5DXWA 1AQDB 4BSVB 1D5ZB 4POYA 3NN8A 3EHBD 4L4TE 3PWNA 3ES6A 4G8FB 2ZCHH 4JQIL 5DMIL 4ERSH 4JRWA 4NQEE 3IS0X 4F15C 3KPRE 4JY5H 2VR5A 5F97E 3H9HA 3NGBC 4NSKB 1Z9MA 1C7SA 2L7JA 3GI8L 3MJ8B 4LHUA 3SGEI 4G42B 4G9FB 4Y4KC 4D9LL 1KF9B 2GSGA 3O3DA 1GH7A 1NAKH 3VGGA 2D7OA 3KPMB 3OG4B 4NC1C 5IB1A 2PTUA 4M7KH 5JXED 1JVKA 4RMWA 3P30H 3AU1B 1M7XA 4KHTH 4M61A 4NBXB 3AM8A 3TYGH 3NAAH 3LKSB 1M7IB 5C08A 4PJDF 3LPFA 3C8KB 1ZT4B 1HWGB 3EKCA 2F54D 3VXUD 4GMSL 1ZGLP 2YUVA 5EO1A 2VLRD 2ZJSL 2BNQB 5FB8B 1NL0L 4JANA 2DMCA 5IB3B 1G7JA 5HHNB 4U1KB 1P84J 5FDWB 1KTDA 4U6VL 1EXUA 4W4NA 1FL5A 3ULUE 3LZFH 3MLVL 5DQDL 5DD1H 1DVFC 2FR4A 4KMQA 3MRHA 1MFEH 2MQ3A 4JZJA 4PJIB 4OZIA 5GJTL 3EOAA 3IFPA 5EU7C 5I17B 2UWEA 3K4ZA 3MCKA 5HI5C 1CGWA 4Z7UA 1P4BH 4UBDD 5JORA 4ZD3H 1KJMA 2YWYA 3DGGA 1CDUA 5BRZE 4YEFA 5E4EC 1J0YA 4Y4FD 2IFGA 4X98B 4EOWL 3ZYJA 2Y06H 5MEND 2X4SA 4BJLA 3G5VA 3GJEB 3IRZA 3IAPA 1H3PH 1U3YA 1UH4A 2C1OA 1CN4A 1NCCH 4PRAB 4Z7QF 1EEUA 4E41A 1EGJL 1LMKA 5BW7C 1I85A 1W0YT 3MRLB 4WW2F 5I73B 3NFPB 2OTWB 1O0VA 3C60D 5TFSL 3OKMA 3WNLA 2CO6B 4UQ3A 3VE0A 3VWJA 4WJ5A 5B39B 1J1XL 4RDQF 1ZLSL 3T1FA 2OK0L 3SKMA 3X13B 4C59B 4APQB 5J0BA 3F5WB 2B20A 3RVTC 4F15B 3QAZB 3PWUA 2NY4C 3U4BL 2NYYC 3LIZH 1NLDL 1BQUA 1LO5B 2FL5A 5T1LD 4DKDC 1KCUH 2Q8BL 3UTQB 4Y4KB 4KZDL 4HMDA 2FB4H 2VXSL 2ZKHH 4C56E 2RCSH 4LASL 4TYUA 5IMOA 2X4QB 4YWGH 3E6HA 1NAML 5DEZA 3RI5F 2MQ0A 4IMKC 1H0DA 3QXDA 4IMLB 4KI5C 3RGHA 1S8DB 3LQAL 2DYPA 3BAEH 2FSEB 4OZGF 4KV5E 3H9ZA 3ZKQD 4HLZG 2G9HA 4NN5C 4XPFL 1U8KA 2YD3A 4O2FB 4PJGF 1QSEB 4LP5A 4JFEA 3VCLA 1RZGA 5T3XH 4Y7MA 3H42L 3MFFA 5E00B 3VMPA 1OAYL 2XTJD 4N8CH 4D8PA 1BJ1H 1DVFB 3DTXA 1RIUL 1Q9LA 1WBYB 2HN7A 1U8NB 3RL2B 4OFVA 3C5JA 5F7DB 2ZOKA 4OCNC 4O2CB 4PGCB 2BSRA 5DFWH 3TBYB 4EQ3A 2BMKA 2IMMA 3S37L 1W2KT 3GO1L 2DQEH 4LK4A 4XAKE 3TWCH 4EI5C 3EYFB 3GIVA 4RIRA 2ZUWA 1WBZB 3BPNC 4QRQB 1FLRH 4GW1A 4KK5C 3KPLB 2HG5B 3OHXA 1BM3H 2HJKB 1BREA 1JHKH 5E4EB 4ODUA 5IJKA 4G5ZL 3U4EA 3V6ZA 3ZKSD 1KJ3L 3U0PA 1ZLUH 5D1QD 3VXSD 2AK4A 5DURD 1RV6X 1JPGA 5ITFA 1SM3L 4WUUD 4TSBH 2I26N 1IAKA 4KROB 1RHFA 1IQDB 3NPSC 2EYRA 4A6YH 3BIBX 3TIDA 3VDAA 3UJTH 4ZTPH 3DV6A 3FFDA 4BFBD 4P2OC 3HS0A 3LEYL 4HIXH 5IBLC 1JP5A 5EC1A 1RZFL 1I9JL 1U8PA 4GJTB 2QADC 2XFXB 2DF3A 5F9JB 1EUTA 5ESQA 1CL7H 5DUBA 3V9FA 1ND0A 3TESA 1SEQL 1X5FA 3OKYA 5J6HA 4FXGA 5DJYA 1GPOH 3DMMA 1L0QA 2XWBA 1WF5A 2VO5A 1G9ML 3BO8A 1FN4A 4G6MH 2XZQH 4ELKA 3FT3B 1HI6B 3D39B 5FYLH 3MYZA 3O3UN 1KPRA 4KRLB 4LSUH 1BLNA 3JTSB 5I1IH 3BRDA 2HRLA 1NMAH 3BN9D 3LSOA 3RDTD 2YMXH 5C9JB 3K0WA 3LS4L 5F9WC 4N1CA 2JJWA 4NN5B 1IM9D 3GBNL 4P4RB 7FABL 4XXCC 4OCWL 1BBDL 1Q9KB 4CVWA 4QRRB 1UJ3A 3TCXA 4FQXD 4HDIA 5DSCB 4NO3A 2C4XA 1UZ6F 3JWOL 5GS0D 2AJUL 3EAKA 3RNKA 3OTTA 1LGVA 4XCFH 2GAZB 3SKOB 3TM6A 3G6DL 3W9DA 5HYJE 3D0LA 3FN3A 3QHZH 4IRJD 4DN3H 4Z7OF 3PUCA 1MHPL 2FHCA 3F7VB 4LRNL 4JPKH 3CDFA 4U1GC 3AC0A 3D69B 1QBLL 4LLMA 4WI7A 2EH8H 4X0KB 3BPNB 5TQ0L 3RJQB 1IAIL 1EJOH 1MJUH 4NZUL 4RAVB 4A6YB 5IW6B 2AABL 1YPZE 2Q3ZA 1R3IL 1LP9E 1EERB 3VXQA 2OM5A 4WCYH 3QQ9D 3GKWL 3AM8C 1DR9A 1BQLH 1J5OH 3ZE1E 4M6ML 4HH8A 1ZOXA 3C6LD 3DYPA 3QQNA 5FXCH 2XA8H 1FO0L 4JRXE 1PEWA 4JREB 1VADA 4E42A 1MPAH 5GGVL 4W6XB 4P2OB 2B1HL 2Q87A 2BNRE 4ZS6D 5ACZB 1YN6A 4D3CL 3CXDH 1RVFL 2QADB 2DKSA 1QFOA 5F88B 1F97A 4DWHA 5JA9A 2GITA 4AT6A 5KTEL 8FABA 3QNZB 4PJ9D 1EBPA 1U92A 1RK0B 4TN9A 3FONB 4JZJC 3E6FA 4QOKA 2FD6H 5HI3D 2UZIL 4YHIB 2EKJA 5HGDB 2DQDH 3P9MA 2EE6A 2WAHA 4JDZA 3ESVF 1YECH 5FYJE 2ZPKL 5E1HB 5C0GB 4NN6C 5JIKA 1FL6A 4BZ1H 1DQDH 3CSPA 4U0QB 1INEH 4OLYH 2Q86B 3CX2A 1AR2A 5KS9F 4KMLB 3P0VL 4XCCL 3C5ZD 2WWKT 3VH8G 4WU5B 2CLZB 3L3OB 1X5YA 1YYLL 3RJDA 4OCRH 4EBQH 5DS8B 2A83A 3WIHA 1KNOB 2NZ9C 4X99A 1I85C 2N56A 4LMQE 4FQ2H 4LEOB 1SQ2N 4M9OA 5HDBE 1UWEL 4S0SD 4YUEH 3RWFA 3ILPA 4U31A 3E1F1 4L3CB 1GZPA 1CGVA 4JHBA 3ULVF 3ZTJH 1KIQB 2VLKE 3VWJC 3MBEA 5D9SA 4ZS7H 5EOTA 4ZSOA 3NN8B 3VGBA 3QRFM 4X9HA 2C9AA 3PWNB 3ES6B 3RNQB 4LCCA 3MV8A 1U8IA 2C3VA 4FTVE 1FP5A 4P4KA 5ICYB 4ODTL 3HZKB 1QRND 3IJHA 4LHUB 3OXSA 5TPWL 1Y0LA 1BJ8A 3QZWG 4LEXL 3O3DB 3M1BA 5FAAA 2E7CA 1CICA 5GRXG 5IB1B 4OGXL 4U1SB 4Y5YB 5C0CA 1WGOA 1J8HA 4XNUH 4AQ1B 4UI2A 5EOCH 5H35A 4Q0XH 5C08B 3RAJL 1RD6A 1Y6NR 4JEGB 5D7LD 5EO1B 3D0VA 5DJ8A 1DFBL 3QG7L 4JANB 1B4JH 3L3DB 1G7JB 3UCRA 2IPTL 4ZDHB 2W91A 5CJXA 1D5IH 1FL5B 2MPAL 4RDQG 3V0VA 1KN2L 5F96L 3DYMA 4M7LL 3EYUL 3O11A 2IFFL 1AGDA 4XVJL 4OZIB 1EAPA 5F9OL 1I1AA 5E2TH 4I9WE 2EC9U 5BV7C 4M6NH 1CDGA 4QRTA 1YA5A 2UWEB 5FYKH 3MRKA 4FQCH 4Z7UB 3PJSB 4J4PA 4FFVC 1G9EA 4NN6B 1KV3A 5JORB 3QWOA 2COQA 1V3JA 1D6VH 3DGGB 3JV6A 4MDJA 3CFKB 1DBBH 5BV7H 1MCBA 4FZ8H 2IBBA 4G6KL 1TMCB 4WEBL 4M62H 4WO4D 5IJKC 1G0DA 1A3LL 3GHBH 3WFDL 3RWIB 2NR6C 3ARWA 1AD9A 4M1DH 4TULH 4F58L 2X4SB 3G5VB 3J7HA 4TUKL 3KJ4B 1KPUA 4M5YH 3VFRA 4E41B 5EA0H 1P5UA 2A6JB 3DSFL 3GEWB 2ID5A 1X5XA 4LLWB 5GJSH 3UBXG 1HHJA 3OKMB 1R5VA 5KN5A 4UQ3B 3VE0B 3OQ3B 4WJ5B 4GRLD 3QUXA 3T1FB 1HINH 1OP9A 4PJ8A 3T3ME 4NZJA 2IBZY 2W9EH 3S37X 2A74A 1WEJL 5I8CA 1FCGA 1SJEB 3PWUB 5IQ7L 1RIHL 3DMMC 2VE6A 4Z8FL 1PYWA 4K3GA 3VI3E 3CFDA 4UTBH 1IFHH 5IMOB 2ICES 3E6HB 4N1EA 4HFUH 1AXSA 1F4XL 4KVNL 4IEFB 3LN5A 1H0DB 4KK6D 2Z8SA 3Q5OA 2PXYD 1NGPH 4HBCL 1IAMA 2A77L 2FIKA 2HKHH 1YEDB 2CJUL 2G9HB 5D7IA 3F7RA 1JYNA 1T1YB 1QA9B 1OTTC 2IAMA 3MLYL 4JFEB 3ZHKA 4LLAA 1RZGB 2IANE 4NWTH 1UJ3C 2HKFL 2EECA 1KLGA 4LQ1A 3VXUA 1P53A 5BVPH 9CGTA 2VLRA 3NAAL 4D8PB 1MLBA 5IG7A 4S0TD 5D8JH 5ALBL 4PJHA 3C5JB 1UKSA 2VYRE 3BN3B 2IGFL 3BD3A 3LV3A 4HV8B 5BV7B 2BSRB 3MRPA 1CBVH 1RZIB 3NFSH 2GY5A 3IFLL 2JIXD 4JE4B 4WGVB 4KK8D 2M8XA 2PYEB 3GIVB 4RIRB 4X4XA 5B3JF 2VQTA 5AZ2H 1NKRA 1ZWIA 5E5MA 1S5IH 2J4WL 4KTDL 4QWWC 4YQXL 1XGPA 4HXAH 2NY3C 4ZNCD 5JUEL 5K9JL 3U4EB 4TQEH 3V6ZB 4RMVA 4N8PA 1IARB 4PYHA 5DRNA 3HZVA 3CC5A 5ITFB 1IAKB 2EYRB 2D3VA 4KKCC 4Y4FA 5HPMA 1I9RL 1YZZA 4ZD3L 2OP4L 3MLRH 1YEJH 4BH7B 3MBXH 5JQ6H 3FFDB 4AEFA 3HS0B 4S1QH 4EI6A 5MENA 4MJIA 4R0LA 4R4ND 1TZGH 2PTTA 5GGSY 3ZE2F 4HJJH 1IGIL 3P4OA 4AL8L 4AIZA 1ULVA 1J0ZA 1J87A 1I9IH 5ESQB 5DUBB 1ND0B 1MFDL 4P46D 5JW3L 3H0TA 4GKNB 2R0WH 4HWBA 3SKJL 2EYSB 3LCYA 4JZOB 1EZVX 4CU8A 5J6HB 1ZHLB 3V6FB 1HSAA 3DMMB 1MOEA 5E9DD 4Y4HD 3IB4A 4HZAA 1H3TA 5ISZE 5INCB 5ADOL 3X12B 1N5YL 3BPCA 2AXHA 1KXVC 4GH7B 1IMHC 1KPRB 4FXLA 4YPGB 3LSOB 1NCDH 5CD3B 5IMLA 4H8WC 1CYGA 3G5XA 1AP2A 1OAUL 3QEUA 2LVEA 3VI4F 2NY6D 1MI5E 1BOYA 3IU3B 3X11B 5JR1H 5EC2B 4JAMA 1ZSDA 1MAMH 2DQIH 1UJ3B 4WV1A 2Z8RA 4H8WH 1LILA 2V5TA 2VB5A 3RNKB 4DVRL 4JZNA 3W9DB 4R8WL 3MBEC 3WIHH 2PF6A 3THMH 2IPKA 4LCCC 2XN9A 3TF7C 4CN1A 4MX7A 4P4KC 2YBRB 3HG1D 3HI1B 3B5TA 4K3JL 1PZUB 3U0WL 4O4YH 4YXLH 3MRJB 3MRDA 2NY3B 1CICC 1MCEA 3ZSSA 3PWJA 3SE3A 1VGEL 3MJ9A 4MAYD 4WW1A 3GIZH 3VGHA 5DD0H 4NFBA 4WUKL 3VXQB 3W11C 3S3JA 3NCFB 1MFBH 3SKUD 5ICZA 5MEPA 2DQEL 2DQJL 4NNPH 3TWCL 2ZNXA 4X83A 4U7MA 2V2TB 3BW9A 1G7HA 1NCWL 4QT5A 1YN6B 4AZ8A 2E3VA 3KYKL 3KPQB 3ZKXB 2F19H 4WUUA 2VDOL 1I3RB 5DC0A 4P9MH 3VGDA 4S10A 5CJXC 3I3DA 5SWZD 1NMCB 1A47A 1I4FB 4LAJH 4AT6B 4FFWD 1DEEB 4YFLI 1I1FA 1MHEA 5KSAB 1MCHA 2RHEA 4A6YL 4J8RA 5DWUL 5TE6L 1ZVHA 4QOKB 3WLWD 1I1AC 5D5ME 3BD5A 4JRYD 2X10A 3FOMB 1Z5LB 4NGHH 5DD5H 3KPOA 1GOFA 3P9MB 4XVTL 3EOBB 3VXNA 4WI2A 4J4PC 2EO1A 4XCYB 2P47B 4WHYH 2JB5L 3KYNB 3DO7B 1FL6B 2XTLA 1PSKH 2AEQL 1LDPH 2WLZA 4JFOA 1ZA3A 1DL7H 4QXGL 2PKDA 5EUOE 3EBAA 1SY6H 4W70A 4ESKA 4BZ2H 1GPOL 3MLXL 4DZ8A 4HF5H 1MELA 2VDQH 1GRWA 1RZJC 1SJHA 5DVOA 2AW2A 4XCNA 4BZYA 5D2NA 5L8JB 4G80A 3P3YA 5DJ2B 4J2XA 3RDTA 2YN3A 4DEPC 4XWGL 3QDGD 3RWFB 3ILPB 4OZHE 3SOBH 3R4DA 5F71A 1RZJH 5I1IL 1IM9A 2HTKD 1GZPB 4XPHH 2CUHA 1WFOA 4ZSOB 3PV6A 4PJ8C 3HAEA 4I77H 4FQXA 3MV8B 4AIXA 1LE9A 4HX1A 3UJJH 2C3VB 5IHUL 3S96A 3GK8L 1ORSA 4P4KB 1KYOK 2P5WB 2OX5A 4D0CA 3PABA 3IJHB 3MV7A 3CPLB 3OXSB 1Y0LB 4OB5H 4DN3L 1DUYA 5KVGL 1S9WA 2IMNA 1XT5A 1CU4L 5C0CB 4PJ5A 2E9JA 1J8HB 3CNKA 2OI9C 3SDCD 1BZ7A 3IFNL 3PQYD 2PTVA 4PJ7E 2XICA 3FFCD 1A6UL 3DX7B 5E7BA 5CJOL 3MLWH 5HYSB 2MCG1 4FZEH 4RAUB 3LKNB 2FHBA 3D0VB 3WL9B 3RPIA 5DJ8B 2R4RL 1CD0A 1JWSB 3V0AC 2IAMC 4L4TD 4P49A 1IE5A 3O6MH 1CXHA 4NQED 3P9WB 4P2QD 3KPRD 1QBMH 3OF6D 3V0VB 2Q6WA 2O5XH 4MNQD 3QCTH 1WITA 4UAOC 4KUCD 2J8UE 4RRPG 1BQLL 2X4NB 1EAPB 1I1AB 3B9AA 5C7XL 1YMMA 1SVCP 1MPAL 4Z7WA 4QRTB 3EO9L 5HHXL 1PDKA 1BD2E 2VDPH 4KI1A 5L9DH 3MRKB 5CD5C 4GG8A 2H9GA 1S7QA 3VRLF 4KJPD 3QWOB 5GSRA 1HYSC 4K8RL 1JHTB 4NYLB 1CGSH 2H1PL 4K3DH 3I50L 1DBMH 1NEZB 1U36A 3KLHD 2NW3A 1JPSL 4JFDD 4HC1A 4RMSA 2I25N 3P0YL 2IG2H 4LIQH 4Y4FC 4DEPB 2VLJE 4ELMB 5JXAH 5K9KB 1AGEA 1HHJB 1FAKT 1W8NA 1YNTB 3L5XH 4R0LC 5KN5B 2I60L 4M7LT 3FN0L 5A2IH 4BKLA 3AB0C 4JM2B 3E0GA 4HXBH 2MQCA 1EHLH 2A74B 2DD8H 5JZ7C 3QISA 4MCYA 2VXTL 3DI2B 4MXQD 1N4XL 2XOTA 1RURH 1T1WA 4OLWL 3T0WA 1A6ZA 4YHZL 5C07A 5EDXA 5I8OL 3OR7A 2XPGA 1JZ5A 4S1SH 4ZS7L 4HWBH 3LRSB 3HNTL 4KTYA 5DJZA 5GQBA 15C8H 3CFBB 4P3CL 1QRNA 3T08A 3LQMA 3LN5B 3OAZH 2VDLL 2E9WA 2VN7A 3V7AE 3PWLA 3EOTL 4NCC2 3CVHB 3HUJF 2KDGA 4Y19D 3VRJA 3FT4A 2E6JA 5D7IB 1CGUA 3ZZ1A 2I9TA 4BM7A 3T04D 3WKMH 1JTPA 2IAMB 5IVZB 4ISVA 3SDDD 1MAKA 4WV1C 4WTZA 4JDTH 5LWYH 2F54B 1UWXH 3VXUB 2Y25A 1CXLA 5C0DA 5D7LA 2VLRB 4LBEB 1PD6A 1K5NA 2CIKA 2YPKA 3VG0L 3AAZB 5IG7B 2VZ1A 2Z8WC 3T0VA 1W72A 2GJJA 4PJHB 3WFEL 2IF7A 2DWEA 5I16B 3KLAB 4C56D 3LV3B 2Q1EA 2EDDA 3HCVA 3MRPB 4RNRA 1W0VA 3FQTA 2X9YA 4NP4H 1QFUH 4N8VG 1TVDA 4TSCH 1GC1C 2PW2B 2Z31D 3D5OF 5T5NF 4TVPL 2B1AL 4M03A 4X4XB 4JPWH 4PJDE 4FMFA 4CJ0A 1H3WM 3MRCA 3ECBA 3KLDA 3SE3C 2LE9A 3S8WA 4MHHG 2P46B 3RUGA 1GC1H 1A0QH 4O9HH 4DGYL 3B3IA 4GW4A 3L5HA 1CK0L 2ITDA 5DRNB 4MD5A 1OLLA 3RA7H 4LVNC 5BXFA 5FIEA 1MSPA 3W2DL 1CQKA 2KPNA 4HGMA 4Y4FB 5HPMB 4WO4A 4XI5C 1BVKA 3MJ9H 1QD0A 3Q48A 4OSUH 4EI6B 5MENB 3EDKA 4R0LB 2XI9A 4V1DE 3DUHA 4AIZB 1OTUD 3GMNA 1J8KA 1OT2A 6CGTA 2VRAA 1FIGH 3H0TB 2ZCLL 1T5WB 3ELAT 3KJ6H 3NZ8A 4GRLA 4ZPTB 5IMKA 1LEIA 4HCRA 1OAXH 5E2JA 4DGVL 4EQ2A 4LNRA 4NFCA 1U8LA 1VGKA 2PR4H 1AIFA 4ZUUA 3TJEL 3F12B 5CINH 3BPCB 1G7PB 3DRTA 1XGYH 3GM0A 2C3WA 4U3HA 2FX9H 1IC1A 2XQYG 4JFXA 5C8JB 1F42A 5IMLB 1CD1A 3SBWA 3O2DA 4OUUB 5CGYD 3GBMH 2EH7H 3QEUB 1EFXD 3IT8D 4OM1H 4QGTA 4JO3L 2DLFL 5AEAA 3RDTC 5C0BD 5E2VH 3OB0H 1HXMA 3HC3H 5JDSB 1Y18B 4NKMA 3ESUF 3SEPA 2YA0A 5IFAL 1G7MA 5ESAB 4PGEA 3RBSA 1ORQB 1LEKB 4HG4K 3F7YA 3A6CH 1JF6A 3L3GB 4FQXC 2IPKB 3REWA 2N1KA 4RX4D 1A7OL 4PB9H 4MX7B 4WNQA 5GS0C 4ZO8A 2VLME 4GW5A 2XTJB 2QJDA 1L7TH 1AD0B 1KSRA 2H6PA 1J05B 4KKAC 5FKAB 1IJ9A 3HAEH 1AO7A 1SJXA 2CQVA 4QXTA 1F4YL 3BI9X 4EXPX 5GS0H 1R3JB 3BEWA 4HPYH 4I3GA 1U42A 2JIXA 4OF0A 3V4UL 2FECI 3KYMA 4PJGE 2O61A 4WW1B 2AJSL 3G6AA 3PE9A 5L8KB 3TBSB 5DHVA 3V8CA 1ZXQA 5HDQL 4NQDE 5MEPB 1RIVH 4LVNB 4KDTA 5EU6D 4P59L 3QCUH 2HMID 4PRNA 4UDTA 3UP1A 3QIWD 2D9CA 1D6EA 5D1QB 3VXSB 1IM3B 3QDMD 5DURB 1JMXA 5B8CA 4PLKC 5HYJD 1EAJA 2APXA 4MZ2A 1T5XA 3G5ZA 3SE4A 4UIKL 4WUUB 2CKBL 4X6EA 4ACPA 1CT8A 2XNAB 3CK0H 4Z78A 1L6ZA 5CEXA 2F9BT 3H3BC 4ZS6C 3N1MC 1I1FB 1MHEB 4OJFL 1X9QA 2NTFA 3WKNA 4JJ5B 4J8RB 3ULVD 2AV1A 3C2AL 2HVKA 1UC6A 4RGNE 2V5MA 3DWTA 4BQ6A 4K2UH 3MGOA 5I0ZA 4HAGA 4P46A 4UT6L 1BZ9B 3VXNB 5FO7A 4J3SA 2H3NA 5DJCA 1UM4L 2AQ2A 4JO4H 5E9DA 5DR5L 4Y4HA 3GBLA 2YN5A 4HH9A 2CRYA 3JV4A 3CLFL 4JFOB 1ZA3B 2CXGA 5DLML 3L6FA 4PJXB 1V3MA 3SDXA 3RIAF 5IGXL 3KHOA 2NX5A 1OGAD 4DZ8B 5IHZA 2BFVL 3L5JA 4JGJA 1SJHB 4PJCE 2Z91A 1CLYL 4XCNB 4G80B 4YHLL 1N7MH 1SBBA 3RDTB 2NY7L 4BFGA 5DMYA 5DRZA 4TOYL 2PW1A 1IM9B 2R9HD 1NCDL 1AKJD 4HT1H 4HC1H 4ZAKA 2F53E 3PV6B 3HAEB 1R0AH 3BXNB 5LCVH 4HPOH 4FQXB 5CSZA 5DMGD 4YIQA 1LE9B 2O5YH 1VFOA 3MRNA 3S96B 3O4LE 1ORSB 4TTGA 3WXWL 2AKRA 4HGWA 4IRJB 4KHXH 3S88H 4PJAE 4D0CB 4GG6B 1UXSB 4NRXA 5T1DL 4FFZH 1BFOA 3MV7B 2DTML 3ULUL 1UQSA 4XC3L 1IT9H 1MCRA 1JIBA 4X9BA 1DUYB 2E6QA 5BQ7B 3HG1A 4XNZC 2HTLD 1S9WB 3BDBA 1C5CL 4XPBH 4PJ5B 1F13A 5KSVB 2JELL 4X6CF 1U91A 3VD4A 1VACA 5HHVL 4WI9A 1J7VR 1JTTA 4KI5F 4PUBH 3OZ9L 1OP5H 4XMLH 5E99H 1P7QD 4MAYA 3ZKMD 3P9LA 5C70A 4QTIL 1F6LL 3SKNB 1IGCH 3RPIB 1BEYH 3I2CH 5E2UL 1FAIH 4YC2C 4Z7VF 2KUTA 3C6LB 5B4MD 1P6AB 1C16A 2Q6WB 4FQLL 4XHJC 2DDQH 1DANT 3EYQD 5DA0B 4UV4H 2XG4A 2C3XA 1SYVA 5JOPD 2OL3L 5C2BL 4HS6B 4XP9H 1MHHA 4Z7WB 4YNYB 1OSPH 3U79A 4LPXA 4PJ9B 4GG8B 4N9GB 1NBYA 5GSRB 2VDNL 4ONOA 1W72H 2EIEA 1KEGH 3DUUA 1AXTH 3QH3B 4GUPA 1S7SA 1I1YB 1OCWH 5GGUA 5T3ZH 2R29L 3GZKA 5KAQF 4WFHD 3QEHA 2IALA 4GAYA 5FO9B 2VXVL 2P43B 5GHWH 2X7LB 1VPOL 1A9EA 4MDIB 4U3CA 3C5ZB 4DOHB 4AIOA 3WFBH 4WO4C 3BKMH 4ETQA 1I8LA 3IGAB 1EFQA 4RSVA 4MJ4A 3UTPD 2FJHB 1I75A 1AGEB 3RGVA 1RJLA 1RMFL 3OJMB 3BKJL 1SY6L 3RZCD 4BKLB 4MJ6B 1IC4L 5FA3B 4F7PA 3BP7B 1UA6H 1A3QA 1FPTL 4OIIL 1BWMA 3T65A 2MKWA 5T1KD 4Z5RA 5J1SC 2QBWA 2D7TL 5F8QC 5KOVC 1IGTA 1TPXC 2OR9L 1T1WB 4CNIA 4AEIH 4GRLC 2NY1D 4M1CC 5E8PA 3UROR 2G75A 3LN4A 3ARZA 1Q94B 1YEEH 2R56L 2BVQA 5C07B 2J88L 5C09E 1F6AB 2EIDA 3OR7B 4HKJA 1WAAF 2XPGB 5T5NG 1JN6A 1N59A 4PJEA 3VGAC 2IADA 4UU9B 1CGXA 4QHKI 3J8F7 2X4OB 4XNZB 1QRNB 4HCRH 1MNUH 1U93B 3O3EA 1SMOA 5L7XL 3SBWC 3A6BL 5ALCL 5GS3A 3VRJB 3FT4B 4RISL 3GSNA 4N68A 1MQKL 1JF5A 2CXKA 3WEXA 2I9TB 4GXUN 3QSKB 4HUKB 3L3IA 1ZT1A 3QZWA 1LNUA 4HUUA 2GJ6A 4ORGA 3NTCH 3FFCA 4YC2B 2HRPL 2BC4A 1AJ7H 2I5YL 2YD5A 3O2DH 1FFOA 4HIIB 4PRID 1XF2A 1RAMA 4KTEH 2CRMA 1FNFA 1XIWD 2YKLL 1DE4B 4CMMA 5MI0C 5C0DB 1K8DB 5D7LB 4QF1A 1DQLL 4KU1A 4AG4H 4K71C 3TC9A 3MLWL 4L4TA 3OKEB 4K8RC 4FZEL 1W72B 2ICEB 4DK6A 1MIEH 3WN5B 3QUZA 4F2MA 4NQEA 4Y5XA 3KPRA 3HFML 4RNRB 1TJIL 2R1WA 1W0VB 5A43C 3FQTB 1JWUB 4I3SL 4MNQA 4R96B 4M43L 4NQXA 5DD3L 4GAJL 1U41A 3CVHL 3PP4H 5D1ZD 3LS5H 4R26H 4YDVA 4MJ5B 4I48A 2OSLA 5E08L 4O5LL 4GT7A 3WFZA 4CAGA 4GKOA 4JO1H 3ECBB 2AI0L 2IQ9L 3WE6A 1JMZA 5HHMD 4G6JH 4JDVA 4MA1C 1NCAL 4DFIA 5C0RH 5TJWK 2ESVD 4G7YH 4XBEL 3B3IB 2ITDB 3HR5A 3PDDA 1RU9L 3BX7C 4MD5B 2YPVL 5BXFB 1RUMH 4KDTC 4Q9QH 4WO4B 2AGJL 1BVKB 3N9GH 4V2CB 2IQAB 4NOFA 5B8CC 2ZUTA 3B5HA 4JFDA 1CGSL 5HGAA 3W39A 3M45A 4N90E 3MREA 5DHVH 3SE4C 3QFJE 1DQQA 4P57A 2BVUA 4NJAL 3GMNB 3MR9A 1GZQB 4L5FH 1JGVH 4J3OC 4ZUWB 2B39A 1Q72H 1NDGA 3ZHDA 1U8OA 1KENL 3CD4A 5JHLH 4R4NC 1MCLA 2YD1A 4B7IA 3NA9L 4O02L 3NZ8B 4GRLB 4ZFZA 2EDTA 1LEIB 1GAFH 2VOTA 3NIGF 1HYRC 4JCLA 2HT3C 3UBXA 4OZIF 4LNRB 1U6AH 1U8LB 1AIFB 1BFTA 3IXAA 4P46C 4F57L 5FK9A 2UWEF 3HHRB 3DRTB 4TRPH 3G5YA 2WW8A 4Z7UF 4LOUC 4Y4HC 5BRZA 2CK0H 4NO0A 5J56B 1A6TA 5FHBH 4OCXH 1GGCL 1CD1B 2GUOA 5BVJA 4F7EA 4MA8H 5I1DB 2NQCA 1CE1H 3QUML 3UC0H 3W9EB 5HYQB 3WNKA 2PXYB 1VFAA 4FP8H 3QA3A 4M48H 4Y19A 1FIEA 5MI0B 4NC0B 3OKNA 2EEAA 2Q8AH 4Q58C 2AJZA 3HC4L 4ZAKC 3F7YB 4HKBB 1SYSA 3SDDA 4JPIA 5ISZD 3REWB 2HFFA 1BAFL 4G8EA 3WKML 4GW5B 1UCTA 1HEZB 2GYSA 2GTWB 4JDTL 4HS8H 5A16A 1TJHH 1CDJA 4MQ7A 4QXTB 4RZCA 5DRXB 1QFPA 4C56A 1M6OA 1B3JA 2DQGH 1CFVH 4LSRL 3UTTD 2CDEA 1A4JB 2EDXA 4UV7H 1MI5D 4MA1B 1WC7B 3BEWB 1X5KA 2JIXB 3KYMB 2HJLA 5MHSD 5DK3A 2E27L 3S36H 5J8OA 1RFDH 3SGDH 2IEPA 1TQCC 5CP3A 5DHVB 2GT9B 4IBLT 3T2PA 5J12C 4ODBD 2OJEA 2XQBL 4F7TA 3X14A 4AEHL 2UZYB 4MAYC 3B9EA 2LABA 1D6EB 4YFEA 3L5IA 4PJFA 3PG2A 2C3GA 4JQXA 5IFHH 2V7NA 4JHAH 5JOEA 3G5ZB 2YUXA 4OQTA 1CFNA 1ZA6A 4JFFD 1WLHA 5HPOA 1CT8B 2MNUA 2A0LC 3IFOB 5CEXB 3MXVH 1JPTH 3S4SA 1HHKA 1XCQB 5B22A 4GAGL 2NTFB 5IIEB 3BT2L 2AV1B 2HVKB 4ZMAT 2VC2H 1RJZB 3G6JA 4POZD 2KKQA 5IEHA 1IKFH 3SGDI 4BUGA 3MGOB 3PHQA 4P46B 4XPGL 1ZAGA 4JKWA 3FRPG 5FO7B 3IDMB 5DJCB 2DQHL 4BFIA 5E9DB 3WLWC 4Y4HB 1LHZA 3FO0H 5DHXB 3JV4B 1XR9A 3HA0A 4C4KT 3L6FB 2QQQA 5L0QC 3SDXB 1I8KB 1RUAH 1BF2A 1JGLH 1ED3A 5IHZB 1KB5A 2B2XH 5L88L 1S7TA 4FA8A 5GPRA 2HT4D 2Z91B 3BKYH 3E8UH 2F5BH 5C86A 1B2WL 1G7LA 1YEGH 4P5TD 5DQJA 2ZG3A 3WFCH 1I8LC 2APVA 1T83A 1FQ9C 5CJBA 2NY6B 2PW1B 3SY0A 4NQVA 3RGVC 5HY9B 4CRPA 3UTSE 1IZJA 3CZJA 5DC9B 3Q2CA 2L4OA 5DK0A 4H0GA 5CSZB 3SJVD 4OM1L 4YIQB 4XTRD 3GMRB 3MRNB 4Y2OA 1NFDB 5I8KH 5IMMB 3B9DA 3CSYB 3MQIA 3D25A 2FECL 3HC3L 2F5AH 4NM4L 3CX5K 5L2KD 2QSQA 3ARXA 4PRPE 4NRXB 1BFOB 4YX2H 3S9DB 4QRPD 1YJDC 4TPRH 3JVGA 3HRZB 4R9HA 3HG1B 1HQRA 2ARJA 1ZLVK 1FVEA 3MODL 1RZ7H 2AJVH 1EBAA 3VGFA 1P5VA 5EZIL 5JHDE 2BRQA 3DX6A 4U1LB 5FCSH 5KAQG 1VACB 3I6GA 2C26A 4X5XB 3RIFK 2D7NA 3D18A 3DUSA 3GSXB 2EXWD 4MAYB 2FZ3B 2DIBA 4NRYA 4KC3B 4IRSD 3DX9A 4XMKH 2QSCL 5KSUA 5CGTA 5F9DC 4K7FA 1I7TA 1U3JA 3P11L 4B50A 4HWEH 5IKCA 5CSGA 1JRHH 4HQQL 1UACL 3IDGA 5IVNA 3QIBD 3R8BB 1H8SA 3QIWA 3BSZL 4OLUL 1ADQA 3GSNH 1URLA 3QDMA 5HYJA 1T2XA 4YFDB 4GO6B 5JIIA 3EDJA 5J1AA 1MREL 4B41A 3QUZC 1RUQL 2VITA 4GRMA 4Y5XC 4YXKH 5SWZB 5HVFB 4P99A 1Q1JL 1L6XA 2HWZH 5ANME 3TPUA 1NBYB 4KZEL 3QEQD 1OAQH 1TJGL 1RK1A 1EEQA 4PD4K 5C6PB 5GGTH 5IB5A 2NXZC 1QOKA 1S7SB 4PB0L 4HEME 1YPZA 2OMNA 1AC6A 5HXMA 4HUWB 3I6LD 4L4VE 5TDPA 4ENEC 1PY4A 1B6DA 4MVBC 1LP9A 4L8BB 4WWKA 4YHOH 4PRDA 5A2FA 2R0ZH 3ROOA 2VNCA 5TH2B 2VXUL 3EYSH 1I8MB 1WZ1H 4JRXA 2X1PA 1T21A 1I3GH 3S35L 1MJ7H 1LDSA 3KLHC 3GSRA 1V3LA 1RJLB 4KMTH 3BDYH 4UNUA 4F37K 5CZXD 5MP6L 4QHNB 5FYKU 3HE6D 4BUHA 3QDGB 2F58H 3TGXA 4ORZC 3MUGA 2YD8A 2EC8A 4RMQA 1IGTB 3TT1L 3QO0B 5E7FA 4X8JA 5E8PB 2G75B 1QQDB 1SMAA 2V17L 5FV1L 3WHXA 4PJBE 4HKJB 3O45B 1T89A 3TCLB 3FQUA 1JN6B 1ZANH 4PJEB 1IVLA 2WQ8A 3C09C 4LSVL 1VHPA 1YYMH 2BNUA 2UUDK 4LHUG 2FX8L 2YD4A 3AS2A 3O3EB 4U1NA 3CFEB 1MQ8A 3QFDB 4KKLC 1IGYA 4NHCL 3VXOB 3GSNB 3WEXB 4MA7H 4XPTL 2HAZA 1ZHNA 4CN6A 3T0EE 1ZT1B 3QZWB 4HUUB 4KK9C 5BO1L 2GJ6B 4ORGB 3SDCB 3PQYB 3FFCB 2BC4B 2FJGB 4R90L 2XIDA 1JI2A 1FFOB 5HHPA 3ARGD 3C2SA 5ECJE 1RUKL 1FC2D 4Z0XB 4QHUA 4QF1B 2VLKA 2J12B 1AFVL 2M1KA 4H25B 4CVXA 4PUBL 4L4TB 4L3AA 2K9UA 2UY6A 3SDDC 4LPUA 3LD8C 3Q0HA 4FTVA 4NQEB 4P2QB 3KPRB 3Q5TA 2R1WB 1QLEH 5LBSH 4MNQB 2I07A 1FAIL 3BUYA 3KPSD 3U7WH 2FEDD 3LEVH 3NABL 4LLYB 4YDVB 1A5FH 4I48B 1CR9H 4OF5A 2R2CA 4ODWB 1P4IL 1QSFD 3DX8A 5BS0D 5JDJA 1GOGA 2FWOB 1CF8L 1MFAL 2DDQL 4RRPA 5GGRA 5EUKA 1A4KB 2ZG1A 4JDVB 4UV4L 3ZTNH 3T2NH 3FQRA 1XR8A 4JG1L 4FQJH 3HB3D 4OM0H 1NCBH 4G7VL 1OSPL 1MCDA 2VDRL 2C5DC 5F1NB 3REVA 2Y36L 5F3HA 4P0DA 5FO8A 2DAVA 4JQXC 4PS4L 1AXTL 2Q7YA 2WBWB 4GLRH 4JFDB 4U2ZA 5HGAB 5CP3H 1CLOL 1DQQB 1NC2D 4P57B 1N2RA 2HJFB 5HGHB 2DWDA 3MR9B 1TQBC 5H94A 1P69B 5I9QC 2YK1L 1Z0MA 1CIDA 1F8TH 4OZGB 4XBGB 1U8OB 5CGMA 6FABL 2FGWH 1FH5H 1MJ8L 2O26U 1YDPA 4ZFZB 5CUSL 2X1QA 3G9VA 4OQTH 2AJXL 3UBXB 4JHWH 1R3HA 3IXAB 4HUNB 1OAZH 4D94A 5FK9B 3MTRA 1B0WA 4MLIA 1IQWL 1Y6MR 1NANH 1OARH 1UWGH 4DTGL 3LKQA 1OL0A 2C1PA 1LO2L 2KBGA 1V7NL 1NPUA 2BSTA 3QCVH 1YQVL 2OBGA 5I15H 1I3VA 4OZ4B 2QQNH 2W0LA 4J3WA 1BZQK 4KKNA 4FQ1H 1AXIB 3RX7A 5E1AA 2HFEB 4Y19B 1T83C 2DI7A 1KB5H 3LDBC 2AJZB 2Q76A 4X80L 3GMMA 5AWNL 3HNSH 2HH0H 2QQLH 1SYSB 1CZ8H 3S5LA 3SDDB 2DTSA 1J9CT 4OIAA 1S3KH 3LD8B 4OD1H 4PRIA 3MXWL 1UKTA 3OKKA 4ONGH 4G8EB 3IU4H 2E7LA 4GMTH 5KVMC 4MSWA 4HK0A 3STLA 3TH3T 1TIUA 5A16B 4R4FH 3T4YA 1N64L 4TUOA 3IETA 1M6OB 4C56B 3DXAE 1MY7A 2CDEB 3JVGC 4UOW1 1XF5A 5D1ZA 3A6OA 2ZOLA 3EDFA 3FB8A 1MWAA 4OLXL 5HI5D 3WUZA 4BH8A 1ZTXL 1I1RA 4QNPF 1IGJA 1EVUA 4F7TB 1F3JA 4XAWL 4K55A 3DHMA 4XGZB 2N7AA 3L1OL 4ONFH 4PJFB 3MOBL 4P2RE 2V7NB 1OF2B 3LKOB 4K9EC 2IANA 5D7IF 4GRWF 3RKDC 5D96C 5JNYA 1KIPB 5DK2A 4YBQC 5J6GB 1CFNB 1ZA6B 5F7NC 5I9QB 3QIWC 1PZ5A 3RU8L 3TNMA 1A1MA 1HHKB 4JFHE 2OTUA 4JN1H 3BZEB 3WIIL 3QWRD 1OB1A 5EZJB 4K9EH 1LO4L 3K80A 4I0PA 4LVOB 1K6QL 3IDXH 3G6JB 2BCKB 1AI1L 2VL4A 4G9FE 1JGEA 2FRGP 4YXHL 5IEHB 4PJHF 1QR4A 1F3DH 3PHQB 1ADQH 4S11A 5I1JH 2X9XA 1JCKA 2FH6A 2ORBL 4BFIB 2R15A 4L5FL 5EOQH 5DA4A 3RVTD 3RPKA 1XR9B 2NY4D 2NYYD 4OD3L 1E28B 1HOCA 1MCPL 1KB5B 3P4MA 1B6UA 1S7TB 1X7QA 4WWKC 1T6VN 2FBOJ 4PY8J 4N0FB 4U2YA 3VWKA 2BNQE 1R5WA 1G7LB 4CL7A 1SJVA 5F3BA 1J0HA 3D39D 4U0RC 5DQJB 3BVNA 4BQBA 2DRUA 3MJ7A 2NY5C 4CW1A 4IHOA 4PRBB 3B8YA 1XF3B 4PTTB 3W0WD 1EFXB 1D5BA 2D0GA 1CLZL 3SY0B 4NQVB 2LTQB 1GGBH 4F8QA 3VXPB 1QO3A 3GMPB 5C0BB 4PJIE 5DK0B 5LKNA 1KGCD 2H2PC 2NY5H 1EMTH 1CE1L 2VDMH 1U2HA 3QRGH 1WSST 5JPMA 3WNMA 3UC0L 2A9NH 5E2WL 2XWTA 2R9HC 4LSQH 1E4KC 2RAMA 3IDYC 4FQQB 5ISZA 1GGIH 4HUMB 5CEZD 1J1PH 5DMGC 4PY7B 1P1ZA 3FO2A 2Q8AL 1T89C 3O6FA 3SO5A 4IIQB 2BVPA 4P3DB 1CFTA 1HQRB 1ACZA 5HD8D 1JE6A 4EI5D 1JZ4A 2EDQA 4AJ0A 3I6GB 3I9GH 4I4WA 1PGRB 5I19H 3UTTA 3DUSB 3WUWA 1MI5A 1GYAA 4KK5D 4NKOB 5ICXB 5EWIH 2HTLC 2ED7A 1Z3GL 2D0FA 5KSUB 5EBWB 4U6YB 1I7TB 1NJ9A 5D96B 2IPUK 1NCUA 3IDGB 2WWMC 3N1FC 1VA9A 4X4ME 3O4LD 2FBJL 3OJ2C 3QIWB 3ZKMC 1KJVB 3DURA 2Y07H 3BE1H 3QDMB 1BBJA 3GHEL 5GRVL 5HYJB 3O6LH 1MRCL 4DW2H 4LF3A 5JW4M 4M93C 2WUBH 2WINB 1IC7L 3FO1A 3SN6N 5IR1B 5IBLD 5MERA 3RX5A 3Q6GL 1U95A 3MA9H 5IFHL 3WS6A 1MY5A 1HCFX 1VCAA 1ES0A 2MKLC 1T0MA 2BXZA 3O0RH 1SHMA 4NJ9H 4Q6IB 1A6VH 1YEHH 3M8OH 1BX2A 4UB0L 1RK1B 4DAGH 1F4WL 2AK1H 3K74B 4LPTA 5IB5B 2H26B 4HBQA 3GI9L 5TDPB 4R7NA 1LP9B 4GKZA 4GOSA 4WWKB 4JO2H 4PRDB 5F1KC 4OBRA 3IJYA 5IHBA 1QSEE 3FMGL 1K3ZA 4U0RB 5I8EA 4X4YB 4KRPD 3TZVD 4S1DD 2ZSVA 4YHPB 3VRIA 4X6DE 1OGAB 5D2LE 3L3JB 3D2UA 2R4SL 2D03L 3GSRB 3VJ6A 4DKEH 4BQ9A 5IFJA 1NBVL 3CSGA 4K3EH 5F44A 5HJ3A 4WGWB 4LLUA 4OF3A 3MUGB 5IESL 4NQSA 5F72S 2R0LL 3GJFK 4HUXA 1PW3A 4KXZI 2QSTA 4I2XE 3C8HA 4X8JB 5D5MA 3GMQA 2A2QT 3IDYB 2CRZA 1ETZA 2EIBA 3WHXB 5JMRA 3EFDL 3EO1A 1MIML 5FF6A 3FQUB 4JFQA 4ZFOL 1PLGL 2Z35B 2NY1C 5F6IC 1E4XI 4NQCE 1KOAA 1MAJA 4PGBA 2NY2C 3GSUA 4U1NB 3CDGA 4RQQA 3IVKA 4XVSL 1IGYB 3KYAA 3KS0J 1FZJA 1P4LA 4YR6B 2CLRA 1B9ZA 4YX2L 2P42B 2W9LA 4KQ4H 2B4CC 4OZHA 5HHPB 3IRPX 1WWWX 1MHCA 3B4NA 1T0NA 4ZO6A 3T77A 1N8ZB 4QHUB 5EZOL 5C3TA 3CLEH 1G9NL 4CVXB 4M93B 1LK3H 2AEPH 5C09D 2B4CH 3B83A 3NH7H 3QIBA 4U1JA 3Q6FA 3WV0A 3HI6L 2ADFL 2AVGA 1O7VA 1IBGH 4XPAL 4C58B 2E7LC 4TUJB 5I66A 1P7HL 4KRMB 3BUYB 1PQZA 3OR6B 2XV6B 1QKZL 1EDQA 3AUVA 4KI5E 4LVHB 3ZT6A 5T3XE 2WZPD 4U7SA 1CDBA 3LH2H 3ZL4L 5EUKB 5EBMA 4JQVA 3FQRB 1ZHBA 4UILL 3HMXA 1XR8B 5D1ZC 3PGFL 3O2WL 3VW3L 4PJ7A 1XGRA 4UIMA 4MXWL 5CJQH 1MH5A 1WWAX 2MWCA 2N7BA 3ZMRA 3ARPA 4S1RL 3REVB 3I6KB 1TDQA 3S98A 4D2NA 3U7YL 5F3HB 1IL1A 3ZYZA 4P48A 1BQHA 2XA3A 1JZ6A 1E6OL 4JKPL 3VFMA 3V4PL 1MWAH 1FNSH 1RZKC 5I1HL 4R6UA 1JYXA 2DB8A 1SBSH 4XVUD 3OGOE 1N2RB 5D7JD 5I71C 1A02N 3F6LA 1I7ZB 1MUJB 5I75C 1V7ML 2W65A 1EV2E 1QACA 1XGUA 2NZ9D 2J8UA 3U9UA 4Q9RL 1MVFA 1RZKH 3MCG1 3U9PL 1BMGA 1YDPB 1J18A 2CGRH 3RZCB 2OXHA 4I0PC 2ERJC 3MRQA 3N85H 1XZ0B 3IAQA 1BD2A 1X5GA 3O6KL 3VWJD 2H2SC 5T1KB 2VZVA 4Z7WF 2XZCH 1L7IH 4PR5A 4CBPA 1WV7T 1K4CB 1B90A 4L1HA 5ILTL 2NY1B 3F58L 2KQNA 1R3KB 5DHYA 1OLZA 2K7PA 1DBAL 5KOMC 2Z8VC 3A67H 4PV9A 3PGDA 3QPQC 5IBTH 1GCFA 1VKXA 2BSTB 3MGTA 1AE6L 5GRJH 3IJSA 5E6YA 3VWKC 1UM6L 3RL1A 5DGRA 4M7JL 1S7XB 5E1AB 4Y8AA 3HKFA 5F7WC 2VXQH 3KPPA 4H88L 5IV2A 4OLZL 1ZGLM 4L8CA 1OSZB 2BRRH 2DYPD 3GMMB 5AZEH 5AD0A 2BOBA 3ARGA 4PRIB 3ULSA 1OPGL 1NH6A 1XIWB 4R97B 4J3TA 1ZK9A 4JFED 2XZAH 4BYHA 4M5ZH 2X4UA 3BGFB 5J06A 5JQHC 5KG9A 2FLRT 4LVEA 5KVFL 3ZYIA 1DBKL 1PY9A 2BY3A 4HK0B 2W9DL 5CILH 4YO0A 3STLB 5IOPA 5FYKD 1SEBA 3IETB 4FABH 5CCKL 3QDJE 4XC1L 3O6FC 1CFQA 1ONQB 1DZBA 3PDOB 4KKBC 2P7TA 3K2MC 2AP2A 5D1ZB 3KPSA 2ZOLB 3FB8B 1K8IA 1MWAB 1ZHKA 1YEIL 5DMKB 1MCJA 4BH8B 1HKLH 12E8L 5LBSL 5BS0A 4GBXA 4FFVD 3T3PF 4L3EE 1F3JB 3IDNA 5HHMB 1A3RL 4LDOB 4F7CA 3IKCA 2ESVB 1MF2H 5M95B 1HIMH 1Q0XH 3BWAB 2IANB 4GQ9L 32C2A 3QUKA 2O93L 5JNYB 5EIQA 5EN2B 2YXFA 4MA3A 5I71B 2AK4D 2HLAA 4N5UA 1T03H 1KBGL 2VDKL 4YEEA 4UINH 4LSSL 3RY5A 2G5BA 1A1MB 2B5IB 1FZOB 2ZUUA 1KB9J 2X41A 4Z0BL 5I1EH 1OB1B 1X5ZA 4JR9L 1NC2A 1P6FA 2ERJB 1YY9C 4GXVL 4QYOA 3O4OB 3OAYK 4N0YL 3EUUA 1IAOA 3WS6C 2VN4A 3DBXA 4LQFH 3VFWA 3V0WH 1A6WH 3OSKA 4JFYB 2FATH 4K7PX 2FYYA 3UAJC 1G6RL 2CSPA 4LLDB 5GIRA 4JPVL 3DMMD 5E8NA 1MRDH 3D3VE 1HOCB 2F8OA 3P4MB 1X7QB 35C8H 4I0CC 4J3XA 5DDHB 2W60A 4KVCH 3VWKB 1L0YA 3RUGF 1R5WB 4IDJH 1O5DT 4Y2DD 3NACL 2G2RA 1CLCA 5HVGB 3BVNB 1AGCA 4QXUH 1QPPA 4MWFA 4CW1B 4U6TA 3EYVB 4NT6B 1D5BB 1PG7H 1WVZA 5MEOB 3BMVA 1NUFA 1QVOA 4ALAH 4V1DA 3QNYA 2X89A 4GSDL 2UYLB 3NIGE 4POUB 1A8JH 4XH2A 1QO3B 3BMWA 4M4RA 1F4HA 5AYUH 4HWUA 1C12B 1UCBH 5FV2A 2VIRA 5DUMH 4F9LA 3RHWK 4QCIA 3KNBA 1X4XA 5DVMA 4Z7UE 5T33L 2JB6A 4LPVA 2DQFA 3EYOB 3TBVB 2GI7A 5ISZB 4WFGE 1P1ZB 2EKSA 3KXFE 3FO2B 5DFVC 3OJDA 5KANG 3WDJA 1K3IA 3O6FB 1INQA 2HH0L 1JNLH 2BVPB 3WD5L 3U30C 5INDA 3KR3L 2IJ0C 3MUZ1 3DSNA 4I0KA 2CO7B 5AUMA 5E95B 4N0UE 3IU4L 1KG0A 4MXVF 3UTTB 3UO1H 4OTXL 1MI5B 4HWZB 1FE8L 1ZT7A 5HVHC 1AY1H 4R4FL 4JKKA 5FCUH 4QWWD 2X4TB 4CKVX 4OCSH 2BVOB 2NY3D 4EDWL 4Q97A 3CVIH 3V7MA 2A73B 1J1OH 4LARH 4YDJA 5DUPH 1X5LA 1EO5A 1FZKA 4YH6A 3CCHA 4M1GL 1DDHB 1E4WH 1BBJB 2VH5L 4RWYL 1S9YA 4KKCD 2R1YA 4RFOH 3HNVH 3RRQA 4XNMB 1CXFA 3O9WA 3O2VL 4JFFB 4WFFD 3FO1B 3QIBC 3LEXA 4Z77B 3QUYA 3OPZH 1K9TA 4PREA 4DQOL 5ADPL 1IKNA 2NLJB 5M7QA 1ES0B 5GISL 2WK2A 3A0OA 2A9ML 3MA7A 1T0MB 2OR8A 4ZFGL 3F65A 1WZMA 3MRFA 3KGRA 1JNHA 1ZEAL 1T2QL 2IH3A 1DQMH 4GAFB 2EO9A 5SWSE 3V4VH 5J11C 1T66C 4TVPE 4NUGH 5LQBL 4U1IA 4JQVC 3L3KA 4GKZB 3U46B 3ZYOA 5BJTA 5F7FA 2PO6D 4NQDA 1KELL 3IJYB 1G1YA 3LKRB 3MACH 4UDUB 3CFCL 4M8QA 3DYOA 2ZSVB 3AY4A 5JW4R 5K9OA 4QHMB 2BDNH 4XB8A 2APBA 4OV5A 4P5TB 2GEEA 3PV7A 5HJ3B 4LLVB 2YD9A 4NQSB 5EFIA 3ULVL 4HUXB 3L9RA 5F1IA 3PF2A 5F21B 2PYEE 1TCRA 5D5MB 3U2SB 4XP5H 2SEBA 1ETZB 4ODHH 5IW1A 1UH3A 4RBPK 3SJVB 5CHNB 3MBED 4L4VD 1HDMB 2VR4A 4LU5H 4OLVL 5JW4Q 1FYTE 1ZV5A 4JFQB 3QJHB 4AENB 1HN1A 4UTAH 3U30B 3KWWA 1EMTL 1W0WB 5L2KB 1TZIB 4FHBD 4ZPVA 2A9NL 4K7PH 1OQOA 4PGBB 1KN4L 4QRPB 2EYTB 3CDGB 3IVKB 3PWVA 4AMKL 1UB6B 1K4DA 4PJCA 3SDXF 4P5KA 1P4LB 2CLRB 1BIHA 1CICD 4YK4C 5KVDL 3MUHL 4LCYA 4PRHD 4OZHB 1NKOA 3W11D 1YEFL 4L9LA 1AGFA 5AAMA 4DKAA 1MHCB 1T0NB 3BZDA 3T77B 4IRSB 2F53A 1J0JA 3TN0A 3RWDA 3M07A 2CR6A 2OZ4L 1J12A 3BWUC 4M7ZC 5DYOA 3ARGC 3QIBB 4U1JB 3O4LA 4CU7A 1LD9A 2YEZA 1WJ3A 1PQZB 4TNWK 4PJAA 1WFTA 3MUY1 4LKCA 4L29A 3ARDD 1EHXA 1YNLL 1JHLL 2NTSP 1I1AD 4RGMC 1NGQL 4YZFF 4D9RD 1ZHBB 3VD3A 3MOQA 1T4KA 1U2CA 3GNML 3QEQB 1NDMA 1NMBH 1MH5B 2ZG2A 4J4PD 3PNWA 3FZUC 3MOAL 4GBXC 3QHFL 1ZGLB 3UZEA 2ZUYA 5ID0B 5IQ9B 4PBXA 4XP1L 1FNEA 3DRQA 2JJVA 4A2MA 3MRGB 3TZVA 4G8GE 3ZDZE 1J10A 3VFUA 2J6EA 1Q0YL 4LCIH 43C9B 3U9UB 4XB7A 2A6DA 3TO4D 1E4XL 4RFNC 4P9HC 1FGVL 3MRQB 2VL5A 4ODSH 5FUCE 3WSQH 5HBBA 3WO4C 3HE6B 1OM3H 2HFTA 1YN7B 4DKEL 1DEDA 4YHKL 3QUXD 4YDIH 4PJ8D 2VZTA 1A9BB 2EEDA 4PR5B 1RSFA 3B5GA 3NIDF 4J6RL 2QQKH 1B0GB 3RVUD 4P9HH 2EE9A 5DHYB 5A40E 1IEAA 1TETL 4PV9B 5B38A 4GS7B 4IOFC 3F8UB 5C0AE 1VKXB 1I3UA 3MGTB 1YMHA 3IJSB 3QEGL 5EORL 3U36B 5J3HD 2AQ3A 4OFKA 5D70L 5SX4I 4YK4B 1VFBB 3T4AA 3QNXA 1DBJL 4XP6H 5D7SH 1LO0L 3KPPB 1TENA 5HHQB 1LWRA 1FGNH 1H3XA 4KUZH 5L6YL 2BK8A 4L8CB 5EB9A 5T5FL 5KJRH 3WNPA 4U3XA 3ZDXF 3MV9D 3IDJB 5DJ0B 1A7PL 1B4RA 5AD0B 2BOBB 4QOKE 1T7VA 4WTZG 3V5HA 4M7ZB 1TTGA 3QXVA 3ARGB 1M71B 4FQIL 1M7DA 3ULSB 4F9LC 2IAMD 2GK2A 3ZDYF 4O2EA 5KG9B 2XKNA 1BFVH 2X4UB 4TSAH 3EIFA 4XNQA 4HUVA 2XRAH 3V5KA 4YO0B 5IOPB 1U8HB 5H2BA 5E6ID 5C09A 1FVDA 3S34H 2B0SH 3S97C 1XAUA 4Y16D 4JG0H 3RVVC 1CFQB 1KCSH 3GRWL 5DTFA 1DQJA 4RGMB 4F8TA 1B0RB 2XXCB 3KPSB 1JV5B 4OFYA 4PJEF 1AHWA 4RGOL 5CD5D 1IBGL 1QSFB 5BS0B 4GBXB 4OGZA 3UZVB 3IDNB 5GGQH 1N6QH 2GW5A 1HYSD 4JFZH 4ZTOL 1GL4B 2AXGB 1FORH 5IM7A 1BOGA 1CTOA 5HI4C 4F7CB 3IKCB 5J13C 2X1XR 3BZFA 3QUKB 2EE2A 1UFUA 1CD9B 4MA3B 1GOHA 2HLAB 3MCLH 4ONHA 2VZUA 4EVNA 4G3YL 4MD0A 3HC0A 1FFPB 2G5BB 5DJAA 3MLTA 5I30H 1NC2B 4RFNB 5D7JA 3O9WC 2E6PA 2P5WE 1TVBA 5AG8A 3WO4B 1PX4A 4MJID 3QUYC 2IH1A 1BJ1J 5H37H 1IKNC 1XH3A 3VFWB 5JZ7D 4H20H 1KJ2L 4KUCF 2FYYB 3NPZB 1J8HE 4FOMA 2A6IA 5DI8A 4QHLA 3JWDC 1RHHA 2VLLA 5K59E 4WY7H 4X7TA 4HFWA 2B7DT 3MUJA 1T80A 4X7SL 4UQ2B 4LPCA 2W60B 1T22B 4X8XA 3N0PB 4C55A 2V5SA 4XRCA 2DBLH 4CDHA 4NZRL 2G2RB 5I1GL 4BK5A 3B6SA 3C08H 3X3GH 3LMJH 3AY4C 3JWDH 3NGBB 2ICWA 3VFGH 3PL6D 2CDGA 2OCFD 1JGUH 3I85A 1IGML 1E6JH 1QVOB 3MRRA 4DCQA 4DGIH 3QNYB 4D0DB 2H41A 3QFJA 4ZO9A 5C0JA 1X5IA 5I1LA 1MEXL 4R2GD 4J12A 5KW9L 4QCIB 3KNBB 2VAAB 4MQXC 4OFDA 4ODVL 4JLRA 1KTLA 4QRUA 3V6OE 2DQFB 3FOLA 2R39A 1FDLH 1MCWW 2EKSB 5FEBA 1INDH 4ZYKB 5DT1L 3CH1A 1BGXH 4NDMB 1S9VB 2XN9D 5IF0A 5INDB 4R4BB 5CMAA 4NO5B 5AUMB 3ZT7A 2QHRH 5TF1L 3RWEA 4JN2A 2UVEA 4ELME 4WTWA 1R24B 1ZT7B 5I2IB 5CZVH 1MLCB 5LJYH 5CLTA 2G60L 4OGAD 5IJVA 5HD8C 2P48B 3K8LA 1RUPH 5CEZH 1F90H 3TA3D 3NOIA 4YDJB 4NUJA 3WNOA 4NO2A 1FZKB 1A7RL 3VD5A 4L9LC 5EBGA 4JKLA 1FV1B 1F4AA 3TN0C 2V7HA 1KPVA 1YEKL 3CXHJ 4XI5D 3QULA 4OCYH 3LHPL 5EU3A 2Y5TA 1HKFA 4KRNA 4PREB 3SGKA 1NLBH 4WEUD 1D9KD 2EC9T 3TEUA 3V52L 3MA7B 4E5XB 1JGDB 2EDEA 3V6BR 2Z4QA 5LGJB 2WIIA 4HK3J 4OGYH 4CADB 5IB2A 5DJDA 3TVMD 1JNHB 2IH3B 4RFEB 1KCRH 2X40A 1YNKL 5I1EL 3L3KB 5I18L 1IGFL 1NGWA 3QDHA 1RJYB 4H1LA 5BJTB 4NQDB 2GQHA 1JWMA 3SE9L 4K23L 2NY4B 4G9DA 1JK8A 3SGJA 4M6OH 5GZNC 4LQFL 1A6WL 3DI3B 4M8QB 4PGDB 3GKZA 5K9OB 1S7VB 2F54E 3CMOH 4KV5F 1F11A 2VLRE 1LO3L 3CUPA 1R3LA 4PJFF 4Y2DA 5TE4L 4KRPC 3TZVC 4PJHE 1DN0A 4S1DC 4X6CB 5D72L 3INUL 5CBEA 3ROLB 3IDIB 3L7EA 5EFIB 3W0WB 25C8H 2YC1A 4G6AC 3TIEA 3L9RB 1TTFA 4KJWC 3OL2A 2ZCKH 5F1IB 2WUCH 4FFYL 1TCRB 3MLZH 2P24B 2OR7A 4PV8B 4YE4H 1CL7I 2LQRA 4Z7VB 4KPHL 1HZHH 3Q1SL 3OKDA 4LIQE 1FFRA 2MCPH 3G6JF 2J6EH 2HFGL 2HT2D 3U6RA 3FL7A 3QI9D 1E27A 3KWWB 1QNZH 4YDKH 4ZPVB 5D6CB 3HZYA 4PG2A 3BIKA 4KKAD 4OF7A 3K2UL 2HA1A 1K4DB 1MFCH 3EO0A 2GJZA 5BMFL 1DSFL 4O51B 3MV7D 3UJIL 3D85A 5MENE 4Q2ZA 5J9PB 4OBSA 4R3SA 1A7QL 4EI5B 3T1WA 1FRGL 4PJ5D 1AQKL 3O41A 4L9LB 4NKIL 1AGFB 1EGJA 1HILA 3UTSA 5JOFB 4H0IA 5DZLA 3MC0A 2AJYH 5HTSA 4I18A 4LAQL 4OT1H 3OAZK 1GHFL 5DYOB 4PLKD 3MROB 3O4LB 1LD9B 5C0ND 4CVZA 4E0RB 2DM2A 3EOYG 1TZHA 1PKQB 2VQ1B 3NPSB 4Y1AE 5DUPL 5LXGH 3OX8A 4NQCD 3D9AL 2OJZL 1JNNL 4K07A 4PRPA 2VSCA 4LKCB 1YUHA 4L29B 4QY8A 3QWQB 4EZMA 3B9KD 3FRUA 3BGAA 3NIFE 4PLOB 1ZVSA 3JZ7A 3QJFA 1HXYB 3SDYH 1HH9B 1YMMD 1I9EA 4L1DA 5K9QG 1AHWC 1T4KB 2MJWA 1NDMB 2DMKA 1NAMA 4JB9H 4NZTH 4FNLH 3PNWB 1DLFL 2DMBA 3WS3A 4UT9H 3OKLA 1IEBA 5ACLA 1C5DA 1MCOL 3FTGA 5E94A 5EOCJ 5DVKA 1FNEB 2PO6A 3LKPA 5FUOH 4N0CC 4MCZA 1KFAH 3SQOH 4KRPB 2R0KL 3TZVB 3AGVA 1S9XA 3VFUB 3MLUL 2H8PA 2A6DB 2XTJE 3ALXA 4KJYA 5KVEL 4J3VA 4LSTH 4XVUC 5F9WB 5D7JC 1C8PA 4X6BA 4WHTA 1A1NA 4U6XA 5C6TH 5I76A 2BJML 1IILE 4I3RL 4QO1A 5ANMA 1D3CA 1KC5L 4MYWB 5DMJB 3SE8L 5JLZA 4ZNEE 5ENWA 2I24N 3NFNA 1IC5H 1F58L 2DJ4A 2NMSA 3TBTA 4L4VA 1OAKL 5FUZL 1F5WA 4IDLA 5C07D 1YPZF 3VXSE 2FNBA 2LU3A 1FBIL 1LP9F 4U1GB 2C4FU 4NQTA 3T4AB 1DLHA 4XNYH 3EDEA 3QNXB 2FX7L 3H9HB 3MPCA 1FNAA 1UYWH 3ZE1F