4ODIA

2.6 angstrom crystal structure of putative phosphoglycerate mutase 1 from toxoplasma gondii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
GNMAKAKYTLVLIRHGESTWNKENRFTGWTDVPLSPVGEQEAVEAAKALKEKGFEFDVAYTSVLQRAVVTCWTVLKGTDMCHIPVKSSWRLNERHYGALQGLNKAETAAKHGDEQVKIWRRSYDIPPPPLEKSDKRWPGNDAVYKMVPNEALPLTECLKDTVERVLPFWFDHIAPSIMEGKRVLVAAHGNSLRGLVKHLDKMSDEAVLELNIPTGVPLVYELDEDLQPVRHYYLLDEAELKAKMEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.6 Angstrom Crystal Structure of Putative Phosphoglycerate Mutase 1 from Toxoplasma gondii.
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Phosphoglycerate mutase PGMII
total genus 87
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.4: Bisphosphoglycerate mutase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4odiA00
2H4ZA 2H0QA 5AJZA 2QNIA 4PGMA 4AROA 1FZTA 3NTLA 1EBBA 1E58A 2HIAA 1UJBA 3FJYA 4D4LA 2OWDA 2GFIA 2HHJA 2P78A 3D4IA 2P75A 2DWOA 3EZNA 4EMBA 2WNIA 1QHFA 3D8HA 1YJXA 3GP5A 1BQ3A 2DWPA 3GW8A 3DCYA 1V37A 1RPTA 5HTKA 4D4MA 2OWEA 2EOAA 2P2YA 3GP3A 4GPZA 1DKOA 3MXOA 4FDUA 1DKLA 3F3KA 4IJ6A 3E9DA 3HJGA 1T8PA 3QPVA 4ARUA 4PZAA 2I1VB 1SKAA 4FDTA 4MA4A 3IT1A 5HR5A 5AJWA 4HBZA 3E9EA 5PGMA 2F90A 3R7AA 4EO9A 5CDHA 2HPAA 3DB1A 2P30A 1K6MA 2P9ZA 1SK9A 1SKBA 3K4PA 2WU0A 3OI7A 1QWOA 1DKNA 1IHPA 5AK0A 2H4XA 2P9YA 2P9FA 2H52A 2YN0A 2WNHA 3LL4A 2P6OA 2BIFA 4JODA 2IKQA 3F2IA 5CU7A 1RIIA 2PA0A 4JOBA 5CX4A 3QPUA 4TSRA 3MBKA 4JOCA 1ND6A 2ENUA 2P2ZA 4QIHA 2A9JA 1DKMA 4IJ5A 3IT3A 3EOZA 1YFKA 2RFLA 3K4QA 4D4JA 4E3WA 1NT4A 3BIFA 1C7ZA 3NFYA 3IT0A 3FDZA 3KKKA 2AXNA 2EKZA 3IT2A 3LG2A 1BIFA 1XQ9A 1H2EA 1CVIA 1SK8A 2ENWA 1E59A 3O0TA 1BQ4A 4ARVA 1TIPA 3D6AA 1C80A 2P77A 4GPIB 2YN2A 3E9CA 5AJYA 3LNTA 5AJXA 3C7TA 4ARSA 1UJCA 3PGMA 3FDZB 1DKPA 1ND5A 4D4KA 3QPWA 1H2FA 1QFXA 1FBTA 4PZ9A 2P79A 2P6MA 2EKBA 5AJVB 1V7QA 1DKQA 1C81A 1RPAA 2A6PA 4ODIA 3ZHCA
chains in the Genus database with same CATH superfamily
1SR8A 1TAQA 2WAOA 1E69A 2XDWA 5IK2A 2VYCA 4FFMA 3FDIA 2IHZA 2F7SA 4GECA 3ABQB 4Y6RA 2RHDA 3UBTA 4PX9A 1E94E 1J1UA 2WEKA 4RLQA 2FSIA 1SU6A 1SVSA 3FWYA 1FJGB 2C3OA 4WD3A 3AR2A 1ISGA 2F3UA 3ZIDA 1TEZA 3IR7A 4FT2A 4UU1A 3INGA 3ISJA 2YRFA 4X1IA 1NIJA 3HG7A 4P7KA 1TRHA 3GDWA 5C8DA 3FPEA 5EZYF 1Q20A 4MW7A 3F5SA 2NIPA 2QU8A 3OTGA 4MITA 5D8DA 2NVBA 1KMQA 1X87A 1C4KA 3JD4A 2HF7A 3NTRA 5ALNA 1ZD9A 3CLTC 4DRXB 5C81A 3N1UA 5LYYA 3O9ZA 2G83A 2IZ5A 2JFQA 4YPVA 5KJ1A 1PLLA 1XZGA 1MGOA 1VFNA 3G0IA 5DI9A 4P5EA 5FUVA 4PG6A 1DCTA 4MVJF 4Q1EA 1JKIA 1ZNZA 1SA0B 4QDZA 4NKRA 4LQCA 4B87A 3DZCA 2P68A 3WRXC 1VDMA 3BKWA 1SBYA 2JK1A 4QREA 1WDKA 4WZZA 3OAAA 3AEXA 2MSNA 1T4CA 4ZOEA 5I3CA 4HSEA 5EJMA 3H11A 4DA4A 4BKOA 5ALEA 4X54A 5KNBA 4O4JA 2JJ2A 2BGTA 4ZI3A 3FI9A 3DMDA 4MUEA 3DV0B 1E4OA 2HHAA 4HMQA 3CPJB 1LC0A 1CXZA 5L8VA 4PQFA 5P21A 4XCXA 1N6KA 2F8MA 3ADOA 3UICA 1WJGA 3ZHSA 2GEBA 5ILOA 2FRVA 2H07A 1HMPA 2ZIAA 3H05A 1TPZA 4UEQA 4WRRA 4IGKA 1JLLB 2FYTA 2NNLD 4QUAA 2DJ5A 1VE3A 4AJEA 4BFSA 3RYCA 2A88A 3BF7A 3IX7A 2FE1A 2JLRA 5I4BA 4OP3A 2DVMA 1S96A 1PUIA 1Q19A 1E2QA 4Y7CA 4R1SA 1QC5A 4P08A 2A59A 2Q9BA 5GGXA 3PFWO 1HFJA 2OBMA 1XRRA 1FTQA 1XEWX 3I64A 1WXIA 4RKQA 4AF8A 1QHHB 4OYHA 1HK7A 1YDWA 3EXG1 1ADJA 1E1DA 3DWIA 1D4AA 3F7MA 3PGXA 3X1XA 5J59A 3T3MB 3LFHA 5CYFA 3GGOA 3D0RA 3UEOA 5JECA 4G5SA 2RIPA 2ZJBA 4NS1A 3FF4A 2PPVA 2HLDD 3AR7A 4PLTA 1JP7A 1P6UA 2DBQA 3DNFA 3GDGA 2RI6A 2I4IA 4KO4S 4P4TA 4FDMA 1ZPDA 4CIWA 3U6BA 4C87A 1I2MA 1OCEA 1Z5OA 3GEEA 4K6GA 2Y27A 2WC1A 1UQRA 2C1EA 3MRSA 3P45A 2IHJA 4WZ6A 3VO2A 3ZZNA 1D03A 2FW7A 2R1UA 1ZNQO 1ZU5A 1Y7IA 2Q3MA 2GPNA 1DAHA 2GXUA 2MJLA 3VHXA 4RZ3A 2CLKB 4C88A 1KXZA 3HI6A 1WR8A 2PSJA 3I28A 4Q5IA 3GXBA 3WIOA 3IH5A 1ZRSA 2HDWA 4BNHA 2JDIA 4GNKA 3RWBA 3PC8A 2XCIA 2G5PA 3D6MA 3T52A 3I2HA 1NC1A 1HYQA 1GRQA 1NXPA 4FE7A 4MR9A 3JAWA 1ZCFA 3AY7A 4B09A 1NUQA 5HF5A 4EQZA 2I62A 3UPDA 2CK3A 2X0KA 1V4NA 2LGJA 2Q6IA 4GX1A 4Y18A 5U9CA 5CIYA 1E9RA 4QVGA 4L4XA 5DHTA 2PMCA 1SXJD 4OUDB 1XAJA 3AYZB 3V1YA 2IXTA 2C7QA 2COKA 1FRVA 3H1EA 3RJ9A 4ENRA 1U2GC 2H06A 3AT1A 3CM0A 3THXA 4MYTA 1CULC 1G8AA 1SZJG 2BFCA 2EP5A 4EHJA 3QFSA 4M7PA 2IDJA 4WZBA 2YZGA 4Q39A 5AM1A 2YMMA 4GBMA 3WICA 2WJ3A 2WSSA 5K8JB 5HXAA 5UKDA 1G6Q1 3VPHA 1OLSB 2Y4OA 4F9FA 1FFWA 3I61A 3COZA 4W1RA 3U9SA 3PQ3A 5I7HA 2I78A 1SUIA 1ZLXA 4WKCA 4EB6B 4F46A 1R6TA 3SEFA 2AN1A 3G8BA 4RWEA 1O97C 1REQA 2Q3HA 4KQCA 3U7QB 4I66A 5ALYA 2Z2YA 3BG5A 1I24A 4ZAZA 4Q18A 2CV1A 1T1GA 1OBHA 2VDUE 3LKVA 4H0FA 2RGRA 1DPFA 4PHFA 4XB6B 1BH2A 1TYZA 3PD1A 4KIFA 5DNYB 4U1RA 1W75A 1MNAA 1MRZA 2Y1DA 3OJEA 4OD0A 4OU5A 1UMCA 2A57A 3LUFA 3I58A 5CLLA 4BFZA 2JFYA 5CD1A 4OBBA 1TVMA 3LIPA 1YVUA 1HT3A 3AP3A 5HR5A 2NZVG 3KTAA 1NW4A 1UK9A 1YZYA 3TG8A 1YMQA 4OAQA 1E77A 1U1DA 4FZ5A 4IDBA 4MINA 4RH0A 3RASA 2BVNA 4YRFA 1XJ5A 1B15A 4CN8A 3GJQA 1DMRA 1RMQA 5B37A 3WLHA 1DAEA 2H9YA 1V8ZA 4CKYA 2KLBA 1ENZA 3DZBA 3IKJA 2G04A 1TXGA 2A9OA 1OIXA 2QUIA 4PIPA 2CF5A 2VHUA 4P4SA 5KWVA 4MYCA 1GR0A 3WYGA 3FOEC 1FSPA 3AF4A 2WA1A 3NM4A 3RNLA 3SJBA 3EVFA 4INAA 1POXA 4CL0A 1H9BA 3HCWA 3FB1A 3OQPA 1KAHA 2ZTLA 4RF5A 4NMHA 1AO0A 4L0CA 1OBVA 3PD0A 2ABWA 4S1PA 2Z1DA 4DBLC 3PT9A 1W0KD 4QNNA 1PG0A 3I73A 4U2FA 1X15A 3PLRA 5SYNA 2JLUA 2H3HA 4M9SA 3QV1A 1K66A 2HSWA 3CEHA 3ZWXA 1VIAA 2WP0A 1MO4A 2I2DA 1L3IA 2W48A 1TO6A 5L7YA 4BWFB 2ORYA 5A06A 3K5IA 4Z9FA 4HNVA 2ENWA 4ZPXA 4UNIA 2AG6A 4FMDB 3DZIA 3RU2A 4M0UA 4MEJA 1N7IA 3DC7A 1GPH1 1GZ5A 1MG5A 1SCDA 2C4HA 2VT2A 3DKVA 2ZB3A 3IMCA 3MSCA 5TPZD 5D3KA 3W8NA 3HHEA 2RDMA 1GARA 1M1UA 1OPRA 3LV8A 2PYZA 2D7JA 1PS8A 3D6UA 3F5MA 3PDWA 5JFGA 1P29A 4TT8A 3RVBA 1LQ2A 4IF4A 4OLBA 5EXXA 4DV7B 3W6NA 1VI6A 4BZQA 4A91A 1CDOA 1PQ4A 1ZH6A 3ELWA 4BNUA 3ZY6A 3DSRA 1LSOA 4JLOA 5BORA 1GTG1 1KJ9A 2D1FA 1T6BY 3H2YA 1GLVA 2DR0A 5EPUA 5EZYA 2CZQA 3GOHA 3OFKA 4RPIA 1AXRA 3RVKA 1JIVA 1YZNA 3V33A 4D9IA 2ZTUA 4WWHA 1UBNA 1JU3A 4G65A 2K7FA 3NIFB 1I30A 5JSZB 4DV5B 4FS3A 1U3UA 3DVAB 3PRKE 5JAZA 2PXAA 1PZHA 1R5BA 1UT5A 3C70A 4IIVA 1Q92A 4Z7OB 5IFLA 3CLHA 2ZSHA 2K87A 3T35A 1UJBA 1O9GA 1T8TA 4I1OA 1XQVA 2TMKA 4JP2A 4UQOA 5EJIA 4HDSA 4I55F 3VU8A 1ECBA 4KQJA 5E95A 1E3SA 3ZDZB 4RHTA 4RHEA 1L0BA 2NPIA 1RRPA 5K0NA 2JAWA 3C5HA 3NBUA 4R05A 5F4BA 1IAQA 1N8KA 1KEUA 2CLDX 3PV0A 5DIFA 3G0BA 2HCBA 1GPJA 3MD9A 5KTOA 1Y4AE 5AXBA 2AJBA 3W2EA 1KP3A 4WJLA 1FQKA 1LLDA 3F6CA 3M9LA 5F5LA 3JRXA 1X7XB 3ZTWA 4DM7A 2EFHB 4HXFB 1JAHA 4IKOA 5IDYA 1AKTA 1DKOA 1J90A 1PV1A 2XMSA 4FDUA 1I3NA 1P33A 3EY4A 3IALA 3N87A 4MVJH 1UWKA 3CSUA 2V3CC 4NC9A 2QK4A 3IOYA 3NKFA 2GTHA 5AHRA 1M2OA 3FSRA 5IDQA 5FBRB 1PJAA 2WU8A 3IPCA 4F9GA 1Y6GA 2HW8A 2ZATA 3TNDA 1JAZA 3AEKB 3CJRA 3LBYA 4R0VA 4AKHA 3C6YA 1G6HA 3C3DA 2BHNA 5KDOA 2NU7A 1TTPB 3SQNA 3WFJA 5IX8A 3EF3A 1EX6A 2QAGA 1Q3HA 2P7IA 4LZLA 1R3DA 4RK5A 4TMYA 3VR1A 1QWOA 4LWZA 1I2BA 1O6CA 5IJ0A 5DP2A 1RS0A 3K5PA 1MAAA 1MA0A 4HQRA 3MLEA 2QGFA 2GZAA 3L0BA 4YCLA 5HSGA 5JNRA 1B6TA 2HZ7A 3RDPA 5MFZA 1OT3A 5CX4A 2OVBA 3L04A 2CUNA 1JMVA 2PZAA 4RD0A 2J9GA 1P8AA 3TO5A 1FS4A 3HYSA 4JSTA 3O74A 1DQSA 2O52A 4DSTA 1II9A 1TRKA 4LIPD 3E3OA 5ITZB 3R75A 2NSLA 3BTSA 3EWSA 2CLFB 4BE9A 4IIUA 3QSYA 5K09A 4EABA 3FKSD 5F3DA 1AMOA 2G77B 2JLZA 1FPQA 2SICE 4YMWA 1GRVA 1ZNWA 2C2ZA 3FCAA 2BEJA 1CTQA 1WMFA 4AKEA 3LBHA 5AKXA 1OTYA 3HDQA 4LRTB 1JJIA 3VZQA 3KT6A 1JQEA 4O4LA 1DZ3A 5ERXA 3ZWOA 5BSEA 5I7VA 2QL9A 1M0SA 2O0HA 4HRAA 2ZT5A 3RIHA 4DPLA 1P0PA 5CA1B 3P9IA 4GGPA 1OWOA 3C5CA 4XX0A 3SNKA 1EXDA 3E9CA 1HEIA 2PLWA 3LPCA 3DDZX 4JQZA 1USVA 1XZPA 3TE6A 1P7ZA 1UBKS 3DBLB 1HH4A 1E7SA 1PK9A 5E1DA 3WQSB 4BEBA 4OK3A 2D4HA 3SM9A 2GESA 2P4EA 3QPCA 1TNDA 3V2HA 4ZMRA 4FPXA 3OM1A 2BC9A 2G4LA 2BGGA 5HYVA 5LNK6 1ZA1A 2HCTA 1H0SA 3KUKA 1DKQA 4ILEA 1W4AA 1VKZA 3IEPA 3K0FB 3O8DA 4N3GA 3IEKA 5C18A 1GZHB 2WKWA 3ESYA 4M60A 3TLMA 4C0LA 4E0BA 2KPOA 4UBJA 3AY3A 5AW1A 1QS0A 2B1IA 1KGSA 1FSSA 1SIBE 1W48A 3G9ZA 5GV7A 1GQFA 4JUCA 1UBHS 3C14C 1EAMA 3IKVA 3PP8A 5FL7A 3RVLA 1E5VA 2UZ1B 2OZPA 3G5MA 2AFIB 2F6RA 2IW1A 5E6SB 2G0AA 2PR7A 2VF8A 5KOJA 4N18A 3FNHA 1ZMOA 4IM7A 1KI4A 3D9QX 4IZHA 1A7UA 4GE0A 2JH3A 4AY6A 2VHWA 3PWSA 2BCGY 2YDYA 4HUQA 1U80A 2OHXA 2VUTA 4KXWA 2C88A 1HQCA 1M7HA 2BY4A 2OM6A 6ADHA 3LA8A 3ORRA 4IIDA 2ANCA 3RHTA 4NJMB 1E96A 4LYYA 4B0PA 2Z6UA 3DMRA 3AGQA 1Y1KE 3L49A 3BXOA 3OTIA 4ZVTA 1E1KA 2FF7A 2JFZA 2VWPA 1UP7A 3RFFA 2RCNA 5CT8A 1BMTA 3RIEA 4U2KA 3NT5A 2G5TA 2JCYA 1UZAA 4ZZ1A 4IDOA 1B6GA 1OD6A 3DVRX 4L6IA 4QD3A 4WKOA 3N2NA 1GUAA 5TPWB 3PVZA 2R7AA 1O4VA 1WKCA 1SNYA 2PH1A 3H2KA 3I9OA 2NU9B 5THXA 4GPTA 3ZDYB 2XADA 2E5LB 3K96A 2DLCX 1TA9A 4J7UA 5H1YA 1GUBA 1AHHA 4P33A 5EWJB 4LRQA 5EUCA 1QP7A 4MV9A 5DLPA 3N0XA 5HBGA 3FZQA 1VXOA 3ESRA 3GMDA 4FINA 5BY2A 4K6MA 2WYHA 2WSYB 3GGGA 2OV4A 4XKJA 4AZ3A 1KJWA 1KFEB 2D0PB 3DHEA 4I4TF 1WSAA 4PYIA 4YI5A 4BLVA 3UWSA 4OHFA 4BNVA 4QUDA 3OMWA 3AH8A 3KVRA 2GBPA 1JTVA 4LX0A 2YZNA 4TUYB 2P62A 4FMDF 4FUTA 4CLXA 3MPUA 2I91A 2CNDA 1G8KA 2OEPA 3UNXA 3OURA 1Y9AA 2XWPA 4ENQA 1DT5A 4OLFA 2GZRA 2A1IA 2I6GA 3BQMB 2IU0A 4YJGB 1UKBA 2ODNA 3FUWA 3OF3A 2W8BA 3REGA 4YMTA 4DJTA 2OTCA 3HN6A 3LX5A 1TA4A 4WKGA 4BZXA 3TKLA 1IVNA 4A3SA 5A0TA 3GUYA 4N01A 2R00A 3LDHA 3FYUA 5KEIA 2B20A 3D59A 1HF3A 2J46A 6ABPA 3Q9LA 4NU5A 4ZREA 3VHRA 1H0HA 3N70A 4MS1A 2BLNA 4LYAA 4BLPA 2XB4A 3A31A 3RTBA 3RRZA 1ZK3A 2P67A 2C1ZA 4EKGA 4N5DA 5FCDA 4MJLA 1J0BA 4KXQA 4ZVVA 2CY0A 4KCGA 4HB3A 2YN2A 4HGPA 2BJWA 3CO0S 3KL2A 2F55A 4ZGBA 5CGZA 4YWHA 2PT7A 1FVOA 5G0VA 3E5HA 3UK2A 4YEDA 2J3QA 3KVNA 4PCLA 3RK0A 2WU4A 1EFRD 1XMJA 3ETHA 4RANA 3HP4A 5EINA 1JEYB 4PZ9A 4Q7EA 2BH9A 2HRDA 1MPXA 3F7OA 1NR7A 1PDOA 1T25A 1T4DA 2P6MA 3D8UA 3JZIA 3PJEA 4CJXA 5EJ8A 1Q77A 4CVNA 4ZI7B 1UEJA 3PTAA 3NOOA 1EDEA 2WUEA 1PT9A 1STOA 1XVAA 3OP4A 4BRUA 1YCHA 1YOBA 1E5XA 4QLAA 3ANTA 3GIWA 5LZ7A 3M7IA 3TQTA 3I6BA 3DE2X 1GPBA 4XQGA 1JA9A 3PR1A 3AU9A 4I3GA 4DGQA 3MWDA 1TQ8A 2COEA 5A3QA 1R8XA 5BYJA 2QTNA 3CB4A 2AMJA 5AWFC 9ABPA 3CMMA 5IW8A 2ZS8A 4UAUA 3DVSX 1UBLS 3T7DA 4F60A 2IOFK 1V5IA 1XJ0A 4KH0A 3D7RA 3KDSE 1QU3A 1CRQA 1LA2A 5LDHA 2GAFA 1YJXA 3K5WA 1I9GA 4FGZA 5DBGA 2EG5A 3P4XA 5F2OA 5C4MA 1IATA 1ZI6A 3L1IA 3HXPA 1F6DA 1YUMA 2CSXA 4DLVA 3EZXA 1Z9BA 3CT6A 4X93A 1NJ5A 5I45A 2QM8A 1BU5A 5FFFA 4OMUA 4TWBA 2ZRGA 3OM8A 1N32B 2D1RA 1IWBB 3LHSA 4CNBA 1C8VB 2GAJA 3D3NA 5DH9A 3PFHA 3URMA 4DSNA 1NVGA 3EFEA 4FBGA 4NBSA 4KSBA 1EP1B 1U3CA 3KXIA 5AK4A 5FF9A 4NG4A 2PD3A 4QBKA 1U0GA 2X2EA 3SMQA 5C37A 3H8WA 2B6HA 3ASVA 5JCPA 4FYPA 4F38A 3T7SA 4EPYA 5KQRA 5HX7A 5B55A 2ISCA 1H42A 4EMSA 1NGSA 2GMWA 1UOEA 4WOKA 5IC5A 1C5KA 1VMAA 3EZ2A 4M53A 1TIBA 5AUQA 1N3LA 2GZDA 3VMMA 2J3JA 2MOKA 3BMCB 1RXVA 3RYFB 5HKLA 1ZGJA 5J47A 3Q9UA 2GEKA 2FPWA 4RGVA 4YY3B 3OOJA 4DBLE 3CZ5A 3M33A 4A2QA 2JFUA 1VRWA 1BCSB 3CWZA 2PAFA 1DQYA 1RVV1 1Z39A 3BDAA 1S9DA 2WTBA 2E3JA 3JQ7B 1O08A 1FNBA 4J1SA 3BL6A 4AJNA 1RRCA 4LGCA 3ZBPA 2OY0A 3EVBA 2HJ9A 4D9HA 3LQ1A 1RIIA 3KLMX 4IOKA 3SX2A 1BH6A 4GKBA 5B1HA 3WAJA 3I2FA 3DDOA 4MUYA 4TMXA 4YP1A 2Q3FA 1TQ4A 4LK2A 4FYKA 4OXQA 1I5OA 2ZU0C 5FUYA 1F8GA 1A0OA 2BFEB 5BV0A 5CVTA 3I6ZA 1E0SA 1RRFA 4O4JF 3T06B 4D45A 2AS0A 1F38A 1CQZA 4C2AA 4DZTA 4DIEA 1E8NA 1K4KA 4F92B 3FTDA 2QT1A 4B2PA 3DM5A 3VBEA 4Z1MD 4AN4A 4D5GA 1VLJA 4X7BA 1N8SA 5CYGA 1GQRA 3A7EA 2XCUA 3M6MD 3KALA 5IT5A 3DS8A 1RFGE 1NLUA 3HP1A 3ZQUA 3CFYA 4RF3A 3I04M 2PKCA 3R3JA 2X5JO 1EUZA 2FX3A 4GOND 2W6IA 1FVXA 2FUEA 1UOQA 2B8WA 2ZI6A 3O92A 4D3YA 4EGJA 1BRMA 3RC2A 4DZZA 3UHJA 3TBKA 5BMOA 2QG9A 3HWWA 4HC4A 4EHKA 5KTRA 1IU9A 3CKYA 1KVRA 2VPIA 3GJ7A 3MJTA 1YQ9A 1QWSA 4A6EA 3OZUA 1YL6A 2PCJA 4L07A 3UBMA 3KIPA 1AB5A 5GZ1A 5A4IS 5LR6A 2O1SA 1T4MA 3LLSA 4BFXA 3ZVKA 3N7TA 3EZ9A 3I62A 2OFFA 4QDJA 5HIKA 1Y81A 2GA9A 3EE6A 3MJCA 3PJFA 1NXXA 1RD4A 4AIRA 5JXWA 3L79A 1GQSA 2GJSA 4V0KA 2YNMD 3VOBA 4DVGA 5B2FA 2ZJYA 3SBEA 4MUFA 4V3CA 1DLIA 2VIIA 1U90A 4DMHA 2ZJ2A 1J2UA 3R40A 5EOVA 1WVMA 3JQAD 4DV3B 1N9GA 4TL7A 5CB8A 3NTLA 2C4TA 5DMHA 4DZRA 2X8AA 3CLUD 3HB5X 5CT5A 5FWXB 4K0KB 3MWKA 4HXGA 3B2EA 3EVGA 3NV9A 1TF2A 1EM8A 4UHFA 1CE8B 2EIXA 1DT3A 1IJKA 4R54A 3SQWA 1PJ2A 2J87A 4LY6A 1B8VA 3LTEA 3IBYA 4GOLD 4OQEA 3EHEA 3U3DA 3HC7A 4QXRA 4UCXA 5CCEA 3JWEA 4E1VA 3TINA 5FORA 2PGDA 3DOFA 1W1WA 5J5CA 3VZDA 1LPNA 3MRTA 4L2IA 4WNYA 1I4WA 1IXRC 2B6NA 2PL5A 1EFTA 3NBKA 5C5EA 2WK1A 4GZMA 1PGNA 4R9UC 5JWRA 4I4TA 1X8JA 1B3BA 1T5SA 3OKFA 2GPTA 1J8YF 2CDAA 1XBTA 3RVOA 4FDTA 3ZWPA 4R2MA 4M88A 4F0JA 1SKUA 1PK8A 4WGGA 2Q0HA 1UINA 4EYQA 1EAYA 4IVQA 4RGYA 4XYMA 1LDMA 2CHEA 1Q2UA 3WJ2A 1G41A 1OILA 5BQ5A 3VU9B 4M9RA 2I80A 3Q10A 5K3CA 3VDQA 4C2UA 3L9WA 2WUFA 1EFRA 1R6XA 1Q0TA 1ULZA 3PQEA 1G19A 5I9NA 1N34B 3RKUA 5U4XA 1HG1A 1KVTA 4M1ZA 1G5IA 4JR0A 4II3A 1DAKA 2H59A 4NCHA 1YU6A 4NIMA 2WUDA 4RA6B 3TWOA 3T1HB 1P9WA 4OKSA 1SN7A 4YALA 3MCUA 2FXIA 2DT8A 2PKYX 3QBEA 5EE5B 1O57A 4XRGA 5LZ2A 1UWCA 2Q5IA 4JEUA 4NEQA 3IUMA 2OORC 5ALGA 1BEEA 5A6VA 5HPYB 3GWZA 3SC4A 3CN7A 2OAQ1 3HKCA 5JEEA 3R2JA 5BT9A 3MWGA 1PE0A 3FGNA 1AUXA 1E9FA 1NT4A 1OX5A 2QVYX 5EZYB 1W5FA 3G7UA 3HUEA 1KF0A 5JBIA 2ZVJA 3OEHA 3PHHA 1T8WA 1Q44A 3GJSA 1O95C 1RWPA 1XWWA 3QXHA 4PO8A 4EQ6B 5KYWA 2RIRA 3HA7A 3ANLA 1QHXA 3EJWA 1UP4A 4XDHA 3AQIA 1NBAA 1UL1X 3O3NB 5D86A 5HK8A 3H5IA 4OQ4A 3AL3A 2X0FA 2ID4A 1IQPA 5E6RB 3K94A 2ZBFA 1SHTX 2O3RA 3GRCA 4M1TA 3AUYA 2B94A 2PTHA 3N3BC 1JG6A 4MPTA 3HUUA 1QFSA 3K8ZA 4RVFA 3REOA 1R5OA 3EQ8A 3Q41A 5CA1A 2ZUSA 3PITA 4L28A 4AVYA 2NGRA 3CCBA 1NMYA 1L4YA 3MJEA 4BNMA 5HRUA 5FI5A 2AEJA 5I7EA 1LNZA 4UU0A 2OHJA 4RQUA 4TRRA 3URKA 2XQVA 5EXEA 2LV8A 2AG0A 3FTCA 1NOKA 2FPOA 1R6BX 4MCAA 2DPYA 1Q3KA 1VE5A 2UYOA 1N1GA 3FGZA 3ONWA 5K3BA 3VR5A 2YIVX 3PFIA 3I0NA 3V1MA 4KV7A 2F3PA 2LIPA 2CXXA 4UM5A 5KTTA 2WOJA 4B85A 3JD1A 2AXEA 5FDFA 2Q5HA 4MUJA 1HE5A 1C8BA 2ESRA 4L5AA 3MGCA 5EE3A 5BOSA 2F8SA 5JARA 1SVKA 3E81A 1NW9B 1Y0BA 3WGKA 3BAFA 4NENA 4EUSA 4Q16A 2PJRA 4W7SA 2IA5A 1G8SA 3UV3A 3U7RA 3PNLA 4L8VA 1OB5A 4OKIA 4WN3A 3WWCA 4AURA 3SZRA 5DM60 1S4MA 3WA7A 4K8OA 4OQQA 2IUSA 1P4GA 3E9NA 4YJHA 5TS3A 5JRJA 3T6KA 4HEA6 2ORVA 2HK7A 1X1DA 5LLTA 1CZHA 5KU7A 2YKGA 2OWEA 5CMLA 2E1PA 1A9PA 3O4HA 4ZFNA 2X0NA 4RM2A 3PWKA 4YMGA 1NXSA 1Z5NA 4M46A 2HEGA 1Y9DA 2PX8A 3H6KA 2HEIA 4B8ZA 3K1TA 3CEMA 5B53A 5KCMA 3O82A 4FYMA 4QECA 4ZXPA 4AMUA 2ZB8A 4YIKA 3LT1A 4M7RA 1VGQA 5IBQA 1ESNA 5EIEA 5I9LA 1K5DA 3P96A 4D96A 4FFNA 1ZINA 4G1EB 5SICE 4LJLA 2QRJA 4JV5B 1ZJ4A 2DP4E 4Y1FA 4ZI7F 1K7CA 4RZ2A 4KV9A 5A9SA 3FI0A 1FP1D 1PFYA 4LGMA 1RAGA 1JKMA 2WJJA 4MW1A 3C6KA 3UY4A 3K4PA 4YRRA 2J30A 3GEPA 3WNBA 4BN0A 1H6CA 3JX9A 2V4UA 1RQPA 5T5QA 3UB3A 3KL4A 5TQ2A 3EGCA 3OU6A 4AMYA 2V5AA 4IIGA 1EDBA 2Z5FA 2ZUCA 5JJKA 4KPGA 4BO7A 4ECAA 5JY6A 1RQ2A 2BI8A 2ID8A 2YV3A 3C1UA 3JASA 1AK1A 1ES9A 3KKEA 1RCFA 3Q12A 4GP9A 4ZAWA 3A9CA 4OGGA 3RFTA 5PNTA 4HLQB 1OQAA 2CVOA 1KBZA 5EWLB 1QAOA 3WRYC 4CN9A 4CM7A 5COQA 1TCCA 4LVUA 4DKJA 1CY1A 3EOBI 4J4TA 4V0LA 2MMCA 2HL6A 7YASA 1X1BA 3NONA 4N1AA 1UK7A 4ISCA 3W05A 5AQ1A 3BIFA 2OM2A 2G9QA 7MDHA 2PUEA 1GCIA 2O2CA 2VF7A 4JROA 2NV2B 3UXYA 4CM9A 3FY4A 5TLSA 2KBFA 3ZHUA 3B85A 4B6JA 2VJQA 5EZQA 4X63A 5CLJA 3DZJA 4DHWA 5FUXA 5IU6A 4R16A 4ID9A 2ZJ1A 3OAAD 4JLUA 3QEAZ 1C1DA 4Z0TA 2Z6QA 1ECFA 1HFWA 1XZAA 4EUEA 4M0KA 1W4LA 4D8TA 3RABA 3WK5A 2YVQA 3BSFA 4QARA 5BWCA 2XVAA 5E2IA 3ZX4A 4EG4A 1BX1A 4N40A 1B00A 4P81A 4RH3A 1IWPB 1QNLA 2FPKA 1W0JD 3QEMB 1IULA 2FTKE 2B1QA 1Z6PA 3RWMB 1OA0A 2CVHA 2E82A 2Y6VA 3SEZA 4JUIA 5B4UA 2IPXA 2GBLA 2QF7A 4HWGA 2QYHA 3LUBA 1ZNXA 3EQ9A 3O4VA 4B3DA 2EW2A 4YV7A 4YAIA 4K9KA 4X7MA 4I4LA 4ZOLB 4C4ZA 5KB3A 4YNBA 4MULA 3W4IA 3DPUA 1YQGA 1PFKA 2P6NA 2C54A 3F7TA 3ETNA 1GAJA 2SECE 3HCRA 3KUXA 3NGXA 4ONEA 1JDPA 1LBSA 4RD2A 3REQB 3OOYA 4RK0A 2ZGVA 3JQAA 3MS4A 2QZPA 3FJYA 3FIUA 4S1OA 4HNAA 3E3NA 1RZUA 4R9RA 3E84A 5HKKA 4W8HA 3PEUA 3T99A 1Z06A 3KKQA 4HAZA 4G6ZA 3TL3A 1P0MA 2GYUA 3KZMA 4CHGA 2XMPA 4ZGWA 1C1YA 4IQFA 4IIHA 3K5HA 2I4OA 4F9TA 4HFRA 1P18A 1S3IA 2LW7A 3LY7A 3OZBA 4MXDA 4PZEA 3PFCA 1ILWA 4ZAYA 3S4YA 3TTSA 4BEJA 4BNKA 1IHDA 5IUKC 1KEWA 4KMRA 5CPFA 4YMSA 1XU7A 1SZCA 2J3DA 4OB7A 3OZVA 3LDUA 3VNRA 2LCQA 4G0QA 2X77A 4J0EA 4NICA 2UUBB 2JH9A 4HV4A 3SR4A 1XQ1A 2C98A 1I6MA 1SXQA 1HNNA 2VJLA 1KGDA 3TOVA 1NLYA 4HWKA 1CUDA 2R44A 1SXHA 1OC4A 4KQ2A 1GJRA 2H9AA 1S2DA 3FYUB 2EJTA 2IVZA 1WW8A 1YR9A 3PUVA 4QRDA 5T3YA 2IXEA 2L42A 1XQXA 2AYZA 5F2NA 4P7JA 4J1NA 2HJSA 3AILA 5EPOA 3QYJA 1DKNA 3HN2A 4FIZA 3GPBA 1IB6A 2VH1A 5FTMA 4CQMA 2F1RA 4BATA 4YCJA 1E2FA 3T3IA 4ZV9A 3KJHA 3E22B 4KYUA 4CE6A 1RAHA 3AONB 4URHA 1NVWQ 2GLTA 4E2ZA 1UBFA 1H1TA 5F1YA 1EUYA 3GJ4A 3NC0C 5B36A 4GWKA 3B36A 2ENUA 3A4NA 1YFLA 2XYHA 4FFBB 3RSHA 3JVVA 5C8YB 1Y4UA 1LPBB 2YFQA 2W58A 1ZNYA 3FOWA 3HJUA 3IT3A 4ERXA 1A88A 3L06A 4HGYA 2JAOA 4QU8A 4CQNA 2AFRA 2HWYA 1G38A 4RZSA 1WMEA 3KJFA 1BROA 4QEKA 2HWWA 2VPYA 1HQDA 2IU6A 4ATNA 4DMCA 3ADKA 3BXHA 3HACA 1EX9A 1E2PA 1MO5A 4IWNA 5EESA 3UGJA 4TYNA 1VYVA 3L7YA 1OVGA 4AJ9A 3J81A 4R0MA 1BQ4A 2OESA 2BTQA 4PRKA 4UDXX 4MS3B 4IINA 1TM7E 2XUGA 4EKNB 3AHHA 4J1TC 4BCBA 2AOUA 1XALA 3S0JA 1P5RA 3IBTA 4G86A 2C29D 1OROA 5IN4A 4ERNA 1THGA 2EZTA 3RUDA 2HSDA 1FDWA 3Q0TA 5I8ZA 1FYVA 2P2NA 2WPDD 2PS3A 4LS3A 5CNMA 5IVDA 3SFTA 1K7EB 2OLKA 4EKEA 1RJWA 2D1TA 2NSHA 2UZIR 3AR9A 4JB0A 4Y6GB 4C0SA 1ADCA 2VDWA 1G21A 4QT0A 4OIMA 5ESRA 2QN7A 4DJJA 2PX5A 2CL0X 3VOAA 3GLIB 5TT1A 2V98A 3ONDA 4YRCA 3GFGA 4GKJB 2J5RA 1D5WA 1V2HE 1ULHA 1SD2A 2QP3A 3IV7A 4IIFA 3TLGA 1L4BA 1N7JA 4JGBA 4ZT7A 4JXJA 2HTEA 2IUTA 3VR5D 5JY1A 4FHFA 3SYNA 1A50B 2ZBPA 3C4QA 1QVZA 3FPSA 4OP1A 1XA0A 3I42A 5DXJA 3KHUA 4OI1A 1ECCA 4G5FA 1Z68A 1R5NA 2VJKA 2WT9A 3PHJA 3MTIA 4X44A 3FR7A 3NEPX 2BFFA 5ALTA 4OFXA 3KTFA 4BJ5A 5HCIA 1FPMA 4OHZA 2MCFA 1DL5A 5EIFA 3ZKWA 2XDQB 3NTOA 1YXMA 4I5EA 4Q1BA 2YVAA 4D02A 2O5RA 1YZFA 1MJNA 4FGUA 1T9HA 1TJYA 3B38A 3E22A 3QSGA 5CT9A 3RSGA 3VQTA 2LBPA 3WLFA 1H8ED 1IEWA 2CLOB 3JVDA 5B1DA 1U81A 3SF8A 2CCGA 2EHJA 1R16A 1RWVA 4MW0A 4OQMA 4WNCA 4LBYA 2RD2A 1EB9A 2IRWA 2W6JA 1SA0A 2YJTD 5B3JC 2JLXA 3A3YA 3HVHA 1H94A 4FMCB 4HNQA 1R10A 1HL7A 1WB6A 3IVGA 1IMJA 1KOJA 4W6QA 5EHGA 2DHRA 1A9XA 1EUCA 1XZIA 3ZDRA 4ZIRA 1GPWB 1I7QB 1LUAA 2B7CA 5C8YF 5JS1A 2KJQA 1JXQA 3UKOA 2WU1A 3FB4A 4Q15A 2AZTA 3USZA 1RP7A 5CRIA 1NQVA 1O6BA 1XL0A 2QW8A 4XYBA 5EPEA 3UGQA 2POQX 3WB9A 1DWPA 4B9EA 1WXHA 2KWIA 2MDTA 2GJAA 4CMGA 3RJ5A 3VV2A 1DRKA 1FSGA 1GYPA 2V4MA 4BU1A 4E5MA 5ABPA 3NHAA 3OLXA 1Z75A 1I2AA 2PANA 2RHHA 3IB6A 4FX2A 3Q6IA 1RYEA 3GROA 1P1CA 3OWHA 4P3XA 2AYXA 2YVLA 3B5JA 3DF7A 621PA 5K0EA 2C7OA 3DH0A 3W7VA 1LBIA 1E0KA 1URPA 2ECPA 3ZV4A 3GLFE 4IJQA 2RGEA 3KPYA 2FF5A 4ESEA 1KO8A 3P32A 1GNTA 2G28A 1D9ZA 2GO7A 1D6MA 1FIUA 1H8EA 2REXB 2X15A 3E35A 4QG7A 1U3TA 1L5GB 1U6IA 1NN5A 2AXNA 1NMXA 1PZEA 1ZK2A 1IXKA 2B5VA 1FU4A 2O3TA 3FAZA 3L7NA 4HNRA 16PKA 3OO1A 4XEHA 3WYNA 3HPQA 4M0EA 4QHSA 3UJNA 1X7ZA 1JEDA 4UPDA 1TQHA 5IAOA 2YIDA 4HWOA 1E60A 4JLKA 3WI7A 4D41A 4BQPA 3DBVO 3VPGA 2WIGA 3DTNA 5FFMA 2JIMA 3D6AA 3AM4A 4NZZA 2F17A 2YTZA 3B3QA 1B0UA 2ZJ5A 3UH0A 1DIAA 2PXHA 1S2IA 1H2HA 1GCAA 1APBA 2X0RA 2JGRA 3NAMA 4K03A 1Z6GA 4ZQHA 1WG8A 3FPHA 1QYRA 3IP5A 1H65A 5CM2Z 4C6TA 5A6SA 5FBVB 3V7UA 4HEHA 2E18A 5K2MA 3DPSA 3G23A 2N47A 1WRBA 2FCAA 4KU4A 2PO7A 4U9UA 3GLQA 4UHEA 1GSIA 4CV1A 4O59O 4BAZA 5JRDS 5D2CA 1LBHA 5I9SA 2VLIA 3ZXYA 3NJ8A 5C1PA 1DWUA 4KRXA 4NCKA 3DOIA 2AMFA 3WKCA 2PZEA 3R9XA 3UPUA 5YASA 4HNGA 5CDYA 3CUSA 1ZL2A 3EQ6A 5KIAA 2WTUA 4PPNA 2WYVA 1NTOA 3H1PA 3SSAA 2ERXA 2H2IA 3T5AA 4A2WA 4K6HA 4PLCA 2DUUA 2AE2A 1YULA 2B2XA 3E5NA 3I3OA 1E9VA 1UKVY 4FXOA 3BGWA 1XVUA 1BQ3A 3F8SA 1G2IA 4GVLA 4NONA 2VWQA 2YXBA 1GHTA 4R01A 4U2CA 3T3GA 4A2CA 3A1DA 5HQTA 5AJHA 4YLGA 1T2VA 5M04A 1FJHA 3CF6R 4UEWA 4RNCA 5CHEA 3ER8A 3W6OA 2G9VA 1IYZA 3HYRA 2GO1A 1FTYA 1C9DB 1EBUA 1EP9A 2ZXEA 3IA7A 2AJLI 2PT6A 5LD2B 1CE8A 1YBHA 1P2VA 1Z2CA 3B60A 3T8YA 3WZLA 3IL2A 3FWNA 1RABA 2I99A 3W9UA 5A4FS 1FP2A 3NORA 1QUEA 1T8SA 2WMDA 3C8MA 1RJGA 2J67A 2C0PA 1LPSA 2I33A 3BXGA 4DNQA 3PNPA 4MIKA 3R8XA 3RS3A 1I0IA 3TUZC 3MLAA 2JH8A 4ZEVA 4E33A 3FUVA 5GADl 1SUBA 2Y0BA 4TMWA 1NATA 3I9V1 5JROA 1P5HA 3TW8B 1WUTA 2GPSA 1NR5A 1R6UA 3TN7A 4JYBA 1DE0A 3L1UA 3KB6A 1FS5A 2AL7A 2PWYA 3HRHA 3DP9A 4L6CA 4DLSA 4M49A 4UNSA 4A5SA 1OC2A 4PCUA 2J3HA 1Q17A 1YIAA 3DAOA 3Q5EA 4QYMA 1T0HB 4DXAA 4I50A 4DYHA 1S2LA 4MWZA 2BJVA 4EG8A 3BHNA 2V6BA 2EWWA 2JGFA 4IHKA 4AMGA 2GKSA 4QXMA 4RPGA 4A9AA 1EUCB 1UKCA 4L22A 4YP9A 3UMCA 4DWVA 3M81A 4F91B 4O2BB 5B3LA 2QLMA 4URUR 1I4TD 4HLNA 3KU4A 1IBLB 2R8YA 4AP9A 3S7ZA 3WLKX 5BQFA 1Y1TA 3D3WB 3K05A 3O8LA 4LQLA 4EI8A 3K6SB 5LQCA 3PF9A 4A26A 2NYVA 2R1VB 3JQ9A 5DYGA 3E9RA 3KBBA 2VHEA 1SEPA 3W5UA 3B52X 4DB4A 2WJ6A 2WFMA 1HA3A 2QVXX 3K1JA 3RRJA 2E2WA 2P2SA 4INOA 3MUFA 1BFUA 1V8PA 1ZIOA 3L6CA 5HJEA 5JYBA 3G17A 1P60A 4GO1A 1JSXA 2K5UA 4ZVKA 3G0HA 1XWFA 2CUKA 2NZ8A 1KI2A 2HY7A 1J9GA 5B4VA 3TQCA 4EUFA 1GNQA 2D00A 4TXHA 4RL4A 2RGUA 4M36A 2RHMA 4HMPA 5AJVB 1W5BA 5E6RA 1ZUHA 1U0HC 1KP2A 3SDZA 1EVQA 2O2YA 5HS6A 4R2HA 3BD8A 1QK5A 3PIIA 4OJMX 4Y2HA 3TM5A 3AR4A 4LJ8A 4PQGA 2JJ8A 4WNAA 4X3PA 4BQOA 5J2TA 3TYXA 3PUJA 2I3AA 4WZAB 4B44A 1C7FA 1HV8A 4CT5A 4ZZ3A 4IXNA 4LEIA 4CR7A 4C7KA 5EG5A 5HUQA 3L6DA 1UM8A 1FX0A 1S01A 3K15A 4H1UA 4BKUA 2J5QA 3HLKA 4HUTA 3A6LA 3B70A 2VCHA 2NV0A 3MIIA 1M8JA 1VCHA 1CUIA 4HDSB 4WLOA 4R7GA 1N5OX 2YZKA 3L4KA 5JBNA 2O8NA 1BWSA 4XWTA 3JZMA 3CCFA 3OQNA 4E31A 2ZJ7A 2O8BB 3KQPA 1TT5B 4TLLB 2VJPA 4U7HA 3TKYA 4PGFA 4YACA 1FMFA 2PRJA 1GOTA 1JU4A 2EL9A 3H1AA 3LKDA 5TY0A 5IUNC 2XGMA 1DLJA 1UK8A 3KR1A 3OX1A 2CJFA 4JHXA 2PYIA 1AGYA 2V9PA 1P0CA 3N2IA 2QD2A 4NVRA 4DAOA 5FQNA 2Y9MB 2W5UA 4LNUB 4EHNA 1N78A 3SR3A 1HDIA 2X9NA 1WPRA 3M5CA 4IXMA 3ONNA 1WNTA 3G02A 3C3BA 3GNTA 2NU7B 3U7IA 1P0IA 3TDMA 3ZDEA 1R6DA 1YJ8A 2IEBA 2J7KA 2R0QC 2CKMA 2IPLA 3C85A 2VDQB 3B2QA 3S5JA 2PT9A 1A9RA 5TF4A 4MUGA 3WKEA 4R7ZA 1G7CA 2VZ9A 2C04A 3U4HA 2HDOA 3QOFA 4O1MA 4CR8A 3LY8A 2FEAA 1SU7A 1ZICA 4BYGA 1L4MA 3Q87B 4DV0B 2J9YB 4XSHA 1RWOA 4YAJA 3BIOA 4BX3A 1G59A 1B0PA 4MZXA 3K9LA 3OE4A 1SIOA 1FU7A 1ZGGA 2P11A 5FPPA 4EEXA 3E9YA 4F2DA 1KWKA 3NGLA 1YDEA 2HJHA 1JI0A 1KR2A 3W8RA 3T38A 4RA6A 4RACA 4MKGA 2Q1SA 3PVSA 2XF8A 2FA9A 3OG9A 2O14A 1IHYA 1R0RE 4ITVA 4ZGGA 1LF5A 2G1KA 3GK3A 2VTBB 1JIUA 2I2XB 3GRKA 3UF0A 4DJEC 4ENTA 2VTKA 3NFRA 5HQJA 2CXNA 2DHEA 3JQ8B 1ENPA 4LCEA 4PO3X 4YRLA 2JATA 1E0JA 4Q66C 1GA4A 4G63A 3RIGA 1DX9A 3LYUA 5DISB 5TQ2B 1EVKA 3WIBA 1NUPA 5B30A 1E4EA 1F5SA 3FZGA 1BO6A 1R0XA 2RH9B 2GN4A 2AD1A 5GIOE 4M0PA 4PRLA 3DDWA 4FP9A 1M9NA 4IWXA 4OI2A 4OXXA 4YP5A 1Z38A 4CCYA 4MP6A 3UHAA 3LIIA 3ZYZA 3PC3A 2WD7B 1OXKB 2MSDB 4YCBA 5BQPA 4EG5A 1J99A 1RQNA 1YL5A 1J2TA 1RT9A 3DE7X 3ESAA 4RVOA 5KYNA 3LNTA 4D4HA 3L77A 3H3XA 2BM9A 3O5AA 4YR9A 3I2GA 5A4JA 3IPYA 2JIOA 3WL3A 4ND8B 5H0IA 4CWAA 1V2GA 2JDID 1B73A 3NCTA 2P6PA 2I3BA 1VHQA 1ESZA 1KH2A 2FSSA 3M6AA 4YRPA 2NUTB 1EU1A 3GNLA 4ZCLA 1WSDA 3BMNB 1IZZA 1V8FA 1P1FA 1MOZA 4E5SA 2Q5JA 3E7XA 2G08A 3A1NA 4B45A 5FTJA 3CLRC 3SHWA 2FMKA 3QPAA 5AJZA 1FDUA 3RLIA 3WYDA 2Q5LA 2AF4C 4RF2A 3ICCA 5AVQA 4RDCA 1NMSA 3F4LA 2WF9A 1QAMA 2Q3JA 1UJ4A 3IBFA 3OFJA 4E2WA 3TLGB 1WV1A 4Z3OA 3T1NA 3IKMB 1UT6A 1NJ8A 3V7YA 1JX6A 1CLUA 1OYVA 4J3JA 2X23A 3DXXA 4D6XA 5IXJA 1KAOA 2YWEA 1QDEA 3EGDA 1H3FA 2CVFA 2WZCA 2P9BA 3GQVA 4RVGA 4RJIA 3RSSA 3V4FA 3FWPA 4XGNA 1E0AA 5HBRA 3TXYA 5ADVA 1BHSA 1EWTA 1FU8A 2AEEA 4L74A 1ZJZA 1XNGA 2OKCA 3DXYA 5LQMA 2QA5A 3UCXA 3KQTA 3M3PA 4TTAA 4EZBA 4DSOA 4WZAA 1IN5A 2DQYA 3LW7A 5LOVF 3F9CA 3ZH2A 2PH7A 4LXIA 5I9TA 5JPCA 4EHIA 1B74A 4E32A 2IYRA 3ZWDA 1QVRA 1OXSC 1R4NB 1G1AA 1G8GA 1CYEA 5ELLA 5HIIA 1CR0A 1QZTA 1Z26A 2AD5A 4AG6A 5H7XA 4CBVA 1AQJA 5HP4A 1UAAA 2NVUA 3QA3E 2W2NA 2NTJA 3ZBTA 3RHFA 4I4TB 5GZ3A 1TC1A 3OSUA 4F96A 3NJ4A 2ECKA 1XTSA 3SZ3A 2G0TA 1PBTA 2FMXA 1K0FA 2VA9A 3R7AA 4ALIA 1KDPA 2OO5C 4PW0A 1OT5A 4AX8A 3E1GA 1WEHA 2WTNA 2WQ6A 3NHSA 1FP4A 5ETJA 1N2ZA 1PI3A 3B9QA 1TEVA 4P83A 2GBIA 2ZPTX 4UE3S 1BFDA 3AEUA 2WNHA 1NXTA 1K3FA 1F8FA 5HGJA 4W8GA 2V6FA 1H2XA 5FUMA 3Q7RA 3G49A 4HDOB 4KE9A 1SD1A 5CUQA 3GRFA 2REBA 4AJLA 3CPEA 2XDYA 4ACBA 2XZPA 3EG9A 4YDQA 2IYNA 5AK3A 3UK6A 4DLWA 3ZGZA 5I7WA 4LGVA 2IEIA 3SZUA 5KQPA 5LL6P 3CNOA 4MMXB 2FOLA 2XXAA 4U3JB 2C3PA 4RGQA 2O9JA 2KBEA 4R3WA 5AHKA 4EA7A 2C9MA 2PO5A 1P4SA 1QU2A 3VZPA 1HUQA 4BTLA 2IZZA 3SX4A 4EI2A 4EY8A 3UJAA 4ENPA 1CU1A 1EVYA 2XMZA 3QGMA 4RZXA 2OYRA 1D6NA 3F4KA 4UVDA 4N7BA 1C41A 3KOOA 4TV8F 4IDFA 1GDHA 1UT8A 3KEMA 4Q82A 2XF2A 3DA8A 2QN8A 3TLYA 5GJVC 3VISA 1B8PA 3I6QA 1UBMS 1UXJA 3IDFA 3IVMA 4ZVQA 3WJ7A 3ZZUA 4EELA 2YYSA 3U1BA 4F56A 1HG0A 1XZFA 4TYQA 2DWQA 2X8WA 4JFRA 1U8AA 3M4ZA 3TFWA 1AQNA 2IZ1A 3PQ5A 2R6JA 1J6UA 1UM9A 3EDMA 5BSUA 3UH1A 4P7BA 4YMLA 2Z08A 1MC1A 3RYIA 2CHQA 1IK6A 4QBFA 4JLPA 1P2UA 1PF7E 4PC2A 1BCRB 2O8FA 3T5BA 2GJ8A 3DR5A 1UPXA 1ISSA 1ODKA 1VM6A 1SC1A 3OSZA 5LQUA 4KVGA 1RXUA 5HZHA 1IN7A 2WW8A 4M9XA 1N75A 3IUQA 2BV3A 4IHJB 5EGSA 1J25A 3KQNA 3L0ZA 4BLRA 5DBIA 1A9XB 1YZTA 3AVTA 1XHEA 5CNJA 1PD1A 1KO4A 3H0KA 4RWZA 3AKYA 3WLNA 4D9KA 5L95A 2CV0A 2IWRA 1EPUA 3OICA 4BVFA 4CG0A 4BZWA 4C03A 1MF7A 5CDTA 2IHTA 3BMNA 2PAAA 1ISPA 2PJDA 3PGJA 4J1QA 2EZ9A 5EJ7A 1ZJWA 4P0PB 1SU4A 5JS6A 1GFWA 1WUJS 4TOIA 2VYFA 4U7WA 4DDVA 3BK7A 1U0JA 3FZEA 2WLSA 4AYWA 3OEED 1UDXA 3PHIA 4O2AF 1US8B 4FFLA 5JCOC 2O8CB 3THYB 4ND1A 3ZHOA 4AP5A 1X8XA 3MRXA 3NYQA 1QRTA 3CZCA 3KRTA 3IVCA 4Z9YA 2FRXA 2Q1YA 4UTOA 1JR2A 1LQUA 4KYIB 4D3FA 5REQA 1RRVA 2XE8A 1RP1A 2B1JA 2FQXA 2H1LA 3LA6A 4R8VA 5AOBA 2JFGA 4IDEA 4PSAA 2XR1A 3DT6A 2LE0A 1NUSA 3O0DA 4GEKA 1M2WA 3IT1A 4QWMA 4MB2A 4EMBA 3DKKA 3NANA 1ULBA 2Y1FA 1CUXA 2BEWB 2ZPAA 3UN1A 1KI1A 4D8XA 2XGOA 4MAFA 2P2LA 1L4NA 3LUJA 1V11A 3DLHA 4Q47A 3RC7A 5KBYA 3WAGA 1FFXA 1RQRA 4JR1A 2IS6A 4EG3A 3PENA 2Q7XA 1L4FA 5LMCA 1QYIA 1KZ1A 1W5EA 9GPBA 1TK9A 3BFXA 4G4IA 1Y8AA 2J7PD 4QL3A 3T7KA 2WG1A 3TLCA 1NBME 2IFTA 1F2UA 3D6FA 4ZHSA 1YVPA 2UYQA 4F6RA 4J29A 1DCMA 1ACJA 1Q0ZA 3IP7A 1FFSA 1HQYE 3WK8A 1QO9A 4FFDA 4JNCA 3N2LA 2C83A 1LEHA 1QOPB 2YOHA 3R0QA 4KQ9A 4TZ6A 1ONPA 4JJIA 4IH4A 4XWKA 1W5TA 3DEYX 5EWLA 2B25A 4I8DA 4RD6A 1EVEA 3UMBA 4Q9JA 1Q12A 1CJTC 3MCVA 3O1JC 3Q4GA 4ETNA 3S44A 1BCRA 3S2EA 1NE2A 4E5PA 1WBDA 2VQ3A 3PWTA 1DKRA 1G0OA 2PRIA 3HCEA 3KPWA 3HY4A 3NR2A 3R09A 4CEIB 3JTEA 4CKCB 3T7RA 1A5SB 4QGFA 3BB4A 1XTPA 3U4MA 2O06A 3I1FA 5I8PA 5CA0F 5JYDA 1TMYA 1WNFA 1Y5RA 1X1SA 2RJNA 2JGJA 4FFSA 2NZUG 4BIIA 1VXRA 2GK7A 5D3MB 2FK8A 1O4WA 3V4SA 2JARA 2ACVA 3UT5A 9LDTA 4IHJF 1FDRA 1TU4A 1TF5A 4ME6A 5K51A 5CCDA 3RLFA 4RJJA 4B33A 4J0HA 2VRWA 1LDEA 2PY6A 2Z1NA 3KAPA 1DNPA 4WY2A 2RBGA 4OH7A 1Y6JA 3DYBA 1NVKA 2IGBA 3D31A 3MUOA 1O5OA 1Y6QA 3GLIA 2PN1A 4R31A 3WYEA 1UP6A 1YS6A 1R9JA 4RABA 1OI4A 2BGMA 2PU5A 1S8AA 2FWRA 2ZRBA 3BJIC 3KT3A 4V0OA 1FNDA 1WDTA 2BT4A 5J5VA 2H18A 3UMYA 1Z63A 3QVTA 2IV3A 2D5IA 4G97A 3Q40A 1EEHA 1M2EA 3GBVA 1O58A 1FLVA 3Q1KA 5IKEA 2HA5A 1CWUA 2HPZA 4MS4A 1UMCB 5LXTA 1IVSA 5JPDA 2BOVA 1TZMA 4B3JA 1G4AE 4L78A 3CH7A 1XN1A 3J80A 2IU4A 4RVUA 1G20A 3KYIB 1ZJJA 5H3CA 5CXUA 1MQSA 4MHOA 1NUUA 3FMGA 4E22A 1YGYA 3EBPA 2I3ZA 4H4EA 1JQJC 2GWRA 3DPIA 3F9RA 1YOVA 3PVCA 2Q1XA 2DMRA 4B6SA 1ZISA 1QG0A 3AEYA 1TE2A 3QRWA 2J33A 2G72A 1MIOB 1CNMA 1NT2A 2WAXA 3CNHA 3DTVB 5FLEX 1BE1A 3BICA 4GQAA 2UZ0A 2YH2A 1ORDA 4PZAA 5ECWA 5JCZA 1OHHA 3U17A 1L4HA 1W1UA 2HQ1A 2Q6OA 1U4NA 1XTJA 4TZ0A 3JQEA 2PHZA 1T9BA 4Y2VA 4Q00A 3SI7A 3W5JA 2W11A 2Z98A 4LJ6A 4AL4A 1PTJC 3SEQA 5LFAA 3G7SA 3COWA 5G4LA 4LBVA 1EWYA 3WQHA 3MJHA 5EIHA 2J0UB 3VNBA 1BHQ1 1UMDA 3W2FA 3WLQA 4X62B 1ZCAA 4O29A 4RLSA 3U7EB 2HGSA 1KEEB 2IYZA 3BWBA 3RRFA 2W7TA 2HA4A 5E7MA 2QYSA 3I3SR 4Q3EA 4OYLA 4K9RA 4P53A 2JHCA 3VSCA 3R7FA 5B4TA 1J09A 4R6XA 5JYCA 4DSAA 2D0OB 1PFUA 3NV7A 5AVVA 2L17A 5FV7A 4GDMA 1VHWA 2I1WA 3NTXA 1NJSA 1HZJA 2XUDA 4GKVA 4I1PA 1PJ4A 1RHKA 2CL7X 4JSYA 4XRRA 3TW8A 3U3RA 5I4CA 3M34A 4PYQA 1SBZA 2X9QA 1A76A 4AY2A 1I7DA 4IKPA 1O87A 4JBYA 2JI8A 4OQDA 1W2HA 6GPBA 3T5CA 3OIDA 3E7DA 4P93A 3W34A 2B61A 5CBPA 3EEYA 3WMGA 4G37A 4TKMA 4IVRA 2HKIA 3ADPA 3OBBA 1H2WA 3EUAA 3OJLA 4P98A 3UOWA 3NO4A 5LQKA 4UASA 3UWOA 4Q4CA 4W5RA 1C0LA 1C2YA 1CRWG 1EH5A 2C31A 3A06A 2P5YA 3QU4A 4JLMA 2HXGA 1H6BA 4URWR 1ZQ9A 2VAPA 3LOPA 2ZT6A 3B3GA 1QIFA 2VDOB 3NMUF 1QUFA 2DFVA 3JD3A 1X1RA 3LPNA 4TV9F 4ARCA 3LT5A 2XOXA 3N76A 4CL8A 1PTJA 3K0HA 3SIPA 2PQMA 4B4UA 1H1DA 2VAVA 2AC7A 3COVA 1V6CA 3ED1A 5AW3A 4LZAA 3TRHA 1VPDA 4B4VA 2E89A 3B1XA 1BEUB 3O95A 4J0GA 4ABTA 4NI5A 1UEXC 5IAAA 3PEYA 4R8RA 3CF2A 3HRIA 3P9SA 3QG5A 4DANA 1K97A 3FN4A 5KJFA 1EJ0A 2WTEA 1D07A 1VHLA 1T0IA 4KSCA 4CV0A 1LWOA 5T4FA 1Y63A 5E6UB 2CXSA 3CG0A 4EYOA 2GVDC 4HVLA 1KQOA 2UZ1A 5LBIA 2QBYB 2IS1A 4E5KA 2HIAA 3ES9A 3UT5B 1U9IC 1WP4A 2A9QA 1ORIA 2ZJAA 1AUQA 4TM7A 1EE1A 3LZ6A 4X91A 3N05A 4JL8A 4WHMA 1KZ4A 3ON5A 4D46A 2CNNA 3RTEA 2OA0A 4TRNA 4EGFA 4HWSA 3GP5A 1FB5A 1DDIA 1ZOOA 1ULSA 1TIKA 2CEAA 2G63A 1ZD5A 3MT0A 4LHXA 1UBJS 1Y3CE 1LPOA 2B7LA 1BN6A 1MVNA 3UKDA 5LP6B 2EX1A 1KR5A 1NW6A 1VQ1A 1L7RA 2J0QA 2IYWA 2CD9A 1LVHA 2PMDA 1N2CB 1XI2A 2AKEA 3I9MA 2OP0A 3JQCA 2EJBA 2ODAA 3OZAA 4FD3A 4GPD1 4WCFB 1DQPA 4E6EA 4S3MA 4IMRA 1JR6A 1O6ZA 4Y9UA 1Y7PA 1NZJA 4B2IA 1P44A 3MF4A 1SHJA 3KKZA 4JLSA 4US1R 1TUEA 2Q4OA 3V7WA 9ATCA 1FC0A 1ORWA 3BS4A 4R9VA 3SFZA 1XMOB 1FDSA 3KO8A 4WVFA 3DLCA 3ROFA 4ASUA 4OX9Y 3TAUA 1AQYA 1QM5A 4ESHA 1CY6A 3QEBZ 1A5BB 4ZVMA 1SC4A 2UV8A 2D2XA 2QL7A 4MWGA 2FG6C 2EIHA 2OCKA 3H16A 3S27A 2VHYA 1MABA 5A9SB 1SVIA 3QENA 4ZARA 2YJ5A 4HQFA 2RAUA 2PKWA 3MJVA 4Y2JA 2ZDHA 3C4VA 4L72A 1TW2A 3ITNA 3EMVA 2Q6TA 2IYUA 2IKQA 2ZS7A 3D3QA 4DA8A 3E2MA 4NAVA 5DHUA 2PNFA 3WSWA 5KX5F 2Q8QA 3V6LA 2QYTA 3E4DA 3KELA 2E87A 4ALKA 4KG7A 4D3ZA 4S1WA 4AY5A 3GG9A 4QIHA 3AZPA 4YJFB 5JOQA 3ENNA 4JI3B 1IPFA 1PNTA 4QO8A 5C32A 5DVZA 1KBOA 2IWHA 5JZBA 3RSZA 4YS6A 2J0UA 4O1IA 2Y0PA 3DD5A 5HRAA 2LCIA 1Q1NA 2CKDA 1U3WA 4ZALA 1NN1A 4TXNA 3BJRA 2P9JA 3IEUA 3OZCA 3MGAA 2E49A 2ZU6A 4JJAA 3RRXA 5IKPA 5K8IA 2YX1A 3L1KA 5AKEA 1ESCA 1Q16A 3LT0A 4H6WA 1JVNA 5A04A 4BE7B 1FRFS 1EHYA 4KGDA 4ARVA 1JEQB 3SFVA 1G2QA 1GGFA 1QVVA 3ACDA 4RPLA 1KMIY 2R65A 2QM3A 4COKA 4C7VA 5AOAA 3T0FA 4LOJA 3GRZA 3V7NA 4UVGA 3L40A 1Z82A 5E2AA 2X5KO 1MV5A 2C96A 3DW1X 3I39X 3OF5A 2FAXA 4NCJA 3S2ZA 1QR2A 2AE1A 2P0EA 1R8SA 5FL3A 4O4IF 5E7JA 3L4BA 3ZI7A 2BEKA 1NV9A 2CBZA 1EFVB 3RPEA 1MPTA 1KVQA 1NW8A 3E8MA 3QEMA 3KBOA 3L6RA 3BHMA 4M1MA 4ES6A 3OQIA 3FH0A 4HTAA 2XQGA 3Q8LA 4C7OA 3RBXA 1SGWA 4XR9A 5E4FA 5LOVB 1Z8NA 3AFGA 3FG9A 4PRZA 5DHPA 5I47A 4OMFG 1EK5A 2XCLA 3REFA 3HKDA 1SHKA 3HB1A 1SCNE 1RXCA 4GAEA 3ZU5A 3WLIA 4D8UA 2OCXA 3EYWA 2Z4TA 3JYLA 1SOVA 4HAXA 3WLPA 4PLHA 5FQOA 2G76A 1JEOA 2RI1A 1VJDA 5A7GA 4LTNA 1R3UA 5AXDA 4ARBA 5IVPA 1WCV1 1SC9A 4RK4A 4TS1A 4X9XA 3M2PA 3EDOA 2IYYA 2WZDA 3S8YA 1QQAA 4KSYA 1DO2A 1K88A 2QGNA 3QXJA 4TZTA 2ZE8A 1M6YA 1VG9B 3CW2A 1OR8A 1CY2A 2NUBA 1DINA 5JV5A 2XUAA 3FNFA 4Z4CA 3K4HA 4E21A 3UG6A 4Z51A 4A6DA 4QGBA 4UXJA 2EOAA 5C4IA 5DN6A 1UBGA 3GGJA 1X77A 4GPBA 1U9IA 4H18A 3R7DA 3UMGA 3AIOA 4CMJA 3WV5A 1CFZA 4C7XA 3DMTA 1ZW6A 2V1XA 3ETDA 4HOYA 3SHFA 4F5EA 2J1LA 3H4VA 3K0AB 4G3XA 4IPTA 3T1VA 1D6JA 2EJUA 4HYTA 4RHYA 4U7GA 3V2IA 5BYKA 2A78A 5A3RA 3AGPA 1PUJA 1JDTA 5A4KA 4HZIA 3DO5A 3I6YA 3DTVD 4M8IA 2BCEA 3TBFA 5IDXA 4NCAA 2BGUA 4UQPA 1SXPA 2Y77A 3VHQA 1NYTA 5BN4A 1TUBA 2I7CA 2Q4DA 2VDNB 3U4AA 3EDCA 4MEBA 3ZOKA 3IQDB 5L3SB 2J6HA 4ZOQI 1WE2A 4F21A 3SJCA 2I9PA 2QRHA 5T57A 1Q0UA 5I48A 3U7FB 1K86A 1E6UA 3F49S 1ZITA 4POAA 4IQ4A 5BR4A 1RI5A 3H2BA 2XAUA 1P75A 4DUYB 3FDXA 4R9NA 2QVCA 1E8DA 4NHOA 5FJIA 5TE9A 5B5SA 1UJ5A 2WJHA 3HVRA 3LCVB 4MUMA 5EXTA 3P71T 4KP7A 3RTDA 1TZCA 2Y99A 5F33A 1VLLA 4Q3NA 1XX6A 3ITEA 3X1JA 4B1FA 1WDWB 4Z8YA 1N3BA 2CBGA 3VC1A 4BP3A 1UKAA 5I9IA 1N6RA 2R5NA 3BHIA 5E4TA 5JDCA 3K0CC 3UK1A 4LUCA 2F4VB 2V9ZA 4LKRA 2OSBA 4YONB 1IY2A 5JI3E 4CF6A 1XROA 1VRCA 1V5EA 2W2KB 3BRSA 1SPXA 3QFFA 2HLNA 5BR1A 5E9JA 2CHUA 2WWXA 2OAGA 2ADOA 3Q5GA 5IWAB 1TT7A 1VIDA 4JEIA 3FOCA 2QQEA 3JYHA 5JNVA 1QHSA 3AFNA 3P0IA 4NMLA 3P9RA 4BTEA 2PGNA 2PKQP 1Q7EA 4JEMA 2H57A 4MRMB 3UJ8A 4EVQA 4ARSA 4NSNA 4YRJA 1EFUA 2WOOA 3PNMA 5BW6B 1N77A 2A3RA 3LX8A 4KEAA 3UJ3X 1RYNA 4DJDC 1QV7A 2DFDA 1MENA 4EX6A 3GJYA 3PIDA 3RS7A 4AF7A 3RVNA 1CDEA 1JEQA 1M0WA 2Q27A 3LWBA 3SYRA 2B4TO 2ZZKA 1BKSB 1PYDA 4PR0A 2HQBA 3PR2B 2FOIA 3T5PA 1JQKA 1ESDA 1HTBA 1Q91A 2AUTA 2HA2A 1XA3A 1EFPA 1Y8RA 4MRNA 4TMFA 3UKJA 1LX6A 4ZANA 4NDZA 1CVRA 1QR6A 1XCMA 2VKQA 2ZIZA 1J0AA 2Q1UA 5CJ2A 3LUHA 3FAKA 1NY6A 2YCBA 2ZRIA 4JQCA 3DE5X 3O2NA 1AURA 2WTAA 4JBLA 4KFRA 4B80A 2RH8A 2WKRA 3LTNC 1N3IA 4EY5A 4QC2A 2DWPA 3DCYA 2MSLA 3PLNA 1ZL0A 4DQ0A 3E05A 3JAWB 2XYPA 1FFBA 5CB4A 1PVVA 1AIPA 4CMKA 1F7VA 3ZU6A 1I3MA 2FZEA 2JCSA 3JZFA 2H5IA 4RV5A 2LKCA 5CHYA 4KUGA 2D5BA 3W9SA 3PDCA 2O07A 3OECA 2JIDA 1MUUA 4D81A 2YQ4A 3G1WA 3QI2A 2WB2A 1HKHA 4Q3LA 4AX4A 1XTTA 3CVJA 4GM4A 4DCCA 1AS3A 3JR7A 5K05A 4GZ3A 1PKXA 4C0QC 4TYPA 3BORA 3U7GA 4V0NA 5ANRB 4UEKA 3PXXA 1JAIA 4JLWA 2J6BA 4HLUC 1G42A 2AYYA 1HXHA 1G0NA 1NJFA 1UXOA 4NZYA 4XGRA 3WLLA 2FQQA 4X1KB 3I9V6 5LU8A 1F3OA 1JE0A 1QF9A 3P4UA 1K6MA 3OY7A 3VKVA 2Y1CA 3A4IA 4Q1AA 3CN9A 2JLYA 4UE2A 3IEIA 5DM4A 3QH4A 1XXHE 2PQ0A 1Z7YA 1I5EA 3B7WA 3KAJA 2XEXA 3I52A 4OQNA 3L8HA 1GA1A 4QUGA 1HTTA 2PA0A 2A2ZA 4B7UA 2B0CA 2QTRA 4WEOA 3TQQA 1TZJA 1L8XA 5ADUS 1TM2A 2PUJA 1T8YA 2X0JA 4UTPA 2HBRA 4TLEA 3FKSA 3K1AB 5TJHA 4JUAA 2J3MA 4Q4JA 2R6R1 4I36A 2HNBA 1IM2A 1RJ9A 4IXDA 2G6BA 3HZHA 4LMBA 4QXPA 5DYNA 2PZJA 2OK7A 2RGDA 3Q3VA 5EJ9A 2AX4A 4U7FA 1A96A 2F9MA 5JJIA 1O5TA 3A3KA 2ZI3A 1LRKA 3IE2A 4C7MA 1PV4A 2I6QA 1JHMA 2QT0A 3Q2IA 1U0OC 3NHUA 3LG2A 4QATA 2C8JA 3DLBA 4I5IA 1P3DA 5E2BA 3T7TA 2LKDA 2Z4SA 3BERA 5TGDA 4LDAA 4MOWA 3FUCA 2FDRA 1QRDA 4K9OA 5AIBA 4LJKA 5KYYA 4FR0A 4L57A 2YBEA 2HRQA 2FWIA 1CR4A 3RKSA 3WMEA 3OUUA 3WNVA 2XTNA 1I1HA 3G7NA 1NLMA 2C78A 3HFJA 3RAFC 2V7EA 2AG1A 1S3SA 3KKPA 2Q5FA 3VOTA 1NC3A 4Q4LA 3H4MA 4DEYA 4PYRA 1QH9A 1PLJA 2R4TA 5CEFA 1FRNA 3SYTA 1OAKA 2H1WA 4FZ3A 3EY9A 5IF9A 4UC0A 1JKFA 2D13A 2P9QA 3GT0A 3QVWA 3WXMA 3ZWMA 3JYPA 4HEJA 4D57A 1VSUA 4PTZA 3TCXB 5CFLA 4DRXA 2ZYSA 3MWLA 5F23A 4KBYA 4KXMA 1HT0A 3M49A 2AXPA 4KAJA 4LZNA 4M38A 1ODSA 2GD0A 4QOIA 3WIVA 3X43A 1MFZA 2YNMA 4FU0A 4JI8B 4JBGA 4CZ2A 2BAGA 3CZPA 3DTVA 1IOVA 1GKKA 1JHXA 3QQPA 2IT1A 1Q5PA 1V9CA 3AG5A 3UA4A 2QXYA 2R6GA 4RSGA 3V00A 4UM9D 2QJFA 1Y89A 3HB9A 2PUTA 3Q98A 2ZRLA 1YHZA 1KRXA 2QLLA 2ZIFA 3LPAA 3KTDA 3LXRA 3VH1A 1P39A 2IITA 3TKAA 2VBGA 3ZV5A 3NGMA 5FH9A 2FR8C 4Y9SA 2O2HA 1IDOA 4JT4A 3S1AB 4Q4AA 3SVZA 1YKGA 5IJ9A 1E3IA 5HS4A 5C5DA 2J08A 4X6LA 2H51A 4BO8A 4WA8A 1LS1A 4XD7A 4JAVC 2M1ZA 3DKIA 3LZCA 4JP8A 2ANBA 4EPVA 2DY1A 1VA5A 5ADHA 3DEZA 2QJTA 2IYXA 3QWBA 4M21A 5KREA 2O8VA 1ILEA 4Y0VA 4PAOA 3CH4B 1JBQA 5I9BA 1U7HA 3O3CA 3TW6A 1TK3A 2XE7A 3ED5A 2IYSA 2OVFA 3LCMA 4AN0A 1E32A 3NYWA 5JJCA 1M1ZA 4CEHA 1VL0A 4NZ9A 3UV6A 3P94A 4B4DA 4N12A 1NVUQ 1DAIA 3IELA 3HM9A 5DO9A 4ER0A 3C5VA 4ZEWA 4H7FA 3BSYA 3HGMA 3RYFA 4TVKA 1UPBA 1Z5VA 3A4YA 4OL0A 5HZMA 2H9IA 1KHHA 2VAXA 4R4JA 2JIPA 3FVRA 5JRZA 3WR5A 2ZJOA 3SZMA 2RGYA 2EJWA 2JVKA 4U2BA 3BDIA 1PR4A 3KUUA 3QOYA 4TLCA 5A2GA 1KY5A 1SHZA 1D8AA 3CLVA 5AESA 1RQXA 2VYQA 2EXXA 4L8WB 5KVAA 1Z6QA 1GD1O 3KJEA 1RLOA 1J7JA 2XKJE 2FETA 1RJFA 1YH3A 2V03A 2Y9PB 3OQHA 4KQWA 2WSSD 1SKMA 3FNQA 3KWFA 1RKXA 3AEUB 3VC3A 1ZW1A 2PX0A 1V45E 5DE3A 2RG7A 4OF4A 2IPMA 3OH8A 3L0PA 4HLCA 4MWOA 4O4JB 3SD7A 5FOQA 4QG3A 3VAYA 3FJ1A 1BYIA 4L5JA 1A2QA 1JJBA 1YJ5A 1PQYA 1Y5NA 2TMDA 1V7ZA 2PM8A 2WDZA 3HI4A 4HG2A 4QDUA 3EX7C 4M1KA 1R12A 1Z8HA 2XD9A 3GZJA 2VHCA 2FPLA 5HF9A 4KOEC 2J41A 3FDZA 4AS3A 5LYJF 2FXVA 4HQNA 3GVCA 1WTCA 2ARKA 3N7UA 4BMSA 4MVJM 4C78A 2DR3A 4ER5A 3OP1A 1JQAA 1NOIA 4RETA 2RK4A 4WINA 1KIMA 1LV8A 1QMGA 2BBWA 2BZGA 3MTBA 3K8QA 2HRRA 5H3HA 3QTTA 4C6RA 3X2FA 5C1BA 1FQWA 1TJ3A 2AN4A 4G1FA 3L8YA 4WE3A 3THWB 5FIUA 4NAUA 5KVQA 2R8XA 1RI1A 5KNBH 4EFDA 2H1SA 1H23A 3DLPX 3PF8A 3F8TA 1AXGA 1CEQA 2VEDA 2JLAA 2RHGB 3K9NA 4GW3A 2FVXA 2G4VA 2PD6A 3B89A 3UJ9A 2QRMA 2Z0MA 3V8BA 2F3RA 2WE7A 1HNWB 1VP3A 3Q2KA 4EECA 4RE6A 4GU5A 2X6RA 1MGPA 3EFOB 5JMWA 1JMYA 3G68A 1GVHA 1NI3A 2RGGA 3WFIA 1TZ2A 1F51E 3DLAA 5EE9A 2NPFA 4L3WA 1C3OB 2VXYA 2A35A 4MO2A 2D6FA 1QGUA 4YPFA 1J0XO 4K9QA 5G0UA 1PFQA 2VQFB 4C7OB 1AD2A 4YJHB 1XZHA 2NQ8A 2DKOA 3G0GA 3LECA 2GCOB 3PFFA 4WEQA 3WMRA 3ZU4A 2IBTA 3DEFA 1ZWKA 3N2KA 1MV8A 4HDCA 4MUKA 1SXJE 4EA9A 1IWOA 3ET4A 3WB0A 5K7SA 1FYWA 1XU9A 2L0XA 4CMHA 5B7GA 1K68A 2XUQA 4RFSB 1NM5C 3WQRA 5BUZA 1FX0B 4B6RA 4B74A 1RAAA 2FW6A 3E61A 3MYRA 4HH4A 1OJLA 1XD2A 2V6GA 1SOUA 5A3VA 5BR7A 5K0CA 4J91A 3OD1A 1DBQA 3BBLA 2X40A 2B30A 2EKLA 4Q7QA 3GT7A 3TRDA 1JFVA 2QRLA 2DWUA 1K27A 2FPMA 2GBCA 2J6IA 4GKAA 4GPZA 3R74A 4FHEA 1WCYA 5B2EA 4B7XA 4ZK6A 9MHTA 1A97A 1CUYA 1G8JA 3E3AA 4M6WB 1LWNA 2RMKA 2WJGA 3Q7SA 3V97A 1ZEMA 4FDVA 4FTWA 1ZUD1 3H2GA 2C99A 4BJHB 2DTEA 3L4EA 3QF4B 1R6AA 3G0CA 2X4IA 1AXEA 1EA5A 1SY7A 4GICA 1CEYA 2JFWA 3KNZA 1SQ6A 4OFZA 3VR6H 5JAMA 2I55A 2QJOA 3M4YA 4FOSA 4C0AC 3QX9A 2YZ2A 1WZNA 1CZNA 2WSMA 2C7PA 3KC2A 4EMUA 1O5IA 5AI4A 1DRUA 3I2JA 3IUBA 1PR9A 3RNOA 1F4VA 1QGZA 4NE7A 4D80A 3OU7A 4EHFA 2ZIXB 5DBOA 1SIWA 2W43A 4TMTA 1RXWA 1JDVA 1FLAA 2B36A 4J2HA 3RS5A 4Q3KA 1XV5A 2HHLA 3LHFA 2CNLA 4LHEA 3G6KA 1OXUA 4F71A 4QRHA 3RADC 3FYHA 2BHSA 3SM3A 1RRKA 1LK7A 3MS7A 3WHKA 5KNLA 2EKDA 1DV2A 1DPGA 5T8KC 1ZAKA 3SSNA 3RS4A 4A8JB 1DJPA 1N5IA 4NDNE 3X1KA 1CR2A 5DPMA 1C7ZA 1IJEA 4XB1A 3IQZA 1T3LA 3RQSA 3VPAA 4MWBA 2QX6A 1A4RA 1L7EA 4PPGA 4RX1A 4GMFA 1ADBA 1Z2PX 5TGTA 4I1UA 3D4OA 5KZMB 4KPYA 3TF5A 2JB9A 2PWZA 3DWEX 3E1KA 3MJRA 3A04A 1UDWA 1X7HA 1RWWA 1BS9A 3H19A 1MX9A 1WZEA 3X3HA 4B7CA 4CFYA 3QX8A 2PLRA 3L8GA 2E4XA 3A6EA 5T41A 3TLKA 5A7FA 2PVPA 3N2EA 1VYHA 2XUKA 3ZJ4A 3FLBA 4J1TA 4BMVA 3NNSA 1UBEA 2PUAA 4F1JA 4WBNB 1ZXBA 3OQ6A 5A6SB 4D8YA 1YK0A 3N6VA 3H5WA 4OI4A 2W8ZA 4LRUA 4XQCA 1EJBA 1JL3A 5BMVF 1D0SA 4C4SA 2N0SA 1JLMA 5FI1B 1K4YA 4MI6A 2MYNA 3ZDXB 3ZUGA 3IPRA 1YT5A 5LWHA 1X6VA 1ZVMA 2IXAA 1XHFA 1T9KA 1MORA 1O0BA 3EVCA 3HSKA 4G0YA 5B3KA 1IG0A 5BYAA 1FFEA 3LGSA 2VT7A 1KC1A 2WP8J 3KOXA 4L5CA 2IXFA 1OGJA 5L53A 4QA9A 3B1JA 4G5YA 1HEYA 1I10A 3JPWA 3KYBA 2X6TA 1JYSA 3GO4A 2Z5VA 5AFSA 4CG3A 1YASA 1V1JA 5KJCA 1XO1A 3GEMA 4OP2A 2QVZX 1CDZA 1VIYA 1EFPB 1Y8RB 1B16A 1NVMB 2DWOA 2PRYA 4HGNA 4M0FA 5LBUA 5KYUA 4BEVA 1MDFA 1LRJA 2WNIA 4NHEA 4RVCA 2JJMA 4DREA 1IIRA 3GRAA 2QR2A 2V7QA 8LDHA 2ECOA 1DCKA 3H8VA 3ISVA 4AO7A 4HGQA 1J5XA 3OOWA 1U7DA 1VBMA 4NDAA 1U0NA 4LZOA 5K0GA 5ILGA 3TX2A 4IJMA 2DF8A 3DT9A 4XIFA 4EVRA 4KR2A 2RJ3A 4H15A 1EUDB 2C3MA 3CYFA 1KYIA 3ZWNA 4LSGA 5HKBA 2F43A 1USIA 2QG4A 2WVJA 2ZE6A 1S7GA 2V59A 4PC6A 3P2YA 4FYJA 1F0PA 3DCIA 2PJZA 1P2DA 3CJTA 1OZGA 3G2HA 4BJ1A 1I1OA 1T2DA 3NIBA 3CZAA 1J70A 3IVRA 1JN0A 4RSHA 5JD3A 2YWDA 2FFAA 4LJ7A 1TJ4A 3QVVA 4G09A 4D0GA 3FHCB 2I3DA 3WRWA 2GFHA 3N07A 3CBQA 4B48A 1K2WA 4WTOA 3F5DA 4MIYA 1I6KA 1ZMXA 4ENSA 4XPIA 1AS0A 5AR1A 3M3DA 3JY6A 3V8EA 2DGDA 2IPAB 1C4WA 5KU1A 4Q7LA 3GZNA 3HEBA 3K0AA 3EPRA 4G56A 2QLFA 2DTDA 3EARA 4PTYA 4N54A 1W76A 1SUSA 1WA5A 5NLLA 4PAMA 3EBOA 4EMTA 2AK2A 1L4LA 1RZVA 2GILA 4EAQA 4J2TA 3DDUA 1SOMA 4LJRA 3NHFA 4HVCA 3C5WP 5D6OA 2ZB7A 4R2KA 3PQ8A 1TYAE 4J16C 2BMDA 4C1BA 1H2EA 5F4ZA 1Z2OX 4EYKA 5JXGA 2FPIB 3HYLA 4FIDA 3A4TA 3D4BA 3BHJA 2P35A 3V8VA 2CXOA 2QSJA 3NHBA 2EBHX 3V1UA 4E7PA 4MVJG 1E20A 4FGKA 1NN3A 4U02A 2FZ4A 2GCNA 2X8LA 4R69A 3WZ2A 4CM6A 2C2KA 1T36B 5DCUA 4XD2A 3N6XA 5IM5A 1I1NA 5IC4A 1V1RB 2O7RA 4QUJA 1AZSC 1ML3A 3AY0A 2R1TA 5HDQA 4OEHA 1MQAA 3SKYA 4DBVO 4FYVA 3FTEA 3O1LA 2AK3A 3HVIA 3V8NA 4PHTA 4K86A 3BRWD 3HSSA 2WHQA 1D9XA 2Z4RA 4B3SB 4B79A 1RAFA 4L8GA 5JYEA 1CHNA 2IYAA 1KRWA 5FBWB 2V9CA 3OQIB 2QSZA 4NU6A 1TZKA 4PZLA 5BSTA 1LFAA 5B7PA 3A25A 1SQ5A 2G4CA 1F1BA 3CH6A 3S7TA 1NRJB 2J3KA 1AVTA 2N75A 2YJNA 3WSTA 4DIMA 4DG8A 5C8ZA 1JFSA 4IRMA 4WBNA 1YSCA 3M5WA 3PUWA 2FX2A 1O8CA 1DO0A 5IYZF 1GG2A 3BUSA 2J0EA 4PSKA 4UHBA 2F3TA 5ITWA 2CFCA 4G1BA 3D8RA 5BPFA 1S89A 1W4CA 2OGWA 3SSMA 1C0EA 4NY1A 3WX0A 3VSEA 3T0IA 3U26A 3W3ZB 2EZUA 3B1ZA 3HCOA 1X80A 1KS9A 2X4DA 5CX1B 1N92A 3NBYC 3VUFA 1IQ0A 2H4JA 2O7SA 4DE5A 2ZOSA 3GUUA 5SY6A 2BL4A 2QX4A 1GPKA 4QELA 5EHNA 3PX3A 4HVAA 3ZLTA 3D43A 3K9QO 1C9EA 1LTQA 1NVBA 4XTCS 5JHHB 1R0SA 1SG0A 2JIBA 3AOEC 3O93A 5JSHA 1FW6A 5E3HA 2ZR9A 4KLRA 3EHDA 1EE2A 1UC9A 4ASUD 1IFXA 1LGYA 3CB2A 3CVWA 1A1VA 4OREX 5H5JA 5BXYA 3LLCA 5ILQA 1N6OA 3IYLW 4PC1A 4PFQA 2YHSA 1WU7A 2VPQA 4QJIA 5LBTA 3TW0A 3PJRA 2NP7A 1QCZA 3LE8A 3IUPA 2GJ4A 1U2QA 5JJ5A 3O7WA 1VJ5A 2YJ6A 4LAFA 2ODEA 4YAOA 5FLKA 3U40A 4A6XA 1Z4PX 2C9CA 3BEOA 2F43B 3UIEA 3I5XA 2PE5A 3QF7A 2PWAA 1W9MA 3OPMA 1AKEA 1FFXB 1N25A 4WIAA 3VZCA 5JI2E 1QRRA 4RKWA 3MMZA 2WIDA 3M83A 2A9RA 5EHZA 2WF7A 4KR9A 3H5NA 4LJSA 1CVLA 2XT0A 4RY2A 3H2ZA 2WAAA 2Y1XA 2C4UA 4JYAB 1J07A 4MCJA 1UQTA 1Z4JA 4KLZA 2G09A 1CQJB 3KLBA 1GITA 5JCJA 3RUPA 3VPBA 5K99A 3A26A 4JX8A 4M9UA 4D5EA 1T9ZA 2F9FA 3PXBA 4L4RA 2Z2XA 2V8BA 3NKLA 4DMUB 3IODA 4QO7A 4E70A 4CT0A 5HRCA 2EP8A 4W9NA 5T7BA 3SJZA 2P1ZA 5EHQA 5B6IA 4MVYA 5M29A 3OZIA 3GY0A 2VS1A 2R96A 5BWLA 3SOZA 3KYCB 3FVTA 4IL5A 4OM8A 3R41A 3CR8A 4OBEA 4IG9A 1E98A 3GOQA 5AICA 3FFTA 4L27A 4Z54A 1RACA 2V7XA 4UAGA 4PSCA 3AI3A 4PX2A 5A3SA 3RYCB 3IAAA 1U2DC 3L6OO 3KQMA 4MRSA 2HFJA 3AETB 2DXIA 1RCUA 4RIFA 5ELMA 4L5IA 2IUYA 2B99A 3A4MA 3BWXA 4ZO6A 4CLDA 3FYDA 2AI1A 4RORA 2P6RA 3VPFA 2VHJA 2PKRA 1E2UA 3F71A 2A86A 1CJSA 1Z5UA 2JKZA 3TSAA 5TDHA 3R3UA 2IIQA 3H5TA 1XFDA 2O05A 3QXSA 3OA0A 3QY9A