4ODIA

2.6 angstrom crystal structure of putative phosphoglycerate mutase 1 from toxoplasma gondii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
GNMAKAKYTLVLIRHGESTWNKENRFTGWTDVPLSPVGEQEAVEAAKALKEKGFEFDVAYTSVLQRAVVTCWTVLKGTDMCHIPVKSSWRLNERHYGALQGLNKAETAAKHGDEQVKIWRRSYDIPPPPLEKSDKRWPGNDAVYKMVPNEALPLTECLKDTVERVLPFWFDHIAPSIMEGKRVLVAAHGNSLRGLVKHLDKMSDEAVLELNIPTGVPLVYELDEDLQPVRHYYLLDEAELKAKMEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycerate mutase PGMII
publication title 2.6 Angstrom Crystal Structure of Putative Phosphoglycerate Mutase 1 from Toxoplasma gondii.
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
total genus 87
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.4: Bisphosphoglycerate mutase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4odiA00
2HIAA 1C81A 1DKMA 2P9YA 2H0QA 3QPUA 5PGMA 3IT3A 2EKBA 2P30A 4JODA 1UJBA 1TIPA 2H52A 2HPAA 1EBBA 2P2YA 5AJWA 4ARUA 2HHJA 1K6MA 4D4KA 2EKZA 4EO9A 1DKNA 2GFIA 1CVIA 3DCYA 2P75A 2WNHA 3C7TA 2DWOA 2H4XA 1SKAA 2QNIA 1RPTA 2YN0A 3QPVA 4AROA 4E3WA 1H2FA 3D6AA 1YJXA 2P6OA 4ARVA 4JOBA 1QFXA 3DB1A 1BQ4A 5CX4A 3E9CA 1RPAA 2P78A 4EMBA 4MA4A 3ZHCA 1DKLA 3LL4A 2P6MA 2BIFA 1E58A 4GPZA 2ENUA 1ND6A 3D4IA 2P77A 3E9EA 3IT1A 3IT2A 3F3KA 5AK0A 2A6PA 1E59A 1V7QA 2ENWA 3K4QA 1QHFA 3PGMA 3GP5A 1H2EA 4QIHA 3R7AA 4D4MA 1C7ZA 3QPWA 1RIIA 1SK9A 1SKBA 3GW8A 4IJ6A 1NT4A 1T8PA 4PZ9A 2H4ZA 2OWEA 3FDZA 4PGMA 2AXNA 2P9FA 3OI7A 3F2IA 2PA0A 1XQ9A 5AJVB 1BQ3A 3EZNA 5CDHA 1IHPA 3LNTA 2DWPA 4ODIA 3HJGA 3E9DA 5AJYA 2IKQA 3LG2A 3EOZA 3GP3A 4TSRA 1ND5A 1SK8A 3K4PA 2I1VB 2A9JA 1DKQA 1DKPA 3BIFA 2EOAA 4FDUA 2WNIA 3O0TA 4GPIB 5HTKA 1FZTA 4FDTA 3MBKA 2P2ZA 3FDZB 4D4LA 3IT0A 1V37A 2P9ZA 3NTLA 5AJXA 2YN2A 5HR5A 1C80A 5AJZA 1YFKA 2OWDA 2WU0A 4D4JA 3MXOA 2F90A 4HBZA 1DKOA 4IJ5A 1BIFA 1QWOA 3D8HA 1FBTA 1UJCA 4ARSA 4PZAA 3KKKA 3NFYA 5CU7A 2P79A 4JOCA 2RFLA 3FJYA
chains in the Genus database with same CATH superfamily
2RK4A 3KQSA 4P22A 4HKTA 3JQAD 4R69A 3K31A 4IDNA 5F35A 3WNZA 1YVUA 4AZSA 4US2R 1FDSA 3F78A 5FOUA 4RJKA 4B2IA 5A9SB 3KPVA 4BAGA 4G9GA 421PA 5IXYA 4WEOA 1ZSNA 5ALPA 2YCBA 1DJPA 1WABA 1DTSA 2Q5QA 1QX3A 3IP8A 3L0SA 3R76A 3TUJC 3U7FB 5EVJA 3NP9A 3AVXA 3WL4A 1SELA 4DQVA 4HZIA 2UXDB 5GJWC 3C7KA 5SZKB 2ZCUA 4FOSA 1FMJA 4YV0A 1WXQA 2ZR0A 4YRKA 2G9QA 2J7PA 1MQAA 1TU0A 1XVAA 3EYWA 4RSMA 5B6JA 1Q1QA 1J33A 1DG9A 3TUZC 2DVMA 3QLJA 4FBMA 1L4FA 1GPUA 2BL4A 2VXOA 3MAJA 4OMDA 2H4HA 2AEEA 3QU4A 2V5AA 2QF7A 3LQFA 5E0KB 2F2TA 4ZTZB 2QORA 1M2GA 3PD7A 3AHCA 2XE7A 1H8ED 3QHAA 1IFXA 2B21A 1MOSA 1XJCA 2CJWA 3HJRA 4WW0A 1GAXA 4Y6OA 5IS2A 3HUFA 3THYB 4B6OA 1QNFA 3V1KA 4LIPD 4Z7OB 1QQBA 1LTKA 2XIQA 1QS0A 3BWDD 2PUBA 4NNJA 1YA4A 3USCS 2DEUA 1LW6E 5FDFA 4YCCA 3PKZA 5FTWA 3SXJA 1OROA 2P68A 1MC1A 3LL7A 1WDMA 4YJGB 2CJFA 4ZYLA 1KQOA 5IVKA 2P0YA 4HPJB 1GOTA 1C7ZA 4AX4A 3KHKA 5CLFA 1AGYA 4EY3A 4BZZA 2H1LA 5FT9A 1VI5A 3SS9X 2BGMA 2J5BA 3WLKX 4W5OA 1OLSB 3ENNA 4WX2B 3SEQA 3D4LA 3PRYA 4XIFA 3QUQA 4AQYB 3K30A 3CC8A 1MEOA 2AZDA 4R5MA 3A1UA 1USGA 1GSHA 2OOSA 3X1MA 2BEJA 1YA8A 3JZFA 2EEZA 4CCYB 1F1JA 5IBQA 1C0IA 1V6CA 3C1OA 1SOVA 3FHLA 2WDPA 1OA0A 4G36A 1D03A 1VG0B 2V58A 1L7XA 2B7CA 1E1CB 1O9BA 4HXGA 4KMRA 4Q3OA 3JAWA 2GH1A 3GXOA 1ZBDA 2A9JA 4XJXA 1JR3A 2FZ5A 4HXFB 2AS0A 3RG8A 3NZEA 1A2QA 3Q3EA 3GZTB 4QDOA 4EA6A 3G8DA 1A8PA 3GQBA 4JI6B 2HY7A 4BO0A 4E2XA 1N2XA 2R6ZA 2XI4A 2ZJ1A 1HRKA 1NT2A 4IQFA 4JJKA 1I7PA 5F5NA 2RHOA 2J9YB 2V97A 3A28A 5EFZA 4FB5A 1DLJA 5FTLA 4RV4A 2CKMA 2Z6VA 1GT91 3PNPA 4DARA 1SG9A 2W00A 2C61A 4LYJA 5F9MA 2IUYA 4HDKB 1UWKA 2OSBA 3JTMA 1Z2OX 3SPXA 1CNFA 1RRGA 2R65A 1KJQA 3Q2OA 3ACBA 4IMJB 2LZ0A 4MVJG 1WUTA 2Q2WA 3RGWS 2ZIEA 5KNDD 4RTPA 2J0QA 3Q41A 3EUAA 3WWEA 4BJHB 4YRLA 4EKDA 3HKEA 4H08A 1DUVG 2C59A 3O47A 1EUYA 1CIVA 4P82A 3TW0A 1IQUA 4ESVA 1ACMA 1GQYA 4N0DA 2HMYB 3IKMB 5A4KA 4WK2B 2O2ZA 4OIMA 4IJMA 1K92A 4AY4A 1T8SA 1OC4A 4ZA2A 4DLZA 2DWOA 1ZR4A 4MPJA 3R4CA 3CV3A 1YJXA 3P9CA 5HQJA 5MN6A 2R85A 1EVZA 4HUJA 1R00A 1YL6A 3IEPA 2QB5A 3C4JA 3QOWA 4XTCS 1UUFA 5J47A 5KYWA 1H8HA 2XT9A 3ZGZA 4PRYA 3Q9SA 2O06A 1I7NA 3C87A 2W6NA 4PLHA 4Z1MD 2O57A 4LXQA 1TTTA 5JJIA 3GD5A 4X20A 2V96A 1GPBA 1E5TA 2CVFA 4KOAA 4Z51A 1BE1A 3O38A 4RD1A 3CNHA 2Z8XA 2N75A 5B4TA 4RTMA 4A15A 5ENDA 2BGTA 4DJFC 2WKQA 2QRHA 4IO1A 1GPLA 5WRFA 2BFMA 3KXDA 2EERA 4BMVA 1U3WA 3G8YA 4TKVB 1TO1E 5KVAA 1K8ZB 4EG3A 4LOJA 3CKYA 3OOEA 5AXAA 1OUMA 4IWXA 1B0UA 5CVTA 2I9PA 5HCIA 3ZVLA 4IZ6A 3VDQA 3MLEA 4A23A 3N2KB 1HE2A 1GT6A 3DSRA 1VRVA 4C4PA 2AYZA 5GIOE 3ASYA 4FFVA 4ZDWA 5CRIA 4BO1A 3QBEA 2P0AA 4NQZA 1QB7A 3W77A 1TZCA 2C84A 2ZPAA 3B52X 4A6EA 4RTRA 1I2ZA 5EEHA 3VR1A 2HEIA 1HFEL 1UIMA 3C6YA 2V6FA 3WDSA 4RLHA 2VUHB 4TROA 1IB6A 3B6JA 1ONNA 3B1WA 1NPDA 3SYRA 3VR2D 3MJVA 1JFFB 3KXPA 1TM3E 1QIMA 3VPDA 1G8SA 1O54A 1RMQA 2Y4OA 5LUAA 2V03A 3EXHB 1LV7A 2Y6UA 3FFAA 3DMFA 5EVCA 2OCKA 1YI0A 2HGZA 4LTDA 5A5DA 2G82A 2Q0HA 3CLVA 4ALJA 2QR3A 2FPPB 4JP1A 1MOZA 3Q72A 1ID8A 1MQ8B 1POXA 2LV8A 3AR2A 1B2LA 3N2EA 4U0JA 3W6NA 3Q85A 5AW1A 1JIQA 2JK1A 1P81A 4RF2A 2XWPA 4A8JA 4TTPA 1B8OA 1RJDA 4OATA 2IHNA 3UATA 4F8JA 4DANA 5A1JA 4K6KA 4DBLE 2R3SA 2SKEA 4R3WA 5A05A 3R9KA 4AU1A 3EXEB 4BLOA 5FULA 1QGED 4B4UA 2VIIA 5HKAA 1KO5A 4NPCA 2RH4A 4DDVA 1YDGA 2AOWA 4A73A 5CLIA 4NG4A 4DF3A 1L5HA 5HVNA 1ENZA 4DTIA 3GLGB 5DBIA 2REBA 2X6QA 3K2IA 3M5WA 4X8MA 1SVNA 3K9CA 3R7SA 4D92A 1K3UB 1UM8A 3KCNA 3ZIAD 1R2QA 1C41A 2DPHA 3HSSA 2JH3A 2WOJA 5COAA 1EJ2A 2JI7A 2REQB 4AFNA 5KZMB 3HJBA 1ECLA 3PNLA 5AXCA 5B7PA 2ORWA 2W6ZA 4YJFB 4C7MA 1SOWA 4Z4CA 1XMOB 3RVSA 4ZXFA 1YHZA 4NH4A 2D0PB 3UN1A 2WF6A 2IP1A 1NXVA 5JDCA 2IU3A 4TL9A 1Z22A 4ALLA 3L6CA 2C3OA 3PHHA 4HAWA 1F38A 4IMRA 1U9CA 1D0SA 3H86A 3WQRA 1RMTA 5D6NA 1VGQA 3DV9A 1T4CB 1M1NA 1CE8B 1XZLA 2V9ZA 1GTMA 1QFXA 1CRWG 2QVCA 2WIDA 3QXXA 2B2NA 5JNSA 3LF2A 1MH9A 3SLKA 1YZYA 2OORC 4QG3A 3HZOA 2MT9A 1DBQA 3RFVA 2E4YA 5B1DA 3TSWA 1GNQA 2HBYA 5CA1A 4UTRA 1JAHA 3WGMA 4KCGA 3ZHCA 4GWKA 5F7JA 2ZYIA 2G0NA 5KHAA 3RNLA 3WAJA 2I6GA 3P2OA 4XJVA 2NSLA 4V1CB 1AO0A 4L73A 1SKQA 3PE4A 2QRNA 5DM0A 4EF6A 1I8TA 2Z30A 3BIWA 3OZVA 4KL8S 1N0VC 1ZI6A 4UASA 5IJ9A 4Z3OA 1ZKMA 3UZUA 3HU3A 4OJQA 3AKCA 3K8QA 3CRQA 3DWEX 1O96A 1HL7A 3QG1A 1M1ZA 2H2GA 2JNWA 4JLNA 4XVRA 5E1OA 3TBKA 3HXPA 3MGKA 1FDIA 2QTWB 3O4RA 2VT7A 3H2GA 1JQEA 4H6VA 5A6VA 1KMCA 3C3PA 3CINA 2M1ZA 3LCRA 4G5QA 3VR4A 1N3YA 3ILXA 4FEYA 4LY6A 4XWTA 5TGZA 1ZL0A 3ZE9A 5BSHA 5TEVA 1T8PA 3D8NA 2AMYA 3FYTA 5DULA 5CB4A 4WNYA 4YO7A 4MRMA 4PHHA 4A91A 3AIOA 1QU2A 3ABQB 3DLTA 5F2EA 2H2AA 2J32A 2JF0A 1U3UA 4LHSA 2A92A 3W8DA 2GCOB 4KSBA 1HYEA 3E05A 3D59A 4WPGA 3X1JA 2IHZA 3JWGA 1FYWA 1IBCA 1Q0ZA 3U4QB 5EZYA 1XZGA 2DRIA 3QEMB 5B7GA 3CH7A 5J4HA 3BGOS 3ZNPA 1V5IA 2Q4TA 3BXOA 3TTYA 1PJSA 2Q1YA 4YAEA 5JVDA 1KO8A 1JDPA 2JLUA 2RH8A 4JI0B 1XEFA 3CBQA 3F6YA 1NXWA 3PUWA 2IZ1A 1XCBA 1G20A 1NQVA 4QVKA 3F90A 1AOXA 1VSUA 4OFBA 4CM9A 3OIWA 1N6RA 4PGGA 2VDMB 1TJYA 4OL0A 3PUZA 5LL6P 4QXMA 1TT7A 3DUFB 5DGTA 4LFBB 4XJTA 2G1KA 3WTBA 4F1JA 5AVRA 4LN1A 3TSCA 4XR9A 1L4NA 4YLEA 1SEPA 3IA7A 3VSAA 2JGNA 1YRLA 1E1QA 3NTOA 3PZRA 2C1XA 2AEFA 1EGVB 3AETB 2ID9A 4NY1A 3F97A 1LNZA 2AUNA 2ZJFA 3GJ8A 3B36A 4U3JA 1GA1A 1LWNA 3MTBA 4PBTA 4UUMA 2OOKA 3SF8A 4UCXA 5BMVA 3R9XA 1IHOA 4OF4A 1P6XA 5K05A 2IA5A 4PG6A 2QMEA 3DKRA 4X6YA 1H0HA 1L8QA 4AZVA 3T7RA 2LKCA 4TVKA 1UPCA 5FLYA 3FDJA 3CLTD 1RJ9A 4MULA 1SHZA 4CKYA 3BE6A 3SIXA 1X7XB 3PVCA 1DKNA 4GWGA 2ILVA 1NP7A 5ITWA 2BSQA 5JRDS 3NIWA 1BU5A 4K87A 4KZPA 4D9IA 1KDYA 4ASUD 3N5KA 1FXWF 3WWOA 2QHXA 1S2NA 1RI3A 2GESA 5F1OA 5FA5A 4Z1OA 1PYGA 1XQ1A 3VPAA 1ZP6A 4UBNA 4UUPA 4KR6A 1N2ZA 2OP1A 4IGFA 1E1RA 1P2SA 2FSSA 3TQOA 2M6SA 3NPMA 2AI3A 2GPYA 3PC4A 2IHTA 4LQLA 1X7WB 4BVLA 4W82A 2XQGA 4EATA 1ZA2A 2KYRA 3TAUA 3W5JA 3CX7A 4I1IA 4BNWA 3QX7A 4N6GA 4GQBA 1QPGA 2X2EA 5D3KA 3REOA 3KJZA 2AHOA 2F1HA 1ZNYA 3C1UA 3U3KA 1EHIA 3HLTA 3DFMA 4GMHA 2VJPA 5D5PA 4KQ1A 2YYYA 1NW6A 3LPAA 3OMLA 3PXAA 4F9TA 1GTVA 1OHHA 1DTWA 3A3YA 3MPOA 5F21A 1UPAA 2Z2YA 1XTSA 1PVOA 1NF8A 2XOEA 4K9LA 1ESEA 3BM5A 2C0CA 4CLEA 2HTFA 3ESQA 4U2CA 4WOKA 1H2EA 2H1RA 2HWWA 3EUWA 4I0WB 4QIHA 1L1FA 1SCIA 1E94E 2ZANA 3CE9A 4EHBA 2O8FB 3E8MA 1D1QA 1V9SA 4LZZA 2P2LA 2XOKA 3V9AA 2O8BB 1PZGA 1SKBA 4MI9A 1OAAA 5JHGB 4YXWD 3CIFA 4QOJA 1T3LA 4BJ3A 4AMGA 3HBNA 4TSFA 4HWSA 2WIFA 3KOZA 3K15A 3M49A 4WD3A 1VDZA 5AUPB 4YAIA 4IJUA 4F84A 3VJRA 3SQWA 1O58A 3G59A 4YRFA 1YBHA 1OGJA 1YMQA 2HUNA 1JG7A 2OL4A 2W58A 2GM4A 4G5OA 2GYUA 1O95C 3O82A 16PKA 3VTKA 1M1UA 3KTAA 3Q98A 3PZBA 4M36A 1E6CA 1UZAA 4ZYXA 5GJCA 3QBDA 2YQ4A 1PTJC 4X94A 1EUCA 3U40A 1FZTA 4UMEA 2FUCA 4LDPA 4QYMA 2Q1UA 7YASA 2AE2A 2CF5A 3K2QA 3HZRA 3D6TB 1JSRA 2ACEA 2PMBA 3H11B 1UR5A 2QLTA 4MUFA 4DNFA 4E13A 4EHHA 3WSVA 2NZYA 3JQ9C 1ZH8A 4RJTA 4H7DA 3T9EA 3OQIB 3AR6A 4LOKA 1L5RA 2P2SA 1JMVA 1CJVC 3L79A 1B42A 2OZVA 1IU9A 4MH0R 4ZVNA 2I1WA 3L1VA 3JV7A 3TDNA 2C58A 4GKKB 1ONSA 3HU2A 4NYMR 1BOFA 1X0XA 4QJIA 1LDEA 5INTA 4ZRMA 4OHOA 4FNOA 2QIOA 1TECE 4DCJA 3BDIA 3DL7A 4BNDB 3BSWA 5ECGC 4KOEC 3GJQA 4UMFA 5ALSA 5LYJF 1IVSA 1L8OA 3O94A 5DRTA 1PWYE 4XARA 1ODLA 1ZCJA 1K7SN 5KQPA 2QN9A 1RC8A 4CIBA 3EIWA 2B78A 1G5FA 4HO1X 5J2TB 3B3JA 3UPUA 2JZOA 1FP1D 2KB0A 4B85A 3HKBB 4CQMA 3U5ZB 1VKZA 1A77A 2IRWA 1Z29A 1T3HA 3T9FA 4ZI2A 1GGEA 5FWYA 2BGNA 1GPNA 1U0GA 2MWMA 4J9VA 3JX9A 3KC2A 4KV9A 4CPDA 5B12A 5EHXA 2Y77A 4CDMA 1GZUA 1TEHA 4U6SA 2DHEA 4TLLB 1K1EA 3W7BA 4H31A 3C3CA 4TV8A 4F2HA 3HB7A 5CFZA 5K8IA 4OK6A 1JALA 2JLAA 3ANLA 5BQPA 1LBSA 2HDHA 4UMVA 2GJSA 1K68A 4R40A 2AIRA 3ZDQA 1DCMA 2PGXA 2FNAA 1DQYA 4HVAA 2VH5R 3AK4A 4RMNA 2B1GA 1YSCA 4DSNA 3KOXA 2CLSA 2J48A 3LHKA 3NHLA 3AUAA 1RE0A 1OVMA 4L9RA 4RXMA 4Q3AA 3PQDA 4AKGA 2VJNA 1KKMA 3WKEA 4RF5A 1T43A 1OBVA 1HE1C 2IYSA 2F1OA 1KJ8A 1MT3A 2G1JA 4PNEA 4FYWA 4HMQA 5DT9A 1NNSA 5TVKA 1ZK1A 3VSCA 2WFAA 3OTWA 2G5TA 2ZSEA 1G5PA 4JLWA 1HR0B 3BGIA 4C88A 3L4BA 3TINA 3ETGA 4HQLA 3J80A 1F7UA 5DX1A 4ZQIA 2IQ5A 3AB7A 3T1HB 1FFXA 1U28C 2XA9A 2PEYA 3LUJA 1QHFA 3P94A 1FXUA 2AG5A 4F86A 2UAGA 5F7XA 2UZ0A 2VLIA 2RGNA 3PQ2A 1M1XB 3LE8A 3OT1B 5B3AA 3CUYA 3K8ZA 3T3IA 1IH8A 2HN9A 3B3FA 1LFDB 4IH4A 3DE2X 4PX5A 3TL6A 4CDNA 3T1YB 1QH8A 3BEDA 4IIFA 4Z6KA 1E3DA 1XTBA 2B5WA 2PKRA 3I01M 2XGSA 3BK7A 2Q6LA 1M54A 2JKZA 2UV8A 1O8CA 1Q15A 3DH0A 3JZMA 3K09A 1CR0A 1RZVA 2H65A 2OMEA 2YZMA 1QKKA 3L07A 4OQYA 4D0RA 2GBPA 3L7OA 2ZJYA 1QQ6A 3F2IA 4IRMA 4P4TA 3TPZA 4JK3A 5IT9A 2DAPA 4JJ4A 3FOWA 4QQRA 1PI3A 2Q3JA 3TRIA 4E2YA 4LMAA 1UDAA 2BUAA 4JEIA 4E1BA 4F7WA 1IHPA 4N5MA 1NVMB 2XSZA 3LWNA 1P5RA 4EFLA 1OXXK 5DNAA 1Q0HA 2OBLA 2NM0A 5ALVA 1E2GA 4N47A 2OBMA 2XUGA 2NVUB 2IT1A 3A4TA 3EIEA 5I9MA 3PQ7A 3I61A 4CMEA 2XKJE 3PLAE 2XYQA 1LBHA 4PCLA 1YZLA 2DQYA 4GUDA 1ULZA 1UM9B 4HNHA 4WBXC 4PS0A 4UCFA 5HQ3B 4RSHA 3OZRA 2LCQA 4URFA 4W9NA 2B9VA 3ZCPA 1D9XA 1QKIA 4E5MA 4BNNA 2WE8A 1DJLA 4HFJA 1K5HA 1BA3A 1MX9A 3NGMA 4UBIA 1FP4B 5LDGA 1BCRA 3E9RA 2B1JA 3CKMA 3GUZA 3JY6A 5FO0A 4E1VA 5MGNA 5LBTA 1W0JA 3JVIA 1NMSA 4QYIA 5FUYA 3ZJVA 1VHWA 2ZE8A 1M2EA 1E5QA 4ZYVA 2ZCVA 1Z9BA 1KC3A 2YV2A 4F96A 3SZRA 4TYYA 1WDLA 3PX7A 2I80A 2FUKA 3CEAA 1WXGA 3LDHA 4MS1B 2VDPB 2I2AA 4KWIA 3T5TA 5I7FA 1TVCA 3VU8A 3BPSA 4ZVLA 2BTEA 3WRYA 3EGXB 4TMWA 3HA3A 1CY6A 4WNCA 3FJ1A 5LQNA 3CR7A 3E3OA 5JZ9A 3QKRA 1NMXA 2H1HA 3DVSX 1IWBB 1VJ0A 1YZGA 2B36A 2PKQO 4YFVA 2OQRA 2OO3A 1GNSA 3RM3A 1Y98A 2PKCA 2VJQA 1U2TA 3WWCA 1EAMA 3TLGB 3VJMA 5JANA 1Z45A 2X4LA 1J8YF 1EVJA 3D3JA 5KYKA 4EFNA 2QY9A 4UTZA 3DEHA 1JFRA 1ULUA 4BMPB 2P91A 2PA3A 3LU1A 5J2TF 1CDZA 3GMSA 4FC6A 3EG5A 3JQQA 4JR2A 1NBMA 1MC8A 4M21A 3TI7A 1YJAA 3PDWA 3PIRA 5ALGA 4EM6A 5K0TA 2O2EA 2JFWA 4D0GA 2QN1A 3RK4A 3BMNB 3K35A 3IUJA 4HG2A 3PX3A 5E2IA 1ZPDA 3UG6A 2IOYA 4L6IA 1WXXA 3SK0A 4N3BA 1SCUA 1J49A 3CJTA 1RZUA 2YZNA 1IN4A 5JI2E 4KKXB 3ZCRA 3N75A 3MBIA 1CS0A 3MBOA 2IU6A 3T3MB 3IAS1 1JKXA 1BDBA 4RM3A 1RACA 1OXSC 1TCUA 1D2GA 1IEXA 2WHQA 4GOJA 1Q14A 1XGKA 3JD1A 4LYFA 3RJ5A 4R4JA 1H3NA 1WIWA 3F4KA 2C82A 1XRRA 3HSYA 1KMNA 4RETA 2JGKA 2ZRAA 5G02A 3UANA 2V8OA 1M2HA 3M1LA 5DDIP 1NVVQ 4DDKA 3HJUA 1QOPB 3LDUA 4NCBA 5AOCA 2O8NA 1NN1A 3HV0A 3L8EA 4FD2A 5ALOA 2X7XA 4C20A 2W6CX 4DWOA 2IDJA 2W8BB 1R64A 3I1FA 5I9TA 4X6LA 4BE4A 4F4HA 1L5VA 1ZZGA 4ZQCB 1NE7A 1V8BA 4ZK2A 1BH6A 1A9TA 2VJKA 3H1BA 1P2GA 4JOSA 4MZDA 2I1VB 4QICA 4A0GA 5B2FA 3S7TA 5LP6B 4BNGA 3FKSD 2HBRA 1UJNA 1Y82A 2ZUSA 3ED5A 4CMIB 3GLIE 2XNDA 2IXBA 4BNFA 1YFLA 3TMKA 1G21E 2I4RA 1ADGA 3CRVA 5CR9A 5DHQA 1LPBB 4B84A 3PTZA 3G0GA 2D2VA 5L3SA 4AMYA 2GBIA 4RFVA 3ENQA 2R6R1 1PLLA 3A0UA 3SIRA 1FNDA 2CJXA 3V7FA 2P62A 3UXHA 4KNYA 3SQXA 1AZTA 2OFOA 4RA9A 4OLHA 3G9XA 1CT9A 4B3DA 2PX4A 2WAYA 5EMKA 3JYLA 5EZSA 4DLYA 1O57A 3A9WA 5CU7A 1ZINA 3G23A 4NQRA 4ECEA 4P36A 4LY9A 1XKTA 1DRUA 4I9GA 2AT1A 2Y4NA 4AYTA 4EB3A 4DILA 4AYWA 3L1JA 2NXJA 2Q7DA 4P33A 2Q6OA 3QXGA 2ZI7A 1II8B 3N28A 1GCGA 4JBIA 2FX5A 4MQ5A 4M1QA 5NULA 2Q5OA 3WO0A 1UMCA 4NVRA 3DTYA 2JCYA 1TQ6A 3ED1A 5CM8B 5BW8A 2O48X 4AY3A 8AT1A 2EJBA 1IXRC 1TVMA 1WMFA 1NVGA 1JLLA 5ALQA 5LD2C 1UBHS 4LG1A 2IJGX 1Q91A 1E1DA 4BJ6A 6YASA 3KLPX 3NIBA 1G4HA 3O31A 4X7MA 5ESRA 1PUIA 2OG2A 3O95A 4H6WA 5LYJB 3MTQA 5KPDA 4RHYA 4TV9F 3VR5A 4NYJQ 4BQEA 1DWUA 4UAGA 2O6HA 4E22A 2IYUA 3S2EA 4IZHA 5BSMA 2P9HA 4WN9B 4P34A 3AF5A 1OLXA 3JATA 2HB6A 2WVHA 1R9JA 3FLEA 1RBZA 4H7KA 4JJFA 4H18A 4RTSA 1HQKA 3K1ZA 3U4GA 3S99A 3OCYA 2ZG6A 4WXEA 3EF3A 2YY6A 1N8SA 2VEDA 3AU8A 4WXRA 3NXKA 1O7JA 2YWXA 3OC6A 2CLHB 2V5UA 2HHAA 1X8KA 3NQ41 2Z6QA 5ERXA 3L7BA 1KSJA 3WJ7A 4FUTA 1UFKA 5AKYA 5JPIA 3A6HA 1CB7A 3RIHA 1N0UA 1NBOA 2D13A 1H65A 1STOA 3NV7A 5HDBB 4YREA 3THSA 4BQSA 3QP9A 1BVHA 5K5EA 3RJTA 3AL2A 1DC6A 1QC5A 5H02A 4F91B 2RG7A 2ZBPA 2VDWB 5AXBA 4ITVA 2I71A 3GH1A 1VMDA 1OR8A 3SXUB 1KOFA 2NO7A 3NKFA 3EVCA 3A4MA 4ZVVA 1YZNA 2QBYA 4MEBA 1PVVA 3SC2A 1Z4NA 2VZLA 4K9RA 5KNDH 4PGMA 2J67A 3UGTA 5GTDA 4CT0A 1Q7EA 2NW6A 4KACA 4OAOA 3TNLA 1J9GA 2VYNA 3HYLA 3NEYA 2VG8A 3PUXA 5K3FB 4D56A 1CY4A 2E18A 2AG6A 2QQGA 4I55F 1PN3A 1YIAA 4OHMA 2WM9B 4QARA 5B1EA 2HWUA 1UKEA 4M7PA 3SYKA 2Q4DA 1VBNA 1Z36A 4CKCA 4PPFA 4Q47A 2G4LA 3R5KA 3KQWA 4X95A 5CXUA 5CG1A 3LO5A 1DT5A 2CL6X 5T57A 3LCMA 3PV0A 1FNNA 1JIJA 4PZEA 2BKLA 1BRTA 3RAJA 4BP1A 1U2GA 3HGQA 5IFLA 4R1PA 3IVAA 2WWVD 3FIJA 1Z2NX 3TUIC 4D8UA 4TN5A 2Q6VA 4G0NA 3SVZA 1JT2A 1Z16A 4L4SA 2D59A 2XV1A 2ATCA 3C97A 5C37A 1C8VB 1VXOA 3TTUA 4NZNA 1EUDA 4EEXA 1Q11A 1VBKA 2OK8A 3BMXA 2XODA 2IP4A 1D9ZA 3L04A 2H00A 2WU0A 3ABSB 3D3NA 1W4AA 3P19A 2AI1A 2ADOA 2HA7A 5L3RA 3H1AA 4O2BB 2BBWA 2I6TA 4QOHA 3PEWA 3KKKA 3VOAA 4LJAA 4EI9A 6CHYA 1G6Q1 3FE2A 2RAFA 3VHXA 2WWFA 3AYZB 1L5KA 4CLHA 1KK0A 3R6TA 3FCOA 4FPXA 1DJOA 2QAGC 3KV1A 1DRVA 1GRQA 3QWFA 4GLOA 4MWTA 2REXB 3ZW7A 4PIMA 4GR4A 2A1UB 4IOLA 5FA8A 5HPYB 3JZAA 3A3NA 3JASB 1OU4A 5HNKA 5FPSA 2V1UA 1E3WB 1I6LA 3IFSA 3KS9A 2C9BA 4PXYA 4RL4A 3VDMA 2QVYX 1PGOA 1VHLA 2NSYA 3C16C 1V35A 4BKMA 5DM60 1KXZA 2GK7A 3ELWA 3I34X 3CVYA 5IDYA 1X86B 2P75A 2H3EA 3NAQA 3BRWD 3NIDB 4PX9A 5BQFA 4E3ZA 3RYIB 2FSGA 1ZXBA 1NL3A 1GAEO 3DW1X 3KO8A 4I19A 3FNHA 4KN9S 1Q0UA 4MTCA 1KDVA 1MC5A 3S1AA 3T52A 4MS4B 1DE0A 3ESRA 4ZOAA 3OHPA 4YVFA 2YXPX 1JJAA 2DG2A 4JLKA 5EIOA 3AY3A 1BZYA 1I3CA 3HN6A 4R9RA 5JISA 5LP1A 3CH5A 2QG9A 3N59A 1DCTA 4ZANA 4BMSA 3RRNA 3LPLA 4KR9A 1D7AA 4MMXB 3TSZA 4J3FA 2CXUA 1UODA 3IIIA 2OSVA 3A7EA 4WCFA 4OQEA 5KINB 1POWA 1YR2A 3M6MD 4J1TA 4KVAA 3H5VA 2WWRA 3NH6A 3I1IA 4DC9A 1KVUA 3E9EA 1GXSB 3G0OA 3WGOA 3WSTA 1AH2A 1CEEA 1OZAA 3R2JA 5AK0A 3VZSA 4DAEA 4DPKA 4WZBB 3E5HA 4KR2A 1GU7A 1JMKC 2OY0A 5SZHB 4R8MA 2JFFA 3L0ZA 4AKSA 2QNBA 1DL5A 1P5JA 1KVTA 4DR4B 1XHLA 1NPTO 2WSIA 5ALXA 4BNJA 4C03A 5THQA 3D3WB 2OXTA 1SXJC 1A8QA 1WCV1 1ARZA 5E3HA 4RZSA 2MSLA 3B8EA 1JN0A 2V7WA 1KIMA 5TGTA 4A27A 4IOMA 2DPMA 4AJKA 3GNSA 1QAOA 2FHPA 2QMOA 2RJ3A 2VF7A 3E22A 3NTQA 3EEQA 1R4ZA 3GH3A 1QFJA 1TMGE 3E18A 3WLHA 1DJMA 1ONPA 1W36B 1UWVA 1L1QA 3NG1A 4YMIA 2EHDA 3BD9A 3DULA 1E1MA 3LLSA 2Z5VA 3LP6A 4X60A 1RPJA 4D4HA 1R5OA 3S44A 1C50A 3HBAA 4MUKA 1XMQB 3AVVA 5DTRA 5EIBD 2HEGA 1H23A 1P17A 2DWPA 1KDOA 1O0SA 4OXRA 4BOYA 4CG1A 1EGMB 1BQEA 4G8DA 1VE7A 2VDKB 2VBGA 1CUCA 4LQCA 5FTNA 5BSUA 1SVMA 5CK5A 4F85A 4OLBA 4Z4FA 1V26A 3E23A 3M3HA 3DDSA 1J06A 1KI8A 4LCEA 4ZQEA 5HKBA 4EY8A 1GTSA 2IODA 2C9MA 1NSTA 2R11A 3TR6A 1V37A 5AWFC 2Z5FA 2WLTA 4AX8A 4CGZA 2JGRA 1A82A 3C5EA 1Z26A 4H2DA 4A0QA 4LMBA 4NSNA 1PS8A 1GUBA 1WP9A 2HFKA 2V65A 1UXIA 3MIZA 4PAGA 4PLFA 3GLUA 5CXSA 3TG2A 4LJ8A 3S29A 1U8ZA 4WY5A 4HAVA 3UWDA 7MHTA 4W8GA 3EY9A 4F4JA 1OX4B 4DCCA 1E61A 4WERA 4CF4A 4LX8A 1CUBA 1L8XA 2VPPA 4OYLA 5HBGA 4GNRA 2QUIA 3AI2A 2MYNA 2C2WA 1PWHA 3NHYA 4TYQA 2D7JA 1TZ2A 3WWPA 4D26A 1MO6A 4BLVA 4QEZA 5HCUA 1GYPA 4IP0A 4LTMA 2EG5A 3OEYA 5BWCA 3D2BA 2ZIZA 4JLUA 4NBKA 5HFAA 4AZ0B 1YUMA 4P4SB 5J4KA 3ZQKA 1XVVA 4JI5B 4BO7A 2BUCA 4G65A 3EB9A 2FOIA 4TXLA 1HE3A 1E2MA 2J0SA 5JCJA 4HXEB 2BF7A 4N76A 3U7EB 4HSGA 1O97D 3DDHA 3CF4G 4EBFA 3H1EA 2ZSHA 3HJCA 4H17A 5BW5A 3E81A 3D7SA 1UBFA 4RVUA 4CLRB 3HJFA 1KZGB 4O0LA 3Q15C 5FPTA 3UJCA 1SC9A 4EYEA 1YS2X 2IPAB 3D6AA 4XGNA 2DFLA 3UOGA 2E9SA 3FVRA 3K4HA 1YNSA 4OM8A 3CW2A 5DIZA 4XWOA 2VOJA 3R7WB 4FQ8A 2NO6A 4B7XA 1PEAA 4YJGA 3AY6A 1JU4A 4M46A 4MPDA 4YPFA 2BDUA 4EJ2A 2PUGA 3V8QA 1G60A 2E4AA 3E03A 4WKPA 1BFKA 9LDBA 1YE5A 4LDAA 4LBZA 4B81A 3FNGA 5KHOC 1T8RA 3ROPA 2G5GX 3NRJA 2NWQA 4HYQA 2Q7OE 3T9BA 3I5XA 5C18A 1UEIA 3PQCA 4XKJA 1QO9A 2G4VA 4RJJA 4Q6BA 2EP8A 2V0NA 2G0TA 1LU9A 2VCEA 1MW8X 3V42A 3EUEA 1RXUA 4KFRA 4K9PA 4Q03A 2Y1XA 2HWXA 4RHCA 4RZQA 4CCYA 2VT2A 4W1QA 2SCUB 3G89A 1RYMA 1TZMA 3H8VA 1KEUA 3EZ9A 3FSGA 3QH4A 2ZRLA 3QYJA 4RU1A 4XGIA 2GOYA 4LV5B 2D1TA 4YUVA 1E1CA 2R8EA 4G2TA 3WLMA 4ZAZA 3KWMA 4G1CA 2RHTA 3ZHXA 1GGJA 1JSCA 5J43A 3IULA 3P9KA 3I9MA 5IDQA 3BWVA 2RAPA 3FAZA 4GHWA 4YIKA 3TTVA 1XLTC 4TKLA 2IV2X 4AURA 2ATXA 1D4FA 4C4XA 1HLGA 3T3OA 2V7PA 3L8CA 2Q5JA 4M0KA 4MINA 1QG2A 2J9FB 2WWIA 2WYUA 3EXFA 4UVHA 4DSAA 4V03A 5FTJA 2GR9A 3G1TA 2ZBRA 4MARA 2GVDC 3O9MA 1TMOA 2QTFA 1THGA 4ER7A 1XNJA 3QFSA 3ZDCA 5DASA 1Z0KA 2BGRA 2OC4A 3GT4A 4NMWA 4WCVA 3EZYA 3FVQA 1IJEA 2WD7B 3B85A 1Y48E 4AB1A 2FI1A 2XE8A 1USUA 5SYMA 4OU5A 1VQ1A 2C95A 4D9GA 1A9XB 2XBUA 2YOGA 1IY0A 3D5TA 1O89A 1JU9A 1NULA 3IKVA 1PJRA 1T0UA 2X0FA 3AEUB 4BYGA 4LWZA 4OHUA 4CKZA 4KJZA 1Q0QA 2QL6A 5AM5A 3U9SA 1RQ7A 1BH2A 3JQCA 4RTNA 2EWWA 2G72A 3KEQA 5ED0A 3VYSB 3FXAA 4L3OA 1NJ1A 3M81A 3T54A 1H1LB 4CKBA 1NM5C 3CRMA 4LSMA 4CF6A 1TQDA 4C7BA 1CJUC 2FGKA 4HLDA 3U16A 4B34A 1V4BA 4LI0A 2V9CA 1PX2A 3HH8A 1XNRB 3ZHVA 3OOHA 2VH1A 4M9CA 1V8FA 4MROA 3V00A 5KSYA 2QJFA 2JKYA 4UE3S 4QHSA 2OZPA 1P3JA 3STXA 3UKDA 10MHA 3N8HA 2FPKA 4I4TF 3UUFA 4K9OA 2QDKA 4NJOA 1DAPA 3VPGA 3NBXX 3JWJA 1Y7LA 4R7GA 4K81B 1T5BA 4CNQA 3H2ZA 1TDJA 1SVUA 5EIFA 2CLIB 3ZWXA 4EL5A 5LIPA 2O5CA 3DZJA 3SCZA 5K45A 3GROA 4C07A 1JVBA 4ZKEA 2YASA 3R75A 3AY0A 3O4JA 4GI7A 1AK1A 2J08A 2OHXA 2I34A 4XH9B 4GZMA 1H2HA 5AI4A 3LQKA 1FP6A 2GS9A 1HM5A 2FPLA 1KA9H 3JQ6A 3IMCA 3AEKB 3P9QA 4OUDB 4CQLB 2OK7A 1GU0A 3VU9B 3JU3A 1XVTA 5LQJA 3D6FA 3QEBZ 1SZJG 3M4JA 2PJUA 2EKLA 4DYHA 3AJAA 1VCHA 2PT5A 2GJ8A 1DBWA 4P3XA 2PVCA 4Q01A 3ZWOA 3LVQE 4N4AA 5T64A 3PC8C 1UBGA 1PW5A 5D84A 3HP1A 4BB6A 5K09A 4B2PA 2OLJA 1G3QA 2CHQA 4TTQA 2OCAA 4F3KA 1J9ZA 3QIVA 2K6GA 1NLZA 2W2LA 1UC5B 1HT3A 3AZQA 2O20A 4ND1A 1HEUA 4E94A 1QB8A 2A58A 2V6GA 5CEEA 4ILEA 2DBVO 2BSAA 2FFBA 3CBGA 4FN4A 1HETA 3KVNA 2YRFA 2JIPA 3EXHA 3IPYA 4B6PA 4WT7A 4YR9A 2HMSA 1F06A 8LDHA 1B6RA 4LCJA 5F73A 1LF5A 3LKDA 3M9XA 3PC7A 3F6PA 2FMXA 1ZIDA 3ADOA 3BIOA 4KLNA 2FPPA 3JWEA 3HE3A 3WWDA 3V97A 5BYBA 5JSUA 1O6BA 1UIRA 4HNRA 1XJWA 3QFHA 3E2MA 5TXGA 5HTOA 1EIZA 1CR1A 1ZK0A 1JQDA 5L3QB 2EFYA 4B7CA 3MSXA 2ZT8A 4JIGA 3F47A 1TGVA 3E3NA 4O6VA 4Y0VA 4C14A 2CLDX 4YAKA 5EIXA 2JFPA 5T41A 2ZWIA 3KX2A 1WDWB 3HBJA 4DVJA 3GCWA 3QHQA 1ETUA 5IK2A 4ZRNA 5AVYA 1MT0A 1CP2A 1QHSA 1SUSA 2PIDA 1KYTA 2X8JB 5EWLB 3ETCA 4DV5B 3BHMA 4R51A 1DRKA 5KMGB 3OFSA 4YGYA 5G0SA 1OTYA 2YOFA 1CRPA 4OJYA 3AL3A 3RBXA 4EOGA 1IDN1 3GGPA 1X1AA 3KJEA 1FDUA 4UEWA 2WF9A 4DMRA 3PNKA 3UTCA 3U56A 3Q5GA 1K7YA 1IL0A 1ISIA 2EBUA 2HO4A 3I5MA 3R6DA 1V43A 4NYJR 4PCUA 3OSUA 4Q15A 5LDDC 2RCYA 1CZUA 4BJ1A 3CEMA 3OZGA 1YB4A 1VIMA 2ON6A 4Q9DA 5BP7A 5IC6A 1KKUA 1LQ2A 4Q0MA 1SXHA 3LGSA 1DX9A 4IIYA 3BE8A 3N53A 3U26A 3OJXA 2EJWA 2FW8A 1TYBE 3SGLA 4QPDA 3UXYA 3B5JA 3N2GB 1T4CA 2KJQA 4YLGA 1L0BA 4KODA 3BKWA 5FD8A 1JW9B 3EGDA 2I9KA 1Q12A 2XUPA 5CTJA 1LPOA 1QAMA 3VOTA 3CT6A 1NXXA 2GHTA 3CSDA 2VT3A 3EEBA 4E5DA 1Z13A 4CLXA 4IQ8A 2CV1A 1YRHA 1GVNB 3F6BX 1R27A 2ZRGA 2POCA 1MOQA 4BEBA 3TLAA 1IXSB 3L8MA 1KO7A 1L5FA 1SKAA 3VU1A 4Q1BA 1OIWA 1A5BB 3AR3A 5B37A 1AKWA 2AEJA 4UDYX 4ZJPA 4G07A 4BKOA 3TQSA 2XB6A 1W49A 1ZJ6A 1HDZA 4MKHA 4EKYA 5J2UB 5CX4A 2P8JA 3DL0A 2CK3D 1YAJA 3GZNA 2CDAA 5IANA 2B6HA 2JGEA 3DZGA 3GARA 4WKCA 2YV5A 4PYMA 3P5BA 3RVMA 3WYEA 4K46A 4B6JA 2COUA 2AYXA 2OFWA 3CZQA 3CGWA 1QIFA 3NUGA 1WBBA 1W4LA 1P1CA 4N0PA 1XX6A 5EPUA 1DKLA 3SWWA 1NVAA 1RRPA 3ERCA 5FF9A 3WWZA 1U2QA 2ZUTA 4E09A 4YCSA 1WB4A 2PQ0A 4L27A 1HA3A 4FINA 4BVKA 1TM5E 4FOPA 2ODBA 4N82A 3OFND 2BLLA 2CDBA 3TZEA 4C4AA 3R1IA 3ZDEA 3EZXA 3NONA 3PGXA 2CFOA 2X0NA 2X77A 5TIIA 2E4WA 3VGJA 1SUAA 4FSXA 4TL8A 1XAJA 5TPWB 3PUHA 3V55A 1Z6ZA 2GZAA 3WKCA 3U44A 2XXAA 2X1HA 2VJYA 4OCZA 3QEMA 3CA8A 4RE5A 4AO7A 3RIMA 2J3HA 3JQGB 3PHGA 2ISCA 3OLWA 5A62A 3FYCA 1WZ2A 1GHTA 3QSYA 1ZMTA 4MVJD 1N7GA 4GQAA 3E15A 1GEEA 5FOQA 2GSDA 4PLVA 2OWEA 3HR8A 3KTDA 5F7ZA 4D98A 2H16A 3MTEA 2W2TA 4E5SA 1Y8ZA 4FNAA 2ZUUA 4YQYA 5AM0A 4MSUA 1YDEA 4ND5A 5F5LA 4BX9A 1YS7A 3FCXA 4MDFA 4CM3A 1P9OA 2H5JA 1FMFA 1RYZA 3DUFA 4J0DA 5E4FA 1XNHA 1XQ6A 4QFMA 4UJ3A 4BX3A 3VO2A 1H0KA 2Z4SA 5AMXA 3UAWA 1U3GA 4H59A 2X1VA 5U4QA 2ZYUX 3HY3A 1BVUA 4L9AA 2FJUA 3AETA 1LBTA 4TQGA 3IX7A 2VPXA 2Z9CA 4OG2A 5IF9A 3K1TA 2BGGA 4C9BA 4DLUA 3QOXA 4Q16A 1N2JA 1RNLA 2WHYA 1FDWA 2WOOA 4L8FA 1XZAA 3HXTA 1KMHA 2C57A 3EPPA 3LLCA 4A26A 3QE0A 3V8NA 1MAHA 2GD0A 1UBRS 1GV1A 1LQUA 2G25A 1MABB 3A4YA 4PNPA 2P3QA 3A1EA 5HGXA 4AF8A 5JCOA 3VDNB 1R74A 3S2GA 3TRDA 1V1RB 4H1UA 4V2IA 3QFCA 3DMTA 4C6HA 5E7IA 5IASA 1DC5A 1DO2A 1X92A 3E9NA 4WECA 2QN8A 4ENVA 3A6PC 5I9IA 3ZLUA 4KQKA 1PFGA 3LBYA 3VH4A 4DDWA 2AQKA 1I2CA 1RQXA 3BUSA 3H2KA 2BFFB 4EP1A 3DVQX 5K0JA 3JQ7A 3DVRX 1S2IA 2YYSA 3GLRA 1G8YA 1NKSA 1W87A 3MTGA 4B3GA 3AHGA 3ZE7A 2B1QA 4XB1A 4BB0A 5BT9A 1X7YB 4NZYA 5KOJA 2XCUA 2QZZA 3LIIA 5HIKA 1XZ8A 3GA7A 3IP5A 2YVLA 4QJ5A 4DKXA 2NO5A 1VIYA 1N7HA 2H1IA 4II3A 3AB3A 3HL4A 3OU6A 5C7YA 4L0DA 4KRFA 2ZB7A 2EGHA 1ODCA 3LUDA 5JXIA 3NYRA 2ONCA 4BRWA 3U61B 4II7A 4CV1A 1TJ3A 3Q3HA 2JL1A 2X22A 1MZVA 1UKZA 3QXJA 1Y3CE 1XI2A 3KKQA 1T9KA 2QM3A 2R2GA 3T5CA 1CZOA 1JJVA 1PUXA 2B37A 2KLHA 1UBOS 1U81A 4WZAB 2O8FA 4OGFA 2GN0A 1I24A 1QZZA 2HLDA 3JQ8B 3T9DA 1E4VA 3WIBA 2J5RA 3SBEA 4CBVA 1RYEA 2O8BA 2GEKA 1M33A 2I7DA 2ZRNA 1WW2A 1UPBA 5ALJA 4P7KA 1I4DD 2C5BA 4G2NA 3ZWQA 4GMGA 2WVJA 3IE2A 4P83A 3F3KA 4HQRA 4BFVA 1D07A 1I3NA 2E5WA 3JVEA 4IMIB 5HIMA 4Q9JA 3UTDA 2I87A 4LE2A 4MV8A 4B6EA 4BFCA 3DHEA 2H4YA 5IAOA 4Z7JA 3AKDA 2R84A 3H84A 2PH3A 2O2GA 4YQFA 1DINA 4ARAA 2RB5A 3R9WA 4RESA 3IHKA 2GD6A 2RBGA 4F5YA 1KY4A 1NAHA 1U2EA 1TW3A 4E7OA 5KS2A 1KI6A 1KJJA 3G0IA 4JT4A 3T7JA 1KQGA 3HHEA 3A31A 2H2IA 4O8CA 2ZJAA 4RK1A 1R0LA 3PFKA 3RRJA 2DE0X 4XPZA 1OTHA 1SUIA 3UW1A 2OHIA 5DOVA 1E98A 1WKVA 5TQ0B 3ML1A 1NV9A 5FBKA 5THKA 1HH4A 2CDCA 4B3BA 1PF7E 1Q74A 2JFGA 1DARA 1S1MA 2PKQP 5HF8A 1RWWA 1BNCA 4UPEA 1KYXA 2EQ5A 3OD5A 2FW6A 4IAOA 3N8GA 1SAYA 1UXGA 1MGPA 3QVVA 4L57A 4AMUA 2X9LA 3SKXA 4DXDA 2EX0A 2X0RA 4IBOA 4MPRA 4R1OA 2F3UA 1TK9A 4ND4A 3WBKA 1AXEA 3FD8A 3I6YA 4D1YA 4MPPA 5FA6A 5HFNA 3TJRA 2JBAB 5ALTA 4KQEA 2O8DB 3BAFA 3ZD8A 1KH2A 1ULHA 4L3WA 3UV3A 3VSDA 5FBVB 1MZPA 3EVGA 3A14A 4IXNA 2EW2A 1EU1A 2HGSA 1TX4B 5EMLA 4Y2VA 1EM8A 2OO5C 3HHPA 1U04A 3HKBA 4IXMA 1OSNA 4MEJA 4LNUB 3LLUA 3OE5A 2ZTSA 3N7AA 3CE6A 4K0RA 3SM3A 5BRAA 1B0ZA 6Q21A 3IAS6 3K2BA 3WKBA 4M1TA 2C0PA 2PT9A 3GPCA 4QBKA 1E2JA 3IQZA 1QPBA 3W2TA 2VAVA 1HLFA 3SHFA 4F06A 1R6TA 1CD5A 1GPMA 1ZBQA 1NXOA 5J59A 1YRYE 3FUCA 3FYUA 5G4LA 4LRUA 4CHGA 1A1SA 4M1YA 1Z8HA 3PEUA 4HFRA 5ICCA 5H3LA 2I6UA 5A2GA 4DCUA 1F51E 5ALHA 2ACVA 2PVSA 3QYFA 3WMWA 1V3VA 5I7EA 5FLKA 5KEIA 4BB9A 2VHTA 4LHVA 1OXVA 3DE5X 1JYEA 5JJLA 1K63A 3BCHA 3H6GA 4YCAA 5CVEA 1I5RA 1T3TA 5IKXA 3IODA 5DH9A 5TVGA 1EWYA 4X6XA 4DIKA 3OTOB 1KMMA 1IWPB 2C7QA 1IZYA 3G5MA 3VR3D 4GF5A 3F9RA 5BXQC 3OTQA 3OCUA 3M5CA 4QVGA 1ZM7A 1P91A 1ZNQO 2Z3ZA 1G2IA 2O8VA 3H75A 1FTWA 3B89A 2WK1A 2WYHA 4BEVA 4Y9TA 4V24A 1JFTA 3FG9A 4CIDA 2H5EA 2AFHB 5LR6A 2GEVA 5I45A 3L3BA 2X86A 4D6PA 3CPSA 4HJXA 1I4WA 1UFQA 3CN7A 3HYCA 4Q24A 4PIVA 3LPDA 3FNIA 2EFCB 2YN4A 1SKMA 2QP4A 1L8AA 4Y2JA 1I51A 4C7KA 5JDIC 1G0NA 1EK0A 2B61A 2UU9B 1QRSA 3RVOA 4YDHB 4XWGA 1DWPA 1THTA 4WA8A 2FPMA 2NVUA 4Y18A 3MS7A 4L07A 3F9CA 2HV8A 4WDRA 3ELYA 3MAGA 3M9WA 1YOVA 1M8GA 4G4JA 1ORWA 1NYTA 4FZ3A 5KIAA 3DLPX 3BXPA 1BVRA 1UM9A 1USKA 1RQGA 3RTEA 5HQ3A 1B7GO 4S04A 4Q37A 1U0FA 3JYNA 5BSKA 3WGLA 3KYCB 3KETA 3V8MA 3CLTC 4YN3A 1Z5PA 4DDMA 2Q21A 1RC1A 3ZDZB 1GRNA 5FWNA 2Q1XA 2ETVA 2VF8A 3ZZNA 1NG1A 1QGYA 2VNIA 3KKEA 2M6LA 2AZ4A 4R2KA 1Z12A 1GGMA 3NVMB 4LS3A 4WOJA 4ZD6A 2AL7A 4M88A 1FC0A 3I92A 3AILA 1MB9A 5JV5A 1AS0A 5GONB 1X1DA 5AICA 5AM1A 5JXGA 5J23A 1QORA 1MO5A 3A6FA 1DZ3A 3RE1A 3UJHA 4D0LB 1ISHA 4QZVA 1C3OA 2N47A 1E20A 4J0IA 4XD7A 3FNFA 3ZWYA 4AP5A 3AP3A 3TRFA 1G3RA 1JHVA 3T4UA 3VR4H 4MS1A 4AXBA 3CRRA 2YN2A 2ZIXA 1NVWQ 2F67A 2UYCA 3QPDA 3S2FA 2P4HX 3CF4A 3EGXA 2CUNA 2E4UA 3GLIB 2IEIA 4NS4A 4WSOA 3JZDA 4JLOA 3WKAA 5HX7A 2QTHA 1TAHA 2Z8YA 1OYWA 4PTZA 3RC1A 4ZT6A 4Y9DA 3K6SA 1Y9DA 4A5OA 1IUOA 1YQWA 3RUHA 3HTXA 1M0TA 4EHDA 1DAHA 1VLMA 3TLGA 1U1DA 2DQ4A 2ZTLA 2NZUG 2ODQA 1SUEA 3ROTA 3UFBA 2NIPA 3B1XA 4RDXA 1YASA 3T5AA 1R0RE 2YVKA 3GLHE 1MFZA 1QV6A 4O5AA 4RK0A 3NT5A 4DLTA 4QFCA 1DTEA 3G85A 4LXGA 1MB2A 4IFBA 5HDQA 1XCJA 1EINA 4Z4GA 1ZU5A 4J76A 1F0KA 3L2OB 1LSOA 1UJ4A 2NQTA 4FW9A 1NQ5A 4DT1A 2HXGA 1U6KA 4UAUA 1KO4A 3BMNA 3UJBA 2ZVQX 3BTOA 1Y4AE 2R7AA 1KZ1A 3NFRA 4MVYA 1LH0A 2OXEA 3KQMA 5BOSB 2D1QA 4N3AA 1YIDA 3QVGB 4CXMA 1GN9A 3Q7PA 1FVOA 4YTEA 2BEWB 3T7DA 4DS3A 4EGQA 4MW0A 4YGXB 5D86A 1BWRA 1NOIA 1Z6GA 3EQ2A 3TZLA 5CEFA 4BO2A 5GIPE 1H9AA 4EA7A 2NQ2C 3T0GA 3DFKA 1RQNA 1H5UA 2CMDA 4GBMA 3N6VA 2XYHA 4NU5A 1OA1A 4ZAGA 2I78A 4UM9B 5ELMA 3ES9A 4UVGA 1PZFA 4A16A 4TTSA 1DG3A 2W83A 5C2JB 3UMFA 1AK9A 2P77A 1TI7A 2Y0DA 3ESDA 1VFNA 1KYZA 4L6CA 2PO5A 4NMHA 2NU8B 4XQEA 1PKXA 2DPYA 1Y1QA 4D9MA 4HRVA 4RZIA 1BW9B 4QPZA 2PH5A 2IKSA 2EYUA 3ADDA 3RGGA 1MJFA 1XZDA 2EL7A 5CIQA 4D46A 1O9GA 1SBNE 3TW6A 1CULC 5IWAB 5LP6A 4O25A 2FN7A 3P0IA 5IP5A 3EZFA 3AVWA 3OCCA 4CMIA 1MX1A 3M4NA 5F3WB 1A27A 4R1UA 3REQA 2JGFA 2B4RO 3UHPA 1ZITA 1L5WA 3GRRA 5EXSA 3M3DA 4R05A 3DMGA 3OJEA 3UBTA 1F0YA 3RSSA 2QA5A 3GHYA 2ANBA 4Q66C 2RJNA 1X1CA 1XLWA 3DEJA 4JYAB 1A7AA 4Q3BA 1V8OA 1MBZA 3PJRA 4OGLA 3GT0A 2ISQA 1IQRA 3QEJA 3P7MA 4LOHA 2JIBA 5B5SA 5L3VA 4C5BA 4ZC8A 1VMAA 3KUUA 1UQUA 1ZOPA 1RBMA 2GAAA 1A7JA 1R0CA 3E3AA 5HTKA 1TO2E 5LDHA 3R6GA 2BFCB 3N0TA 4EW2A 1E6UA 1YQTA 2AMLA 3UAXA 3EGOA 3KRTA 1JG3A 2JCSA 2YJZA 2DLNA 3CS3A 4URUR 2P27A 4UC0A 2ASEA 1PGNA 3QVMA 4KXXA 4RQTA 5LOVA 1Z56C 1FCJA 3CNNA 4GMDA 4MRSA 3G6KA 4LRWA 2XCQA 1ZD5A 2I3ZA 1MX3A 3S40A 1GUAA 4Z4EA 1QIDA 3PR3A 1XMIA 2AVNA 2HQ1A 5JS2A 4BZQA 4HTFB 1WXIA 4CG2A 4QULA 1II9A 3B3AA 1XWWA 1ZUHA 1OXTA 5COBA 4XYBA 4BLRA 3R0JA 4KIJA 1REQA 3LI2A 1K6XA 4HS9A 4DMUB 2AGVA 3UHJA 2FKNA 2RCNA 4PQFA 3P9RA 2PXAA 1ZOOA 3MN1A 1EDDA 1OWNA 2X3FA 5TNXA 2JJMA 3NDJA 4CWAA 3USZA 1OKKA 5CFRA 3K53A 3L6UA 3EXAA 2SNIE 3HJNA 4OGKA 3DT9A 5KTYA 3K8OE 3LBFA 5BN3A 1NAIA 4IDPA 3CJQA 1XZEA 3FNBA 4L3VA 4YA6A 5JIBA 1YVDA 2D74A 5FFNA 3X1ZA 4P38A 5TMPA 4R2JA 3N2NA 4ETMA 5LA6F 2OZKA 2YRXA 4UTOA 5FBLB 2QY6A 5AKGA 4FHZA 3RUCA 4JXXA 3ZU3A 3O3NB 3KJHA 3LA8A 2A3NA 4X66B 1DWOA 1ZY2A 3L0DA 1XFDA 2Z98A 4HRYA 1MV8A 4AJIA 4ZGWA 3L7MA 3BFKA 1DAGA 1I32A 2VDWA 1V3TA 4M37A 5EUBA 2ZS9A 1EFVB 2BRUC 3MJRA 4ONEA 1HDIA 4CF7A 3SXUA 3A0RB 3IOMA 4OI4A 1J20A 1WXFA 3A7DA 1ADJA 2XLCA 3RRBA 3TOVA 1KZYC 2VLBA 1GZ3A 4YYEA 4HOYA 3OZIA 5EXTA 3ZWBA 3LZCA 5KX5F 3NDBB 3OX1A 4ABTA 3PJDA 4XTRA 1VPWA 3BBPA 4OHKA 1GKYA 1DX6A 2MMCA 2OHHA 3BSYA 3BYZA 2JIZD 3DPUA 3DOEA 1NYLA 1IDOA 1V3QE 5JYBA 4P53A 4CLOB 1SKYE 3HM9A 3OH8A 3WR5A 2BE9A 2NVBA 3AHEA 1P9RA 4IV8A 1N2CE 3ZCSA 2RKBA 4RKYA 3HFRA 3U7JA 5IEJA 1Y63A 1S9DA 2ZR8A 2ECFA 3ETDA 2PE5A 4HR7A 3ZU6A 2VN8A 4RVHA 5J63A 1PV4A 2FWJA 3OCWA 1HFKA 3ZWKA 2YY5A 3FMGA 4I9HA 1OYOA 1IXYA 4AN1A 4WACA 3FWHA 2FSUA 1XQXA 2AOTB 3H3FA 5AK6A 2ZI4A 5AW8A 2YQ5A 3M3PA 3SJBA 4ZCRA 2B30A 3L1HA 1J90A 1XJQA 4D0SA 2MSWA 1WUHS 2BM0A 4XGRA 3VSEA 1KSHA 3WK8A 1COWA 1GZ4A 2A4KA 1QQTA 4HAIA 3W6UA 4CTKA 1TJPB 1KGDA 1ZLYA 4O2BA 5C81A 1SK8A 1F12A 5CJ2A 3NGXA 4CZ2A 3KZXA 4JP2A 2XMZA 1O94A 3GVCA 1W76A 2FSIA 2GK3A 3IUYA 1EDEA 3D5EA 2PX6A 2F3QA 1TA9A 1V6AA 2P9ZA 4W99A 3O8QA 3L6OO 3VKUA 4UTPA 2PLRA 1QDUA 3GJ3A 2HRCA 2QU8A 2EZTA 1M5RA 5TEWA 4C2UA 1H2AS 2NQ8A 1E3WA 3BFXA 1EDOA 3MJDA 4KAXA 5AVTA 4HGQA 1C80A 4QGAA 4WY2A 4BU1A 2Y3IA 2OE2A 5BUSA 1U0BB 4F21A 1GL6A 3V4ZA 3W9UA 4BGIA 4DV2B 2BV3A 3B20A 3FPLA 5DISB 1E4EB 3RYHB 1K98A 1MA3A 4HGYA 2AR0A 5FWAA 4OI2A 3I5YA 3KL4A 3TCXB 4C0HA 2P79A 5DP2A 3HB5X 2DY1A 2PMDA 2RFLA 4MS4A 4XSHA 1CEYA 1U1CA 2BZGA 2FUG6 3U62A 3RUPA 2OENG 4UHFA 4AS2A 1FTGA 2FW7A 4KWEA 4EJSC 1PO7A 5IKPA 2HTEA 1D6SA 4LEIA 1ZGJA 3PL5A 2HHHB 1VTKA 2GN4A 2YJ6A 4INPA 3OO1A 4M60A 3C4VA 1JHDA 3FGZA 3DZFA 5JQWA 3VX4A 2Y76A 1SQSA 5IDXA 2PXHA 3KB8A 4R2WA 4GQIA 4HSEA 5H70A 3GRZA 3PCTA 4TQAA 3R3UA 5G41A 3HN7A 4DLRA 5EJ7A 4IH9A 3F6SA 2OQVA 1EG7A 2ZQ5A 3NTVA 4L0MA 3ILYA 3WGQA 1E62A 4JJIA 4RIHA 2HJHA 1WZEA 1T5IA 1ZK3A 2E4ZA 3C41J 3DB1A 3VTFA 4BECA 1C30B 2FG5A 3KJGA 1OVGA 1ECPA 3FLMA 3D3WA 3E7FA 4OB8A 3YASA 3TZKA 2W93A 4UOQA 3D8SA 3N0VA 2NV2B 4MDEA 4ADSG 4IDGA 5I9BA 2J3LA 3CISA 4LGCA 1VI6A 3MT0A 4EI7A 3U3ZA 3GI1A 3IBCA 5EZ6B 4KIWA 2GDJA 3GA5A 3I72A 2VP6A 2O0HA 3O4IA 1EVEA 3EIFA 3LCVB 2OPHA 5LXTF 1K8XB 5AKXA 3QW2A 3ZI4A 4DLAA 5KVSA 4OXIA 5K0BA 5JEEA 4R2HA 3GIWA 3K4QA 4C3UA 4PWYA 5FNVB 2WAXA 4OA8A 3W5IA 3LBNA 4Q7QA 3S2UA 1B16A 4TYPA 4LOAA 3BMOB 4TTIA 1YB2A 2QRVB 5FAXA 5TY0A 2VP5A 4FYHA 5AW7A 4UQPA 4ZU3A 5JHHB 2KLBA 3GGOA 1VLLA 3O4HA 2KW5A 3G02A 5EYPA 3UWKA 3NTRA 1T5TA 2BKVA 2B34A 2ZS8A 1GZDA 2PL1A 2NT4A 3RIXA 1I4TD 2HL6A 1GL3A 1SG6A 3ZWPA 4H6PA 1W6RA 5DYYA 4Z0NA 1A2BA 1SU7A 1W59A 3GWZA 5B6IA 3IIMA 1U98A 3BTSA 1HT2E 3N3BC 4BTVA 4ZTUB 5DBEX 3B3GA 2AC7A 3ECCA 3F9IA 4JDPA 2IX9A 2M2IA 4YJ3A 5IT0A 4D3XA 3C6XA 3U1VA 2RGEA 4BLSA 4BRZA 2C4KA 3NYQA 2XUDA 4BQOA 5EJGA 5EKDA 4W1PA 4CM5A 3BIFA 1OC2A 4ZQBA 2BKUA 1LNQA 1NVDA 2OHVA 3EF0A 4GOLD 1NMEA 2Q4OA 2FPXA 1RI5A 2X6RA 2YW2A 3IT0A 4EUFA 2JFQA 1N8NA 3DG9A 1RYFA 1YR8A 4DYDA 1JIVA 2DLCX 4ZVPA 2H1VA 2YXBA 1FJXA 2VI5A 1JDSA 3NGLA 4P4SA 2J4DA 2XE6A 4YUAA 3MCVA 3BXZA 2JJ1D 3RRMA 4E2WA 4KXLA 1RZ3A 2ES4A 1FFEA 4D4JA 3ETJA 3P9PA 1MRNA 4NAVA 3D7NA 3GG9A 4HH1A 4ZP1A 4AQDA 7ADHA 3GAZA 4Z7NB 3W3AA 1S7CA 4CLRA 5K2OA 1WUYA 1WV1A 3A1DA 2GJ4A 5K6RA 4IJQA 5G40A 3RIYA 4WESB 4A03A 4BB5A 1PT8A 3ZVNA 3FJOA 3IBYA 3ZR4B 4Z4QA 2AX4A 1RBQA 4NU6A 2PQ6A 5PGMA 3EH2A 2BN4A 3RWBA 1JFLA 1K86A 3SFTA 3VPBA 3KE9A 4BJ5A 5CFOA 3F3YA 2PGIA 3R7WA 4C1NA 1M1YE 3PGJA 3QJ5A 4I5DA 4JVOA 1DJNA 4D9BA 4FYKA 4OI1A 3UHAA 4AIRA 4Q34A 2Q5EA 3VO1A 5EPOA 3FLBA 4OYRA 1CUDA 3UUWA 1GL7A 3PJEA 4U6NA 4ND8A 1J0XO 4RNDB 2I7XA 5JFGA 2BEVB 3ZTWA 4FI3C 2RHLA 1UPUA 4ZYZA 5EJ9A 1ODFA 3D1JA 4WTOA 2I29A 1QO0A 3KWFA 4BV3A 2H9AA 1JBQA 2WR8A 5G4KB 3TBFA 2A5LA 2VL7A 5L4SA 3R7BA 1YQ9A 3TXXA 2PSEA 4L78A 3OP1A 4TLDA 2QR5A 3OFKA 4OHXA 1XRPA 3T5BA 4MQLA 2OUIA 3W2HA 2VK1A 2WHEA 2PGJA 1AUOA 1PT9A 1U5CA 1V96A 2AQHA 2RJOA 3EZ7A 1UPTA 1C29B 4J4HA 2JG3A 5BV0A 3KFVA 4G8BA 5EZQA 2C8KA 1U8TA 3THXA 2CFRA 2CE2X 3H1TA 3ICPA 4JHXA 3V7UA 1E18A 1ZMOA 3BH6A 4B4WA 3RKSA 1E9RA 4QTZA 2WKPA 4OQQA 5JXWA 1P72A 1DFHA 2NG1A 2X8WA 2O3JA 1Q21A 1YZUA 3CGGA 3DHVA 1G1MA 1NNUA 3OZTA 4BNXA 3FROA 1OWPA 3P9SA 1L7NA 3KZOA 4LE1A 1YQXA 4B3XA 3WXBA 1IM2A 2VK8A 1VLHA 2VS1A 1H2XA 1Z88A 3I9LA 4B6RA 3VR5H 2R68A 3K0AB 1ZD3A 2WD7A 4TWRA 1VB5A 1HDYA 1VG8A 2R7KA 4O4JB 4B7AA 1VSVA 5CW1A 4UZFA 1QGOA 4KQFA 4FKMA 3VHQA 3G1UA 3OI7A 1AKEA 1MDBA 2BHTA 2QMZA 1XYGA 3FW1A 1MF7A 4JELA 3FKQA 4M89A 2O1SA 2EFEB 3L9XA 3VUFA 4DG9A 5A3JA 2QEQA 2ZS7A 2E1RA 5BQ5A 3ICEA 4CFSA 2SICE 4PPQA 5JBQA 4L9WA 5ELXA 4HB4A 1FX0A 1CJSA 3AFNA 1USVA 3OEHD 1R7RA 5BW6B 3CF0A 1H1LA 1TEZA 4B09A 1HE8B 4PHFA 3DLAA 1DXOA 4MCAA 3SY8A 3RVDA 1TA0A 4FMDB 2C5AA 4LRSB 5E6RA 5ARDA 4TS9A 4HZUB 2QUJA 3CJRA 3N6RA 4E6EA 1N3LA 5K0GA 3Q12A 3GUHA 5FBRB 3TAXA 3EZLA 3BL6A 1RW4A 4GSLA 2NUBA 1KAOA 1RKVA 1XMJA 2H5IA 3CR3C 1GCIA 3D4PA 2ZJZA 2AEMA 3SYTA 3EF1A 4PZZA 3UK2A 2ADMA 5HUJA 1JHUA 3IRVA 3V8RA 4UEQA 4B43A 5TT1A 2RK3A 2XUQA 2X2OA 4YRCA 5JS1A 1VHDA 3RFUA 1EAYA 2C4MA 5IJZA 1JFSA 1IK4A 1FX1A 3AERB 3RC2A 5K2MA 2ZOSA 4EF4A 3IMFA 1IUNA 5JAZA 3O8RA 1M73E 1MO3A 1VLVA 5TARA 2JJQA 2ZITA 1FQJA 4TMTA 2QMQA 4KR3A 4XUCA 3CUEF 4OUDA 3AEKA 4ACAA 4CQLA 5EHQA 3VU9A 1O1YA 3VVBA 1HRDA 4JXJA 1XA3A 1K0UA 2ABWA 2ORYA 1TKRA 1WNTA 3EXIA 3PS9A 2QRUA 1N5RA 2B99A 1XZBA 2ID8A 4EPWA 1YDMA 2Y1KA 3HXKA 1C7RA 1MAVA 5FBQB 5LB2A 4CKWA 1DP4A 2ZETA 2NUTB 2OYRA 4PW0A 3VNVA 2CXSA 2WYIA 4P31A 9ABPA 4MGKR 4DMFA 3BFPA 3G8BA 2CXOA 3VX3A 5JQGA 2P3OA 3SZ3A 1IE3A 3W2GA 4BBPA 4D79A 1Z08A 3DWIA 5JI3E 3A05A 3P9YA 1WB6A 5EIBC 1SQFA 5AIBA 2BMAA 1ABFA 1VG1A 4JVSB 1SNYA 4FYMA 5KCMA 3TEFA 3RUAA 3GFPA 4IIVA 3HCDA 1VPTA 4HUQA 4MWSA 3CCBA 4LJ5A 4RYLA 1M7HA 2PR7A 2D1YA 4M0FA 2COKA 1W1IA 1RSZA 2FWBA 1QKJA 2VPIA 3I5AA 4PAWA 2C96A 2ACWA 5EJEA 1CQPA 1VE5A 2PS3A 4GDMA 4JZKA 4UNNA 4ZOBA 4ZCIA 2NMVA 2LWIA 1F8YA 1XMXA 3JD0A 4LVOA 5A9TA 4LXYA 1W73A 1NV8A 1I80A 4YMUA 1PJ2A 3OIUA 2FP4A 5C4IA 3DO5A 3V34A 2ZKIA 3KPUA 5IKMA 5L3QA 4RNCA 2C07A 5MFZA 4LHYA 3LD9A 3RRXA 1W0KA 1P80A 5I9SA 2BCGY 1S2MA 2RIRA 1CUXA 3F71A 621PA 1GTL1 2PCJA 3AF6A 4HPXB 4O3FA 3R8XA 4JT9A 1MO4A 3EHDA 1M6NA 1O3YA 2VHYA 2NNWB 2DGDA 1B43A 1U1EA 3G3EA 3BGWA 2NPIA 3C4QA 3KUXA 1I13A 4YMHA 3HCFA 4FMCB 4LGYA 5DMXA 3VAYA 5KMGA 5IM4F 3SDBA 1A7KA 2H1WA 2WSMA 2OLKA 1M6WA 2KQUA 1TVEA 2WTBA 3L7IA 4BNZA 3UPTA 3GUYA 4ZEWA 3KQNA 5J58A 3GMDA 3RSZA 1OLUA 3HLYA 5C80A 1O97C 2IUUA 3BZUA 4BQRA 2DZDA 2G9NA 4YXFA 2X40A 2AZTA 3F6CA 1NZFA 2W6JD 3LQ2A 3NTUA 2XW6A 4H7IA 4Z8XA 4ZZ1A 5CNIA 2B82A 2XAUA 4ROTA 3QFFA 4MLDA 1SHJA 2ZSKA 1Q17A 2AR9A 3N2GA 4M54A 3MD9A 3GLQA 2YJTD 4M7OA 2YWDA 2V7QA 4O4JF 1IBMB 5CNKA 3I9NA 1QLHA 2DHQA 2ZSAA 4MHSA 3ZHOA 2J3EA 2Y66A 5AHXA 3EVFA 1VYTA 1QIHA 2C2ZA 2IQIA 5CLJA 3RFFA 2GO1A 4WBNB 1BIFA 1YC5A 2HAEA 1BO6A 1Y8CA 1TRKA 3M6IA 2AOUA 3V7YA 4BGEA 4I50B 1C0KA 1LSSA 3HA2A 1ELOA 1LX6A 4IIJF 4JLDA 4POAA 5AVQA 2IH2A 1E2HA 2PY6A 4FMDF 1NXQA 3TLKA 2B4AA 4B8YA 1H5NA 2J07A 1ZMRA 3JQBA 3UK6A 1M6YA 3GR6A 3H8JA 4PAOA 2VDRB 5LB4A 5J2UA 5DHTA 1TGYA 4NU0A 2RHHA 3TG8A 1QTNA 5CB8A 5HRUA 3FTPA 4B3SB 1SU4A 4EY5A 4Z0PA 4Y1RB 1BN6A 3GEDA 1G66A 4S0ZA 3JQFA 2NTYC 5KKCA 2H0AA 3VYWA 3EDRA 1A72A 1X7GA 2EV9A 2GUGA 2XD4A 3KM0A 2Z0MA 2FRXA 3C7TA 3EUFA 3E9QA 1R37A 3MMXA 1XD2B 2GEFA 4I4LA 3PDUA 5IG2A 1IONA 1T0JB 5FOWA 4DLBA 1XF9A 1BD4A 1OXBB 1TYEB 2PRZA 2VA8A 1BDMA 2P6OA 3FR8A 3KL2A 3LOPA 5AKEA 1N5IA 3P2EA 3PEFA 2F9LA 3VPHA 2GPBA 4BHTA 1H1DA 5TPWA 1B6SA 1ZLXA 2CLEB 2OB2A 4NP6A 1OBOA 3WYDA 4E88A 1OV4A 4IGKA 4QO8A 4TRMA 4PLTA 2AVDA 3JQGA 5ICEA 3R3ZA 4DQLA 3HO6A 5D5HA 4B79A 1ZNXA 3VI4B 3G79A 2BIFA 1H3FA 1Z3IX 4QDJA 1D8TA 1SCDA 3LRXA 2VNHA 3A1CA 4OHWA 3UJDA 1VZ3A 2PVPA 2V7XA 3FMVA 2WU8A 3AVYA 4IVPA 3V8VA 1G98A 3QM1A 3H99A 1XZHA 2J3QA 2JANA 4GVLA 1QZTA 3WAGA 5K8LA 2ZBVA 4J75A 2WB2A 2J5XA 1B74A 4CE6A 2H2WA 4C6TA 2CKDA 2JCXA 1Z6TA 3GY0A 2TS1A 3GEHA 1PL0A 1DFIA 4M1WA 1NONA 1O5TA 2WHPB 4NBTA 2A9FA 3TE7A 1I7QB 3NOOA 2DKNA 2NYVA 1N6HA 2Q29A 4HGPA 4UPDA 5EJ2A 4ZVOA 1ZJ4A 1N57A 2OMKA 4WWHA 4ZGBA 2VAMA 4IFIA 2XCTB 1NXSA 2BZ1A 3DOHA 2R1UA 3O26A 1R0ZA 2JEZA 2JLSA 3BVPA 5YASA 4E46A 5DN6A 1KZ6A 1GZHB 4Z3DA 2JJYA 1GSOA 2GASA 2D0OB 2GDZA 4HFNA 2WJ4A 2GPTA 1DELA 3BGDA 1V1RA 4R8RA 1W9MA 5GPBA 1KI2A 2XYRA 1NTRA 2QSUA 3MWKA 3GG2A 2NTVA 4GM1A 1PSZA 2PD4A 3MC1A 3AHFA 3PQEA 4G84A 1UK7A 4FKZA 3L4BC 1AURA 2GCGA 4BCDA 2VP0A 4IIDA 1NBWB 1YHYA 2RGNC 4H4CA 5AJHA 4H9GA 3X0DA 3ZV6A 4EGCB 3P4UA 4MUJA 2ZUFA 1KP9A 3O3OB 1IMJA 1WTCA 1E2DA 2O52A 4EPYA 4FCVA 3KT0A 4Q3LA 4B17A 4DJTA 3L6BA 1DQPA 1MVNA 1SBIA 3D6NB 4NRDA 4QYSA 1UDXA 3ZEIA 3ZY4A 1XYYA 4BFYA 2JFUA 1T4DA 3O93A 3K09C 1WMAA 5SZJA 1J09A 1NQTA 1PD0A 1RJGA 2F8TA 4GU5A 4RHFA 4ZU1X 3RTBA 4DMMA 3DC2A 4MGEA 3EVZA 3GDWA 2YWRA 4Y6LA 1VJTA 5I01A 3ISVA 4D5GA 3EQ8A 1WF3A 2YFYA 3FBWA 4FR0A 4U02A 3SQMA 5IXSA 3LCUA 4LYGA 4WINA 2QGNA 5IHPA 1N78A 2ZYSA 2HWYA 4N6OA 1E1YA 1ODKA 3ABZA 5DT2A 4CM8A 5THXA 4Q1DA 1AQJA 1K88A 2BD0A 1G7RA 4R0NA 1E7RA 4WZAA 3ZXYA 1Z5ZA 2VZEA 4MV5A 5DE3A 4CI9A 2WIGA 2DWQA 5K3CA 2VPWA 5CX1B 3EH1A 1DSSG 3F3SA 3W4KA 3ORHA 4CMEC 3H4MA 4RV9A 2X5XA 3Q3GE 3FZNA 3T06B 2XH8A 2XMBA 4KP7A 1PLKA 4ZT7A 5E1BA 1A4IA 5FOVA 4ZCLA 3SLGA 4W9NC 1S8AA 1VP3A 4H4EA 2UDPA 2VUIB 3HVUA 4Q48A 1Q0SA 2CZGA 2QX9A 1MHPA 4OVKA 3T95A 3EEOA 1V7PC 2I3AA 4LOIA 1I3KA 2X0EA 1WW8A 1QU3A 1IN1A 4I3HA 4IXTA 2PTGA 1KBQA 5AI9A 2J9ZB 3V80A 2A9PA 4Z53A 4F5DA 1G1AA 2Q8QA 2H11A 3I83A 3PTLA 2IEYA 2B1RA 2OV3A 3QFRA 3QV2A 1L5NA 3RKUA 5DU2A 3AVOA 4DPMA 3I4FA 2WE7A 1PRYA 4N18A 4W1SA 3IUPA 5B58T 2PUEA 1JG1A 5FEUA 1RRFA 1GLGA 3C1AA 3ZWAA 4AG3A 4HV4A 1QS0B 2RSLA 4FFSA 5ULLA 5HILA 1N3IA 2PCLA 3LQRA 2ZRKA 4XQCA 2TMGA 5GOTA 2A6PA 3DGEC 3WOVA 4O59O 3X2FA 7REQB 2PTHA 3SMVA 4K40A 2RH5A 3ESBA 3NJ8A 3OM9A 3EWAA 2OCGA 4BIMA 3I42A 5CYFA 4X1YB 2UZIR 1WKCA 3E0QA 2FWNA 3OZSA 4NCJA 4IV5A 2R1TA 3ZX4A 4BFSA 3EIUA 2CV0A 2G9UA 2OFFA 2VYVD 2JFHA 3D0OA 3K0CA 4TXNA 2IVZA 2PJZA 4FDVA 2JHCA 2W9XA 3BWXA 4GOXA 2ECKA 2JIMA 4HNVA 5KNBD 4L5IA 2H4ZA 3O2NA 4EZBA 1QANA 2JBAA 3RU7A 5KYYB 2A14A 4JNCA 4D9NA 1CHDA 4FZRA 3BS4A 5EHIA 2Y0EA 3PI7A 2WPNA 2J3IA 1CUWA 3ZDXB 4CMAA 5M29A 3WQBA 4QGBA 5TDHA 3MTIA 4AL4A 1R4NB 3V6MA 5DM70 1VBMA 3KPWA 1P33A 4J43A 1I2AA 4NPHA 3ZE2B 4CIXA 4DG5A 3A2LA 3NORA 4P54A 4UOEA 1WNFA 2GCNA 4RCYA 5IJXA 4EI8A 3M7IA 2NOAA 5IF3A 3PGLA 4FN5A 3UICA 2B2XA 4BYMA 3SJZA 2YKGA 4CEJB 1XAHA 1YL7A 1KPGA 4NZMA 3B13B 4NBNA 2WA1A 1KORA 3GBSA 2YXNA 1PDOA 1Y8QA 3RVRA 3UAYA 3G0HA 3RUEA 3A6ZA 4DVGA 1OI3A 3HCCA 3TGWA 1IIBA 3SEFA 4OXNA 2A0YA 5FR1A 2JGMA 4PXAA 1AKQA 4G6ZA 5JASA 1VYVA 3B9RA 5AHOA 1C0EA 3MJEA 2GUWA 1CJBA 4E5UA 2QK4A 2F62A 2HJGA 2B20A 4C21A 3QUBA 3OICA 3TIVA 1KE1A 4H77A 2WI8A 4J0QA 5E38A 5D7NA 3E1GA 1E1NA 1FBTA 1GGVA 1MVOA 3AJDA 1IOLA 1J7JA 2DFPA 2IS4A 4QTYA 3TF5A 5KWVA 4JMLA 3GOHA 2XVAA 3ZY5A 2BONA 5CH8A 4GEGA 3B2QA 1KY3A 1SRQA 2Q2NA 2ZB3A 1EJ0A 2X23A 5G0TA 1DAKA 5EE3A 5C5CA 4KG7A 3O1IC 1U8UA 2P30A 4KPYA 4JODA 3MSCA 1FRZA 1G18A 2OBBA 4G0YA 4OXKA 3KXLA 3NASA 1H2ZA 1RVV1 1GDHA 4ARUA 2G36A 4EO7A 1EXNA 4MCIA 9ATCA 1ZCFA 3I62A 1HYHA 2ZREA 4B48A 2D0DA 2I55A 2Q45A 2Z2ZA 5CYOA 2BM1A 4EYQA 1R50A 2DBZA 4UU7A 3AF1A 3F8WA 3OZDA 3V1UA 2NZ8A 4QKQA 4ZI3A 2AFHA 1PT6A 1M5TA 3KEMA 3DV2A 5JWOA 1W36D 3ORSA 3I9FA 3GCXA 2WHRA 4CLDA 3K9GA 4MYDA 4MGHA 5DFAA 3BK2A 1LLFA 1QQ7A 1P0MA 1QVRA 3GFFA 2I1QA 3H2HA 3R6WA 3IUBA 1ZVKA 4OXYA 3Q3IA 3OLQA 3SDSA 1E6KA 2AZXA 4B44A 5K4AA 3G5TA 1G8HA 1ZH2A 2WP8J 4I5GA 4X20B 3DAYA 4RJ2A 4YK7A 4QSHA 5EUMA 2OV1A 2DKOA 4XIIA 4GKBA 3AKEA 4MKXA 2XR1A 2CDRA 1H3EA 1Z5VA 3A6KA 1RXYA 3UYKA 1N36B 3EYAA 1K6JA 2WEKA 5D3QA 3DO6A 3D4IA 4DNQA 3IT1A 4TVBA 3ZW9A 3MRVA 2OYCA 721PA 1EWRA 1BMFA 3KYCA 5KC9A 1XD8A 3DCIA 4FK8A 4N9QA 5TE9A 4BVJA 1AJEA 4AJ1A 4PQGA 2JLWA 3KQTA 2OVBA 4QQNA 3H83A 1DEKA 5F2KA 5JMWA 1LJ8A 3U4IA 3TTTA 2GWHA 1VI2A 3HUUA 2G1PA 2CL5A 3R7AA 1YBMA 4BQIA 1CG6A 4IS2A 2AKYA 1QIGA 2PBLA 1BHQ1 4K2HA 4M2LA 1LTQA 4ZI5A 1MJGA 2IPOA 3OM8A 2IYRA 3EGEA 2WTUA 5KYGA 2HW8A 4FS3A 2C7PA 2IBSA 3MM4A 2QPOA 4HN2A 2EJVA 4NJMA 1LY1A 3UGQA 4C0LA 2XGJA 1LX7A 3JAKB 3DEZA 1P9NA 3F5MA 4QGGA 1E5DA 3PXUA 4AUNA 2VHEA 2AF3C 4PS1A 3H13A 4DJ5X 1XF1A 3AHIA 2ZUWA 1QF6A 1H6CA 1AMNA 4FEEA 5LVAA 1IEQA 1ICEA 2A86A 4DR2B 1CNEA 2Z43A 3SEZA 3GLIA 1ATZA 1L3BA 4NV3A 4XX0B 1ADBA 2ZLBA 2X42A 4XSVA 3ETEA 5EKSA 4BATA 2Q1WA 2FCRA 3M34A 4LRXA 4HDQB 1XTKA 4MQ4A 1UOOA 3R09A 4C7VA 5CDSA 4XW2A 3HXQA 4A8JB 2XRFA 2EOAA 3WB9A 3GGCA 3EFOA 3ODPA 4PYLA 5F4ZA 3T94A 4FU0A 3W6PA 1U2DA 1QRUA 1OQAA 4OP1A 4CM7A 1L7PA 2CVZA 4ZJYA 1C7IA 4N8SA 3IIEA 3FBTA 1I5EA 1TM4E 3K5IA 4MUNA 1DKRA 1C4KA 1Z5WA 1U9IA 5DIFA 2VAWA 1S8NA 4YIHA 4RKEA 4JR1A 4UHCA 1QYCA 2XX3A 1TM1E 3EDQA 1E9SA 1ENOA 5E8RA 3V4OA 1EHCA 2R8XA 5KHLB 1GYRA 1N32B 3DYBA 1INLA 4FYVA 4NZ9A 3FJYA 4U2EA 4HGOA 1QO0D 5BOSA 1G4UR 4MCJA 4W5JA 2YYZA 4RZXA 1SUCA 1P2BA 2QL7A 3HWSA 2AG8A 3HKCB 4LY0A 3NNDA 4RL6A 4BX8A 2QXUA 1CDOA 4HNQA 4BL5A 1NDUA 5EOVA 1M76A 5BN5A 1MPTA 1Y1PA 1ZW1A 2OBXA 1RXCA 1XU9A 4Q1EA 1ZOLA 2YBEA 1Z8FA 3PBKA 3BXGA 6REQA 4H0NA 1FFWA 4IRXA 2DUUA 5JO9A 3H1FA 2AYYA 5HP4A 1FQKA 2C0QA 1YKFA 5DBHX 5DI3A 4BMYA 3R40A 1M1NB 4ZAWA 2A5JA 2PSJA 2WU1A 5JG7A 3UB4A 1JJFA 2VJBA 2C7BA 3L7NA 3KSZO 1B6GA 1QJ4A 2NU8A 5JPDA 2GVNA 2HOQA 2QE6A 2XVZA 3C3WA 2VZ9A 1BQ4A 3LOUA 3QVKA 4NULA 3ZWDA 2VPQA 3PGKA 4BU0A 4MI6A 5AVVA 3OO0A 2VHCA 1PJ4A 1Q83A 3A4VA 2I2WA 1XCMA 3IDSA 1CEQA 1G7TA 2XHEA 5J1SB 4FXOA 2P6NA 1VE9A 2GKSA 1HXHA 2IS6A 3HRIA 2DC1A 2GETA 3OCJA 1E4OA