4OD3H

Crystal structure of human fab cap256-vrc26.07, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
245
structure length
234
Chain Sequence
b'VQLVESGGGVVQPGRSLRLSCVGSQFSFNRYGMHWVRQAPGKGLEWVAGISFDGTDRYHADNVWGRFTISRDNSKNTLYLQMSSLRAEDTALYYCAKDLREDECEEWPCRKSRGVAGVFDKWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.07 light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 234
sequence length 245
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od3H01
2G60L 4GMTL 2OL3B 1I1RA 3QUYD 5HVGB 4U6TA 4LQ1A 1NUGA 4PJIF 4JY5H 1AXTH 4G7YH 4LGSB 1KB9K 2Y06L 3NIGF 3FQXA 3V52H 1U8JB 4NC1E 2COQA 2J1KA 4NQSA 4HJJH 4U7SA 3CU7A 3V4PH 1OTTC 1S9KC 3U6RA 2NXZB 4WWID 3DURB 4MNGE 5DRZB 2VDRL 5JOPE 1YDPA 4XCFH 1KYOJ 5AEAA 5BXFA 1G7MB 1Q94A 4NQCA 1KFAL 5B38B 4V2BA 4HHAB 3VDAA 3DXAA 4ZFFB 2IQ9L 2YPVL 1FAKT 3VFTA 3FQTA 1MWAH 4KRPB 3LD8C 1FFQA 4XAWH 4QRPA 5FGBA 4QTIL 2A2QT 2ITDA 3CXHJ 1T22A 5EZJA 5E2WL 4MGXA 4PB9L 2ADJB 4RMWA 5EUOB 1UT9A 3GSXA 2EXWC 3NZ8B 4FQJL 4ZTPL 5IESH 1DN2A 3ZKQD 4KKAC 5DDHA 4Q6YA 1JZ4A 4YX2L 1VENA 3VGAB 32C2B 4FQ2L 1T7ZA 3MJ8A 1ZHBB 3RX7A 5JPNB 2AK4E 4F33B 3GHBL 3DTXB 3CH1B 4YAQA 3F7RA 1C08A 4HFWB 3T8XB 5C07E 3WSQL 4G7VL 4NO2A 5IK3B 2JB6B 1JTPA 3EDDA 3TFKD 2Z4QA 3MRFA 1O5DT 4MNQA 1CI5A 4FQHB 2E27L 1JPSH 4YC2C 4LKCB 2HTLC 2MQ3A 1N6QH 3HI1B 3N1MC 5CZXC 2FGWL 3TH4T 3D18B 3EJJX 1SJXA 3K8MA 3OHXA 3Q1SL 4XP4H 2VIRB 5A2KH 3OJMB 3O11B 2IPUK 2ZUWA 4F15C 5I8EA 3VCLB 2Q7YB 3B2UD 1TQBC 1RHHB 2H9GA 4ETQB 2BC4B 4PJGB 2BNQE 1ZKAA 4Y5XB 4Z8FL 5KTEL 3KJ4C 1FO0L 3VRJA 1UJ3A 1U93B 5EN2A 5EU5A 4F7CB 4NNXB 4DAGL 1OM3H 2GYSA 2WUBL 2G75B 1IAIH 5I8OL 1FNGA 3KPQB 4PD4K 3MGOB 4NUGL 1D5ZB 4OF0A 4OKDA 5DHVH 4JN1L 3IAQA 1RFDH 2FZ3A 1R5WB 4U1GB 1XZ0A 3GSNH 2CIKB 2GK0A 1MQKL 4QXWA 3C6LD 4OZGE 4CU6A 3FB5A 1WAAE 3GMQB 5FM5O 1RIHH 2VYRE 2Z31C 2V5TA 3U46B 2V6HA 3RWIB 2DQFB 4Z78B 1JWMA 4NZTH 1VA9A 5E94B 3RDTA 2W0FA 3UTZA 3AAZB 3K46A 5JR1L 3QFDA 4APQC 5BCAA 1VESA 1QLFB 5BO1L 4X6EA 4XHQA 4XI5D 2DM2A 5C0DA 1KB5L 2ARJA 1AQKL 3FN3A 4KMTL 5SWQB 2QQNL 3V6ZA 5TH2B 2E9BA 2OI9C 4LHUD 4PGDB 3H42L 1IGTB 3E6FA 5E2UL 1TNMA 1MAMH 1EFXB 3W0WB 3IETA 3B83A 3GHEL 5FHAL 2IADA 1FYTD 2ZUQC 1K8IA 3PDDA 2B8OT 3EYQC 1WK0A 1RZJH 4G8EB 4CU8A 5D71L 4LQFH 5FYJH 5KZCB 3G9VA 3TN0B 1MCJA 2VDML 3OB8A 4A6YB 1JGEA 3C5SB 4KWUA 2CJUH 3V5HB 4AY0A 5DRWB 3LRGA 3GO1H 4FMFA 3G5YB 3QCTL 1MFCL 4HS6A 2LU7A 6CGTA 1K3IA 2XKSA 1I1FB 3BW9A 5MERB 12E8H 3BUYA 1U9KA 4XRCA 1JYVA 3VGDA 1DN0A 5DFVD 3L5XH 3L95A 4IIQC 1GGTA 1HKFA 1CXHA 3FOMA 1YQ2A 4I2XA 2OP4L 1AE6L 3SE4C 3K1KC 4JQXA 1MCWW 4HUNB 4PJBA 5IOPB 2ZKHH 2PYFA 3SDXA 4LLUB 2H3NA 3RIAK 4Z77B 4WEBL 4P2OA 4E0RB 5CSZB 2M26A 1DCLA 2YPKA 3E2HC 3TT3L 3B5GA 2EIEA 4HGMA 1ACZA 1IKFH 5HHQB 1XGQB 3NVQA 5CJBA 5JW4Q 2HP4A 1X5HA 2I25N 3U0WH 5E99L 3EO0A 1MCRA 4LCIL 1LK3L 4KVNL 4K9EL 4KZDL 4NQUA 4HWZA 5C0CE 4JY4A 3UZQA 3ZYIA 3DLQR 1GHFH 3TBSA 2V7NB 4HAFA 4ZXBC 3IFNH 5C0JA 5DO2D 5EB9A 3UYOD 1GGIH 1F90H 1KXQE 1FNSH 5DD5L 3V9FA 1HOCA 4O51A 4TSAL 4O2EA 5I73C 1EO5A 3P9WB 1JK8A 2CGRH 4GS7B 4RWHA 4ZSOA 2J5LB 1BWMA 3T0VA 1A6UH 2EICA 5FO8B 1RZKC 2ZOKB 3X14A 5CWSB 1XF4B 4MAYC 4R26H 3QDHA 4L8BA 3ILPA 5JXAL 5DVNA 2H1PH 5D6CB 4Z5RA 2WIIB 4CDHA 4UQ3A 1RMFH 5FDWB 1ZEAH 3QUYA 5ESQA 3ZKNC 4Y2OA 1MEXL 1AGDB 4R0LA 2QR0A 4HUMB 2EDOA 1YY9D 3LIZH 3KLDA 4X6CB 3N1FC 2YEZB 1M05A 3DO3A 5IP4A 2JJTC 3LKRB 1WGOA 4KKCC 3RBSA 2CRYA 4I3RL 4IRZH 4QT5B 1RK1A 3EDFA 5EORH 2PUQT 4JB9L 1G84A 1P84K 5IFJA 5AUMA 1QTYT 2IEPA 3O2DL 5DYOA 1QZ1A 4D9QD 4G8GA 1T89C 5EC1B 4TVPE 4KGJA 3IKKA 3S96B 4M6OH 3IDIA 2WBJB 2ZSVA 5C08E 3TO2A 3T4AA 3BPCA 2X4NB 5EO1A 2FCBA 5E9DA 2VXSH 5E5MB 1UWEL 4YIQB 4HULB 3DMMC 3U1SH 1EHLL 1MUJA 5BMFH 2R4RH 4QF1A 5DMJB 3BMWA 1IGFL 1M6OA 1WTLA 5C86A 4JDTL 4HAGA 5MEPA 1MJJA 1RULL 2ED9A 4TOYL 1D9KC 1P7QD 1XR8A 2R9HD 2VR5A 3BT2H 3JWDH 5EBLA 4U1NA 4KTDH 4NGHH 1S7UB 3KPSD 1INDH 3G6AB 2KQNA 4P5KB 4RBPH 3SGEH 2A6KB 3U79A 1PY9A 4FFWD 3MLUL 1VGKB 3MRQA 4IMLB 3DX7B 5EU6E 1QO3A 4HF5L 4WIQA 5BV7H 1WBZB 1BPVA 5ERWB 3MOBH 3VXUB 4RA0C 2C1PA 1A4JA 1FNEA 5DQ9B 1AO7D 4ODXB 5AZ2H 5HYJD 3HG1B 1NLDL 3I84A 3G5ZA 3MGAA 4KKLC 1VFAA 4I77H 5KSAC 1A7OL 2E9JA 4ODHH 2X10A 5FYKE 2UWEF 1A21A 5BOPA 35C8L 3O45A 5ETUB 3ULVH 1KG0B 4XXCC 3MV8A 4LIQE 1MCCA 4HEME 4PJHE 3PWJB 4NCDA 3CC5B 1XGRA 3O6FC 1F58L 4KPHH 1KXTB 1U36A 5A3IC 4PY7B 4TUKH 3G5VA 3CFJA 5I16B 3QDGB 4X9GA 4A2LA 5LBSL 5HYQB 1OTSC 3FFCD 1ZVYA 2IG2H 5DJCB 1UZ8A 3FHAA 5IVXA 2AEWA 2RFXA 3PHQA 5F7LB 4M8QA 4Z7WB 2JJWA 4C57C 1QEWA 2JELL 3WXWH 2VXUH 4HUXB 5HYEA 1GGCL 1RJLB 3ARWA 5SWSD 3SOBH 4L4VD 2X89D 4LARH 4JKPL 2P8MA 3HUJA 4BQ9A 3VFMB 3MLYL 5F7HA 3HC3L 1DBML 3QI9D 3FTGA 2GY7B 3O3AA 4OGXH 4R8WL 4D8PB 4XWOD 4AMKH 4WJ5B 5D1ZA 1M4KA 4UT6H 2GUOB 4LHUA 1IAOB 4ONGH 4OZHE 2NTFB 5F88A 5DFTA 1GCFA 1M7IB 4HGWA 4N0UE 3RVTC 5HHVH 2VITA 4FXKA 3MUHL 4XP9H 1LWRA 4QHLA 1FFNA 1XGTA 3D1MC 4BYHA 3QAZC 1INQA 1QACA 5JXED 4O9HL 3SDDA 4GKNB 4K55A 5D7IE 1D5IL 2RAMA 4PP1D 4MS8D 1PGRB 3RL2A 2EDHA 5LCVL 1XF1A 5J1SC 1G6RA 1GAFL 4KI5F 1EJOL 2GAZA 3I02A 3QIUC 3PG2A 2P8LB 3S35X 5JHDD 1X7QB 4F58L 4PJ8D 4LLDA 4QRTB 5F97E 4AENB 5IB2A 1MCSA 3OZ9L 3TCLB 4Y5VA 2X6MA 3QUKB 5CEZH 1WSST 5I0ZA 3RWGA 3HNTH 4JRYD 2AJSL 4TNWK 4X0KA 3B9AA 3W5MA 3L3DB 5DD0H 3PQYE 3MBEB 4IM8A 4PJAF 5HHOB 1Q9WB 2H32H 2EDRA 3MLWL 2NY5H 4XCYB 5B4MD 5BVJB 2DIBA 2FIKB 1OSZB 4J4PC 4MQXC 2XZQL 1U3HC 3O0RL 4HK3J 5AAMA 4RSVA 1WEJL 2AEQH 3OBAA 3RWHB 4NP4H 3MXVL 3GMPB 1CXFA 4OLZH 3W9EB 3IDUA 5F9WB 1YEIL 1BD2B 3UBXB 1EK3A 4LASL 3HPLB 4ZO8A 4ZAKC 1YYLH 2DI7A 4LCCB 3DUSA 4YXLL 1MFAL 5MEQA 3FQRA 1J5OL 1LK2B 2NR6D 1C5CL 2ZOLA 1J1OH 4I0PB 4O2FB 3FQUA 5JUEL 3IB4A 4HIXH 4Z7VE 1G7HB 2DLIA 4L9DA 2YZ1A 1HHKA 1MCOL 2XT1B 2O5XH 3VFSA 1FJ1B 1A4KA 3OJ2C 1H3VA 4KUZH 4Y8DC 4TRPL 3X13B 4LK4A 4OI9A 4BSJA 1MCEA 2Q3ZA 3U9PH 4ZO6A 2RCSH 4PJEA 3TV3H 4LLYA 5TQ0L 3BIKB 4YHPB 3STZB 1I3RA 3WHXA 3KJ6H 1GPOL 1PG7L 3FOLA 3WFCH 3LN4A 2ID5A 4H20L 2N7BA 4ODBD 3ARBA 2HT3C 3U7AA 3NAAL 5CJQL 4FZ8H 3P0VH 1NMAH 4ZD3L 5JORA 3WV0A 2ZPKH 2B0SH 4QXGH 4HIEB 2VXQL 4L29A 4YBQC 4Z7UF 5D1QB 5AYQA 3V6OA 4NRYA 1KENH 1QFWI 1HK6A 4LLMA 2ADIB 1DBBH 4XP5L 4ZNEA 4FZEH 3ULSB 5D2LA 2DQUH 4L4TB 2R56H 1FYTE 2QHRH 1YEFL 1FL3B 3D9AL 2WZPD 2VR9A 1LE5A 1WC7B 4YDLC 4E9LA 4LL9A 3A6CL 1IGJB 3RQ3A 2ZUXA 4LP5A 3F8UB 4R4ND 3QPXL 3HNSL 4O4YL 4PV9B 5BS0A 4TUOB 4EDXB 4P3CH 4YFDB 1UCBL 2GT9B 4NHCH 1KGCD 4CJ0A 3Q5TA 1FO0B 2ATPA 1AO7A 2C1OA 5HYJA 2BP3A 4L3EA 4OV5A 1A1OB 1H3PH 1IFHH 2ZSWA 3MLSH 4IHOA 3HNVL 5HVWA 3GIVA 2IGFH 3BQUA 3FT2B 5C09E 3PV6B 5EOQH 4OQTH 3WJLC 1BLNA 3HLAA 3Q6GH 4ZUSA 1Z0NA 5C0GA 3RUGF 1TVHA 3D6GA 3B5TA 5ICYA 3UTTD 4LCYA 5IG7A 1SJHA 1NBZA 1D3CA 5IHUL 3WJJA 4LU5L 5GRZA 5GSVB 4LGPB 1CLOL 1NBVH 4NN6C 4X7SL 1IVLA 2D7OA 3QDAA 4E41D 5ABDE 2MWCA 4YHKH 1AGFB 1T2QH 3DBXA 3I75A 4HJGB 4W6WB 3IGAA 3GMOA 3OF6D 1KB5B 4HV8B 4PJCA 4YXHH 1A7RH 1FG2B 5TDPA 2AEPH 3THML 3PHOB 3WFEH 3LEYH 5SWSA 1S7RB 1JGVL 2DTSA 3GGWA 4OD1H 1J8HD 5FA3B 1QLRA 5T33L 1CXLA 1HWGB 4GRLB 2EE6A 1B4RA 2IBZX 1JHKH 2VQ1B 4U6XB 3PIQA 4FQXB 4RZCB 4IRJB 4M4PA 3Q3GA 2VLRE 3V5KB 1ZT7A 2HT4C 3TO4A 2O61A 3ARVA 1N5YH 4WFED 2YK1L 3GB7B 3MRLA 3PGCB 5DJYA 1P6FA 3S8WA 3QZWG 4OJFL 1I7TA 1EAJA 2A6JB 1RU9L 5F1SA 2HVJB 4XBGA 5DA0B 4OZFA 2HN7B 3QISA 5MEND 5E5UB 4X7FC 4WWKC 1D5XA 1MJUL 1KEGH 1KN4L 5JHDA 1KELL 4K2UH 5EBWA 1KACB 4OZIE 1J7VR 1VERA 2DICA 3BISA 3V0VB 4PJ8A 4TSCH 3S5LB 4PJFB 3Q6FB 4U31A 1F3JB 3GIZL 4RAHA 3U9UA 1UXSA 2CLVA 1MFDH 2HWZL 3OAUH 4GSDH 4AH2A 3IS0X 1RD6A 1I3VA 5KVGH 2BY1A 3TZVC 4YLQT 2I07B 5EU3B 3MOAH 2VLJD 3KYOA 4K23H 3VXQB 3GNMH 1EEYB 4WW2A 4RIRB 4ZDHA 4MVBC 4KKAD 2P24B 1OP9A 1V3KA 1ZOXA 3IRPX 3MCG1 4F80A 3DVNA 3L3GA 4LEOB 4PJDB 2WWKO 4JKMA 2FJGB 2DOCA 1MRFH 2EO9A 4WI6A 2OBGA 1ZA3A 2H41A 4XNXL 4BQBA 3KPSE 4HKXA 5DEGA 1YMMD 3SO5A 3R06A 3ZDXF 1J0IA 4IS6A 2JCCE 3T04D 3L3KB 3JUYA 2VE6A 1HHGA 3U0PA 3JV4A 2HTLD 4D0BB 1A6AA 1J10A 4JDVA 4LRIC 4LMQE 3RWEB 3O6LH 4AZ8A 1KBGH 4DJMA 1KJVB 4YHYB 3O9WC 1RVFH 1UGNA 1U6AL 2IH1B 4LCWD 5I1KL 4QWWC 3FT4B 5DVKA 2QV2A 2JTDA 4EIGB 2PF6A 2R1YA 1NAKH 2VZ1A 1VFMA 1KB9J 3IYLW 3WKML 3K4DA 4XVJH 5JW3H 1SYVB 3TJHD 4EXKA 4PLKD 1WWBX 3F5WA 3L6FB 3L3OA 1INEH 3MMEA 1MI5B 5ALCH 4LVOC 3T1FB 1IJ9A 4WI7A 3FFCE 3LDBB 3L3IA 4KROC 3AU1A 4P2RB 2ICWB 4YBLB 2DQCH 3CNKA 1CDYA 1GGBL 4P23B 5HDBE 1YPZE 3MRDA 5DS8A 4NZRL 2B4CH 5EO9A 4NQEE 2GTZB 1ZLVK 4G5ZL 4L4VE 2B39A 4MSWB 4F7MB 1DP0A 1WBXA 1A7PH 1QSEB 5IMKA 1FL5A 5AZEL 4HC1H 1AHWB 4X6DA 4P4RB 1H3TA 3NA9H 2FX7H 4APQD 1QVOA 5HYSB 3L5HA 3VH8G 5L8LB 5DJAA 3DV4A 1AIFA 1BQUA 4PJXE 3TT1H 2R1WA 2DLEA 4OFIA 4TVPL 1T80A 4ODTL 5EFIA 3ULVE 1Z3GL 3MRGB 2ENSA 3MBXL 4BZ1H 1KJMB 4JZJA 5KSVA 4G8FA 2AV7A 1E6OH 3VXME 4OGYL 5JPMB 1P4LB 3AREC 4KI5C 1WLHA 1SEBA 2X9WA 3HZYB 1JPGA 1BWWA 3BXNB 5M94B 3ECBB 1EHAA 2QADC 3TNNB 1QRNA 3MZGB 2EYTB 4QXUH 3OKMB 1B90A 1IKNA 1KIRB 1A14H 1JMZA 3DNKA 4Y4FC 4AM0B 1BHGA 1OGAD 3VFNA 1HEZA 5IFHL 1BFSA 1PSKL 2IANA 3V8OA 4GAJL 4JRYE 2IFFH 4PJ7F 3T3ME 3ZTJH 1HHHB 3MSPA 4OIIH 1J0ZA 1NCAL 5DFWH 3SGKA 4M7KL 2DTML 3B6SB 2A1WH 5FECA 3CSBA 4MAUL 2J88L 3UTTA 5HGHB 3ULUL 1CD1B 5KG9B 1XIWC 5T3XL 1H0DB 1NMCC 2AJVL 1TITA 2DKMA 3KDMA 2FX9H 5IVZB 4OLWH 4C55A 4E41A 3KNBA 1U95A 4H5SB 3O3DA 4GQ9H 4LVHB 1UJTA 4BH8B 5KVFH 2DD8L 1T0NB 4RFOH 2P5WD 4ZXBD 1YEJL 4H0HB 4I0CC 5I76B 2A6IA 2NY1C 3BD3A 1EPFA 4RRPA 2C7UB 3NCJH 3BDXA 4CUCA 5C0FB 4OCYH 1AH1A 3QFJD 1R3JB 1FIGH 1NKOA 1GC1C 5DJ2B 3WD5L 4XWGL 2AJXH 5IGXL 3D39B 3U4BH 3VI4F 3KYAA 4PS4L 3VXOB 2NY5C 2EDQA 3HI5H 3P77B 4HMEA 3GKZA 2V2XA 3QH3B 5LWYL 5CEZE 3ARGB 1A6WL 3JWNC 1AXSB 1RURL 5IV2A 5SX5H 3VXRE 1DFBL 3QDMD 3T2OA 2X4OB 1S7WB 4RAUB 3K7UA 1M7DB 4X83A 2R15A 1X3DA 5E7FA 2YD8A 1P7KA 1S7XA 1ZS8A 3KGRA 4D2NA 1ZHKB 2XZAL 4DQOL 2CRIA 3C5JA 3QHFL 5IBLC 2GEEA 5MENA 5F7KC 4Y2DB 2DMBA 4XNQA 5TF1L 1FCCA 3SDYH 3QA3A 1MHPL 1S7TB 2JB5L 5IEHB 5E6YA 2ITCB 3EKCA 4X7DC 3GI9L 4POUB 3QWOB 3UJTL 1JGLL 1HDMA 3LAFA 1HXYA 1PDKA 5D93C 5GZNC 4MA3B 5EZOH 4WV1C 3KVQA 3LQMA 5KS9F 3V4UL 3RWDB 1PD6A 4NKDA 4NRXB 2VLJA 4OIBA 4QRRD 5DHYB 2J6EA 4YDIL 4OF6A 2ZZUT 3TIEA 1F4AA 2IFGA 4HH9B 2IPUG 1RZFH 5DMGC 5DR5L 4NKIL 3K2MC 4QRQB 3RWCB 3SDAB 3STBA 3RY4A 4QYOA 3WEXA 1IGML 1X5XA 1G1CA 5JW4R 4HS8L 4JM2F 1B3JA 3RPIB 4PRID 4U2YA 2VMFA 4OSUL 3ZKMD 1ZMYA 5FM8A 5BRZA 3NFPA 2Y72A 1OAYL 4JPVL 1CYGA 3UTQB 3BUTA 3DX8A 5IIEB 4CVZB 4BKLA 1KGCE 4N5ED 3CK0H 4KZEH 3ROLA 3H9SE 2VRAA 1IGYB 2BOCA 4FQLH 1JWUB 2J2ZA 5ADPL 5GS1C 2RJMA 5KSAD 1FE8L 3I6GA 3PWNA 1NAMH 3HC4L 4PREB 2X2YA 4U1SB 2VLKB 1QR1B 1E4XL 3ZE0E 1H5BB 2AXFB 3CSYA 3OKEA 4YHML 4HQQL 4WI3A 3PHSA 4NKOA 1KJ2H 2DMKA 3T0EC 2FSEA 4DKAA 3JTTB 2X41A 5HI3D 5IKCB 3LRHA 4MD4B 4OTXH 5MEOB 3L1OH 1PW3A 2M1KA 4MNGB 5T5NF 1FIEA 3O6FD 3JVGC 1NBQA 1EAPA 2OQJA 2NX5A 1A0QL 5F1IB 4NSKB 2EDBA 5A3ID 2D9QB 4M7ZC 1RPQA 4NJ9L 4GBXB 3WXVH 3FO1A 1VEOA 3DGGB 5I30L 1OTSD 4OD2A 2Z31A 5GGVL 2ZUUA 5A2LH 5LGKA 2EEBA 3AS1A 2HJFB 3HFMH 5KSBB 5C2BH 4W81A 4HGKC 4NQDE 3ZDYE 4APQA 4BUHA 3CJJA 1FZMA 3MRMB 4GAGH 2Q8BL 1UB6B 3PDOA 2BNUA 2MOVA 4FXGB 5D2NE 2V7HA 3O4LE 1T0MA 1SVCP 3D69B 1IGIH 4ALAH 4QHUB 1CCZA 1ITCA 1WV7T 2G9HA 5LVEA 3CXDH 4H88L 3RKDC 4GAYA 3MRBB 1BIHA 4D0CA 1EX0A 2KPNA 4M43H 1HINL 3FZUC 5E2VL 1SY6A 4D9RE 1FH5H 2EH8H 5T1LD 4AL8H 5LQBL 3RGVB 3PWVB 1I8MA 4WFFD 3TBWB 1JNNL 1YNTA 4OAWB 3V95A 3QXAA 3QXUA 2BY2A 5C92A 4WTZG 1X5JA 4JFED 3IJHA 1G6RL 3E8UL 1OGAA 3QIUD 2Y6SD 3KAAA 2R0WL 3N85L 2G2RB 4IIQA 4ZOAA 4G6KH 5C6TL 4GW5A 4ELMA 1MHHB 4LKXB 2BNQB 1B4JL 3SE4A 4JY6B 3D85A 2NY0D 5ADOL 1F11B 1HCFX 4JPKH 4MDIA 2VDNL 4DUWA 4Z7NF 2EDDA 2YD5A 3GSOB 5DLMH 5CMAA 2O5ZH 3W39B 1RZ7H 4OUUA 1Y18B 2N7AA 4J2XA 4UV7H 1VGEL 5I66A 1T1YB 4UB0L 3MV01 3OR7B 1QP1A 4NC2B 1YMME 1CU4H 1K3ZA 4MQXD 5GS0C 5ESVB 1OAKH 1U3HD 2A77H 2CDFB 2DDQL 4ZXBA 1SJEA 3WIIL 2BSRA 1RUKL 1ZVSB 4HKZB 3VWKD 5JA8B 3QFJA 4FQQA 5FHBH 1Q1JH 5K9JH 1NDGA 5L2KB 4ZAKD 4JAMA 2ATKA 2A73A 1BM3H 5BZDA 1IAIM 4CRPA 3UTSE 5MHSD 5D5MA 1BECA 1DQQB 4LCWE 5CZVL 4MLSA 4LAQL 4MAYA 1SBBA 4CBPA 4XPHL 4YR6A 1R24A 1NFDE 5C0AD 3MRKA 3FQXB 1H15A 2NY6B 4NQSB 4LCUA 5F7DA 1MCPL 5TDNA 2NY7H 2PTUA 25C8H 1DQLL 3R8BB 3U6RB 2AJUL 1ORQA 5L8JB 3N1QC 2FJHA 1UENA 4LRNH 4ODVL 1PYWA 3QXDB 2W9DL 5HGAA 5BW7C 4F57H 3ESUF 3H9HA 5BXFB 1Q94B 1GL4B 2OL3H 2JJTA 1ZGLM 1S9YB 1I8KA 1LO4H 3VFTB 3FQTB 1CICC 4ODSH 3ZTJG 1CGYA 4WTXA 2WM0A 3WNPA 1FGNH 2ITDB 4LSTH 5AWNH 4G42A 3L3HA 4EUPA 1T22B 3NFNA 4J12A 4YPGA 1YY8A 3BRGC 1CL7I 1T89A 3GSXB 1CDBA 2J12B 3EOTH 4YBQD 3C5ZC 4RMQA 5DDHB 5KOVC 4PLJD 3G6JF 1YECH 4QRRA 1YYMH 4S1SL 2MCPH 1Q0XH 4YFLF 4YAQB 3DMMA 1C08B 2VOTA 3LEXA 2VAJA 1U58A 4OFKA 3ZSSA 2BVTA 4NO2B 1U8MA 3MRFB 5TE7H 4MNQB 4YUEL 4P49A 4Z6AT 1NL0H 4JO2H 2O5YH 1D9KA 3DRQA 3PWUA 2AJYL 4EN3D 3QXVA 1ZT4A 2H2PC 5B8CC 4XMLH 4K7PY 1YEEL 1YJDL 1TQCB 5I8EB 5ITBH 1V3MA 3W2DH 4H8WH 2H9GB 4Z7QE 4GG8A 1EZVY 4HBQA 3QO0A 4L1HA 2PXYC 3OXRA 4P9HH 2OJZL 1NCDH 3VRJB 5KSAA 1UJ3B 2IC2A 1CZ8H 4KFZC 4MXVE 4LSQL 4YDJA 4TSBH 1D6EA 1FZJA 1FNGB 5GJTL 2I5YH 2W9EL 3H7LA 4XXCA 5IT2H 2XTJE 4RCAA 4N0YH 4KRPD 3UEZA 3GK8H 2EDKA 1XZ0B 4OGZA 3NFSL 5FA4A 3TPKA 1FNFA 1FBIH 1PKOA 2WK2A 3TA3C 4WDIB 3FB5B 2NY3C 1I1YA 3O6FA 5D1XD 2P5WE 1A6VL 4JFFD 4RGNB 1HILA 2W0FB 5TDOA 2AQ1A 4YHOH 3UTZB 1KCVH 1N8ZA 1OAXL 4HEPG 4X6EB 1QD0A 3WNOA 5C0DB 4JKLA 4I18C 1CGSH 2ARJB 3VXSE 5HY9A 4H1LG 3V6ZB 2XQBL 3C2SA 3P4NB 4NWUL 4MJ2A 3SDCD 5EC2A 3FB8A 3EJZC 4WHYG 3QDME 2VISA 5FUOH 4FQ1L 4ZUUA 3IETB 5J12C 3HE7C 3IDMA 2IADB 1FVDA 1K8IB 5E1AA 4WUKH 5I9QB 5F44A 4JHWH 1KTLB 1XGPB 5IW1A 2FH6A 3WUWG 4HPYL 1JGEB 2OX5A 5B3NA 1ZLVH 4LF3A 6FABH 2HT4D 4KV5F 5D7KE 3O8XD 4BQCA 4J3SA 4HS6B 3I85A 4NFDA 3PL6C 2WUCH 1MJ7L 1W2KT 1BAFH 3F58L 5GRUH 3BUYB 4U2ZA 4XRCB 5I1HH 3FT3A 1W72A 2OK0L 1Y0LA 4U6HA 3WIHL 1JGDA 3L95B 2Z35A 3PP3H 3ZKXC 2JJVA 4J3VA 4DTGH 2QHLA 4JM4L 4I2XB 4JFEA 3QDJA 1LVEA 3LV3A 4KI1A 4A6YH 2VDQH 3HC0B 1JV5A 3QIUA 3VXTA 4PJBB 4Y16D 4PR5A 3X11A 5GGSA 5DQJA 4GAFB 2A0LC 4Y5YC 2F19L 3SDXB 5DGQA 2LAGB 2H3NB 1IM3A 1T03H 3GI8L 1R3IH 2PYED 5SWZD 4P2OB 2D7TL 4YBHA 2WLZA 5EIIB 2YPKB 2VXUL 3RVXC 4MA7L 3T0AA 2EEDA 1HHIA 1HHJA 1RJZA 5CILL 1KCLA 1FZOB 5EOTA 1JPTL 4FQCH 3EO0B 1TJGL 4JM2C 1AGCA 4HWZB 2VABB 1FGVL 2W38A 4PRIE 3NGBC 1UH4A 1N6VA 3VFPA 5BZWA 1MQ8A 4GLRI 3L5JA 4J4PA 1IC4L 1U3HA 2QQKH 5HI5D 1HOCB 4JVUA 1KF9B 4O51B 3L5WA 4O2EB 2NNAA 1QSFA 1FC2D 3GMNA 4ZSOB 1IT9H 1DL7L 4MD0A 2CLZA 3DV6A 5I8KH 1EFXD 4PGZA 3SE8L 4PBVC 1A1MA 4ZAKA 2FL5B 1OOAA 3X14B 4P9ML 1NGYA 4LVNC 5KZCD 4LNVA 1F97A 4L8BB 4S1DC 1UC6A 4Z5RB 5GJSL 3KPRA 4Q7DA 3SCMC 4UQ3B 1U42A 4I13B 1C5DA 5J7CC 3N9GH 2P5EA 3QUYB 5C0AA 5ESQB 4ZYKB 5KJRL 4XNUL 4R0LB 3FONA 2QR0B 1EH9A 5CFHA 2OCFD 5I1JL 4K3DL 4ERSL 3OPZH 4RMSA 1HKLH 1V8HA 3BN9D 1RUPL 1Q9OA 1M05B 4P46C 2EC9U 4YDKH 1JHTA 3BJ91 1RK1B 2V5SA 4PTTB 4GXVL 2X7LB 3E3QC 3S97C 2NY2C 4NOBA 3T0WA 3VD9A 1CTOA 2YKLH 4JO4L 1OLLA 2PR4H 2P1YA 2WLYA 4YNYA 4LGRB 4KROD 5DYOB 2JKXA 5F6HJ 4K94H 1NMBL 4OF5A 4PGBA 3REWB 2HH0H 1BBDH 4OCNC 3PWPA 3U30B 4CMHB 5T1MA 3IDIB 4I3SL 4WENB 2ZSVB 3TO2B 2NZ9C 3BPCB 3T4AB 5EO1B 5E9DB 3WL9A 5JOEA 2XN9D 5B22A 1ZLSH 1OSPL 2GJ6A 3HI6H 2YA0A 3QWRD 5ITFB 3GSWB 5FUZH 3DGCR 1MUJB 1J88A 1K2DA 4QF1B 4KJWC 3RU8H 4M7LT 4PJIE 1M6OB 3QEUA 2FEEI 2LV4A 5E56A 4YHLL 5FB8A 5MEPB 3ZDZE 1MJJB 4YE4L 1TETH 1XR8B 4QCIA 3Q48A 4RGMC 5EBLB 1JNJA 2EIDA 5DEZA 2FB4L 3MRQB 1KCSL 1NLBL 5IUSA 1QO3B 3OKYA 2MPAH 2F54A 4DN3H 1WF5A 2AGJL 3AB0B 3ARED 4KI5D 5HDLA 5HHMD 1HN1A 5C09A 2IWGA 1FNEB 1S5IL 2CMRH 1IEBA 2QADD 1UVQA 2W0LA 1VFAB 5DWUH 1MNUH 2R69L 5ESAB 4ODUA 4JHAL 2FJFA 4G9FD 5JO5A 5C0RH 3ZT7A 3O45B 4EOWH 1ZK9A 3GSUA 1HXMA 2D4DA 2BVPB 4RNRA 4UOJA 3WJLA 5EU7E 2HKHH 1P4IL 3WLBA 2ZWLT 1XGRB 5C1MB 4IMKC 3FQWB 2DBLL 4ZUVB 4OGAC 5IB1A 3CFJB 3UAJC 3C6LB 1CFBA 4PFEA 1QNZH 3CLFL 2DLFH 5EUKA 5MP6L 5IVXB 4JZOA 1MVFA 4JFDD 3T2NH 1MFNA 2RFXB 3PHQB 5FGCE 1PLGH 4M8QB 1DE4A 3VFOA 3TYGH 3BAEL 2D7PA 1QEWB 4OCXH 3I9GL 1NPUA 1F3RB 4ONHA 5I8CA 2NY1D 3HUJB 1D5MA 1UXWB 4LSPL 4UNUA 3O3AB 4NO0D 5IR1A 2VLRA 5TQ2H 3LB6D 3KPNB 4LHUB 5F21B 2E7BA 1AJ7L 1Z9MA 2GJJA 4HGWB 4G6MH 3QEQD 3HZVA 2Q6WA 4OF7A 2IAMC 3LRSA 3TH2T 4QHLB 1FFNB 1XGTB 3O6KL 1ADQH 3X12B 1INQB 4NNPH 1J87A 4QTHA 1FSKB 3F7QA 2JJUA 1TJIH 4JO3H 4RFNB 3P4MA 4XVTL 1C1EH 1ZANH 4RA3A 4BQ6A 5DHVB 2XWBA 2DQGL 3CMOH 4OZIA 4PRHD 3MV7A 3RL2B 3JZ7A 4X5LA 3K0WA 1OCWH 1G6RB 3SKUD 3BZEB 3DVGB 2ESVE 2GAZB 5FCSH 3TGXA 1IC7H 1BVLA 1X4XA 2DJ4A 2A9NL 5CUSH 3T09A 4LLDB 1S7QA 5IB2B 4WWKA 4KJQC 4KK8C 4L8DB 4Y4HC 4XPFH 4BELD 2E6QA 3BPNC 3BYYA 2AXGB 1N2RA 1B0RA 5SWZA 5C70A 2PYEA 2E9WA 5HHXL 1ZGLB 1WWAX 1OAZL 5GZND 1U2CA 4Q9RL 1MCLA 5DRNA 3TZVA 5ISZD 3BP4A 4M5ZL 1PFCA 1U3YA 4HLZH 5GIRA 3IF1A 3WO3B 3QUXC 2FEDD 1N0XH 4DUXA 3OB0K 4MJ6A 1LO0L 5D6DC 2J6EL 1EGJH 1KEML 3QQ4B 1NANH 4PP2A 5DMGD 4WI8A 5HTSA 1Z0MA 1FC1A 1DBJH 4UDTA 1CL7L 2DL9A 1DEDA 3JTSA 4JFPA 1KC5L 3ALPA 3GZKA 1KCUL 1HZHH 3DUSB 1F4WL 1MJ8H 5MEQB 1FCGA 3FQRB 3VRLF 5CP3H 4JPWL 1DEEA 1KNOB 2F5BH 2ZOLB 1HSBA 3FQUB 3O2WH 3VFRA 1RUMH 4UOW1 5EH1A 4S2SA 1UEMA 4LRIA 2UWEA 1HHKB 3P30H 4MJIA 3VFSB 1CN4A 5IFAL 2ZUTA 2YWZA 3O9WA 5D9SA 1Q9LB 3MXWH 1JHLH 3R4DA 4DGYL 1JF6A 1G6VK 1MY7A 2XQYG 5HGGS 1FDLH 4PJEB 4LLYB 1G9MC 2WNGA 3BPLB 3QHTC 2G60H 3L9RA 1I3RB 4GMTH 4KKNA 3WHXB 5L88L 4XNMA 3T0ED 4LFHD 2Y06H 3LN4B 4PB0L 3C6SB 1QYGL 3UO1L 1IAII 5E8EA 4N5UA 4HJ0C 5JORB 2VDRH 4P9HC 3LKNA 3VFVA 5H94A 3GBNL 1D6VL 4L29B 1KFAH 4HIJA 4U0RC 2CKBA 2XACC 3OJDA 2IQ9H 2E6PA 3RA7L 2YPVH 4NUJA 5GGRA 3ZTNL 3NIDF 1MCNA 1WZ1L 4LLMB 2PTVA 4QTIH 4K07A 3A0OA 1A6PA 1KIQA 2VR4A 5D2LB 1QSVA 4EBQL 1CLCA 5E2WH 1GXEA 4PB9H 3IS1X 5I74B 1EV2E 4FQJH 4ZTPH 3IDJB 1LE5B 4YX2H 1PVHA 3IFOA 1ZHLA 4FQ2H 3CZJA 2E7LA 1L4IA 3LN9A 2CD0A 3GHBH 3KPSB 3RKDD 1CD8A 4PJGE 1F4YL 3WSQH 3DHMA 5DJXA 1CFQB 4G7VH 3HB3D 3AREA 2JK5A 2FHCA 3RI5F 5E00A 3WIFA 2ATPB 3WE6B 1AO7B 1OTUC 2C1OB 2E27H 5F1NA 5HYJB 5TFSL 2EXYC 2H45A 1A47A 5GISL 1HIMH 2FGWH 2ZSWB 4IHOB 3CZFA 4Y4FA 1RHFA 1ZLWK 1CE6A 3GIVB 3Q1SH 2IF7A 1ZLUK 2NXYC 3T0BA 1CR9L 1BLNB 3HLAB 5FO7A 3QUZC 3ROOA 5DJ0A 4ZUSB 2HFEA 4ZOEA 1WWCA 1DANU 2BSED 1ZT1A 5DRXA 5C0GB 4JVWA 3GJFK 1V05A 3NABL 5CJ8A 4Z8FH 4P2QD 5KTEH 4PJAA 1FO0H 4P3WA 2WV3A 2FWOA 4C54A 4NQXA 5IW3A 3ZZ1A 3ZO0A 1UM4L 4I4WA 4DAGH 3NA9L 4Y4KC 2WUBH 3CCHA 5I8OH 1XIWA 2ZCHL 4HZLA 1T3FA 5F89A 3PNWB 4NUGH 3BSZL 1OF2B 3O41A 2KKQA 1NCCL 4F8QA 3FFCB 2RHEA 4YHIA 1T7WA 2WW8A 4JN1H 4A2MA 1I9JL 2QSVA 1ZHNA 3GMOB 3LZFL 5J8OA 4PJCB 1MQKH 5F72S 3RL1B 1YPZB 5CINL 5GS0D 3W0WE 4L4TD 5SWSB 4XGZA 4FN0A 4L4VB 3C08L 4IOSD 1UCTA 1JGUL 3IDGA 4P57A 1QLRB 4NO0A 2Z8RA 5L8KB 5JR1H 3MV9D 1U8NB 3QIWC 3P0GB 3VA2C 5BO1H 5ANMA 5FM4A 2F9BT 1KB5H 1AQKH 4KMTH 1A1NA 5E4EB 4G8IA 3PIQB 2QQNH 4JG0L 3U83A 5IMLA 3P4LA 3Q3GB 4WFHE 1GOHA 3VMNA 1DQJA 1RZKL 3H42H 3EYUL 1T1WA 4JRXD 8CGTA 5E2UH 1JZ3A 1BOYA 1NGWA 1QPXA 3GHEH 5FHAH 1RIUL 5FO9A 3SPVB 1LO5A 5DJYB 3DECA 2BSSA 4PRHA 4N8VG 4XPTL 5D71H 1JMXA 1I7TB 1X5FA 2BNRD 3UP1A 4FXLA 5C0IA 3EIFA 2VDMH 4XBGB 3LPFA 3PWLA 3P9LA 1L9MA 4W6XB 2NYYD 1D5XB 5JHDB 3QCTH 5EBWB 1MFCH 2CKNA 4PJ8B 4G6JL 4L8CB 2FD6L 1YQVL 4UBDC 2H26A 3U9UB 1UXSB 5ECJE 4AH2B 4Z7UA 1KUMA 2P45B 4YFEA 1WFUA 4WUUD 2OTWA 2XN9E 4XMPL 4DVBB 2OP4H 1AE6H 1S8DA 3IDXL 3OKOB 1C16A 3ZE1F 1LP9E 5HPOA 4WV1A 3KYOB 4LMQI 3QRFM 4S11A 2Z8SA 3N1GC 4DVRL 4WW2B 3EYOA 3C5ZD 4WEBH 1I1AD 1EVUA 4Q9QL 3TT3H 1AD0B 3DVNB 1FN4A 3L3GB 1ZA3B 3R1GL 2MSPA 4HKXB 1GGYA 5E99H 2GFBA 4LCIH 4R96A 5DEGB 1LK3H 1GZPA 4KVNH 4K9EH 5J6GA 4KZDH 3R06B 3HKFA 4AEFA 3L3JA 1WZKA 4LNRA 4MD5A 5DUBA 2L7UA 4HIHA 5KW9L 5TE4L 3QB7C 1NCBL 1HHGB 3U0PB 3JV4B 5DD5H 3BP6B 3FB7B 4HUVB 4TSAH 1DBKL 2OM5A 1A6AB 4JDVB 4DKEL 1TIUA 2H2PD 1GIGL 1OPGL 2VWEC 4YDVA 4G9FE 4X6CE 2LTQC 2APWA 5BQ7A 2WBJC 5GS1A 4WNQA 3RUGA 3SEPA 2R1YB 1T2JA 5JXAH 1B0GA 3HZMA 1CWVA 3T3PE 3L3OB 3RHWF 3MMEB 4ZO7A 1MEXH 2EDXA 3T0EA 3FO0L 3AU1B 4JFDE 5F7YC 2WQRA 2AJZB 1URLA 3TA3D 4R4BA 4AQ1B 2NY3D 5CSBA 2C3HA 2VUOA 3MRDB 4I3RH 1KV3A 3QT2A 3JVGA 5DS8B 1BFOA 2AI0L 2J8UB 3UPCA 4OFVA 1WBXB 3JWOC 4JB9H 3DYPA 2L7JA 5IMKB 1AXIB 1FL5B 4JREC 3O2DH 4X6DB 3IDYC 1P1ZA 2EYRA 2JE8A 1QVOB 1MREL 4HPOL 4HLZG 1LD9A 5CAYB 5DJAB 3DV4B 3DIFA 1AIFB 1I9RL 3CVIL 1QBLL 5E0QA 2R1WB 3QEQE 5EFIB 2HAZA 4JHZA 4GKSA 4MCZA 3ZYJA 3D3VA 3FN0L 5HVHC 3VXUE 4R3SA 1UWEH 3MRHA 4V2CB 3PXHA 1EHLH 1L7IL 4CL7A 4G8FB 4HFUL 4J6RL 4OF3A 5KSVB 4OLVL 3HG1E 5BVPL 1IGFH 1WT5C 1SQ2N 2CDGB 3C8DA 4JDTH 1SEBB 1JPGB 1RULH 4TOYH 5C0ND 1Z9SA 1F4HA 1QRNB 3P73A 4GFTB 3K8LA 2W9LA 3MLUH 1LEGA 5C6WH 3I6LD 4HF5H 4NJAL 1ED3A 3VFNB 1HEZB 2K1MA 3RWJA 4U1IA 2IANB 1AP2A 1EERB 4XPGL 2I60L 4OZ4A 4X6BA 1NLDH 4ONFL 4CNIA 1MI5D 4AQOA 3NPSC 1A7OH 2X4UB 1KPVA 5FECB 2A0LD 3RP1A 5ISZE 3BGAA 4P2QA 5GGUA 3UTTB 1JNHB 35C8H 4Z7WE 3VGHA 2IALA 5D7SL 5DGRA 4KK9C 1D7FA 2ZCLL 4K8RD 3KDMB 1J05A 2DF3A 3T0DA 4E41B 3BKCL 1KCKA 3BGFC 5JA9A 1U95B 4JM2D 3O3DB 3ME0A 5DUPL 1T7YA 1F58H 1HH9A 4RWYL 2FR4B 4X4XA 3EAKA 3AMLA 3DI2B 4NCC1 5LBSH 3FFDA 3Q5OA 1CG9B 4DOHB 1W0VA 4UUJA 2WINA 1BFVL 3OL2A 4KXZH 1JWSA 5E6ZA 1J8HB 3DUUA 1GVIA 2JELH 3EYVB 3HR5A 4HCRL 3QNXA 2FATL 1GGCH 1J0YA 4XNZB 2V2XB 4JKPH 5HJ3A 3EHBD 1YEGL 5JLZA 4I5BA 3MLYH 3HC3H 1DBMH 3VD7A 3MLVL 1EFQA 3OAZK 4PV8A 4RX4D 1TPXB 4R8WH 1IEHA 1IILE 2Y5TA 4Y19D 3U0TB 1I3GL 4R7NA 3W5NA 3CX5K 4K7PX 5C71A 5DD3L 3MA7A 3M1BA 1S7XB 1UZ6F 5LGHL 2QSCL 4JPKL 4UTAL 1EZVX 1G7QB 2BNRA 1I8IA 1NGPL 1NCNA 5I15L 4O9HH 3HS0A 4X9IA 5DJ8A 3QCUL 5MENB 3BZ4B 5TPWL 2NTSP 43CAA 2BERA 1D5IH 3JUZA 3BEWA 3QA3B 5BW7A 5LCVH 1IARB 4S10A 3WNKA 3RFZC 1GAFH 1EJOH 1CICA 1UEYA 1HDMB 4LCCC 1HXYB 1RV6X 4Q97A 3HMWL 4WUUA 4F58H 4R6UA 2B1AL 4IDLA 4UT9L 2HT2C 1NUDA 3S98A 4KU1A 3OZ9H 4NKDB 2VLJB 4NKMA 5HYIA 2NZ9D 1BD2E 2RGSA 3C5ZA 3TIEB 3GM8A 1JYXA 2AJSH 4I3GA 2KBGA 5FUCC 1IC5L 4D94A 5DA4A 4Y88A 4QYOB 3U36A 4U1MA 1K8DA 3MLWH 3D39D 1IC1A 2OR9L 2EKJA 1YMMB 3LKQA 5HD8D 5J9PA 1E6JL 3RZCD 5DSCA 2XZQH 5BRZB 3O0RH 3NFPB 1WEJH 4ZUWA 1T66C 2ZG2A 3QEHA 3S4SG 3MXVH 3ARGD 4BKLB 3EZJB 1LNUA 4YC2B 4NT6A 2GI7A 1YEIH 3H7BA 4KJPC 1Q0YL 4LASH 3QULA 4AG4L 1IM9D 2X4TA 3GUTA 2BOCB 4I8DA 5B8CA 5DI8A 2XKNB 5EPMA 1UACL 4UQ2A 4HBCL 1MFAH 4YXLH 3VI3F 3WLWD 3LSOA 1J5OH 3OB0H 4PJ7A 1NH6A 3I6GB 3B8YA 1C5CH 1TQBB 3SHSA 4PGEB 5JUEH 1OAUL 2PXYA 3KJ4B 4WHCA 3V7MA 2WANA 1MCOH 2WIMA 2P7TB 4QOKA 4NKOB 5DT1L 4AYFA 4NN5C 1CDHA 2NCMA 3CAFA 4TRPH 2BVYA 1QQDA 2ICWJ 2QKIB 2EYSA 5I1EH 5C0BD 2AVGA 4OCSL 4KK6C 5TQ0H 1EAPB 2NX5B 1DVFC 4DGVL 1GPOH 1PG7H 1Q0XL 3EFFB 3MZTA 3TA3A 3UAJD 4M7LL 3DX6B 5K59F 4L4TE 4OD2B 2XFXA 2BK8A 4H20H 2Z31B 4K3EL 3TCXA 3NAAH 5CJQH 1UB5A 4C59B 1XMWA 2YOCA 3HMXA 3FAXA 4ZD3H 1MVUB 2D7NA 4APQB 4M1CD 3MV9E 1MCIA 1FZMB 3EO9L 2VXQH 4F7EA 4QGTA 2BNUB 4I18A 4BSVA 4FS0A 2AK1L 2V7HB 1PEZA 1YNLL 4HUWB 2A6DB 2OI9B 4F7PA 3CIQA 2G9HB 4XP5H 4Y7MA 4ZS6D 4X9HA 5KANI 1ZVHA 1DUZA 3HE7A 4YGAB 4MJ4A 2ZUQB 3F12A 3O2VL 1YEFH 2EZ0D 4ZUTA 3D9AH 2UVEA 3ARXA 2IAMD 4NO5A 4D0CB 4FTVD 5DURD 3A6CH 3AFLA 1CFTB 1MH5B 5DXWA 4QXTA 1BIIB 3R0MA 3DROA 5ACMA 1I8MB 1HQ4B 2DB8A 2MKLC 1BJMA 1YNTB 3PL6A 3QPXH 5GSRA 3QXAB 3HNSH 4O4YH 4K7FA 3GJEA 2E7MA 3IJHB 1Y6MR 1OGAB 3QUMH 3F7VB 1UCBH 4IIQB 4ELMB 1SVZA 3ALXA 3EDKA 5KS9A 1JNLL 2B1HL 1FZKA 3GRWA 4YQXL 2ZUYA 1AKJA 4MDIB 4KK8D 4KJQD 1E4WL 1I7UB 5CD3A 4Y5YA 3HNVH 5CMAB 4NNYB 1BF8A 1PG7W 2XV6B 4LSSL 4D3CL 3O6ML 4RQQA 4EI6B 3B9VA 2RR3A 2GW5A 4FQXC 4J23A 1O7VA 1S7SA 1EJ6A 2N4IA 1GZQA 5IHUH 4JM2A 4XX1G 3GSQB 3RBGA 4LU5H 1LEIA 3MUJA 3MRPA 4Z0BL 1CLOH 4ZXBB 1UH3A 4X7SH 4LSVL 1SJEB 4KDTC 4OI8A 3W9DA 4GG6A 1CFVL 2BSRB 3NMEA 5T1DL 3BOVA 1T6WA 3QFJB 4FQQB 4QGYA 3CFCL 1PZ5A 1C12A 1NDGB 1R3KA 2YN3A 4W68A 2R29L 4BFEA 2ATKB 1EMTL 3V0WL 1J8KA 5BZDB 1JI2A 3N1PC 3THMH 3NIFE 1NDMB 1WCBB 4NHUB 5D5MB 1JGVH 3ARTA 1CT8A 2YD3A 4H1LA 3U7WL 2XWJB 4URTB 5T33H 4MAYB 3SE9L 4YO0A 4GRWB 3QDMB 4RX4A 3O3UN 4YR6B 5T3ZL 5CJOL 4Y19A 1JF1A 2FIRT 5HYSG 3MRKB 3SCMA 5ACLA 1LHZA 4XCEA 1H15B 2V2TA 2FX8L 2HYMA 4LCUB 5F7DB 1NEZA 5TDNB 4NZDA 4PJFE 4B53A 1ORQB 2FJHB 3INUL 1MLCB 1A3RL 4OD3L 4BH7A 4DCQA 5HGAB 3H9HB 2QQQA 3MUY1 4P46A 3F7YB 2YK1H 5E7BA 1I8KB 5GGVY 1QBBA 4OJFH 1T5WA 5I19L 3M45A 1RU9H 2J3SA 4OZGF 3SGDH 1WAAF 1IL1A 4G42B 3L3HB 4EUPB 2APVA 3NFNB 1MJUH 1KN4H 1KELH 4YPGB 2C3VA 1YY8B 4PJDE 4PRAA 3K1DA 1UM6L 4OFPA 3PGDA 3GIZH 4YHYC 2CKBL 2HWZH 4QRRB 5FOBA 5D7JC 3FJTA 4DW2L 4NIKB 1U3JA 4MQ7B 1TTGA 5FAAA 4M61A 2DJSA 2AV1A 3RVUC 3LEXB 3S3PA 3QO1A 1WJ3A 3IFPA 4EKXA 5L2KD 5JW4N 1U8MB 1LEKA 2F15A 2P42B 1Z6JT 5AD0A 1T04A 5D4QA 5I1IL 1D9KB 3DRQB 1AR1C 3PWUB 3RHWK 3S3JA 3AROA 4OCWL 1G0XA 4XNXH 2UVFA 2PKDA 3DETD 2OXHA 1ZT4B 2J8HA 3JV6A 3V4VL 5CEXA 4YPJA 5T1KA 2VZTA 4ZFZB 2BVQA 4XX1E 4MQTB 2UYLA 1MSPA 2CPCA 3IFLL 4POZC 3LVEA 2X4RB 4NPYA 4GG8B 4C56A 4DGIL 3BVNA 3OXRB 4NCC2 2EXYD 4NBXB 1AHWC 1IEAA 5AYUL 5KSAB 1MI5E 2P8PB 2EDJA 5FYLD 3OGCA 2X70B 4YDJB 4FNLL 1D6EB 1FZJB 2BY0A 2NXYD 4NQCD 3QJHA 4MXWL 1U6AH 3DXAD 4MA1B 2E9IA 3B9KC 1SMAA 2R0ZL 2HFGL 3EOAB 1T21A 3W82A 4QRPD 1QSEE 5FA4B 4R7DA 4TNVF 1I1YB 3O6FB 5CSGA 3WKMH 4Y4KD 3RU8L 2Y07L 1HILB 1BJ1H 3HAEB 1NCWL 5TDOB 1OHQA 4NN7B 1CLYL 2ENYA 1GGBH 5E8DL 3TBTB 3SQOL 4CVXB 5DF0A 4NFBA 5DZLA 4NZRH 5HY9B 1AD9A 4G5ZH 3VFWA 1JN6A 1K4CA 2Z92A 5AZEH 4M48L 5KVEL 1DBAL 2A74A 1T0PB 2GK2A 3IDMB 3QIWD 1FVDB 1GC1L 2FBJL 4AIOA 4P99A 4I0KA 3MRNA 4PJIB 4U1KA 1QRKA 5EO0A 4TVPH 1BZ9B 4ODTH 4C4KO 1Z3GH 2IAMA 2VDKL 3QAZB 3RNQA 3IVKB 4FTVA 5FK9A 1G7PA 4F7TA 5K9QG 5KSUA 1G0YR 3D2UD 4RFEA 4PJ5D 4OGYH 2XXCB 3FT3B 2DQJL 3BP7A 1Y0LB 4MNHA 3UROR 1ITBB 1JYNA 1JGDB 2Z35B 3TYFA 5GXBB 4JFEB 3MODL 3OV6A 3QDJB 1MFEL 3LV3B 1X5KA 1JV5B 3QIUB 3VXTB 1JPFA 5M7QA 3PE9A 4PR5B 5GGSB 5DQJB 3O81A 3T2NL 2NY0B 1JZ7A 3C09B 4OFYD 4DK6A 5LGJA 2YXMA 2GHWB 4Y4HA 5IFHH 1PSKH 3G6JA 4GAJH 3S37L 4XC3L 1HHJB 1RJZB 4N8CL 1DDHA 1NCAH 4M7KH 4XPBL 4Z18A 2DTMH 3RDTD 2PCPA 1AGCB 4MAUH 3ARYA 2J88H 5E6IC 3ULUH 3D39E 3QUXA 5T3XH 1VACA 4XAKE 1MIEL 1U3HB 2AJVH 4R9HA 5D6DA 5L7XL 3HPJB 4CDGC 7FABL 1U8JA 2NNAB 5FGCB 4ZFGL 1QSFB 3GMNB 4BZ2L 4JQVC 4N0RA 3VWKB 3LOWA 4HXBL 2CLZB 3DV6B 4MD0B 1HYSD 2DD8H 1EBAA 1QHPA 1A1MB 5DRZA 4ZAKB 1YEJH 2L4OA 1U8OA 4PBXA 4TVSa 2EC9T 2ZG1A 4JLRA 4ZFFA 3EYSL 4ODWB 3WD5H 4XWGH 5IGXH 4HD9A 1L0QA 1JBJA 2ED7A 3KPRB 3WO4C 4Z7NE 4PS4H 1FL6B 1R3LA 3I3EA 2VZ3A 2P5EB 2XTLA 5DEFB 5C0AB 2D7QA 5LWYH 1A6WH 1I1CA 5C7XL 5EUOA 2UZIL 1RURH 4P4KC 1DFBH 3UYRL 4QHKJ 5GGQL 1PX3A 4V1DA 1Q9OB 1ERNA 5C0BE 4PJHF 1JHTB 32C2A 3R0NA 3SDAC 1ZHBA 5FF6B 3ULUD 2PW2A 2VN4A 4MJ5A 2OZ4A 3CH1A 5T3XD 2YMXL 4JJ5A 5J6HB 4DQOH 2XZAH 3CDGB 5J4MA 4AT6B 3QHFH 3OAZH 2MHAA 4PGBB 3PWPB 5TF1H 3FMGL 1ND0A 1MHPH 2JB5H 4HWUA 1KIPA 3OMZA 3GJFA 3QNYA 1WQVT 1CFSB 4NRZA 3GI9H 4KKBC 3WL9B 2E7HA 1AFVL 1CBVL 3OAYK 3UJTH 1JGLH 5GRYA 3ELAT 4J3UA 4LDLB 1K2DB 3VCLA 2CLRB 2Q7YA 3H3BC 3V4UH 4ZPVA 1TCRB 3S88L 3QEUB 1XF3B 3GSVB 3BN3B 2Y23A 1CFNA 4QHNA 1UKSA 5FB8B 4OZHF 4YDIH 1H5BC 3UMTA 4QCIB 3QPQC 1B0WA 4NC1C 5A2FA 1G7JA 4YDLB 5DR5H 4NKIH 1PJ9A 5ICXB 3CFBA 5K9KA 1IGMH 1D5ZA 5DJ6A 2F54B 4HS8H 1X5ZA 4EN3B 2XZCL 4OSUH 4XP1L 4HK3N 3D0LA 2VLKE 5D7IF 1IEBB 4C83A 3GMQA 1UVQB 1PG7X 1OAYH 4JPVH 2A83A 4F9LC 1VKXB 4ODUB 3IU3B 2FJFB 3MFGB 3RWIA 2E7CA 2E3VA 1CF8H 1SMOA 5JO5B 2QL1A 5E94A 5EBMA 3MO1A 1BJ1J 1RUQL 2FRGP 4X6FA 3MLRL 3WFHB 3GSUB 4WGWB 1U8IA 1HXMB 5EIQA 5INDA 4M5YL 4M7JL 5ADPH 4RNRB 3QCVL 3QUZA 1FE8H 5IHBA 3HC4H 3O3EA 5TH2A 4U1HB 4JFZL 3OX8A 4ORGA 1IGTA 1E4XH 2YR3A 4G8GD 5IB1B 4M62L 5KSBE 4YHMH 4HQQH 5D1XB 5E8NB 3FHQA 3AVEA 4Y4KA 2OS7A 2ZNXA 4NN6B 3S34L 4DWHA 4JZOB 3MCKA 3JBG7 4JFFB 5E9DD 2MFNA 1DE4B 3VFOB 3OKKA 4JO1L 1CGVA 2HLFC 5DRWA 5FYKU 5CJXC 1A0QH 3BPOC 4KUCF 5I8CB 4CGTA 5L0QC 4NJ9H 4X80L 1X4ZA 1D5MB 5I30H 5MERA 4IOFD 4X99A 3HHRB 5GS0L 5IR1B 5GGVH 5F7WC 3SDCB 2HTKC 3KPOA 4ZQKB 1JRHL 3QIWA 3HZVB 3MCLL 4RMUA 5IOPA 2Q8BH 5F9JB 3V2AR 3LRSB 4Z7VF 1HIML 4QTHB 4OBRA 4M8VA 1XH3A 4HX1B 1S7VA 1BQSA 2DQEL 1PKQA 2XWBB 3O8XB 4H88H 1XGQA 4LP4A 4Y1AD 4EI5C 5I6XC 3D2UA 2ADGA 2PN5A 2HRPL 4PJ5A 3EOBB 9CGTA 1MY5A 1A9BB 1BVLB 3MV8D 4OLYL 2OJEB 3NZHL 2W59A 1HINH 5E2VH 5IHZA 3T77A 4B7LA 4R2GC 1ETZA 3LY6A 5HHNB 3OG6B 2EDYA 2ERJB 4Y16B 4J1UB 3IJYB 4YFLI 5LQBH 1Z9OA 2F5AL 1JNNH 1N2RB 2XXMB 1G9NC 1B0RB 4BFGA 5SWZB 2PYEB 4OFYA 5IMOB 2HRLA 1G6RH 3E8UH 1C5BL 3BH9A 2R0WH 3N85H 5C6TH 5DRNB 3TZVB 1B4JH 2AERT 3BP4B 2HT2D 3SY0A 3VGEA 5ADOH 3IU4L 3IF1B 3ZKSD 5GZOC 3KS0H 2VDNH 4MJ6B 5D6CA 3O3BA 5F96L 5L2KE 2O26U 1FVEA 3BD5A 3LKPB 4AJ0A 2NY6C 1VGEH 4Z95L 2KUTA 3MROA 4O2CA 4UB0H 5D1ZD 3FRUA 4UDTB 1H3GA 4JFOB 5E03A 1PQZA 2XPGB 4JFPB 4HWBA 5ALBL 2VSDA 5HPMA 2DDQH 4MX7A 1T66D 1DEEB 1HSBB 3WIIH 1RUKH 5F6HI 3VXNA 5CZKA 2FECL 2H8PB 4KJPD 4S2SB 5J06A 2UWEB 2C3GA 4HKJA 4MJIB 3SDDD 1OT2A 3CDFA 5D9SB 4NZJA 2APXA 5EC1A 3FKUS 4NQCE 1X5AA 3S96A 3DXAE 2BJML 2WBJA 1OWWA 2Z0BA 5CZVH 3CX5J 4LAQH 4ZTOL 1U41A 4XPHH 2HLAB 4QNPF 5J3HC 4XNMB 3SJVD 5FOJA 1JFQL 1PBYA 1RUAL 4N8VA 1MCPH 3ILQC 1DQLH 4LVOB 1QFUL 2AJUH 1IBGL 1F13A 4KK6D 1A3LL 4KROB 3LKNB 2DS4A 4ODVH 4U3CA 5H94B 1DVFD 2W9DH 1RZGB 1XFPA 2KZWA 1S7UA 3G6AA 2BX5A 2CKBB 3OJDB 3KXFD 3DX7A 3HTLX 3SGJC 3MNWB 4UIMA 3V6BR 4NUJB 4H26A 5GGRB 5ERWA 2IBGA 2VDPL 3VXUA 1ZTXL 2EC8A 2XN9B 1TTFA 4ENEC 4MNQE 4ODXA 5IMMA 3HMXL 1LP9B 1E28A 2CUIA 1ORSB 1D5BA 4YZFF 3I50L 1A7QL 2BOBA 4S1SH 1ZHLB 2MQCA 2D31B 1IE5A 3VMOA 4PRPA 3DVFA 5FFLA 2X1PA 4UTBL 1DANT 4XBEL 2JLLA 3KYMB 1KPRA 2XKUA 4E42A 5DJXB 3AREB 1WT5A 5HHMB 1MELA 1L7TL 2JK5B 1L6XA 4B41A 5JHLL 1P4BL 5E00B 4F3FA 3K8KA 4YUEH 4OBSA 5I16A 2HVKA 3QDGA 2QADB 5F1NB 2RB8A 3VJ6A 2AJYH 2VJXA 4S1RL 4NM4L 5DJCA 1B2WL 4R90L 2RQ8A 4Y4FB 2AW2A 1CE6B 4G9FB 1M1SA 1YEEH 4OZIF 1YJDH 5DJ0B 5F70A 1WFNA 2YRPA 1ZT1B 3NCBB 4JZNA 2UZYB 5DRXB 5CKAA 3VFMA 4WY7L 3ARBD 4PJAB 2OJZH 4RGNE 4PLOB 2FWOB 4NQXB 5IB4B 3TVMC 4NM8L 3GRWL 4LSQH 3FRPA 4CKVX 2NW3A 1IAOA 4HZLB 5GJTH 3TESA 1T3FB 5F89B 2VTFA 2W9EH 2LVCA 2OTUB 1YEKL 4WCYL 3MX0A 3KPLA 4YHIB 1I9IL 1RK0A 4JFDB 2Q8AL 1ZHNB 4XMKL 3NFSH 4K8RL 4G9DA 2X4PA 2CDEB 4KQ3L 4RISL 4S0SD 1A6VH 2NY1B 1KYOK 4P57B 4YWGL 4NO0B 2HJKA 4DKFL 2JCCF 1OAXH 1A1NB 3QEQB 2AABL 5AG9A 5BS0D 5IMLB 5CLTA 2XQBH 3TCLA 5FYJU 4NWUH 4MXQC 5E2TL 3QUKA 3NN8B 3ARFC 3O4OC 4MB5A 4WHDA 4FQ1H 3PXJA 1NGWB 1SJVA 4I2XE 5FO9B 4L3ED 4JANB 4U6VL 4J8RA 1I7ZA 2BSSB 4PJBE 4PRHB 1TFHA 2IH3A 3QQNA 4Y1AA 5HHOA 5A43C 3ULUE 5C0IB 3SDXE 4XCCL 3BMVA 2OTPA 4HPYH 4UU9B 3PWLB 3BQUD 3P9LB 5T3XE 5B39B 3KS0J 2CQVA 1DQDL 4KVCL 3NH7L 3TH3T 3VWJC 1F45A 4M6NL 4WVRA 1MJ7H 3F58H 1MF2L 4H0GA 2H26B 3W9EA 3QR2A 2OK0H 4Z7UB 3HPLA 3WIHH 2X42A 5HDBF 1BX2A 5CGYC 5IWLC 1YPZF 4JM4H 2M8XA 4PYGA 3RVVD 4PUBL 2WWKT 4LCCA 1NC4D 4PGCB 5D93B 1TZHA 2OMBA 2KDGA 4OM1L 3QYCA 1KSRA 4WV1B 1LK2A 4M93B 1VADA 2F19H 2H2SD 5ISZB 3M8OL 5LXGL 3GI8H 2D7TH 3BI9X 4ZSOE 3JV0A 4MB4A 5D7JD 1QFOA 2AKRA 1G0DA 4MA7H 4PJXF 5CILH 1WIPA 3EYFA 3ZMRA 1OGTA 1JPTH 4H25A 2GFBB 3ULVF 4R96B 1TJGH 3RVUD 1GZPB 4GXUM 5J6GB 3L3JB 1FGVH 5C2UB 3WDHA 4LNRB 4YHPA 5DUBB 3STZA 3SKNA 4UOW0 4HIHB 1MPAL 1N26A 1IC4H 1CE1L 1OD7A 5GHWL 3H3PL 1MFBL 1DL7H 3TO4D 4YDVB 2APBA 4GH7B 3SE8H 1R6VA 2DL2A 2FBOJ 5LAXA 5BQ7B 3U30C 5IEKA 2IMNA 4P9MH 3ALWA 2YD9A 4HIEA 4WNQB 2DN7A 3LKOA 3RUGB 3CVHA 1EO8L 1OL0A 3ARUA 1B0GB 3HZMB 4LHUG 2P49B 3T3MF 1MRDL 5GJSH 5E08L 1ZXQA 4G8GE 5E2JA 3SJVA 5GGTA 5J11C 5KJRH 4XNUH 3T0EB 2CSPA 4LDOB 2EEAA 1FL3A 2C4FU 5I1JH 2KL6A 4K3DH 4ERSH 4X98A 2XA3A 5E9DE 1MCHA 1RUPH 4R4BB 3T2QA 3AS3A 4MWFB 4LSRL 1UKTA 4X8JB 1DVFA 1BFOB 4GXVH 2AS5M 3MLZL 4JO4H 1JIBA 3KXFA 1T6VN 5DZNA 1OT1A 3CFDA 3MRIA 1K4DA 4RMTA 1P1ZB 4TUOA 4GO6B 5F6IB 2Q3AA 5HHPA 1LD9B 1NMBH 4GKOA 4R4FL 3DIFB 2LFGA 3B2UC 3BGMB 5JZ7D 2B2XL 1CD0A 4I3SH 4RGOL 1A1OA 2F53A 4GKSB 4MCZB 5CIPB 1MAJA 1S78C 1OSPH 2WWMD 3MRHB 4P48A 5JNYA 1CGWA 3WKNA 3GFUA 1R5VA 4LHQB 3WMSA 3ARSA 3SO3C 4YHLH 1BVKA 3C6LC 4KQ4L 4YE4H 4TPRL 1XGUA 5GSVA 3MV8E 3NACL 3OAYH 2FB4H 4RAVB 3QQ3B 3S4SA 3VDBA 1KCSH 1NLBH 3M07A 3KPMA 1AGFA 1RZ8A 5I1EL 3RWJB 4U1IB 2AGJH 2YD7A 1AP2B 3OGOE 4X8XA 2O93L 2UUDK 4YGVA 5JDSA 4HV8A 1S5IH 1EVTC 4XI5C 2X4QB 1I3UA 2R69H 4JHAH 1KPVB 4GUPB 5IVXE 5GGUB 4P2QB 1SEQL 2Y36L 3B3IA 3P2TA 4M1GL 1AGBA 1FAIL 1J05B 1U0QA 1XF5B 3PP4L 5CBAA 3HUJE 4W70A 1P4IH 4U6XA 2VDOL 4FQXA 1V3LA 1HH9B 4ACPA 5E6ID 2DBLH 4X4XB 4DZ8A 5D72L 3CLFH 2IQAA 3WS3A 3GB7A 3PGCA 5MP6H 1W0VB 2WINB 3MUGA 4F2MA 4KDTA 4MMZC 3DUUB 2VDLL 3BAEH 5FM5M 2HVJA 3HR5B 1YUHA 4MZ3A 3I9GH 4ZS7L 2BXYA 3QNXB 2XG5A 4MHHG 4ZPTA 3A6OA 3MV9B 4UINL 4PJ9C 1B88A 5HJ3B 5CCKL 4I5BB 15C8L 4LSPH 4OCRL 2P47B 4NBZB 1F8TL 2DI8A 4R7NB 2WP3O 3QUML 1QRND 4JRXB 5DC0A 1AJ7H 1G1YA 1XF2A 2I07A 3MA7B 5EU3A 2DQHL 3RX5A 4YHZL 3UYPA 2BNRB 3O6KH 1I8IB 2IAND 4P4KD 1MCKA 1RZJC 1T1ZA 3HS0B 4XVTH 2EDFA 2JJSC 4WFGD 1LO2L 5DJ8B 1KPUA 43CAB 3DWTA 2DQGH 4LEOA 4PJDA 1G9ML 2FJGA 2EDWA 4Z7OE 4XPAL 3B8SA 3MA9L 2OZ4L 3QXWA 3V5DB 5HDOA 1CICB 2EO1A 5KVDL 5J56B 2A9NH 4OLEA 4XHJD 1K6QL 1I75A 3E0GA 4WUUB 5DJZA 1KTKE 5F7UA 2AQ2A 1NC4A 3RAJL 5IJVA 4IRSC 1F4XL 1TJHL 5HDQL 3WDJA 3FAWA 4KKBD 3C5ZB 2R4SL 1J9CT 5HHXH 1I1AB 2WMPA 3ZDYF 1OAZH 1QFHA 5D7JA 3QIBC 4Q9RH 1EHNA 2IH1A 2XNAA 1HQRA 1V7NL 4U1MB 2Y7QA 3P11L 4M5ZH 3QG6A 2NQCA 3LKQB 1GRWA 5J9PB 5DSCB 4ORZC 3AXLA 1LO0H 2J6EH 3QPQD 4ZUWB 4EEEA 1KEMH 1SYVA 3QEHB 3SBWC 4XXDA 3V8CA 3QBTB 4NT6B 3ARPA 3OJVC 5JOFA 1NCUA 3H7BB 4M6ML 4LHJB 2X4TB 1OARL 4PJEE 1CL7H 4P2RA 5B8CB 2DM3A 5DJDA 5DI8B 5EPMB 5EA0L 1KC5H 1KCUH 2EDLA 1F4WH 4MA8L 3LSOB 3U82B 4PJ7B 1MHEA 2DQDL 1U8PA 3VFUA 4JPWH 4UNVA 1IZKA 2BXZA 4MSWA 2YPLA 4G3YL 4OT1L 1OTTD 1AHWA 2EE3A 3MLTA 4WU7A 4X4MA 4QOKB 5IFAH 5E5RB 1NGQL 5FYLL 4D9QE 1OVZA 1P53A 1QQDB 4DGYH 3OG4B 4HS3B 3V6OE 2VKWA 4I48A 3B9KA 4LSUL 5D7LA 3T0XA 5C9KA 3ARRA 1UWGL 2AK4D 4JEGB 3TA3B 1KJMA 5L88H 5BJTA 4ZNEE 2NY3B 5D2LE 3OTTA 4PB0H 4X9FA 1QYGH 3UO1H 2EXWD 4M00A 1W8OA 1UB5B 3HZYA 2HLFD 2R8SL 1CQKA 3BO8A 3IXAA 2W0PA 1YMHA 2GITA 2YZ8A 4CN4A 3GBNH 2NW2A 1D6VH 4BSVB 4XT1C 3RA7H 3WN5C 5L2JA 5DVOA 5BS0E 2MJWA 3P3YA 5DK2A 4DZBB 3ZTNH 4PG2C 5BRZD 4F7PB 1WZ1H 2HTKD 1U8HA 4EBQH 1DUZB 2YBRA 3HE7B 1AO7E 1FNAA 5IVNA 4ZUTB 3FCTA 5HYJE 4L3EE 3G5XB 3B6SA 4HKBA 1CS6A 5CZXD 2E5EA 1NFDF 3P9MA 1TZIB 1I7RB 3PGFL 4BFBD 1CD1A 3ORJA 4N1CA 5I1DB 4JQIL 1H0DA 2EDNA 3GSRA 1DSFL 3LKSA 4U3XA 4YK4B 3DROB 3RKPA 2LE9A 1JZ5A 3JWDC 4YHNA 1N7ML 5GSRB 3ARQA 1F4YH 3AUVA 1BZ7A 1Z9LA 3KHQA 4BH8A 4G6AC 3ZT6A 3ZKXB 5BV7C 3IJSA 3WNLA 3EGSA 5KS9B 5CD5C 1TXKA 1FZKB 5TFSH 1E27B 3QI9C 4PG9A 1RSFA 5IW6A 3RIAF 5GISH 4XWOC 5CD3B 4HXAL 4Y5YB 5DJ2A 3X17A 2NX5D 1CDCA 4UDUA 4OLXL 2YC1A 4PJCE 3UC0L 1CR9H 3FO2A 4XTRC 5CP7B 4FRWA 4FP8L 4DFIA 5SWSE 3ULVC 2Z31D 3MREB 1S7SB 3NABH 5DTFA 5BOZG 1AXSA 1GZQB 3QG7L 4JM2B 5JXEC 3WFBL 1LEIB 4FFYL 1UM4H 2B20A 4N9OB 3MRPB 5K9OB 1S7WA 5E6IA 3KG5A 1IGCH 3J7HA 1M7DA 3EDEA 2ZCHH 4MS8C 4PP1C 3W9DB 3TPUA 1PY4A 3WS6C 2HMIC 3BSZH 1NCCH 1I9JH 4OFDA 1PZ5B 1C12B 1R3KB 2E7LC 3LZFH 4JQVA 1CLZL 4EQ3A 4JFXA 5CINH 2ORBL 3HE6C 1FVCB 3C08H 4HWBL 1WITA 3EYQD 4HZAA 1JGUH 2BDNL 3IDNB 4H1LB 4ELKB 1XCTA 4LVNB 4YO0B 5DQDL 4Y19B 1JF1B 2VC2L 2I9LB 4Z7QF 1KT2A 2YXFA 3SCMB 4MA3A 5DMIL 5JHDE 1KTDA 3S36L 2V2TB 2V17L 2R1XA 3WBDA 1NEZB 4JG0H 4XVUC 4JCLA 4MXVF 1ES0B 1J1PL 3VRIA 4EDWL 5DHYA 1II4E 2F8OA 5ICZA 1RZKH 3EYUH 5H35A 4KAQL 4P4KA 4GKZA 4BH7B 5KN5A 3H0TA 4DCQB 5J3HD 4HH9A 4FFZL 1FFOA 3VXPB 4GRWH 1RIUH 3D85D 3SDAA 3BKYH 3BZDA 4XPTH 1T5WB 5C0CD 1MOEA 5F7FA 4UV4L 2HJLA 1IL1B 2X1QA 1WFTA 4PD4J 3LHPL 1QFPA 1S9XB 5JQ6L 3BWAA 3WHE0 2C3VB 3K2UL 2SEBA 4KY1L 3UTQA 4PRAB 4G6JH 4CVZA 4Q0XL 2FD6H 1YQVH 2I9TA 3PGDB 2R2HA 3RX8A 1EDQA 5FOBB 1JL8A 1YEDB 1IGYA 1BGXL 1JWUA 3NOIA 4XMPH 3JWOL 2FLRT 4LLVA 5ENWA 3IDXH 2UV3A 2FO4B 2AV1B 4EUPH 4GJTB 3QO1B 3IFPB 1VPOL 4DVRH 4W4OC 3MFFB 2W0KA 3TIDB 4Q9QH 5AD0B 1T04B 1QR1A 3RZCB 1H5BA 2GCYB 4RGMB 3BP5B 3R1GH 4AEHL 1OAQL 5B3JF 3JV6B 2LVEA 4MAYD 3X3FL 5CEXB 2ZCKL 1M7XA 3DO7A 1MHCA 3ZHDA 4MNGA 1IM9B 4U4BA 4KK5C 2FDBP 2UYLB 2IBBA 5KW9H 2AQ3A 4M1DL 2WSKA 5TE4H 1FORL 4NPYB 1P2CA 1NCBH 3BVNB 1Q38A 3ZKND 2C3XA 1DBKH 2FHFA 3I3BA 1IEAB 4QLRA 3U2SB 2YSSA 1G7IA 4DKEH 4F9LA 3OGCB 1GIGH 1OPGH 4WW1A 4PRNA 4DKDC 1EBPA 1X5LA 4KKCD 4N1HB 2W65B 3NCFB 5C08D 1A5FL 3GKWL 1CXKA 2J8UE 3ET9F 4O58L 1S9WA 4R7DB 4K3JH 5C0BB 3KWWA 4X6DE 3TVMD 3QRGL 5IQ7L 2P4AB 4HMCA 3I2CL 1ZSDA 4R4NC 2AK4A 5ID0A 3L7EB 1WVZA 5C07A 3FO0H 1Z2KA 1OD9A 3DX9B 1TNNA 1LO3L 3EFDL 3PV7A 5IBTL 5CJXA 3DMMD 5EU6D 4ISVA 5FV2A 1T83C 1VSCA 1K4CB 2AI0H 3VFWB 5IF0A 1CVRA 2Z92B 1BQHG 5EOCL 1VFOA 1F02I 1IAKB 3NTCL 3HAEH 5DK0A 1MREH 4HPOH 1D9KD 1N4XL 3HN3A 4K7PL 5KANG 4GG6F 4GQPH 1QRNE 3CVIH 4KXZI 1I9RH 1QFWL 4WO4C 2E8YA 4U1KB 1QBLH 2D0FA 5EO0B 2BNQA 5FYKD 5CKGA 1CF8L 1O0VA 3MACL 4BA8A 2IAMB 3ARFD 3FN0H 3GSOA 3RNQB 2IANE 4FTVB 5FK9B 1G7PB 5DURB 5HXMA 4P0DA 3W39A 5KSUB 1A6TA 1L7IH 1S3KH 4HFUH 4J6RH 5FKPB 3WFZA 4OLVH 4KKLD 5BVPH 5CJ5A 3BP7B 4MNHB 2PW1A 4EI5A 4OV6F 3TYFB 4JFHD 3CFIC 5IB3A 1UQSA 3UTTE 4OZGA 1WAAA 3C8KA 4BZYA 3BWUC 4X7TA 1T20A 3VG0L 1P6AB 4P3DA 2DQTL 1ZVSA 4E41E 4XC1L 3CGTA 4NJAH 4Y4HB 3G6JB 5GGRY 3FO9A 4XPGH 1OQOA 2I60H 1DDHB 1TLKA 1P84J 3T65A 5D2NC 4ONFH 2BSTA 2VL5A 2PCPB 4LBEA 4DOHE 1DQQA 1G7LA 5I1AA 5DC9B 4PTUA 2E8ZA 5EWIL 1J8HE 4KHXL 1LGVA 4HT1L 5D7SH 3QUXB 5LJYH 4H0IA 4UILH 1VACB 4BM7A 3FB6A 1RIVL 4N0FB 3F6LA 4R97C 1U8KA 2ZCLH 1QFWM 3HRZB 4BJLA 2UUDH 3BKCH 5D70L 3X3GL 3ZDZF 4EXPX 2G5RA 4TYUA 3LQZA 5DUPH 1P69B 4RWYH 1E0OB 2V5RA 3QXDA 1U8OB 1W0WA 4FQIL 2XA8L 5DZOA 4EIZC 3RVTD 3LMJL 4JLRB 1S9YA 3MRRB 4WFEE 1BFVH 3QUMB 3DOSA 2BCKA 3RTQC 1CK0L 1R3LB 4HCRH 2FATH 2RIKA 4L5FL 1BOGA 1F6FB 2MQ0A 5K9QI 5MENE 4JDZB 3U48A 1YEGH 3VGGA 1T2XA 3MLVH 3BKJL 4V1DB 1I3GH 3CVHL 3QDJD 3MJ7A 3PQYD 4XP6L 5DD3H 2PW2B 1F00I 4MJ5B 4K71C 5ACZA 3G6DL 1AGEA 5LGHH 2QSCH 5DD6A 4UTAH 4XZUA 4JJ5B 5GGTL 2VLJE 5C0CA 5FKAB 1NGPH 5I15H 2DBJA 2ICCA 2MHAB 1EEZA 4KUCD 3QCUH 5TPWH 1S9VA 1C7SA 1ND0B 3C60C 4M02A 4L8SC 3C9NA 1KIPB 3QNYB 3GJFB 4FFVC 4JGMA 4NRZB 4U0RB 4U3HA 2XG4A 4GOSA 3REVA 5ILTL 5J13C 3SGJA 2I26N 1K9TA 4J4PD 4LPTA 5BRZE 3HMWH 4FA8A 4OKVA 1MLBA 3MR9B 2B1AH 2FH8A 4ZPVB 4UT9H 4UNTA 1QSFD 5C0EA 3DYMA 1CFNB 4KRMB 4QHNB 4ZG1A 4XCNA 1U8QA 1S78D 3TJHC 4PLKC 1G7JB 1UA6L 1IC5H 2CK0L 3CFBB 5K9KB 1R3HB 5I1LA 5DJ6B 1EIBA 1MCWM 2PETA 4FABL 2OR9H 1A2YA 3KPRD 1WBYA 2YN5A 3D0LB 1E6JH 3RPKA 2DWEA 4WDIA 2P5ED 4C83B 5F7EL 2A83B 3BE1L 3MJ9A 4JN2A 1DQML 1Q0YH 4AG4H 5EBMB 3MO1B 4X6FB 1JCKA 1U8IB 3T4YA 1YDPB 3MJ6A 3TWCL 5INDB 2NX5E 1T7XA 4M4RA 1UACH 4HBCH 2NXYB 4NQCB 4IOIA 3QUZB 4ZNCD 3DXAB 2ZJSL 1M71A 5C08A 3P4NA 3O3EB 2HT3D 4K3GA 1OAUH 2ARWA 3OX8B 4FQPA 4HK0A 4ORGB 4QRPB 5EBGA 2Y1VA 3TVMA 5DT1H 4Z0XA 3PWPD 5I71C 3AMKA 5EZJB 3TBYA 4Y4KB 4Q2ZA 3MCKB 1KTLA 4KRNA 1XGPA 3MOQA 4JR9L 4Q74A 3OKKB 4OCSH 2GJ6D 4PLNC 1KLGA 1NC2D 4DGVH 3MJ8B 4M7LH 4L9LC 5EU6A 4HIIA 4X99B 4K3EH 2B4CC 1A02N 1QBML 3KPOB 2YS4A 2Z4QB 3VW3L 4EUPG 4U6YA 1TENA 4PJ9D 3QIWB 3HC0A 3EO9H 2F54D 1AY1L 2AK1H 3A67L 2B5IC 1YNLH 4RDQG 5J1AA 3OHXB 5C09D 1XH3B 1S7VB 2QSTA 4IJ3B 5EIIA 2OR8A 3ARFA 3KPPA 5A2IH 1OGAE 1PKQB 3U7YL 4GMSL 5DUML 2XTJC 4PJHA 1FZOA 4P5TC 4ELME 4JG1L 3O2VH 3D2UB 2ADGB 4CN6A 4PJ5B 5FCUL 3RJDA 2VABA 5EN2B 5EU5B 4HMDA 5IROC 5L6YL 5FYJD 5IHZB 3T77B 4LEXL 1ETZB 3QHZL 1TVBA 4QO1A 5EUOF 3Q5YA 3VWJA 2FZ3B 5T5FL 2GK0B 2CUHA 3BH9B 3WYRA 2VXTL 1ZWIA 2FL5A 5IWLA 1N5AA 3SY0B 3SGDI 1JNLH 1JWMB 2B1HH 4IRSD 4YQXH 3RDTB 2CXGA 3CUPA 1E4WH 3QFJE 3AM8C 3O3BB 3QFDB 4OZHA 1FVEB 1OQXA 4LSSH 2YA2A 2Z93A 1CDJA 4N0UA 3O6MH 2EDEA 1DQTA 3MROB 4O2CB 3QIBD 4QHKI 4D3CH 4ZMAT 1LQSR 2VXVL 4ZYKA 2VLRD 2RBLA 5D5ME 3FRUB 1PQZB 1VFBA 4GRWE 3E6FB 4TULL 3G9AB 3RGHA 2K7QA 5HPMB 2YA1A 4MX7B 4Z0BH 1J18A 4BUGA 5D7IA 4LSVH 4PTTA 2EH7L 4IDJL 4PJGF 1CFVH 2X7LA 5T1DH 1P7HL 3VXNB 3HAEG 1GOGA 1ONQA 3CFCH 4HKJB 2R29H 5E95B 5CS7A 1EMTH 3V0WH 4Z76A 3MV7D 2XI9A 1I85C 2LTQB 3REWA 2VH5L 2YHGA 3BW9B 5I75C 4WEMB 3UZVB 2Q1EA 4D9LL 3U7WH 3DI3B 1HYRC 1DN0B 3SE9H 2AXJA 1P5UA 3N06B 2J7LA 3FOMB 4KRLB 2YD1A 5T3ZH 5CJOH 5ITFA 3GSWA 2R23A 4WWKD 5JMRA 3PQYA 4X5WA 2C4XA 1T1XA 1N3NA 2PYFB 4N8VB 2FX8H 2MKWA 3ZKMC 1WICA 3INUH 4QRRE 1A3RH 4OD3H 3TZVD 2DWDA 1A6ZA 4N5EC 1DR9A 2GKIA 1JPST 4JPIA 4UIMB 4H26B 4UIKL 5I19H 4JY4B 3V6FA 2X5PA 3TBSB 4MVBD 3S7GA 3DPBA 4JREB 5GRVK 3IDYB 3RJQB 5IMMB 3ARDC 5C0JB 3TF7C 1TZGL 4U05A 1MWAA 5ESAA 1E28B 3ZL4L 1JK8B 1D5BB 1UM6H 4Z7VA 5CHNA 2CKBH 3BJLA 2BOBB 4DW2H 5HVHB 4PRPB 1CIDA 4Q9CA 2BVPA 4MA1C 1F3DH 5HI3C 2XRAL 4XB7A 5T3ZD 1FLRL 1JE6A 1KPRB 2D03L 2ZG3A 4E42B 3ILPB 4MJID 4WRLA 3FQWA 5MI0C 3O9WD 4ZUVA 4F3FB 2DKUA 3MNVA 4JFHE 4DN4L 5I1IH 2EECA 2HVKB 3C6LA 1A9EA 2Q86A 5SX5K 3VJ6B 2YD2A 4Q58C 4OCWH 4UZGA 2F58L 4NN7C 4AK1A 4QWWD 3V4VH 1FFPA 3BX7C 2OMNA 4G6AD 1LDPL 5EU4A 2DQIL 3GMRA 4NQED 3IFLH 3W81A 2DJUA 4JZNB 1CVSC 4DGIH 1EUUA 3WDIA 1UXWA 5CD5D 3CFKA 5IFJB 4KTEL 1B9ZA 5AUMB 5AYUH 3VG9C 3NPSB 1A7NL 4JCMA 2VNCA 1FRGL 1WUNT 2NW3B 3KPNA 4FNLH 4G8GB 4EZMA 4MXWH 1LP9F 4XTRD 1FYTA 3KPLB 3ULVD 1RK0B 2R2BA 4O02L 2R0ZH 2HFGH 4LPCA 1X44A 3BGFB 3LCYA 4G9DB 2NPLX 3X12A 4NQVA 3UZEA 2X4PB 4ZFOA 5DHVA 1NC2A 1SBSL 3VXMD 2HMID 3GSNA 2Y07H 3F6IA 5TE6L 3NIGE 3BZEA