4ODIA

2.6 angstrom crystal structure of putative phosphoglycerate mutase 1 from toxoplasma gondii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
GNMAKAKYTLVLIRHGESTWNKENRFTGWTDVPLSPVGEQEAVEAAKALKEKGFEFDVAYTSVLQRAVVTCWTVLKGTDMCHIPVKSSWRLNERHYGALQGLNKAETAAKHGDEQVKIWRRSYDIPPPPLEKSDKRWPGNDAVYKMVPNEALPLTECLKDTVERVLPFWFDHIAPSIMEGKRVLVAAHGNSLRGLVKHLDKMSDEAVLELNIPTGVPLVYELDEDLQPVRHYYLLDEAELKAKMEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.6 Angstrom Crystal Structure of Putative Phosphoglycerate Mutase 1 from Toxoplasma gondii.
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Phosphoglycerate mutase PGMII
total genus 87
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.4: Bisphosphoglycerate mutase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4odiA00
2YN2A 3KKKA 3FDZA 2P75A 1EBBA 4D4LA 5CX4A 4ARSA 2P9ZA 4MA4A 2P77A 1DKLA 2HPAA 3DCYA 5AJXA 3ZHCA 3DB1A 1QHFA 1H2FA 1H2EA 2H52A 1FZTA 1E58A 4TSRA 2IKQA 5AJZA 1BQ4A 1DKPA 4GPIB 2HIAA 1C80A 2DWPA 3IT0A 4JODA 3LL4A 2P9YA 5AK0A 4D4JA 3D4IA 1DKOA 4E3WA 4QIHA 3EOZA 1TIPA 2P79A 2P6OA 3O0TA 2H0QA 2ENWA 3MBKA 1ND6A 1UJBA 2I1VB 3K4QA 5AJWA 4ARVA 2EOAA 5CU7A 1V7QA 1ND5A 1NT4A 2GFIA 2P6MA 2WU0A 1QFXA 1K6MA 2OWDA 3D6AA 3E9EA 4D4MA 2ENUA 5CDHA 2EKZA 2OWEA 1SKAA 1FBTA 2P78A 3R7AA 2F90A 2YN0A 3K4PA 3IT2A 1E59A 4EO9A 2DWOA 1IHPA 2WNIA 3LG2A 2AXNA 2QNIA 3PGMA 4EMBA 3GP3A 1C81A 1BIFA 1T8PA 2A9JA 3F2IA 1SK9A 5PGMA 3GP5A 3IT1A 1QWOA 2BIFA 3QPVA 3D8HA 4JOBA 1DKNA 2P2YA 4FDTA 5HR5A 1DKMA 2WNHA 3C7TA 3E9CA 5AJYA 3GW8A 3OI7A 2H4XA 3QPUA 1RPAA 2RFLA 2H4ZA 3QPWA 3E9DA 4FDUA 3FJYA 4JOCA 3NFYA 1RPTA 2A6PA 1UJCA 1V37A 4IJ5A 2EKBA 2HHJA 5HTKA 4PZAA 3IT3A 4D4KA 2P30A 1RIIA 1YFKA 3LNTA 3HJGA 1XQ9A 3F3KA 1SKBA 3MXOA 5AJVB 4AROA 4HBZA 2PA0A 4IJ6A 1YJXA 3NTLA 1CVIA 1BQ3A 4PGMA 4GPZA 1DKQA 1C7ZA 4ARUA 4ODIA 3EZNA 3BIFA 2P9FA 3FDZB 1SK8A 4PZ9A 2P2ZA
chains in the Genus database with same CATH superfamily
4RVOA 3WJ7A 3AZPA 2JLZA 4BNDA 2BGJA 2FQQA 3FGOA 4EPVA 4BV3A 3RGWS 1NN0A 5B4VA 3T5DA 2J7PD 1ZUWA 4EKGA 1ZJZA 4R2HA 1CZNA 5DMXA 3F46A 1M73E 2VVTA 1P1JA 1DG9A 4ENVA 5IDYA 2QY6A 5TNXA 4P4SB 4AD8A 3G7UA 1PW5A 4CIYA 3BERA 1U0HC 3OM1A 4QGAA 1J20A 1XEWX 5LUAA 1IXYA 4UBKA 2H4WA 1KOLA 2YYAA 2HMYB 3NO4A 2NLOA 2OHXA 3NU1A 3PEEA 3ZHOA 4F2WA 1QF7A 4MVJD 2BHTA 2OORC 4PIVA 3UAZA 4JQYA 4CR7A 2B36A 3CO0S 3FFBA 4W5OA 3O8DA 5HTOA 2ZYHA 1W7AA 1XZIA 5CVVA 1ODSA 1P2GA 2KHZA 3ID6C 3B1VA 4E5SA 3MTIA 4RZ3A 1Z4KA 4WHMA 1ABEA 1E6LA 1P39A 1JRLA 3ICOA 3EAFA 3K1AB 1X94A 4L72A 2ZIVB 2A1TR 3IDZA 4F0JA 3HO1A 3FDFA 4LYDA 2R8ZA 2RC5A 2WWRA 4G8CA 3ND7A 4MCAA 4MP3A 4XYMA 1R00A 2ODQA 3CLUC 3ZY6A 1I36A 1UANA 3IVAA 3T35A 1JQLB 4D46A 1QHSA 4DWVA 1URPA 2BPOA 4Q66C 4V3BA 3EARA 1FTSA 3EISA 5GJCA 2Q9UA 2ZSUA 3ZBQA 4UASA 5DF1A 4NNJA 2FNAA 3ONWA 4FYVA 3JYPA 5IYZB 2QX9A 3DULA 1GSHA 1W5EA 1T29A 1RI5A 3GRKA 2QVGA 3FW1A 3I1IA 4PX9A 5TEWA 4P3PA 3TW8A 4BGVA 4I4TB 4EZIA 3AVYA 3KSBC 2FW7A 1BIFA 3IYLW 4OAQA 1SUCA 3UUGA 1BHJA 2JCXA 3U3OA 4HNTA 1C7FA 3GQBA 2OUIA 1RXIA 3KQPA 3RVKA 2E4WA 1DDGA 5ALNA 1VSBA 5FOTA 4UAUA 1EP2B 2LCQA 1YD7A 3QLVC 4AS2A 2I2AA 2JCBA 3IXQA 3BFJA 5A9SA 4M0MA 5AMXA 5ELLA 2IZZA 3EWNA 4UW9A 2OCIA 3M83A 5DBOA 4EHAA 5EP1A 4R8MA 1YFLA 1CJTC 3G8BA 1G42A 2R4QA 3QKSA 4NG4A 4AY6A 4CTMA 2ICAA 2JJ8A 1H85A 2Q3CA 3BVPA 3FF1A 3ZEIA 1G291 2Y1LA 4IMIB 1FQOA 2PBLA 3H2YA 3NIGB 4IXWA 1D2MA 2A9KA 2Q49A 1U6KA 3BE5A 4HB3A 3QOXA 4OBBA 2NQTA 4PQEA 3AK4A 2IDKA 4Z4EA 4XAQA 1KY5A 3VISA 2YMMA 1G3MA 4J1TC 3TSZA 1GA6A 3LT2A 2ZRGA 4UHKA 1EQAA 1NVDA 3EUEA 4HN4B 4NULA 3V2UA 1MBZA 4BZXA 1C0PA 1Z4IA 3F6RA 3N58A 4MGYR 2F1KA 3PGJA 2GK3A 4DLKA 2F3PA 3O8BA 2AA3A 5D3MB 4YV7A 4NYJR 2H65A 4ZHQF 5JECA 2ZWIA 3PQ4A 2O57A 1YRAA 1Z45A 3L93A 4B2IA 1P7ZA 1NN1A 2O19A 4OUDA 1I5RA 4EJ0A 3ELBA 3K2BA 5K0EA 4LE0A 4AJLA 4DY6A 5LOVF 2C00A 4L9WA 2JI7A 1R8JA 2QUIA 1M2FA 3LX6A 2FMHA 4LC9A 5IDVA 4AG3A 3R6WA 4HGPA 1GPH1 3VZRA 4L57A 2YY6A 4NEHB 3UV3A 4C0QC 1MVOA 5KYXA 2FP4B 3N75A 3TQOA 2I71A 2X7HA 4GWLA 1J2EA 4YMSA 4KOAA 2ZIEA 2ERYA 1AK2A 4YLYA 1JSZA 2OVFA 4JSRA 2XWQA 5EQFA 4CM8B 3UV6A 4RJKA 3WB0A 3OQJA 3AP3A 5BWNA 5FDFA 4XARA 1EDOA 3IT0A 3IUJA 1BTOA 2QJRA 4WI1A 1Z15A 2NQ8A 5ALMA 1NUSA 5FUXA 4P86A 4YRBA 3AU8A 4CKBB 3DM9B 3C6BA 2H4HA 1OXUA 2C95A 2IUTA 1RLMA 2CY0A 3O9ZA 5F4ZA 4B2PA 1W1WA 5LZ2A 3QX3A 2DERA 1Z68A 2ZIAA 4JCOA 4KN8A 2DKOA 3ZTYA 2F8LA 1I33A 2OO5A 2JFPA 2Q6OA 3KKEA 3PPIA 1SD1A 2GTHA 4F92B 3B85A 4DUGA 1R5OA 2VPPA 5IZ4A 5IABA 3LT1A 5EHZA 5TSDA 4BNXA 1U1CA 1G66A 1IN6A 1PSDA 5IAOA 4JYBA 1UMCA 1P9RA 2D4AA 4NLLA 4PRYA 2UYOA 1LI4A 1FVHA 1J5EB 4TSFA 5BORA 1RFGE 3H1AA 3R3VA 1GGHA 5T6MA 3LWZA 1KEVA 5CEEA 1S1MA 2V54A 3JQFC 1BH2A 1VI6A 2EFEB 2GM4A 4YP1A 5LNK6 3ABOB 1RM5A 1RD4A 1SELA 2H1VA 1DAKA 4NY1A 2SKCA 4CIDA 4EMBA 2HT1A 2RJNA 2QPTA 1PS8A 3PCTA 5GOZA 2V3CC 3BYZA 2LVBA 5CNJA 3DFUA 5EKTA 1EK6A 2AR7A 2CCKA 3QVGB 1R6BX 3OZDA 2I03A 3ENNA 4QTZA 2IOHA 4X7BA 4KI7A 3AX6A 1ISPA 1OI3A 3R23A 4FB4A 2NYAA 4R4JA 3HXOA 4D25A 4DDHA 3O6VA 4H1WA 1XFDA 1QV7A 1E4EB 2WJ6A 3C7TA 1WHSA 4A1FA 2C0QA 3HLYA 5DHAA 5IG2A 1DPFA 3UT5B 2ODEA 3S2SA 3G2HA 5H4HA 4X60A 1M8FA 3TLKA 1EK2A 1ZMTA 3O3MB 3ZE6A 3JW8A 4OLHA 4P4SA 3HSSA 4OMFG 9ATCA 5K4AA 3FOEC 4K9NA 1PZXA 2Z58A 4II3A 4TTVA 5LA6F 4EGCB 1EHYA 2XE6A 5A2QA 1MG0A 2ECOA 2GN0A 3EF1A 1JILA 1ZUNB 4ZRNA 4IHJA 1RBQA 2Q9BA 3WFZA 2CMHA 1VRWA 5FWAA 2W6CX 3ZHBA 1ADJA 4DCJA 1TW2A 3UB4A 4TMFA 2ZVPX 3DPUA 4WV3A 1JJ7A 4GWGA 3CC8A 3LX5A 2XGGA 5IBRA 1CXZA 5ISMA 3OO1A 1N9GA 4ZMSA 3AF5A 5B12A 1WDLA 3HGQA 1P7CA 2RD2A 2QBYA 1V45E 5LP6F 1FUUA 4FIDA 1BFKA 1HLDA 1Z33A 3FDZB 2IUUA 3ORSA 2NX2A 3N8NA 3PQ2A 1D2EA 4D41A 1MFPA 4HDOB 4MRRA 4OH1A 1SD2A 1D07A 3QWIA 4AECA 4C78A 3RE1A 4GOLD 2WOJA 3N70A 3Q5EA 3ZLUA 3P9IA 4MRMB 4OBEA 4X00A 4BS9A 1C30A 4F6RA 5I4BA 2WSSA 2VAMA 3KLMX 4XVQA 2IEZA 1PQ4A 1EWVA 4MJ7A 3RO7A 1SBNE 2HA5A 1CG6A 4X63A 2H16A 5IBCA 1KQ3A 1NOJA 1NQVA 2B61A 1ZC4A 2COUA 4TWIA 4PXYA 4WESA 3S0JA 3BULA 2QXYA 4TV9F 4CMJA 1IAQA 5EYPB 1DKPA 3KE9A 3RHFA 4EG7A 3W5DA 2QD1A 2A0YA 2J3KA 4ALJA 3SYMA 1VE5A 2JIOA 1LNSA 2ZSJA 3OY2A 1JEQB 5C37A 1I5OA 2JAUA 1EVKA 4TS1A 4C05A 1E7QA 2IHZA 3DE3X 4JBLA 3A0UA 4JR0A 1R0CA 5DPMA 3RBXA 3C1TA 2VF4X 2EKLA 1A2KC 4KDCA 4J43A 2X0NA 1M5TA 1ORIA 5G4LA 4MB2A 3OUZA 1NVEA 5CU7A 1NFRA 1JDBC 2W8BB 3EGWA 1A9QA 1FL9A 1EEHA 1LX7A 1UDAA 4RA6B 4RD3A 5I5GA 1B0AA 1TCVA 3BWVA 2NUTA 3UMSA 1QFXA 2IOYA 4KMSA 1BXKA 4C6TA 4ZYZA 5B64A 3JARA 1O58A 1TKCA 2YHUA 2W0SA 3HN6A 1AHNA 4HNGA 5JMPA 2QUZA 3G1TA 4PC1A 4WESB 5JNLA 1PJTA 3R3UA 1I4EB 1NXTA 1KE2A 2PWAA 4BYGA 5FOQA 4J3JA 3VSEA 2KYRA 4H9GA 4PQRA 1RRFA 2BFMA 4GXQA 3UK1A 4ZKDA 1ZKMA 4DR5B 2QTRA 2ZJOA 3B70A 3BOSA 5CM8B 3QPDA 1OWPA 4L1KA 4NECA 3WK8A 2QTMA 2JW5A 4OKSA 2Q9CA 5CTJA 4IIJB 1C8LA 2P8SA 4A6EA 4BPRA 4OI4A 3FTEA 5FNVF 4L51A 1A95A 4PLGA 1QYVA 2V96A 4WXRA 2QX8A 1QRUA 1YJCA 2R6CA 1CUAA 4NCAA 4EJFA 4C22A 1DQZA 4F5ZA 3WLMA 1MKYA 3AV3A 3ZE7A 3OIDA 2GZRA 4LTDA 1M2JA 1PNRA 4FN5A 4HAYA 4IQ8A 4REMA 5AM4A 4JBXA 5EVCA 3ZKWA 1GG8A 3FVWA 2OT3B 1XBTA 2HAEA 3AXSA 5BMVF 3QX9A 1TUBB 3F3SA 4ZYLA 1U1IA 4WZZA 1VG9B 1J99A 3U7GA 5IEBA 2QE7D 1AKVA 1JDPA 3BKWA 3OHMA 4ANFA 5KAPA 3Q6MA 4EUFA 3K53A 3UJ6A 3T1TA 1A98A 1QH1B 1SQFA 1HZZC 2HU5A 2I34A 3QU5A 3KWJA 3CG0A 4J4TA 2QRKA 4JI0B 1QLWA 4MR7B 3P7MA 4DIMA 1XD9A 5CM9C 1R8XA 4IVNA 2COKA 4LZPA 1E3LA 3ANXA 4FE4A 4GHWA 1MC5A 3RFVA 2WSLA 5ERYA 1EM6A 1JG3A 4RHFA 1QGYA 4PAQA 2WMYA 1C1DA 2DQKA 4IDEA 4Y1EA 4LX0A 3WWZA 3WLJA 3SDSA 1B7GO 1CZRA 4D9JA 2NZYA 5BYKA 4IJWA 4NCNA 4QBKA 4F4FA 2QMZA 1PTKA 5DGCA 3KEMA 4BKMA 3STWA 1RTKA 4IFEA 2IWRA 1ONBA 1O9HA 3ABRB 5E7IA 1XPUA 2CXQA 1RQRA 2BT4A 3CWQA 3DOUA 1TGYA 5LB4A 4QTYA 1TT5B 1QV6A 1VE9A 2FZWA 3AHFA 2JK1A 3PC6A 5EJEA 2V8BA 3RW9A 5CFLA 4MEBA 3SQDA 3W8RA 2EJTA 1SZDA 4P80A 1N1MA 2CVZA 3II6X 1RNLA 1MABB 1O5OA 2OBLA 3CW9A 1FLVA 1LI5A 2EBFX 1L8OA 2AMLA 1MC8A 1CNMA 1G5TA 4HGYA 2HQSA 3CZRA 5ALHA 1E5XA 4PLPA 3ZOKA 3H5IA 4QPZA 5DXAA 1WRBA 1PV4A 3E7DA 1X0VA 1U7XA 2PX4A 5AI4A 5D3ZA 3RVJA 2UYHA 1M8KA 3E27A 4MGIR 1ZWKA 4G1FA 3NNSA 3V1UA 1KIAA 2CF6A 3LPMA 5KSWB 2XV1A 4QJ3A 2O59A 3FY4A 1E2HA 1NNLA 1HYBA 4N0MA 2YVAA 2QJWA 1KZYC 1NHGA 4D3DA 4ER7A 2EKDA 3A4TA 1HT0A 4D0LB 1G0OA 2M98A 4M7OA 4F4JA 2H51A 3NI2A 1HE5A 3HRKA 4GPTA 3U7FB 4OV6B 4QATA 1N33B 4BGDA 3THYA 1PNOA 3AUSA 3C8HA 4E0BA 3IIIA 1IVYA 2NVWA 4HWPA 1EI9A 3HJNA 4FEEA 1G19A 4X90A 3TI7A 2X1HA 1PYOA 3N8DA 5IT9A 1SOMA 2XRFA 4TT3A 2DBYA 1DXOA 1OHHA 3EEBA 3CEPB 4J4BA 4Z53A 2R9VA 3EA0A 1RYFA 1NFFA 4UFOA 10MHA 1YC2A 1KZ1A 2UZ3A 1E2DA 1C9YA 3CURA 3Q5GA 2Q5EA 3KOXA 3LGSA 4M1EA 4UZSA 3RABA 2AN3A 4JR2A 1UM9A 4BV9A 4EDFA 2CFCA 4AKGA 4HVLA 1NVFA 2GHRA 3JS5A 1HE8B 2BGWA 2XF2A 3P9PA 3VNSA 4W6ZA 1SHZA 3L7IA 3H0CA 4V1CA 3QPBA 1HNNA 1OA1A 3F2VA 4C01A 1NJ1A 4ZQBA 3G9ZA 2H1HA 7REQB 1JNYA 4B7XA 4K2AA 1NT2A 1DBRA 2W6ZA 5DHFA 2QQFA 4BQQA 3LJKA 3ND6A 4RZUA 3FYCA 4FK8A 1UBFA 3ZDFA 3BFVA 2OP1A 2ZFUA 1IRXA 2ZWOA 4YP6A 4UOQA 3W6PA 2B1QA 4HFJA 4OP2A 1HNZB 5HWSA 1AK1A 1INLA 2AG6A 3HU2A 1N5MA 3IE0A 4RE6A 2WYIA 1O9BA 1NJ2A 1RW4A 3U19A 3DVRX 4M1TA 2EP5A 4W82A 1KH3A 3W5IA 1UJCA 1N9KA 4B3XA 4JWKA 5KBYA 2MIIA 5LQDA 5A0TA 1P77A 4UTZA 1YB7A 2FUG6 2UZ1A 7GPBA 4LXYA 1PHPA 2CL5A 4FMDB 1WQ1R 1V71A 1KDPA 3JWJA 3H87A 5BQOA 3O4GA 2Z8YM 4ARCA 3H2ZA 1CJBA 4HBZA 1GL7A 4KU4A 4PLZA 1OR8A 2WJIA 4D8WA 1NVGA 1VQ1A 3CRQA 4R2WA 4BDTA 3E53A 4BQFA 4B6RA 4UM5A 4B4VA 1H1TA 3EFOB 4F3NA 3V7YA 3ZWBA 3FM9A 3P0FA 5FD8A 3V3TA 4DNOA 2A35A 2H18A 1CUSA 2O8FB 2X6RA 1U80A 2H8GA 1NONA 1JR3D 3BCHA 1JPUA 5EAIA 1WU8A 3COJA 4EY3A 2BR3A 1G6OA 1BMTA 3DBLA 4QRDA 4EHBA 4D4HA 2P2SA 3KUUA 1G5QA 2XUPA 3TE6A 1E3MA 4YV1A 1NPDA 2OCPA 3NATA 4PQFA 1H2FA 3INYA 3C3KA 1WUTA 4N5DA 4WJKB 2AWOA 5KEIA 5KMGB 2AKAB 2VHVA 3OTIA 5EUQB 1NF3A 2YHIB 1SQ6A 1XZCA 1OASA 1CIJA 3BQ9A 4ALMA 4CG2A 1THZA 5CYGA 1KZGB 2D3WA 2J0VA 3AP2A 4NYMQ 3WK6A 2P9BA 5I9MA 2JH9A 1PSZA 2PK3A 2QMHA 2DG2A 4ATNA 1USGA 1XG5A 2YV4A 3ZV3A 4I4LA 1QG6A 2ZRCA 4ITRC 1VSVA 1OE0A 2VPQA 1QFJA 4LOKA 2Z3ZA 4NRDA 3ML1A 1T36A 2XCIA 1KQFA 2DH6A 5K3EA 2CB9A 4F71A 1H6AA 4LCJA 2ARKA 2BL4A 2EOAA 1IN4A 4RF5A 2IF2A 5TXGA 2FWPA 5F1PA 3WHLA 1MLDA 4ZICA 2ZUFA 1RC0A 4UCWA 4Y30A 4Y18A 3RSOA 2YN4A 3I6QA 1GDDA 4GE0A 3K0AA 1K6MA 3A6ZA 3GROA 1SC1A 4GGOA 5BWBA 1AGYA 1A5ZA 1TUBA 1ZD2P 2EDAA 3NASA 3LXRA 3OPVA 3WL8A 1X3LA 3VX4A 2OD2A 1FB5A 1UP7A 2WIGA 3B9RA 1T9CA 4HVAA 1LTHR 5EJMA 3DYVA 1HQKA 3HACA 6REQB 4YYEA 1QP7A 2CDCA 1DFGA 2GO1A 3GEGA 2M1ZA 4X7RA 2I1LA 4YXWA 5BN3A 1X86B 3DKIA 3PDIB 3ZDCA 2CLSA 3NIBA 5DLEA 1N8SA 1Y1RA 5K4HA 4A8JA 1C7EA 3GZJA 4CKXA 2C2WA 5JSQA 2HK9A 1VCNA 4DNXA 3Q9UA 3RC1A 3NVDA 3GIWA 3NV9A 4OG2A 4U3JB 5AKGA 3WYNA 1APBA 4GL4A 3EWAA 2FLWA 4II2A 1M74A 5IH3A 4DGQA 3PLNA 1TRKA 3T95A 1Q44A 2NO6A 5JNUA 4QQFA 3TAXA 3SS9X 5AM0A 3OFSA 4L3VA 3NX4A 1Q16A 2IEGA 1XV5A 3LL7A 4X6YA 2YX1A 1YB5A 3NR2A 1Y3DE 2BLNA 3BZUA 1T2VA 3BH7A 3I4LA 2HK8A 3PIRA 1YS2X 4KVGA 2WVHA 5IT0A 2J5XA 4MKIA 4F21A 2VQ6A 4EMSA 2PRZA 1ESDA 3M2TA 1Q11A 3EGXA 1DGQA 2YUIA 1BRTA 3EUAA 4LOJA 4F85A 5JS2A 2IS4A 1EDZA 3UB3A 2R79A 3GFBA 1KETA 1V5EA 3UJDA 2W22A 1EUDA 2VYQA 1V4VA 2PZJA 3U3MA 2ZM5A 4ZCIA 2YFYA 4P35A 1H0SA 1RKQA 3ANTA 4X65B 5KJCA 4EK9A 3FWPA 4Y8VA 1AZLA 2AC2A 1FTYA 2BKVA 1PR5A 2WSIA 3BMOA 3K5PA 4OHOA 4PFJA 1RWXA 4U6QA 2D0DA 4IJ6A 4CMKA 2J9XB 3B6ZA 1R6VA 2QDXA 3EMBA 3KQMA 4L4XA 4C4PA 1H1LA 1R0BA 1QHIA 3EVAA 3EZLA 1W4BA 1UFRA 1ZLXA 3QYPA 4J0DA 4TTRA 2ZUCA 3HY4A 5ELMA 2YJTD 1NI3A 2EX1A 2H5IA 2X1MA 3VMFA 2WIAA 3U0BA 1GADO 3ICWA 3DTTA 4Q93A 3I9KA 3S1AB 3D7LA 2I1WA 1KXJA 2ZXFA 1NR5A 2AFVA 3FDZA 4TPKA 4Z7QB 5B30A 1G20A 3HYTA 1T8TA 4CLOB 4RXMA 3BK1A 1E63A 1X8LA 5TVGA 3EGEA 4HJXA 4LHZA 3PC7A 1UADA 1YIDA 3CH7A 2GA9A 4LZWA 4MPRA 5HCIA 3SQXA 1VBFA 3EUWA 4PXAA 1G1MA 5A7GA 3G0CA 2Y9MB 4RFVA 1IJFA 5D1HA 1CUHA 3RYIA 1RKVA 1RI3A 5JFGA 1GPUA 4JLDA 1ORRA 3IIMA 5IF3A 3Q7EA 4KXLA 1VI5A 3ICEA 5KOYA 2JGDB 1O54A 2GPAA 3AV0B 1JLMA 3I1JA 4PFKA 4EKNB 4X1KB 4RDCA 1DAFA 4GX1A 4P5DA 1FS5A 4WA7A 4YI5A 3FGZA 1Z75A 3SQNA 5LA6B 1PW7A 4RMHA 4KE9A 3MWJA 5C8YB 3OFND 2ZPAA 4YREA 4E6PA 3CZPA 2CNWA 1CW2B 3IXLA 3F90A 4DXHA 5CCXA 3CX6A 4MIYA 4RE5A 1KH1A 1D5CA 4CN9A 4OY3A 3HXKA 5F9HA 1NI4B 1FFSA 3L0SA 3SSOA 4ZYYA 1GRCA 2Z5GA 4KFRA 1O0CA 1KFKB 3A1UA 4KQEA 5KHAA 8GPBA 1JJBA 1GPBA 2P0EA 1FBTA 3L1VA 1Q0RA 3G8CA 2HRZA 3GZTB 4OQMA 2I4MA 3I39X 2D7DA 3KVYA 3VSAA 4E7OA 4HT3B 2O8CA 3KLNA 4OBXA 5IULC 4ZTUB 3TBFA 2NM0A 2VQFB 1T3SA 1THGA 2PEYA 1SUIA 5KWEA 4WY8A 1B0UA 1BVYF 1DJLA 1KY4A 1ZYUA 3K15A 3RWOA 3VVMA 5BR1A 4KR3A 1QPBA 1TMYA 3JWPA 4DRXA 2HHAA 4J8PA 4MRSA 1B3BA 1HTBA 2W6JA 3Q3VA 5TPWA 1FFHA 3T7AA 1N34B 3RT7A 3OIGA 1SXJC 2OYCA 4E1AA 1NVXQ 3FOFC 4I8DA 1WCYA 1TQ2A 5HQ3B 1AXGA 9LDTA 1OIXA 2ZIXA 3A31A 4FZVA 4KUHA 2ZJYA 2XBLA 3WMEA 3ZDQA 4RPLA 4M1MA 4EWLA 4MVXA 5IJAA 3QQ5A 1G16A 1XZJA 3TS1A 3GG2A 4LXXA 3FYUB 2WFZA 3UPDA 3NBXX 2R25B 3L6UA 3W5BA 2B7CA 3L02A 2JB9A 2XXBA 3ITDA 2O9JA 5DLQC 3KUXA 1IM2A 3VBCA 2M9MA 1XL1A 3BTOA 4L85A 4M0CA 4Q3LA 4FWTA 1WNFA 1M0TA 5DYYA 1U5BB 3D4PA 5BN5A 3U7JA 4ZRMA 1FFAA 5JMTA 3VZPA 1AURA 3CXRA 4FGKA 2YWHA 4PNEA 3GVXA 2HMSA 3GEMA 4IUCS 1PEDA 2GF9A 3DDSA 3JQ7A 3KFVA 4CJXA 1RHMA 4GXTA 2QN6A 4Y7CA 1C4XA 3UWKA 3JPWA 4AP9A 1BXGB 4KE8A 2BGLA 4OBWA 3ZW8A 2WJPA 2D0OB 5CDFA 2I2XB 2ZYGA 4E03A 1QHHB 4WOPA 4U63A 1M6WA 1O3YA 1T2DA 2ZBQA 4XDZA 5J40A 3EVBA 1QGOA 2O0JA 3DZKA 1KHHA 2CCGA 1NJSA 2H2FA 2Z5LA 3PNMA 2A57A 2I76A 3LF2A 1U7HA 4AW9A 1WB9A 1UBRS 4YJDA 4UD6A 5EJIA 1R9GA 1IL0A 3L0CA 4AB1A 3GJRA 3LVBA 4FBMA 3IS3A 4Q24A 2Q5JA 4TYMA 4Q21A 3VTKA 1JJFA 3ZIDA 4XVUA 3EEQA 1H2RS 3PD1A 1SCKA 4C2UA 1C7RA 2GGSA 3N8KA 4HATA 4X3CA 1JHYA 2IHYA 3H9JA 1RVV1 3R6GA 4DRYA 1BROA 1LJUA 4FDLA 1P7YA 4ZHQB 3AFMA 4IX9A 1T5HX 2D62A 3B78A 1WBJB 4WFQA 1TQ4A 1WO8A 4A8JB 1LBIA 5G0WA 2NXWA 3U3KA 4I46A 5JY1A 4DQXA 3ZD6A 4H7KA 1OBFO 2O07A 3OZIA 1XF9A 5BPHA 1QG2A 1U04A 2E48A 1NGSA 2ESRA 2HQOA 2ZSIA 1RP1A 2DWPA 4B3CA 4MPTA 3AJAA 2EZUA 3DAGA 1XA3A 2RMKA 3AHEA 3OSZA 3NYWA 3C8MA 3QBJA 1S8FA 1Y3CE 4V02A 4XVRA 1NXOA 1V8OA 1R88A 3R5HA 1KK2A 4NYMR 4I1PA 4FE7A 4ZMRA 1XXHB 3O3NB 4CGZA 4JJ6A 3QEAZ 3D0KA 5J2TA 3JQ8B 1KDTA 1J4AA 2WKWA 3CEHA 1ZN7A 1WPQA 4JJ4A 2AG1A 2QLNA 3G0DA 2FDCA 2LRHA 3EJ6A 4WKBA 3ZCQA 1WCIB 1W93A 5KVQA 2C4VA 1WIWA 3FNRA 2AJCA 2I99A 1XALA 4BMXA 1KYWA 2DY0A 1CYDA 1LQTA 2P78A 3IPCA 4TMXA 4K9LA 4N1AA 2VDJA 2E37A 3PHBE 1JQJC 4B6EA 1UEJA 4GOOD 1XYGA 4HYYA 3PU6A 1HT2E 2HH9A 1ECPA 5AK6A 3CH4B 4F7WA 4NFHA 3K70B 5C5IA 1OILA 3DMTA 2O50A 4HL6A 3WAKA 3DO5A 2AZTA 3R5TA 3BSFA 4FHCA 4MZDA 4URZR 5SV2A 1NLZA 3ZHZA 4F2DA 1AQIA 1S5PA 4ARZA 4JC5A 1NN5A 2KB0A 2WSSD 1MU0A 1KIMA 1P62B 3DZDA 5IASA 3DLPX 7YASA 5AK4A 1HURA 1EFUA 1NLFA 4HYQA 3HVHA 3H17A 1OAOC 2X4GA 1A9YA 1NF8A 1P0CA 2CHVA 1SCNE 1NUTA 3KK0A 1AA6A 4DBLC 2HLDD 4QECA 1KFBB 3IKLA 3QW4B 4RPCA 2IUFA 2B20A 1Z5UA 3Q72A 4OA8A 1V9CA 3ZWMA 2DTDA 1MRSA 3JWGA 4DCPA 2Z83A 1F5SA 2D2VA 1HNXB 4QOHA 3SD7A 5FYDA 4WD3A 1WJGA 4F5YA 2XYPA 1W47A 2VUHB 1K9VF 3D9QX 3KOOA 2WPDD 3ZCSA 3P8ZA 3Q8KA 1KC3A 4BEVA 4GQIA 1WS6A 4CV3A 1RPTA 2YZKA 1XZPA 2PFGA 5CXSA 3PHLA 3IEUA 1L5HB 1XT6A 4MKRA 4QFCA 5EGNA 5LMZA 5KPJA 1AQNA 4URFA 3BGWA 3U5TA 1KJIA 2HHJA 4N65A 3NUZA 4YMWA 5J1TB 3WIVA 1GQ2A 1PFGA 3WSTA 2DMRA 1C9EA 2R7MA 5CBKA 4DPLA 2YCBA 3IVGA 1ZR2A 3B9QA 4UXIA 3QKRB 3LUKA 1T2UA 4JVNA 5GONB 5E9JA 4UVHA 4OLJA 1DIGA 2GYYA 4NL4H 1YJXA 3LCUA 1OMOA 2VBCA 1JPVA 3M6IA 4MQBA 2C97A 4YRCA 4GDFA 1WDTA 2OK7A 5E0OA 3SOPA 1Y5IA 1RKUA 1XCJA 2YXEA 2XOKA 3AJDA 4JYMA 2NXNA 4N40A 3I09A 2EL9A 4EYKA 3T1VA 2XUDA 3C3CA 4B6FA 3AFOA 1RR6A 3GLVA 4FMCB 4KE7A 3RT1A 2AZ4A 3A6JA 4WKPA 2ZCJA 2NZXA 5K3CA 4D4LA 1QR6A 3KBBA 2GEDA 1MX1A 1F2TA 2IODA 4TWJA 2KSQA 3R20A 3DE6X 4JNKA 2WG2A 1EM8A 1L7VC 2I9PA 4JVMA 5E9WA 1C0IA 4QLOA 3EXIA 1X38A 1II8A 1OIWA 1UJMA 3ROTA 3GCGA 3ZDAA 4EJSA 4RLFA 4HUQB 4RQAA 3DEZA 1DHTA 3EZ2A 4ZOBA 5TQJA 2O2HA 2AEFA 2KBEA 2ZIUB 4R7GA 5GJWC 2YRWA 1OC4A 4OAOA 3RSCA 4OGLA 4YRKA 2HA6A 3HCNA 4FOSA 4IZOA 3B1KA 4RV4A 2JLWA 4YGXB 1XAIA 1KGDA 3KXPA 4X61A 4KXWA 3JASA 3Q5DA 4B83A 4B85A 4E11A 4W5NA 1SKYE 3PL5A 1ZM4A 2QJTA 3T99A 2R00A 3D2CA 3NHKA 5U4QA 4M8LA 5AIAA 5DSXA 3WJAA 3MJFA 5KWJA 5AD1A 3AOGA 5C7YA 5REQB 3UC5A 3S8MA 1IUNA 2Y1DA 4LY9A 2QAIA 4MI3A 4RPGA 3SZMA 1KPIA 1ODKA 3K94A 4M1WA 1USVA 4L0CA 2ZBPA 3AZOA 2VTEA 3ZD8A 3ZJ5A 2XNDD 4IIXA 1XOIA 1IOVA 2X4DA 3IR7A 1EFDN 4JLVA 6REQA 5SY9A 1CUUA 4WUTA 1SKAA 4C6RA 2GPTA 1JIUA 2NSLA 2R2AA 2FN3A 3NNNA 1XCBA 2ACVA 1G2QA 1WETA 2OHIA 1XI2A 4L74A 5EZYF 2OCBA 3K0CA 4LXHA 4MS4B 5I47A 1I32A 2A0FA 5D3QA 4OJTA 4RKQA 2GJKA 2RB5A 2ZB8A 3CS3A 2JD0A 3FFWA 4JQCA 4N47A 3TH5A 1P9WA 3AEZA 2CXRA 2W90A 3MRSA 3OE7A 5EINA 5DZSA 4CG3A 3L7BA 5KWVA 2WU1A 1ISIA 5H0IA 2YV2A 3SX0A 4G0VA 1JN0A 4ALIA 5F2NA 1WUKS 2PJZA 2PUDA 2HLDA 1GNLA 3Q3CA 5HFJA 1GCOA 2P6UA 5HK8A 4CDGA 2HWKA 2Q4DA 4MITA 3RD5A 2GO7A 4GQBA 3G2JA 5D87A 4KIFA 2JZNA 1CS0A 4NYJQ 2NVBA 1KU0A 1JFRA 4MYDA 4PONA 1IUKA 2FG6C 2JBHA 1E6UA 2WLSA 2YHBA 4FX5A 3T1NA 4RSGA 1WAMA 1EWYA 1S2NA 1UT8A 4L4RA 4LOAA 4UD2A 3AFNA 4UTOA 3JSXA 5JAHA 1U2RA 1Y8AA 4B76A 1XDGA 2QD5A 5CFNA 2CK3A 2RFLA 5HS6A 2P65A 3B12A 3ZWOA 4AURA 2D1YA 2IGTA 3FWHA 3PUYA 2D2XA 4MV1A 4R40A 3WXBA 1JHVA 1LH0A 1ZW1A 2Z56A 3M6UA 4HQRA 4LJ6A 3FTCA 4Y0VA 3TKYA 3L4BA 3PQDA 4IDNA 5H7XA 4URVR 4C5AA 1HL3A 2WF7A 5TT1A 3RU2A 3ZUGA 4CUKA 2QUHA 1X80B 3IRUA 1YNSA 3WWCA 3JQCA 2P30A 3WI7A 4DEYA 3R8FA 3JCZA 3TL3A 5A7HA 2PKWA 3WMGA 2X5JO 1KMNA 5DK4A 1IE3A 1TI7A 1GA4A 1YMVA 1E2GA 5TVKA 1RAGA 5ITSA 1AKQA 4BCBA 2BMFA 1P8JA 3AETB 2NUAA 3JXEA 3R0QA 1M3SA 4JLPA 4WBNA 4BNKA 1P6XA 3AM4A 4WFIA 4TL9A 2HSWA 4NDZA 3OT4A 4Q00A 1YA6A 4NU8X 1JXAA 3K31A 4ID9A 3IEMA 5CFMA 7MHTA 1WZUA 2DJ5A 4L0QA 4Q4CA 4CEHA 3G88A 3DPSA 1UC4B 3R0ZA 4IX1A 1EBBA 2ZE5A 5F21A 1XZ8A 5FOVA 2JF0A 2NNLD 3I04M 1PQUA 1ODFA 3HO8A 4RWEA 1O9GA 2QLLA 4G0YA 2O14A 3VHLB 1JAZA 4XDHA 2CHGA 4YMLA 2FWJA 3C43A 3N76A 1DEXA 3GGPA 3KQNA 2DUNA 1LSSA 3OPNA 5K8JB 3QSYA 1IOLA 1V11B 3QHAA 3TZLA 2HO4A 2A3NA 4K9KA 4CLEA 1JHXA 1UJ4A 1W1UA 1TU4A 2XDYA 3HABA 4FS3A 4J0EA 4KJXA 1E32A 1LTKA 3AY3A 3L1IA 1XDBA 3KYCB 1QE0A 2C9MA 2Q50A 4OPMA 1ONPA 1X19A 2R6GA 1XVLA 4EQ6B 1QDLB 5I01A 1R7RA 3VZCA 2G1KA 1SCQA 3R76A 2WR8A 1YCFA 3D43A 3R0JA 2WWFA 3G17A 3MZ0A 4C87A 4EY6A 2AG0A 3C5CA 3CKYA 3PYLA 4P5EA 4Q4AB 2P2GA 4WLNA 1VRCA 2JFWA 3NTRA 3WGKA 4BMOB 4X44A 4OK3A 2FWNA 3AB8A 3ZE8A 1KIFA 2E85A 3QLUA 1J70A 1J90A 1ZK4A 1CWUA 1T2NA 2B6HA 3KELA 1EK0A 3OCXA 2JJ2A 3FKJA 1RBMA 3IUSA 2FFRA 1PBTA 2EHJA 2VH5R 1YJ5A 2Z9CA 4EAQA 5REQA 2AJTA 1EEXB 2IT1A 2YIJA 1KKMA 4MUHA 2GFQA 3BXGA 4EKYA 4AKHA 4NG5A 3W2TA 4BVKA 4QDKA 5AH0A 5M7EA 4UZFA 2QRUA 1AGRA 1WW2A 5TIIA 2PZAA 3TQQA 1KO1A 1NW5A 1HYGA 2UYQA 3Q3JB 3ZI0A 2A7QA 5BNFA 1C81A 1KI6A 3E22A 3OKPA 2GFHA 4XB1A 1SBYA 1AUXA 4Y9SA 4MJXA 4BLVA 1QP0A 5LYYA 3PXGA 3NVAA 3V4RA 2XNKA 3ZC3A 2R7NA 3TOCA 2IYLD 1ANKA 2P5TB 2YASA 3L8MA 4GBJA 1L6IA 3EXHC 4GECA 3TLZA 4ZQHA 1AS2A 4A8TA 4DY4A 2WKPA 3OC0A 3PPYA 3U5ZB 3AERA 3BB4A 4OP1A 4B87A 1NNSA 2AQHA 2H5JA 4XWAA 2IYSA 1WUIS 2MYPA 2Z3WA 4CDRA 5MFPA 2OY0A 2JBAB 1FFXA 3QU2A 1EG2A 1MVNA 3I2FA 3KL4A 4OK6A 5BSUA 5AXCA 5TJ9A 2BM1A 4HWRA 2H1FA 2DQ4A 4N82A 1QFYA 2FPSA 1ORTA 4EMUA 5AICA 5ICGA 1ORHA 3STUA 1L2TA 4MKGA 1JQDA 2VK2A 3WWEA 2WC1A 5I7EA 3UAXA 2FZ4A 3KP1A 3M6AA 1V4BA 1K7SN 1NXQA 1Y3IA 2XZOA 2P3SA 4I1YA 2PTHA 4OK5A 4ZODA 2QGNA 5HRUA 2CUTA 4JBWA 1LPNA 4EG3A 2WHPA 1I4DD 1J0AA 1QZZA 1P29A 2W0MA 2BFDB 2WU4A 4N8EA 4KAAA 4E5YA 1N5IA 2WLTA 4NK5A 2ZUBA 4B7AA 2WU3A 4LMBA 3CT6A 3OU7A 1F7UA 2RHJA 4CR8A 3HR8A 1D2GA 2ZS7A 4HRAA 5T64A 1UMKA 3ANLA 3REOA 1YB6A 5EHGA 3TZQA 3GRVA 1ULAA 2IDZA 1SVNA 1W0KD 2VZLA 2WJGA 1NNUA 3KZ1E 5F5LA 2FSVC 2R68A 3WV4A 2OGTA 2XLCA 3RUFA 1Z2EA 3OX4A 1SA0A 4LDPA 3TZEA 3TTUA 1GFZA 1KBZA 2I65A 3WRXC 3A04A 1X1BA 3KQVA 1CC1S 3VBEA 2GCGA 3FKSA 2EXXA 2RGAA 4ESOA 4QU5A 5DM0A 1O95A 3BICA 1OXKB 3H9UA 2GN9A 4FYWA 5FWYA 2OLKA 1YQDA 2ZJ6A 3JZIA 3L7KA 2GEFA 2E4XA 1FX0A 3BAZA 1A5SB 3D6TB 3UXMA 3U60B 5IT4A 5E38A 2AW5A 2BKEA 2OYSA 4J0JA 1VLMA 3WO1A 1Y1QA 1DKOA 3CRMA 4TM7A 3EOZA 3ITNA 3KUDA 1CQZA 2P6OA 1MT3A 1GEEA 2WM9B 2QTNA 1Q7GA 3CNLA 2WTXA 3EIQA 1A3CA 2H1IA 3TEMA 2XZDA 4JD5A 1TMKA 4QO7A 3O8CA 3TR6A 4D0NA 5EP2A 2Q2NA 2I66A 4ML3A 1JS1X 1R4NB 4BPBA 3HWSA 4R2JA 5KC9A 1FRQA 2RHCA 1VZ3A 2OWDA 3S1AA 3WQQA 3E9EA 3JALA 1YB4A 2YWCA 3K2QA 2YXBA 2V0CA 4DCUA 3DDCA 1Z6QA 1LX6A 3HWRA 1RQ7A 3HO6A 1K68A 1OTHA 5GGXA 4U6SA 5ITWA 2IXGA 1PNQA 3QE9Y 4GM1A 1MZVA 3VR3D 4JB0A 3B5IA 2ZANA 1OY1A 2HIGA 1L5WA 4YUXA 3PDJA 4IIDA 5G0VA 1WB4A 1QIFA 1UBGA 2BONA 2OILA 4XKJA 5CT6A 2Z6VA 1EHCA 6GPBA 2Z95A 1DSSG 1DCMA 4GI5A 4HNQA 3F7OA 1GTL1 1RYEA 1SVKA 3D2LA 4OH7A 5FBRB 1XZGA 2P91A 4TMVA 5KCMA 4MVJI 3WYGA 5IVIA 1GQSA 2PLNA 1RWBA 3DD5A 1FP7A 2I1QA 3GVIA 3OQBA 1E3EA 3TPCA 1DC7A 2FPWA 4YJFA 3S68A 1QR2A 2Q1YA 2XOKD 1U3GA 2JZOA 1W9HA 2WWWA 3EC7A 4PCLA 3WZMA 5JRDS 2VT2A 2A9VA 1TJ4A 3L8CA 3JZAA 1VTKA 1F4PA 2JLSA 3C1AA 2RHWA 3E0QA 3K9NA 2AHRA 4H1UA 4TSFD 4U7PB 2FX2A 3W5UA 3VVBA 3W6ZA 1GPMA 4CXMA 3FCCA 2CLOB 1UH5A 4G0PA 3R3XA 2LUOA 3VKWA 3V1KA 4DLAA 3BXFA 3FMIA 2WWTA 1VJTA 3QTLA 2FXVA 4OXXA 4ZQGA 4DCSA 3F9IA 4DIUA 1TK9A 3M9WA 3E8XA 1DXYA 2JRCA 4RX1A 3NWOA 2ZIZA 5HBRA 4LRSB 3SVZA 3BSYA 5ICSA 2P9TA 4PG5A 4HUTA 3I30X 4C20A 1UINA 1KGSA 4QUDA 4Z4QA 2CNBA 4GBGA 2DBZA 1KYXA 3D6NB 2AVNA 1AUVA 4IY1A 1HH4A 1NULA 3LBIA 1JFSA 2OHJA 3N2GB 4PHHA 5TGDA 3KFXA 3W2IA 5KINB 4WTOA 4FEAA 1KRWA 4ZP1A 4GMHA 2ZSEA 5TQ0A 4ZO8A 3AF0A 5ANRB 2J3HA 4J0IA 3MW8A 1H2ZA 4ETIA 2CUNA 1X2EA 2ANBA 3MT8A 2CBXA 1PL0A 1SY7A 2GVDC 1QVAA 1JHDA 3EXEA 2IXEA 3AKDA 1RE1A 1VB3A 3EY4A 4DKXA 4LWOA 1MORA 3KQKA 5GGYA 2CBZA 5K0NA 5SYMA 2PGJA 2XZTA 4NWIA 3OUUA 5EJAA 2WY2D 1QTNA 4Q9NA 5FOXA 4FW9A 4CPDA 2XIQA 2X0KA 1EXMA 3GPDG 3K4HA 3M6LA 5H81A 3WLAA 1TK2A 1YULA 2IITA 4OHFA 4DJDC 4P54A 2WMNB 3TJRA 1KKLA 3WHPA 2E4YA 3RQSA 2CSXA 1R4MB 2I4TA 1SAYA 2EP7A 3HV2A 1YE8A 3PCXA 1B0ZA 3A9WA 3V7UA 4YMGA 2WB4A 4W1PA 1TIPA 5KUTA 1WY7A 2ACWA 1O77A 1K0FA 1PFUA 5DV9A 2F1RA 2Z4RA 5BYBA 3VMMA 5IWCA 3DBLB 5C53B 1M7BA 2YYSA 3NKLA 1ISFA 1Y98A 1ZG3A 2XITA 1GUAA 3M2PA 2PSHA 2EKZA 2GYUA 3U3JA 3TRJA 1IU9A 2DLDA 2AD5A 3HN2A 4FJ0A 4ZVSA 4YUVA 4LJSA 4DXDA 3CFYA 4OOEA 5LLDA 1IOWA 1SXJD 4PYQA 4B43A 1NOKA 1Q6ZA 2JLBA 5FNVB 5JPDA 3ZH2A 1T1GA 4P2BA 5JS1A 2V7TA 3VV2A 4B73A 2DPXA 4MS4A 1FNBA 4QDUA 4EFLA 5KSZA 4IXTA 2KPOA 1GYRA 2YW9A 4RGVA 3PZBA 1FFGA 1JBEA 4BWYA 2WWGA 5AKYA 2VDUE 1NFQA 4FGJA 2WHPB 4MS1B 3AFIA 5ALTA 5BOVA 4V38A 4OQQA 5LBUA 4ZK2A 2QLMA 4IIJA 1JEAA 1DX9A 2GF0A 4JLOA 1A76A 4LRWA 4YIKA 4FYMA 1YL5A 1GU1A 3K6SB 1XEAA 3BEOA 3ETEA 1U4OA 3IUYA 3LOQA 4RXUA 2DY1A 2ONYA 3SXUA 4EYQA 5DT2A 1SIUA 1FXWF 2GBCA 3PICA 3RJ5A 1KEKA 3N86A 3W3AA 1NE2A 3FPLA 5JAMA 1YDFA 5LR6A 1HPLA 2H57A 3UK6A 2ZB3A 2YY5A 3G6WA 3ND5A 1IHUA 3ZS9A 3NAMA 3IKVA 3HDQA 2ECFA 3O26A 3PHGA 1XA4A 3FJYA 3IMCA 4G07A 4DIEA 4DR6B 2F67A 1KPGA 5BMOA 2Z8XA 1D0SA 4D81A 3DFMA 3DNFA 3SS7X 1I3NA 5EWMB 4B7ZA 2J09A 4CR6A 2E5FA 3AUTA 1UBHS 1EFRD 1Z56C 3PD0A 3IALA 4WZBA 3V8PA 1NBMA 5E3HA 2V03A 1YH3A 2FPXA 2BTOA 1NLMA 1I1OA 1SNYA 2HU2A 1OX5A 2P6PA 3HJBA 3LCJA 3QWHA 4HXEB 4P3NA 4Q1CA 4ENQA 3SM9A 3GT7A 3K70D 4UULA 4MW4A 1K6JA 5I9SA 1HBJA 2O8DA 3PE6A 4X94A 2OGUA 3L6BA 3FOWA 3CLRD 5H83A 5CB4B 1V8BA 9LDBA 3A6LA 2FFQA 1Z06A 4GZMA 4W5QA 3X43A 1P44A 1YVUA 1K2VN 1PX2A 3PC2A 2B6NA 3PA8A 4UHJA 1UFKA 3O47A 4LWQA 3A2KA 1Q92A 3D1LA 3PUWA 2ZP1A 3MBOA 5T67A 4BMDA 3P0JA 4YONB 3DKKA 3ESXA 3N9IA 1U3CA 4CCYA 1H4VB 2W2LA 1M76A 3A4MA 3QKSB 1Q3HA 2DFNA 2DBVO 3E3MA 3EX7C 4CUZA 3IVXA 3N8HA 3AXTA 1PD1A 1GCUA 3SE0A 2WPNA 2GZ2A 3R41A 4I1RA 4RMJA 4PHGA 1FY2A 4ND8A 3W5SA 2C84A 3W1VA 4RC9A 3MUOA 4M22A 5AOAA 4BNVA 1NSYA 1GD1O 3CZAA 3CW2A 3M1LA 1BAPA 1K9SA 3D8TA 3P20A 4IGIA 4IF4A 4JBHA 2YWJA 2K7ZA 4MR8B 1V7PC 4UHEA 3QMWA 5CGQB 3RC3A 1N9GB 4G5FA 1KMQA 4I1UA 1R4AA 2X3FA 3RYFB 3WYBA 4CU5A 4D0GA 3K6KA 2BGNA 3H5TA 1ES9A 4M99A 4N7MA 4PZLA 1SQ0A 3KOZA 3QKIA 5HKKD 3D54D 5B53A 2BDUA 4PYOA 5C51B 1XD2B 3HI6A 3HZRA 4UUQA 4RZQA 1HEUA 1UK6A 3AEQA 4ACAA 2IX9A 5BO5A 2VJKA 5EKDA 5GP1A 4XUDA 2CJPA 1SU8A 1ZCFA 2AMVA 2R11A 3K2EA 3PFCA 1H5NA 1ADFA 3EGIA 4EI2A 5BQ3A 1ZMRA 1ZUIA 1YKFA 4E30A 5LU8A 2NADA 2P7IA 2E18A 3L7JA 1IZ8A 2VBIA 2XT6A 3C85A 3H75A 1NJ8A 3GT4A 1N0IA 4ZEMA 2RDMA 2W4QA 4PSVA 1EFVB 4D6PA 1RIFA 2YW2A 1GZSA 1JEEA 4B3FX 3QTTA 4HRYA 2QUJA 4WA8A 5LN1A 1YR1A 1UKCA 2PD4A 1UJ2A 2VHZA 4LHXA 4FCVA 1PWYE 3NHMA 3KWFA 5U9CA 1S3FA 3OZFA 4FFVA 2MWMA 1I3KA 1M54A 3O8LA 3UHPA 2D5AA 2BKLA 1EWTA 2JLQA 3A9CA 5CH3A 3GCZA 3UJ8A 1HWYA 2X76A 3UNXA 1JEDA 2E4AA 2QB5A 3OQPA 1LDMA 2NU8A 1QF9A 3S70A 1P2SA 4DN6A 4YJ3A 2XMGA 1G8FA 2QQ5A 4U7HA 3L0YA 3BX1A 4WK6A 5CGZA 2GVZC 3I9LA 3TYXA 5C31A 4EH1A 1JI3A 3T3HA 1U0FA 3FWKA 1RJGA 1YU9A 1ZINA 4XOUA 4MV3A 1KTVA 1P91A 1WUYA 3JZFA 2FSUA 1YZYA 3GCXA 3OHSX 1GL3A 1KYTA 1CJCA 4GVPA 4W8GA 1WBDA 2WWXA 5FUYA 2FEAA 4OU4A 4AJJA 2EKBA 2ODPA 1L3BA 1DO2A 2ZTHA 3ORFA 4ND4A 3T7RA 1PK9A 1VHLA 3DBRA 4UM9D 4B0OA 5HZGA 3UPUA 1ZD4A 4O29A 1UDBA 1NBAA 3EH2A 1YRLA 4UAGA 5HDQA 3U7IA 3V00A 4ETMA 1OUMA 4HD8A 3WWPA 1P0FA 4TV9A 4FDAA 3T5GA 2VSYA 1LFDB 5KKAA 2ZI5A 4IUDS 4Z3KA 4OB7A 4OI0A 3INGA 1NBIA 1ZDMA 2JI8A 3HYCA 3UXHA 4AMVA 4L78A 5IAGA 2J0UA 2X5NA 2QMUA 3S2EA 3PE3A 2H7YA 5ADVA 3WC4A 4GZ6A 2EG9A 1O96B 2PR2A 4G37A 3KG2A 3RWMB 2CFOA 3U7QB 2PGIA 4AJ2A 3JWIA 4A2WA 2O8EA 5ICEA 2JFZA 2Z5VA 3JAMA 2I54A 1X70A 4JJEA 4LWZA 1PJZA 1M72A 3CUUA 4LHVA 2C3UA 2NV2B 2B2NA 1RP7A 1IG0A 1ZOSA 3SEZA 3JQ7B 3GRPA 3BJEA 4DJJA 2BHNA 2H9IA 4IDHA 1A2BA 1YJBA 3IB3A 1CJKC 1ZH2A 2YC2C 2LKDA 4LUCA 4EJ6A 3ZNPA 4DDTA 3K8YA 2JFFA 1YIOA 3ZXUB 5ERGB 1I4OA 4K88A 2HDHA 1O0SA 1AO0A 2A0XA 1HE4A 1GYQA 1WHTA 2FJUA 3I0ZA 1TTQB 3NPAA 3R8CA 1E1DA 5BVGB 3C8ZA 4Q3EA 1WSBA 1VPEA 4PICA 1ZQ1A 5DCLA 3ROZA 5FUQA 5KTPA 1L5OA 5ITZA 2BKAA 4QNRA 1U7WA 3AI3A 1IB6A 4IDQA 1U0TA 3CLTC 4CCSA 2QBYB 2EP8A 3WLRA 5JBQA 2FRDC 1M34E 1RAIA 3NHYA 2BGMA 4LGVA 1E98A 4UU0A 2WWVD 4J3NA 2R6JA 3A6EA 3OLQA 2XT9A 2XWJI 4DRZA 2WU0A 1A69A 5I7UA 5LWQA 2MYTA 1XZFA 3I3SR 1E1QD 2WYVA 4FOTA 4HDKA 2ZU6A 4ND2A 5IKXA 1FP4B 1BMFA 3KVNA 1OYWA 1S96A 3EFBA 4Q4JB 3WDSA 5T7BA 2CD7A 2J33A 2J7KA 5JATA 2WU8A 3GA5A 1Y6QA 1E94E 1G6KA 1XNJA 3ZGZA 4JVSB 2R3SA 1E6WA 5D51S 5FP0A 5SYAA 1T10A 4DV7B 4AX8A 5JU6A 4C04A 2P1DA 4LNHA 3LDHA 4DA6A 4OM8A 4Q9DA 3G2OA 5E95A 1UQTA 1DBPA 1X1TA 2NTJA 5KTNA 1Z5OA 3ZZ0A 4TLBA 2YJ6A 1ZUNA 3F4BA 3VKGA 1K4MA 1E1CA 3GQVA 2FW1A 5HRAA 3ZWKA 1CEYA 1QUEA 3SFTA 4O2LA 3AQ4A 3A3PA 4FFPA 2IEDA 3HFRA 1PQWA 2I22A 4HLCA 1X1CA 3KUCA 4U0JA 3OFJA 4W9NA 1OWNA 3SYKA 3TDKA 1F9AA 1M2EA 2WA2A 2GZDA 1PLJA 5JHHB 2WJYA 4GI3A 4I4TA 4EHDA 3K5WA 4Q3CA 5J63A 1KI1A 1ZXXA 2D8MA 1V8PA 1Z7YA 2C2YA 2R6FA 2W11A 5BVHA 3BQMB 3AUFA 3E3LA 3U56A 1JEYB 4ARIA 3KB2A 4TOIA 5C52B 1OPXA 3DMGA 2FJ0A 2IL1A 4F84A 1TEHA 3K72B 1V1JA 1M34B 1K63A 1WSDA 3KOWA 5CYPA 2HWYA 1MJ5A 2WG0A 3AF2A 4MV4A 1ECLA 2MSNA 4YLEA 1M1UA 3I12A 1YBAA 5FPHA 1VYVA 2ORYA 2OM6A 3M81A 3P1JA 2OM2A 3TZ6A 4M0UA 3GG9A 4CQLA 5KJ1A 4IDFA 2OBXA 1YA8A 2VZ0A 3IDQA 3O3OB 4M8SA 2FPIB 4U2DA 3HHPA 2BEKA 4BRSA 5I8WA 3L4JA 1QX4A 4PANA 1CDOA 2J45A 2Q3HA 2R6DA 3BBLA 3BWBA 4OQNA 3LQ1A 1BGWA 2HLNA 5FTJA 4YACA 3P32A 3SHWA 3G3EA 4FFMA 4KH1A 1UPCA 2GZMA 1OX4B 1W94A 2OLEA 5EIAA 5F3WB 1KEEA 4UBNA 4IG9A 3CSSA 2EQBA 5HILA 5D3KA 5A0VA 5DWDA 1DJPA 3KZMA 5COBA 3MNFA 4EI7A 2Q4TA 3B7WA 2PZ8A 5G40A 3VX3A 4ZAWA 4E2ZA 5A4KA 4UJ5A 4FPXA 1B14A 4KV9A 1UFVA 3IPYA 2X40A 3T0FA 3KU4A 1B6SA 3T34A 2DHDA 2E4VA 5EOVA 1QLHA 2VZ8A 4GKJB 1LVGA 1K66A 5CVEA 4PG8A 2AIRA 3DB1A 4O2AB 3MT7A 5HFNA 3QXJA 4RVSA 3FZNA 2W6MA 1NLYA 3PX2A 1RWQA 2QM0A 5IAKA 4YRSA 1ZM7A 2AYXA 2RGWA 3QLTA 3B82A 3HJHA 4RY2A 4YAWA 1AQYA 4UOZA 4K7JA 5EHIA 3TI9A 3ZDYB 2NVUA 3F7NA 1WQ4A 3D4BA 5AW0A 4JODA 2C31A 4KW7A 4MUFA 1M6YA 3UFBA 4Z4GA 4N4AA 2Y1CA 3QFRA 2GBLC 3KCQA 4DLZA 3A9UA 3TD2A 5LWHA 4EFDA 1COWD 2GJ9A 5A3QA 1WV0A 3UBTA 3GEIA 4E5UA 3SGLA 4YDQA 1KRXA 1LF5A 1QYCA 5U4XA 1KXZA 3RUHA 5T5QA 3L41A 2YOHA 1E6EA 4MW1A 2YXLA 2GFIA 3ODPA 1VJRA 4KITB 4FINA 1H23A 2WFLB 3V32A 2YBEA 4BLTA 3VPDA 1O4WA 3AI7A 3FB1A 4HUQA 5ITZB 2AH5A 3AEUB 1WDKA 1L5RA 4G09A 3C0KA 1L5GB 3FYUC 5JXHA 4JJ8A 1R0KA 2Z2XA 1OV4A 2HWXA 3TQIA 4FWIB 4MB6A 1G8YA 2VYNA 1BXZA 1CQIB 3DGFC 3FKQA 5FJJA 3EAQA 5FIUA 1TA4A 2FSFA 2JVIA 3FR8A 1XNGA 5C4GB 1YCHA 5KTMA 4O4JF 1ZXLA 2G5GX 4EM6A 4MI1A 4XQEA 5JNRA 2R47A 4RZIA 4V24A 4Q47A 4WWHA 1X1EA 3HEMA 3LW7A 3KS9A 4GYWA 5IK2A 1XK7A 3OEED 4MQMA 4MS1A 2HDNB 3C3PA 1EAYA 1ECBA 3L7AA 4QGBA 1OAKA 3RAJA 5HKOA 3BFPA 2C4WA 4JI6B 4CIXA 3HFSA 1DU4A 4LZZA 3STVA 1XC7A 3VR4A 1P81A 4JGIA 2BTQA 3IKMB 1LSUA 3WBKA 4JXXA 4CRWB 3TR0A 5C5EA 2ZBDA 1IEWA 1Z2PX 1TJ5A 3KQWA 1RS0A 5JV5A 2OBNA 4QO8A 3LKVA 1RCUA 5KSYA 3RC2A 1YNOA 1N6PA 2C4MA 4Y0NA 4LS3A 3T41A 3GXBA 3EF0A 3K1YA 4IH1A 3DEIA 3PCRB 3V55A 5IVKA 3NPMA 3PBKA 5LFAA 4IJ5A 3P19A 3ODGA 4RQUA 4B79A 3WQRA 2XR1A 3FPKA 3QVGA 4CTOA 4OYRA 5AVZA 1O6FA 2E3JA 3GRCA 1UXOA 1YZKA 1Y7PA 1RBZA 2RGNC 3IJRA 1BJKA 4HWTA 4MW2A 4Q03A 1ADCA 5FQNA 4DMMA 1EVLA 4JLNA 1BWSA 1ZMOA 2F3RA 3E82A 3O4VA 1HG0A 1VIVA 5F4BA 2G9NA 1NATA 3ORRA 4EHJA 2HJRA 3R5SA 3A58B 3WGUA 4CQLB 1GVHA 1LC0A 4GPZA 1LW6E 4ME6A 4JZKA 3WISA 2IC5A 1SQSA 3GA7A 4F1KA 4RTMA 1MTZA 2VH2A 1LZKA 2XCLA 5IAJA 1L5NA 3QG5A 1P60A 1UDXA 2P4EA 4RGQA 2GAFA 1GT91 2AF3C 3ORYA 3D4OA 1BN6A 2A7XA 3HB9A 3TM5A 3SJZA 3WSWA 3ZVRA 5BNWA 3MJ4A 3ZWQA 1LNQA 1W1IA 5A4IS 3K0CC 1PFWA 2WHEA 2VBFA 3K0FA 4ICIA 4L6CA 5CT8A 4DHWA 2GXAA 3FNHA 1DQRA 1CIVA 2VJQA 5DBIA 4I3GA 3RTGA 2HA3A 4H1VA 5JIBA 1HGXA 1QZUA 4JNCA 4QASA 3O2QB 4D43A 4KX3A 4QSMA 2YTZA 4X1KA 2KW5A 4RK1A 1ZAYA 4R3UC 4BTVA 3HA3A 1K98A 3HBFA 2G9VA 3OF2A 4MI6A 4W63A 4QYTA 3K16A 5K3DA 2NU9B 2CLDX 1OJLA 5AK0A 2A1IA 2UV8A 3F1KA 3CR7A 1UXKA 3OO0A 1FFBA 2P79A 3PRJA 4CLXA 5L3ZA 4M9UA 3C6QA 1WXGA 1XYVA 3NVMB 5EJ7A 5T41A 1V1MA 2E0IA 3PFKA 3QMMA 3LGAA 4WCFB 4YCAA 3AI1A 5DTMA 1EJ0A 3JQGA 2X14A 1NZFA 3G5LA 1GGEA 4YJKA 1ZGJA 1C3LA 2AQIA 5EEHA 1OLUA 2ZWMA 4ITUA 3ZXIA 4TUYF 3ESDA 5JCOA 3TW0A 3IELA 5AYVA 4ZDKA 3R4CA 1OVGA 4PLWA 1HX7A 1UXHA 3SX4A 4YCMA 2EWMA 4V1CB 3FA2A 4N49A 3VRHA 2BGGA 4HGNA 1EAMA 1J09A 4ZCSA 3PC4A 1GUFA 3WGVA 5EIBC 1SD5A 3OCCA 2CKDA 3ZCXA 1QONA 2C7GA 4E07A 5C3MA 3GLUA 5FPKA 1EZZA 1GSOA 3QYAA 1A9XA 1NWHA 3HGMA 1GNTA 2I4LA 1D3AA 3IURA 2VJBA 2PS3A 3QENA 4J2HA 4EB8A 3ANSA 2VA8A 5GZ1A 4KDRA 3ACDA 4RA6A 4PQGA 2X2FA 5LCXA 1A96A 3NTVA 4YR9A 3L18A 1UOPA 1PEAA 6AT1A 1CQIA 1HI9A 4ZEWA 1SOUA 2R60A 2RI0A 3NCHA 4E21A 2A59A 2OC9A 3OCUA 4O4JA 1L4LA 4DUYB 2NOAA 4OQXA 3NDBB 4NU0A 5JJCA 1EK5A 4RUKA 4V03A 4G8BA 1WVGA 1VFPA 1KERA 1Y1PA 3BMQA 5AI6A 5E1MA 1EKXA 1EVJA 3RM3A 2WYWA 3HR7A 4ARBA 2IEYA 4G5XA 2NU7B 3PITA 3A1NA 2WNSA 4UU8A 1RQ2A 1YBMA 4KGZA 5BN5B 1FU4A 2F9LA 2VP6A 3VHQA 3R3HA 1S8OA 5BW8A 5LOVB 3LUPA 4UPVA 3FDJA 1E2UA 3WGTA 1N0UA 2YNMC 4QQRA 4IZ6A 1KK3A 1Z26A 1RMYA 4MVJE 4TWZA 3C70A 1IDN1 3KSRA 2A5JA 1GPLA 2C3MA 5HOEA 5KMGA 2V6GA 3HZHA 2FPRA 3UGTA 3LIIA 2YINC 3ASUA 3IRVA 1H2HA 3NTLA 4A10A 4AKTA 5CIYA 3TQCA 2EG5A 1GZ7A 3WYFA 2GJAA 2EYUA 4QD3A 4QM7A 1SPBS 1GAEO 4G8JA 4AO7A 1Z6GA 4L3WA 4PLCA 5DBFA 2LCIA 1F1JA 1OB2A 3KNZA 1NLUA 3SXUB 4K9OA 3WGYA 1QVWA 3FR7A 1T8UA 1HLPA 3CF0A 1OLOA 4DJFC 2WMDA 4JP2A 4WBNB 5FA8A 2VJOA 2DFPA 3QFHA 4QUHA 4L3OA 3ETHA 2BBWA 5DTRA 4R1PA 4DADA 1TF5A 2HWWA 3WNBA 4B3SB 1J1UA 2IXFA 2NT4A 1DWQA 1XJQA 3CA8A 1NYLA 4O4LA 4QXRA 1X92A 4F1WA 4MK4A 1WR8A 4KIWA 2R8EA 4LMRA 1NW8A 2B78A 2AQ8A 1RYNA 4KJZA 5B3KA 2OFFA 4DR3B 4D4IA 2CXXA 1WL8A 3T4XA 1B8PA 1DT3A 3UG7A 1NVMB 4JIGA 1U1GA 1Y8RB 3KZNA 3NZEA 1B8UA 1XCLA 2GN2A 4XTRA 1KVRA 4G1MB 5JWOA 2JFNA 1QWSA 2WD9A 4PYMA 3ZBUA 2PRJA 5K7SA 4MGHA 1MAWA 3N39C 3WX0A 1DLJA 1V6CA 1U5CA 5GV7A 5DX8A 1CRZA 5LYJA 4ZKEA 3BTUA 2JARA 3ZK9A 1XQVA 4DXAA 2F90A 2P9JA 4HLDA 1IVSA 4QUKA 2CN1A 2ORWA 1R8QA 4EY7A 2C99A 2GN4A 1JAXA 2ODBA 2WDPA 2XQGA 2BY4A 1IPHA 2HLHA 2ZE7A 3NHFA 1AGNA 4F9FA 4MQFB 2XOXA 4WQMA 1SN7A 1CUEA 3S1SA 2B7BA 1JEOA 3CNNA 1KJ9A 3FNGA 3TQTA 3NOQA 1ISSA 4R7TA 4WOBA 1R3DA 3R3ZA 1KFJB 2VDLB 1C50A 2ANCA 4R0MA 3RAGA 3QUBA 3BE8A 3QEMA 3DDNA 4D9CA 3EGDA 1L9XA 2QG6A 4QAQA 3E3OA 1DDIA 3M1AA 1B16A 1KF0A 1SVMA 1U0NA 2RIRA 3RNLA 3S3TA 5KYUB 1G4HA 3ELUA 4GFDA 2FE4A 4OQYA 3ZE0B 1QYXA 2W2PA 3KZCA 4LK2A 3MTQA 1OZGA 2JGNA 4QTXA 5CT9A 3G2MA 1PS0A 1RAAA 4KAFA 5I9BA 1RT9A 1ZOPA 5JAUA 5EJ5A 2VOEA 5BQPA 2VNJA 4GI7A 3IODA 3QPWA 3Q2IA 3PQ8A 1Y9AA 3TLEA 3A1TA 3TZKA 5KHOC 5JZOA 4EITA 5B2FA 1EUQA 2DLCX 4BO6A 4EARA 1HKHA 3Q40A 4HZGA 3VHXB 2CJWA 2DPYA 4ER5A 3O31A 2CLHB 4YMHA 3MWYW 4CG0A 2DR2A 1F2UB 1I6LA 3AIMA 3EG9A 4CKYA 2XGOA 2VTBB 4CQMB 3KYCA 3FZQA 4MLZA 3HB1A 2BE7A 2D00A 3RANA 1E3WA 4WVLA 4AUMA 4X92A 1U2DC 4MAMA 4YJFB 3W5HA 3FYHA 2O1WA 4WXEA 4BQPA 4PCUA 3OZGA 3DHWC 4Q9LA 4DLWA 1LEHA 4BIMA 1Y33E 1JBQA 3X1YA 4FMDF 2V58A 3V80A 3DOFA 3WJ1A 4P83A 5JD3A 4URYR 2V3WA 5U1PA 1YUMA 4DUZB 2Y77A 3FBTA 3M5DA 4NARA 4WEOA 3RVOA 5ICCA 1MG5A 4BQEA 1U9JA 3MG9A 2PX6A 2Q0HA 1E9EA 3Q4GA 5HNKA 4DWOA 2BR4A 2CJWB 3CU5A 4US0R 4CMIB 1DG3A 4BP9A 5B3LA 4EF6A 1HOXA 1Z83A 1XF1A 2JJ1D 2M6RA 2XMQA 5KTKA 4P4GA 2PIAA 1NMQA 4MEAA 2ATIA 3I58A 5J2UF 4NYIR 2X6TA 1S3SA 2FUNB 1B73A 4ESVA 4OQPA 1U5BA 2J30A 1LLDA 4E7PA 4HOYA 2BM9A 1V2HE 4AK9A 1Y48E 5JTTA 2JVJA 2W6OA 4M3NA 5TMBA 4B71A 2BKUA 4QC2A 5A05A 3SZGA 5A5VA 3G0HA 2V7QA 2XMDA 3MS7A 4Q48A 1PLKA 2TYSB 5GONA 1Z47A 4BCCA 1NVBA 2C92A 1E1QA 4HAWA 5DCWA 2HZBA 5AI0A 4XB2A 3UMCA 4LXIA 4MSUA 4CZ2A 3NTUA 2AL7A 3WL4A 1GILA 5H1YA 4B2LA 3TOVA 1Q12A 3FAKA 4HEA6 4WLUA 2W2XA 3HKCB 2ATXA 2JLCA 2YXDA 4EYSA 3COWA 5C4IA 1DKUA 2ADMA 5TPWB 3ROKA 1TC1A 4B8ZA 2PX2A 1L9KA 1YI1A 4FILA 3OTOB 2DSNA 4FCCA 1M2NA 3CZ9A 3KEFA 1UBCA 3DE1X 3EGOA 4HEHA 4V0SA 1JR2A 1R0LA 4OQFA 3R7AA 3U40A 2X2EA 4NBTA 5JQWA 1PIWA 3IESA 4PTYA 4CIWA 4J75A 3EYWA 5DHSA 1P7PA 4F3TA 1Z37A 3ZJVA 1SUDA 2RJOA 4Z6KA 3F6PA 3KO8A 1OI4A 1BXRA 2IEAA 3TM4A 3UMBA 2DUJA 5F12A 5HBGA 1QCCA 3EW7A 5JD4A 3BSWA 1C3JA 1D2HA 3JVDA 4WKOA 4DNQA 1YB1A 4S1PA 4Z8YA 3CPSA 5EESA 2FMTA 4HWGA 1E2LA 4OQDA 3S2FA 2A9JA 2HEIA 4FKMA 4LDZA 3ZU2A 4RTKA 3O5AA 2Q8NA 5BY2A 5AXDA 5PGMA 1IQ0A 2PVCA 4GUAA 1YVRA 1P0MA 2UUOA 3D02A 3GNQA 3WA7A 3MCWA 2A4KA 3MFQA 2PJRA 2CV0A 1ZK3A 3HNOA 5FO1A 1AKTA 3BGDA 5IM5A 4N7BA 2PS1A 1QHGA 1R5NA 1VMEA 4KWCA 3M9XA 1TF7A 4X8OA 3OF3A 5I7RA 4MVWA 3OLXA 1UKBA 3PGVA 3S44A 4A2QA 1SXIA 1DLIA 2PKXA 2XOEA 2W93A 4XIJA 1ZMBA 2NYUA 1A7JA 3LLCA 5K0SA 2Q0XA 2G3YA 2PMBA 5FTNA 4JOCA 4Q4JA 2XE4A 2FX5A 5CHEA 4YAFA 3X2SA 4MKHA 5KNCH 3TK1A 2IS6A 4BASA 4M60A 2ONZA 3EIOA 1FDIA 1UBNA 3HCRA 1YRHA 4EX7A 3AM3A 3VXKA 3OU6A 3K96A 3BILA 2R8YA 4BVEA 4CHTA 1D5WA 2ZJAA 1SQGA 1J9EA 3MXTA 1XTSA 3I8OA 4M88A 1AC5A 5HGJA 4V1CI 3F0TA 1M6VA 2OHHA 4GOJA 4L5BA 1KI7A 3DZIA 3I3OA 2ZAYA 4PLFA 5HQJA 5FQOA 3A4YA 3W4KA 3HB5X 1T15A 4C5BA 4WJLA 2VEDA 2MSLA 4WW0A 1P2TA 1IN8A 4MPPA 3R6DA 1P7WA 3DDWA 2XQIA 1KOGA 3QBDA 2H8KA 1MMFB 3FB4A 3PQ7A 3DG9A 2PSDA 3GBVA 3L92A 3U4IA 1HQYE 2VHWA 3OOJA 4DDUA 3QH4A 2YZNA 3AUAA 4FI3F 4M1YA 1YFJA 3DYIA 4UTXA 5IHPA 1Y7IA 1UC9A 4G6ZA 5H8WA 2WE8A 5JAIA 1AE1A 2C77A 3QWBA 4IMPA 4PFQA 4QTTB 4R1UA 4ZI7A 3SFZA 4GM4A 4J91A 3PJGA 3N0XA 1II9A 2FETA 3H97A 3D3JA 4MVJH 5IJ9B 3OZBA 4HDSA 5K99A 3AR9A 2OCXA 1EE2A 5A9RA 3OJCA 1RYDA 3ZY5A 3HYNA 2ROQA 1KQOA 3CW8X 1OI7A 1LBQA 2IEBA 4BL5A 3IHTA 1NA5A 2WSYB 5K2MA 2H00A 2R44A 2W48A 3KRTA 3EEOA 3NYIA 1GUBA 1Z12A 3VSBA 4HDMA 1UBOS 2J3EA 3N2YA 3NRBA 3T1YB 3ZV4A 5TF4A 5E8RA 3K1TA 2Q3LA 3L1HA 4HQFA 4OQ4A 3VOAA 5DNYB 3C6MA 2D2FA 3RROA 2VUIB 1OOEA 3WLEA 4Q4AA 1K0UA 3VKVA 3MVEA 2WHQA 2GOYA 1EGVB 3DBVO 2ENUA 3LT5A 3RK0A 1X9HA 4QHTA 2JGIA 3FDXA 4Y6QA 4CKCB 2BFBB 4GMKA 4D3FA 4GPBA 2CMDA 4MRMA 3G5AA 1Q2XA 1KMIY 2PUTA 3KQSA 4DOMA 3D1JA 1CCWA 4GL2A 1FSPA 3RFCA 2YFHA 2ZE8A 4DCGA 3UAYA 3HZOA 4DANA 4D3ZA 2SBTA 4MIOA 3HMQA 1YMUA 4Q37A 2A9RA 5FPTA 1M34A 3V1NA 4OKIA 1NUQA 3ORQA 2P3OA 1BFUA 4Y2VA 4CM6A 1V11A 5L4LA 3C6YA 3PXDA 4DKJA 3T7SA 4M1SA 1FF9A 1IRIA 1XKTA 5JFOA 1M2WA 4IAOA 3TCXB 3GDFA 4J94A 1FP6A 4HXGA 1ZOLA 2GPWA 3PFBA 2VF2A 4UU7A 3ROQA 1CU1A 4REOA 5I3CA 5JYCA 2IYZA 1TA0A 4RBNA 2YDXA 4I66A 4BNLA 4BX2A 1JLSA 2ACKA 1A9OA 3F5QA 1WZNA 1H2BA 2AFIA 2AX4A 1DKNA 2FWBA 5A3JA 1SZJG 1T3ZA 4CKCA 4RZHA 1FRVA 1EG7A 1PT8A 2EV9A 2V6JA 3IHKA 2OHGA 3BMNA 4H3VA 1DT5A 1N7HA 4BLPA 3OE7D 1AX9A 1S7GA 2Q4EA 4PPYA 5ADHA 1AXEA 2QV0A 3FPHA 2H4ZA 5JWRA 2OV6A 3DT8A 3WGOA 3UFXA 1DI0A 2F59A 3ESRA 3KUKA 3W6NA 5KYWA 1QSGA 3KHKA 3H42B 2PGXA 1HO3A 2P6NA 3QWFA 1Y7LA 2B4TO 4EUEA 3SE7A 3GLGE 3U49A 1NUUA 3HP4A 3B48A 5EUCA 3GH1A 3K73O 4HJRA 1ZH8A 2MSCB 3QPAA 2Z57A 4OL9A 2H6EA 5JUWA 2C1EA 2W70A 4L6IA 1HE2A 5ECWA 3SHVA 1AQLA 3HXQA 5ECGC 4BE4A 3C3BA 2B30A 5KS2A 2JKZA 5AUPB 3VTAA 3I2YX 4R51A 4Y3UA 2XGSA 4BO3A 4NHOA 5DNWA 2C1XA 1KE1A 1TM5E 3EZYA 4Q9KA 3W4IA 3N2KB 2PO7A 3Q8LA 1D6MA 3GUZA 4G67A 3JQAD 3R3JA 3T0GA 5JRZA 4L22A 2FWAA 4HDRB 5ALOA 4YFYA 3UO8B 2DF8A 3ILXA 3VO9A 4UVEA 5HRCA 5IMSA 5BNZA 3VUEA 4B3BA 1TMOA 3C87A 3QE2A 3FX2A 3WYDA 4YJGB 3V8BA 1X74A 4TZ6A 3DTVD 4I1OA 3GP8A 3DTNA 1WMAA 1XDZA 2IYYA 3ZY2A 4CMBA 3WGIA 2R87A 4C2AA 1T0IA 2ASEA 4TLDA 1MENA 3C3MA 5ESWA 5HFAA 2JEOA 1ILWA 5BOSB 4OP3A 4TWAA 5ITVA 1E4YA 1YZFA 5L3QB 1IG3A 4RM3A 4C43A 4EVSA 1IXRC 1ULUA 1FYFA 1UOOA 1NBWB 1W85A 4KB5A 3FI9A 1NMZA 1RKBA 3N7TA 3DXZA 4WX2B 1FQJA 1MAUA 3W5CA 2LTAA 1LTQA 1GDTA 5ALEA 4OYLA 2OQVA 4KIGA 4LXGA 4HH3C 5C18A 1J8MF 1BU5A 1GNRA 1YXMA 3J7TA 2C2MA 5FBHA 5C7OO 4AN0A 3FYUA 3FYSA 3ESCA 1QKKA 1JDVA 4RD2A 3LDFA 2NW6A 4DR2B 3W4JA 2Q07A 1MJGA 3L40A 3BZWA 3ADBA 2OZLB 4CL0A 1U3WA 4JDPA 4RVCA 5D2CA 5JYDA 4R1MA 4DG9A 3LPCA 3VR4D 5TPZD 6CHYA 4PGGA 1HDGO 1WM1A 3K0KA 4PNHA 2VNIA 2W2VA 5C3UA 3WMXA 1FTGA 2EVWX 1XKQA 1GTJ1 3X1ZA 2HR1A 5K0TA 1LPMA 1K97A 1REQB 2IP4A 1ODLA 2QRJA 2XYQA 3E9RA 4KN6A 4QOEA 3LG2A 1I0LA 5FR1A 5GZ3A 2J9FA 2XGJA 3M82A 4DLUA 5EJ8A 2Z1NA 3GP3A 3MWKA 3FDIA 4M54A 2HHCA 1N5JA 2GBLA 4Q7LA 5C5CA 1F20A 1YL7A 1P17A 4G0XA 5C34B 4C9BA 5JRJA 4B3RB 2BTEA 4PBTA 3EXG2 1GU0A 4G97A 2G28A 4JGBA 4P2GA 4RQTA 3VUFA 2IZ5A 2P40A 2GF2A 2VP5A 3RU3A 1NN3A 1XL0A 2RHTA 1UBMS 1ZY2A 2HA4A 2PGLA 1VMKA 4EECA 3PNLA 5K09A 2WFAA 5JPCA 1SR8A 4AY5A 4CTNA 3G2KA 5AVJA 1UXGA 4EFKA 5IUJC 5CLHA 1Q1GA 3AT1A 3VYSB 1S8NA 5ADWA 3QF4A 3OQHA 3I34X 3IPRA 3DEHA 3LSTA 3LY8A 1T5IA 3FBGA 1RZUA 3TXXA 4FGWA 4TQAA 3OE1A 3TF5A 1A50B 2X0FA 4FU0A 4G4SO 4MVCA 3RDPA 1CZOA 1R0XA 2GZ3A 2NSJA 3OEHD 3QELA 1D7OA 3AESB 1F3OA 3K71B 1T6ZA 2J3QA 3GEEA 4CLHA 5DYGA 2BDEA 1NG1A 2NZ8A 2Z08A 4KNWA 2FZCA 4BZQA 2C78A 2NWQA 5FBKA 2VK8A 4KLRA 1WXFA 4AVYA 4BWGA 4EGSA 1SBTA 4DLPA 4WOJA 4B35A 2IFTA 3L5OA 5KNCD 1EX7A 4ENSA 4DLXA 4MCJA 1K1EA 3GNSA 1QO0A 4M8IA 3FCYA 2PANA 3TLGB 1W96A 3WBJA 1NR1A 4MHOA 1IUPA 2AG8A 1VE1A 3KR1A 3B3GA 1VGQA 2BW0A 3H6GA 2PYZA 3M7IA 3OWHA 4URHA 4LPSA 4ND6A 4CLOA 1U65A 2ZUDA 3Q0EA 2WTEA 5JAQA 2XUJA 3RR2A 4G0WA 2A5GA 1YQWA 3IB6A 1TJYA 4LNAA 2IKSA 1AQJA 3MJVA 1ZS9A 1E7MA 4PM4A 4YV2A 2Q45A 2WK1A 1Z4MA 3PENA 4MZXA 3TIIA 4MS3B 3SXPA 3PT9A 2VYND 5CW2A 3N07A 3RK4A 3TRHA 1RLTA 1UMCB 2I62A 3HDYA 4JUIA 4UDYX 5LPNA 3P27A 1DKRA 1JH8A 5F9FA 3EEYA 3IOBA 1SBQA 2UZ1B 3GJ3A 1G21E 4TKZA 4RESA 3DGEC 1Z2AA 2JNWA 4HRVA 1NQWA 3P9SA 2RJ3A 4YEDA 3GFTA 4JU9A 4V0KA 1G6HA 2XUFA 3A7EA 3RUDA 3D31A 5E6UB 4WFJA 2POCA 3EA5A 4CM8A 2PUCA 1HA3A 4RU1A 5EWJB 2OCLA 3TXYA 5LXTF 4CF6A 1PI3A 4E12A 5DNDA 5IJ0A 1GGVA 3LA6A 3W7VA 4ED9A 5BOSA 5KO2A 1G7RA 2LE0A 2C42A 4HKTA 3UT0A 1YVEI 5DLDA 4G4SP 4N03A 1XMVA 2Z9BA 3GMDA 4NE9A 2X5XA 3OLYA 4BGIA 1PWZA 4NP6A 1GEGA 2AZDA 4CFZA 4YT8A 1U3DA 2B3TA 2HQBA 1PCXA 3MWLA 5EFZA 1ZU4A 3O4RA 4RJ2A 5EYPA 4R68A 2VSNA 3EVTA 4J1NA 1E1NA 4HFRA 2DP4E 3AY7A 1TAQA 4NOLA 4MX8A 3H1PA 4R5HA 4R1LA 4WN3A 2FRDA 4X1YB 5FA6A 1T3GA 4KR9A 5LQRA 5B2ZA 1MEJA 3IKTA 1MDBA 2JIZD 4G89A 3TG2A 3SJUA 4C6SA 1N2CE 3ZD7A 2BI4A 2FTKE 4ZVNA 2ONCA 1FYEA 4P32A 4PE5B 1PK8A 5LD2C 3I9OA 1TZMA 3CX7A 1AUQA 3JQAA 1DAPA 4EENA 2IPAB 4IDCA 1XCMA 5CA0A 3WP1B 1A9PA 3O7MA 4YRMA 1JKFA 3IMKA 3DLBA 2A3RA 5JJKA 5DN6A 4RVGA 2OBYA 1JPJA 1EP9A 1U2GC 3PPWA 2FJPA 4IRXA 3SAJA 3U7QA 2O8EB 2GNAA 5CCEA 2FGJA 3WMWA 3PDWA 4YJ3B 2AI1A 1RTTA 2YJGA 4QDOA 2RHDA 4HNHA 4U8HA 4UCXA 4JC4A 3D8BA 1B15A 1I2AA 3SDZA 1F2DA 1FVOA 2I3DA 1V37A 1YUBA 4RMIA 5IVDA 1IY8A 1JMKC 2YMPA 3DFFA 4C1BA 4ETWA 1RBYA 2UVPA 4LOIA 1E4VA 1WTCA 3G7SA 4ZC8A 5FEUA 3S2YA 3A26A 4R6XA 4CL3A 2GI4A 1XZMA 2B4KA 4O63O 1W44A 1SMKA 3JQRA 1N5RA 1J5XA 1SZPA 1BEZA 9GPBA 2TS1A 2DKFA 1XMSA 1Z5NA 4TXMA 1T6XA 1WHSB 4ITVA 5FI0B 5A3VA 5KQSA 3TD9A 3EIWA 2EZTA 1E9CA 2Q3JA 1OH6A 2BLLA 2FPIA 3PRHA 4MA5A 2UYCA 2OXTA 1TGVA 3ENVA 2H5EA 1Y5MA 2VPIA 3NG1A 3TGWA 3WAJA 2HF8A 4EB3A 4ENRA 1VLJA 4Q3DA 3BRQA 2C5SA 3KKLA 1P1KA 1EXNA 5HJ2A 1P5JA 3TUIC 2O06A 4O2RA 4PRKA 5CLFA 1H4SA 1MO5A 4YRNA 4MUGA 5BUSA 3T5BA 4AICA 1QZXA 5FUWA 2ZI7A 4TMTA 1K6EA 5F7XA 1ORWA 4GVLA 3DJYA 2I7CA 3DM5A 5EXEA 3TTSA 5FV4A 3BRCA 5FTLA 1Y8RA 1FU7A 2EEZA 2HV8A 3HQ4O 1TUIA 5FLEX 4YQEA 4CEIB 2FMIA 3CLHA 5JCZA 5K6RA 3K0FB 5B6JA 2OO5C 2XQFA 3G82C 4LVUA 3R3YA 5JARA 3KSZO 5CT4A 2OFPA 2GAJA 2P8JA 4Z2YA 3UEOA 3MPOA 3MOSA 3K9CA 3ND9A 5DE3A 1UJ6A 3LZ6A 2PZFA 5C0OE 3RKRA 2ZB2A 1G3QA 3JQ8A 3R5KA 3JTMA 3QKUA 1NI4A 2FZEA 2AUMA 3IR6A 2A8YA 1FFYA 3S27A 1U1FA 1WCIA 1LPSA 3V8EA 3GPIA 1XXLA 1MA0A 1M2HA 1SEPA 2VNKA 2R4TA 1JQBA 2IE8A 1FDWA 2MTBA 3HRIA 4N0QA 1FP1D 1XEXB 5ARCA 4BKRA 5AVOA 2Y6VA 4EATA 5K3FA 3A32A 2H3EA 3WY9A 3RF6A 2XAUA 2OCYC 3IT2A 3BWEA 3RRYA 1CJUC