4ODKA

Structure of slyd from thermus thermophilus in complex with t1 peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
156
structure length
153
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 34
structure length 153
sequence length 156
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odkA00
4JFKA 2XP9A 1YATA 3H9RB 3O5MA 1B6CA 2PPOA 2MPHA 2LKNA 4TNSA 2PPPA 4GIVA 2ZQTA 3TDBA 1FKKA 3KADA 4IQ2A 4TW6A 1FKGA 4O2TA 5DIVA 3VAWA 3UI4A 4JFMA 4TX0A 2XP7A 2DG4A 3O5EA 4MGVA 3IHZA 1C9HA 3MDYB 1D7JA 2F21A 5D75A 1F40A 3NRKA 2RUDA 3NTPA 3UQIA 4FN2A 3UQAA 4JYSA 3IK8A 4G50A 1FKSA 1FD9A 1FKJA 3O5FA 2RUCA 2ZQSA 4QIBA 5BXJA 3O5QA 2XP5A 3JYMA 1QPFA 1FKRA 3UQBA 2L2SA 2PBCA 2FKEA 2F4EA 1R9HA 4ODLA 4DT4A 1FKBA 4BF8A 4QT2A 1EQ3A 1BL4A 2XP3A 2XPBA 2Y78A 2DG9A 2OFNA 5GPGA 1P5QA 4U84A 3RGCA 4FAPA 2MNTA 2ZR4A 3O5IA 4GGQA 3CGMA 4G2PA 1J4HA 4IQCA 4TW7A 1FKLA 1FKIA 4ODOA 3KZ7A 4U85A 4DIPA 5HW7A 1NMWA 1M5YA 3TCZA 2ZQUA 4U86A 1ZK6A 4DRMA 4DZ3A 2M08A 4R0XA 2KO7A 5HTGA 1NSGA 3KCEA 1PINA 2RUQA 2D9FA 5I98A 4TW8A 4MSPA 1QPLA 1JNTA 3O5LA 4LAYA 1ZCNA 2XP8A 3O5DA 3UI6A 2LGOA 1ROUA 4ODPA 1W26A 4C02B 1FAPA 1KT0A 3UI5A 1U79A 4J4NA 4DH0A 1N1AA 2XP4A 5HWBA 4LAXA 1FKFA 5HUAA 2PV3A 2IF4A 2KI3A 3PRDA 3IKGA 1FKHA 1JVWA 1Q6HA 4ODMA 3OOBA 1YW5A 5HT1A 4JFLA 3TC5A 4J4OA 4ODQA 3GPKA 4DRNA 3KAHA 3PA7A 4DRJA 2RURA 4DROA 1J6YA 3O5JA 5DIUA 3O5GA 4W9QA 3O5PA 2RSEA 4IPXA 1PBKA 1J4IA 2LJ4A 2XP6A 2KE0A 1Q6UA 3RFWA 2JZVA 2KGJA 2ZQVA 4ODNA 3B7XA 3FAPA 1ROTA 3WH0A 5HKGA 1Y0OA 1KT1A 2M1IA 4LAVA 3O5RA 4DRQA 5HWCA 2F2DA 2KFWA 5HW8A 1F8AB 3ODKA 3EY6A 2VCDA 3KACA 3O5OA 1D6OA 3CGNA 4DRPA 4W9PA 3KAIA 5DITA 1Q1CA 1FKTA 1TCOC 1FKDA 1Q6IA 2ITKA 2N87A 4DZ2A 2Q5AA 3KAGA 4DRHA 2XPAA 1D7HA 4QT3A 1HXVA 2LPVA 2VN1A 4ODRA 1BKFA 1NMVA 2FAPA 1A7XA 3IKDA 3JYJA 4DRIA 2PV2A 3O5KA 2M2AA 2PPNA 4ITZA 4JFJA 4DRKA 2DG3A 3UF8A 4W9OA 3JXVA 1QZ2A 2MLZA 4LAWA 4NNRA 4TYOA 1J4RA 2KR7A 1EYMA 2MF9A 3KAFA 4N19A 1FJDA 2MLYA 2UZ5A 3LUOA 2ZR5A 2AWGA 3KABA 1D7IA 4JFIA 5HW6A 3I6CA 1T11A 4ODKA 5J6EA 1JNSA 3NI6A 1L1PA 2K8IA 2RQSA 2ZR6A 2PV1A 5B8IC 3PRBA 2MLXA
chains in the Genus database with same CATH superfamily
4HARA 1NWUA 3O5MA 2PPPA 2PN0A 2B31A 4ML4A 1XRVA 1FKGA 3VAWA 4JFMA 4TX0A 2XP7A 3O5EA 3IHZA 1F40A 3GTYX 3UQIA 1FFQA 3IK8A 1FKSA 2FDMA 2DT2A 1GRJA 3O5QA 4AY1A 2YBUA 2PBCA 1SR0A 1H0GA 2XP3A 2Y78A 2OFNA 4W5UA 3ARQA 3RGCA 4FAPA 1VF8A 2MNTA 4GGQA 4G2PA 4MTVA 4S3KA 4U85A 2B5UB 2DSWA 3GU0A 1H0IA 2ZQUA 1NWRA 2KO7A 3KCEA 2D9FA 2DSUA 1HKIA 4LAYA 3ARTA 1K9TA 1X6NA 3FY1A 1U79A 1N1AA 4LAXA 2G41A 2KI3A 4L72B 3OOBA 2WLYA 4J4OA 3GPKA 3PA7A 2RSEA 1J4IA 2IUZA 3FAPA 3RM4A 2YBTA 1KFWA 3ARYA 1Y0OA 2M1IA 4LGXA 1EIBA 1OWQA 5GQBA 1F8AB 4Z2KA 1OGBA 3O5OA 3CGNA 1UR8A 1JNEA 1HKJA 4W9PA 5DITA 3AS3A 1Q1CA 3BMBA 4DZ2A 4DRHA 1D7HA 2LPVA 3WD3A 4QZVB 4WKFA 4DRIA 1OGGA 3O5KA 3PRAA 4DRKA 3CHCA 3W4RA 1IX5A 4WKHA 3JXVA 4NNRA 3CZ8A 1J4RA 3KAFA 4N19A 2UZ5A 4KR0B 4JFIA 3PR9A 5HW6A 1D2KA 1JNSA 3NI6A 4XAKA 2ZR6A 2OLHA 1ZBWA 3ARWA 2XP9A 2MPHA 2DT0A 1FKKA 4TW6A 4IQ2A 1C9HA 3MDYB 4JYSA 3BXWA 1W1VA 2RUCA 4IT4A 3JYMA 1FKRA 4Q22A 1HJVA 2L2SA 1R9HA 4BF8A 4NZCA 4QT2A 1HKMA 5GPGA 1LG1A 1W9VA 4TW7A 3CGMA 1J4HA 1JNDA 3WD2A 1CTNA 1FKIA 1E6PA 3AS1A 1NMWA 1M5YA 3TCZA 2PI6A 3CHEA 1ZK6A 4DRMA 3B8SA 4TW8A 4P8VA 1QPLA 1LQ0A 2XP8A 1WNOA 3O5DA 3WKZA 1ROUA 4J4NA 4DH0A 4WKAA 2PV3A 4PTMA 3PRDA 4ODMA 2A3BA 1RD6A 5HT1A 4DRNA 2RURA 1LJYA 3EIPA 2O9OA 2AOSA 5DIUA 4W9QA 3O5PA 4MNKA 1ZBVA 4P8UA 4MNLA 4WK9A 4IPXA 3RFWA 2LJ4A 2KE0A 2KGJA 2DSZA 3ARPA 5HKGA 3AROA 3O5RA 1ZBCA 2P4VA 3ODKA 3EY6A 5JH8A 4R5EA 1D6OA 4DRPA 4MPKA 4WJXA 4MNMA 3KAIA 2N87A 1FKTA 2Q5AA 1LL4A 4URIA 1HXVA 1NMVA 2A3AA 2FAPA 3JYJA 3ARVA 1HJWA 2PPNA 3WIJA 2DG3A 2A3CA 4TYOA 1EYMA 1W1PA 4ZPTR 4Z2JA 1FJDA 2MLYA 3LUOA 2AWGA 3KABA 2DPEA 1D7IA 2O92A 3I6CA 5DEZA 1L1PA 2K8IA 2PV1A 5B8IC 2QF8A 3H9RB 4TNSA 1ZBKA 2PPOA 4WIWA 3CHFA 5DO2A 3TDBA 1NH6A 2DSVA 1HJXA 1NWSA 4P8WA 4MGVA 3B9DA 3QOKA 1D7JA 2F21A 5D75A 1FD9A 1FKJA 3O5FA 2ZQSA 5BXJA 4HBEA 2XP5A 3UQBA 4NSBA 2FKEA 2F4EA 1FFRA 1FKBA 2ETNA 1TFVA 4U84A 4IQCA 1FKLA 1NWTA 3WL0A 5HW7A 4MAVA 4U86A 1UR9A 3WQWA 1PINA 5I98A 3ARRA 1ZCNA 1W9PA 4DWSC 3UI5A 5GPRA 2XP4A 5DF0A 5HUAA 3ARUA 4KQZA 1Q6HA 1XHGA 3TC5A 3KAHA 4ZPVR 1X6LA 3O5GA 3B9AA 3AS2A 2JZVA 2DT1A 3B7XA 1ITXA 3WH0A 2WM0A 4DWSA 4S3JA 3AS0A 2F2DA 2KFWA 1GUVA 2EULA 3KACA 1W1TA 3CHDA 1FKDA 1TCOC 2ITKA 3CH9A 2XPAA 1WAWA 5HBFA 4QT3A 2WK2A 3WL1A 2VN1A 1BKFA 1A7XA 1GPFA 1LG2A 3ARSA 2PV2A 4W9OA 4L3NA 1QZ2A 1W1YA 2ZR5A 1JCHB 4MNJA 4ODKA 5J6EA 1HKKA 2RQSA 3RM8A 4JFKA 1YATA 1B6CA 2LKNA 4P8XA 4GIVA 2ZQTA 3KADA 5DIVA 4O2TA 3UI4A 3ALGA 4HBOA 2DG4A 3NRKA 2RUDA 2F23A 3NTPA 4FN2A 4DWSD 3UQAA 4G50A 4QIBA 1O6IA 1QPFA 4Z2HA 4DT4A 4ODLA 1WB0A 2A3EA 1EQ3A 1BL4A 2XPBA 2WLZA 2DG9A 1P5QA 4ZPWR 2ZR4A 3O5IA 4ODOA 4ZS6A 3KZ7A 4DIPA 1EDQA 4DWSB 4Z2GA 1E6RA 1E9LA 4DZ3A 2M08A 4R0XA 2ESCA 5HTGA 1NSGA 2RUQA 3G6MA 4MSPA 1JNTA 3O5LA 3UI6A 2LGOA 3RMEA 2G8ZA 4ODPA 1W26A 4C02B 1FAPA 1KT0A 5HWBA 1FKFA 2IF4A 3IKGA 1FKHA 1JVWA 4UDMA 3AQUA 1YW5A 3RM9A 4JFLA 3WD0A 4ODQA 1ZL1A 4DRJA 4DROA 1J6YA 2DT3A 1LL6A 3O5JA 1PBKA 2XP6A 1Q6UA 2ZQVA 4ODNA 3B9EA 1ROTA 3ARXA 4Z2IA 1KT1A 4LAVA 4DRQA 5HWCA 1E15A 1ZU8A 5HW8A 1E44A 1GOIA 2VCDA 3WD4A 1LL7A 1Q6IA 1SYTA 3WQVA 3ALFA 3KAGA 3G6LA 3FXYA 1E6NA 4ODRA 3IKDA 1EHNA 3OA5A 2M2AA 4JFJA 4ITZA 1E6ZA 4Q7NA 3UF8A 2MLZA 4LAWA 2KR7A 2MF9A 1W9UA 1ZB5A 4Z2LA 4IT6A 1T11A 3WD1A 3ARZA 3PRBA 2MLXA
chains in the Genus database with same CATH topology
4HARA 1NWUA 3O5MA 2PPPA 2B31A 4ML4A 1XRVA 1FKGA 3VAWA 4JFMA 4TX0A 2XP7A 3O5EA 3IHZA 1F40A 3UQIA 1FFQA 3IK8A 1FKSA 2FDMA 2DT2A 3O5QA 4AY1A 2YBUA 2PBCA 1SR0A 1H0GA 2XP3A 2Y78A 2OFNA 4W5UA 3ARQA 3RGCA 4FAPA 1VF8A 2MNTA 4GGQA 4G2PA 4MTVA 4S3KA 4U85A 2DSWA 1H0IA 2ZQUA 1NWRA 2KO7A 3KCEA 2D9FA 2DSUA 1HKIA 4LAYA 3ARTA 1K9TA 1X6NA 3FY1A 1U79A 1N1AA 4LAXA 2G41A 2KI3A 4L72B 3OOBA 2WLYA 4J4OA 3GPKA 3PA7A 2RSEA 1J4IA 2IUZA 3FAPA 3RM4A 2YBTA 1KFWA 3ARYA 1Y0OA 2M1IA 4LGXA 1EIBA 1OWQA 5GQBA 1F8AB 4Z2KA 1OGBA 3O5OA 3CGNA 1UR8A 1JNEA 1HKJA 4W9PA 5DITA 3AS3A 1Q1CA 4DZ2A 4DRHA 1D7HA 2LPVA 3WD3A 4QZVB 4WKFA 4DRIA 1OGGA 3O5KA 3PRAA 4DRKA 3CHCA 3W4RA 1IX5A 4WKHA 3JXVA 4NNRA 3CZ8A 1J4RA 3KAFA 4N19A 2UZ5A 4KR0B 4JFIA 3PR9A 5HW6A 1D2KA 1JNSA 3NI6A 4XAKA 2ZR6A 2OLHA 1ZBWA 3ARWA 2XP9A 2MPHA 2DT0A 1FKKA 4TW6A 4IQ2A 1C9HA 3MDYB 4JYSA 3BXWA 1W1VA 2RUCA 4IT4A 3JYMA 1FKRA 4Q22A 1HJVA 2L2SA 1R9HA 4BF8A 4NZCA 4QT2A 1HKMA 5GPGA 1LG1A 1W9VA 4TW7A 3CGMA 1J4HA 1JNDA 3WD2A 1CTNA 1FKIA 1E6PA 3AS1A 1NMWA 1M5YA 3TCZA 2PI6A 3CHEA 1ZK6A 4DRMA 3B8SA 4TW8A 4P8VA 1QPLA 1LQ0A 2XP8A 1WNOA 3O5DA 3WKZA 1ROUA 4J4NA 4DH0A 4WKAA 2PV3A 4PTMA 3PRDA 4ODMA 2A3BA 1RD6A 5HT1A 4DRNA 2RURA 1LJYA 2O9OA 2AOSA 5DIUA 4W9QA 3O5PA 4MNKA 1ZBVA 4P8UA 4MNLA 4WK9A 4IPXA 3RFWA 2LJ4A 2KE0A 2KGJA 2DSZA 3ARPA 5HKGA 3AROA 3O5RA 1ZBCA 3ODKA 3EY6A 5JH8A 4R5EA 1D6OA 4DRPA 4MPKA 4WJXA 4MNMA 3KAIA 2N87A 1FKTA 2Q5AA 1LL4A 4URIA 1HXVA 1NMVA 2A3AA 2FAPA 3JYJA 3ARVA 1HJWA 2PPNA 3WIJA 2DG3A 2A3CA 4TYOA 1EYMA 1W1PA 4ZPTR 4Z2JA 1FJDA 2MLYA 3LUOA 2AWGA 3KABA 2DPEA 1D7IA 2O92A 3I6CA 5DEZA 1L1PA 2K8IA 2PV1A 5B8IC 2QF8A 3H9RB 4TNSA 1ZBKA 2PPOA 4WIWA 3CHFA 5DO2A 3TDBA 1NH6A 2DSVA 1HJXA 1NWSA 4P8WA 4MGVA 3B9DA 3QOKA 1D7JA 2F21A 5D75A 1FD9A 1FKJA 3O5FA 2ZQSA 5BXJA 4HBEA 2XP5A 3UQBA 4NSBA 2FKEA 2F4EA 1FFRA 1FKBA 1TFVA 4U84A 4IQCA 1FKLA 1NWTA 3WL0A 5HW7A 4MAVA 4U86A 1UR9A 3WQWA 1PINA 5I98A 3ARRA 1ZCNA 1W9PA 4DWSC 3UI5A 5GPRA 2XP4A 5DF0A 5HUAA 3ARUA 4KQZA 1Q6HA 1XHGA 3TC5A 3KAHA 4ZPVR 1X6LA 3O5GA 3B9AA 3AS2A 2JZVA 2DT1A 3B7XA 1ITXA 3WH0A 2WM0A 4DWSA 4S3JA 3AS0A 2F2DA 2KFWA 1GUVA 3KACA 1W1TA 3CHDA 1FKDA 1TCOC 2ITKA 3CH9A 2XPAA 1WAWA 5HBFA 4QT3A 2WK2A 3WL1A 2VN1A 1BKFA 1A7XA 1GPFA 1LG2A 3ARSA 2PV2A 4W9OA 4L3NA 1QZ2A 1W1YA 2ZR5A 4MNJA 4ODKA 5J6EA 1HKKA 2RQSA 3RM8A 4JFKA 1YATA 1B6CA 2LKNA 4P8XA 4GIVA 2ZQTA 3KADA 5DIVA 4O2TA 3UI4A 3ALGA 4HBOA 2DG4A 3NRKA 2RUDA 3NTPA 4DWSD 4FN2A 3UQAA 4G50A 4QIBA 1O6IA 1QPFA 4Z2HA 4DT4A 4ODLA 1WB0A 2A3EA 1EQ3A 1BL4A 2XPBA 2WLZA 2DG9A 1P5QA 4ZPWR 2ZR4A 3O5IA 4ODOA 4ZS6A 3KZ7A 4DIPA 1EDQA 4DWSB 4Z2GA 1E6RA 1E9LA 4DZ3A 2M08A 4R0XA 2ESCA 5HTGA 1NSGA 2RUQA 3G6MA 4MSPA 1JNTA 3O5LA 3UI6A 2LGOA 3RMEA 2G8ZA 4ODPA 1W26A 4C02B 1FAPA 1KT0A 5HWBA 1FKFA 2IF4A 3IKGA 1FKHA 1JVWA 3AQUA 1YW5A 3RM9A 4JFLA 3WD0A 4ODQA 1ZL1A 4DRJA 4DROA 1J6YA 2DT3A 1LL6A 3O5JA 1PBKA 2XP6A 1Q6UA 2ZQVA 4ODNA 3B9EA 1ROTA 3ARXA 4Z2IA 1KT1A 4LAVA 4DRQA 5HWCA 1E15A 1ZU8A 5HW8A 1GOIA 2VCDA 3WD4A 1LL7A 1Q6IA 1SYTA 3WQVA 3ALFA 3KAGA 3G6LA 3FXYA 1E6NA 4ODRA 3IKDA 1EHNA 3OA5A 2M2AA 4JFJA 4ITZA 1E6ZA 4Q7NA 3UF8A 2MLZA 4LAWA 2KR7A 2MF9A 1W9UA 1ZB5A 4Z2LA 4IT6A 1T11A 3WD1A 3ARZA 3PRBA 2MLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFK A;  2XP9 A;  1YAT A;  3H9R B;  3O5M A;  1B6C A;  2PPO A;  2MPH A;  2LKN A;  4TNS A;  2PPP A;  4GIV A;  2ZQT A;  3TDB A;  1FKK A;  3KAD A;  4IQ2 A;  4TW6 A;  1FKG A;  4O2T A;  5DIV A;  3VAW A;  3UI4 A;  4JFM A;  4TX0 A;  2XP7 A;  2DG4 A;  3O5E A;  4MGV A;  3IHZ A;  1C9H A;  3MDY B;  1D7J A;  2F21 A;  5D75 A;  1F40 A;  3NRK A;  2RUD A;  3NTP A;  3UQI A;  4FN2 A;  3UQA A;  4JYS A;  3IK8 A;  4G50 A;  1FKS A;  1FD9 A;  1FKJ A;  3O5F A;  2RUC A;  2ZQS A;  4QIB A;  5BXJ A;  3O5Q A;  2XP5 A;  3JYM A;  1QPF A;  1FKR A;  3UQB A;  2L2S A;  2PBC A;  2FKE A;  2F4E A;  1R9H A;  4ODL A;  4DT4 A;  1FKB A;  4BF8 A;  4QT2 A;  1EQ3 A;  1BL4 A;  2XP3 A;  2XPB A;  2Y78 A;  2DG9 A;  2OFN A;  5GPG A;  1P5Q A;  4U84 A;  3RGC A;  4FAP A;  2MNT A;  2ZR4 A;  3O5I A;  4GGQ A;  3CGM A;  4G2P A;  1J4H A;  4IQC A;  4TW7 A;  1FKL A;  1FKI A;  4ODO A;  3KZ7 A;  4U85 A;  4DIP A;  5HW7 A;  1NMW A;  1M5Y A;  3TCZ A;  2ZQU A;  4U86 A;  1ZK6 A;  4DRM A;  4DZ3 A;  2M08 A;  4R0X A;  2KO7 A;  5HTG A;  1NSG A;  3KCE A;  1PIN A;  2RUQ A;  2D9F A;  5I98 A;  4TW8 A;  4MSP A;  1QPL A;  1JNT A;  3O5L A;  4LAY A;  1ZCN A;  2XP8 A;  3O5D A;  3UI6 A;  2LGO A;  1ROU A;  4ODP A;  1W26 A;  4C02 B;  1FAP A;  1KT0 A;  3UI5 A;  1U79 A;  4J4N A;  4DH0 A;  1N1A A;  2XP4 A;  5HWB A;  4LAX A;  1FKF A;  5HUA A;  2PV3 A;  2IF4 A;  2KI3 A;  3PRD A;  3IKG A;  1FKH A;  1JVW A;  1Q6H A;  4ODM A;  3OOB A;  1YW5 A;  5HT1 A;  4JFL A;  3TC5 A;  4J4O A;  4ODQ A;  3GPK A;  4DRN A;  3KAH A;  3PA7 A;  4DRJ A;  2RUR A;  4DRO A;  1J6Y A;  3O5J A;  5DIU A;  3O5G A;  4W9Q A;  3O5P A;  2RSE A;  4IPX A;  1PBK A;  1J4I A;  2LJ4 A;  2XP6 A;  2KE0 A;  1Q6U A;  3RFW A;  2JZV A;  2KGJ A;  2ZQV A;  4ODN A;  3B7X A;  3FAP A;  1ROT A;  3WH0 A;  5HKG A;  1Y0O A;  1KT1 A;  2M1I A;  4LAV A;  3O5R A;  4DRQ A;  5HWC A;  2F2D A;  2KFW A;  5HW8 A;  1F8A B;  3ODK A;  3EY6 A;  2VCD A;  3KAC A;  3O5O A;  1D6O A;  3CGN A;  4DRP A;  4W9P A;  3KAI A;  5DIT A;  1Q1C A;  1FKT A;  1TCO C;  1FKD A;  1Q6I A;  2ITK A;  2N87 A;  4DZ2 A;  2Q5A A;  3KAG A;  4DRH A;  2XPA A;  1D7H A;  4QT3 A;  1HXV A;  2LPV A;  2VN1 A;  4ODR A;  1BKF A;  1NMV A;  2FAP A;  1A7X A;  3IKD A;  3JYJ A;  4DRI A;  2PV2 A;  3O5K A;  2M2A A;  2PPN A;  4ITZ A;  4JFJ A;  4DRK A;  2DG3 A;  3UF8 A;  4W9O A;  3JXV A;  1QZ2 A;  2MLZ A;  4LAW A;  4NNR A;  4TYO A;  1J4R A;  2KR7 A;  1EYM A;  2MF9 A;  3KAF A;  4N19 A;  1FJD A;  2MLY A;  2UZ5 A;  3LUO A;  2ZR5 A;  2AWG A;  3KAB A;  1D7I A;  4JFI A;  5HW6 A;  3I6C A;  1T11 A;  4ODK A;  5J6E A;  1JNS A;  3NI6 A;  1L1P A;  2K8I A;  2RQS A;  2ZR6 A;  2PV1 A;  5B8I C;  3PRB A;  2MLX A; 
#chains in the Genus database with same CATH topology
 4HAR A;  1NWU A;  3O5M A;  2PPP A;  2PN0 A;  2B31 A;  4ML4 A;  1XRV A;  1FKG A;  3VAW A;  4JFM A;  4TX0 A;  2XP7 A;  3O5E A;  3IHZ A;  1F40 A;  3GTY X;  3UQI A;  1FFQ A;  3IK8 A;  1FKS A;  2FDM A;  2DT2 A;  1GRJ A;  3O5Q A;  4AY1 A;  2YBU A;  2PBC A;  1SR0 A;  1H0G A;  2XP3 A;  2Y78 A;  2OFN A;  4W5U A;  3ARQ A;  3RGC A;  4FAP A;  1VF8 A;  2MNT A;  4GGQ A;  4G2P A;  4MTV A;  4S3K A;  4U85 A;  2B5U B;  2DSW A;  3GU0 A;  1H0I A;  2ZQU A;  1NWR A;  2KO7 A;  3KCE A;  2D9F A;  2DSU A;  1HKI A;  4LAY A;  3ART A;  1K9T A;  1X6N A;  3FY1 A;  1U79 A;  1N1A A;  4LAX A;  2G41 A;  2KI3 A;  4L72 B;  3OOB A;  2WLY A;  4J4O A;  3GPK A;  3PA7 A;  2RSE A;  1J4I A;  2IUZ A;  3FAP A;  3RM4 A;  2YBT A;  1KFW A;  3ARY A;  1Y0O A;  2M1I A;  4LGX A;  1EIB A;  1OWQ A;  5GQB A;  1F8A B;  4Z2K A;  1OGB A;  3O5O A;  3CGN A;  1UR8 A;  1JNE A;  1HKJ A;  4W9P A;  5DIT A;  3AS3 A;  1Q1C A;  3BMB A;  4DZ2 A;  4DRH A;  1D7H A;  2LPV A;  3WD3 A;  4QZV B;  4WKF A;  4DRI A;  1OGG A;  3O5K A;  3PRA A;  4DRK A;  3CHC A;  3W4R A;  1IX5 A;  4WKH A;  3JXV A;  4NNR A;  3CZ8 A;  1J4R A;  3KAF A;  4N19 A;  2UZ5 A;  4KR0 B;  4JFI A;  3PR9 A;  5HW6 A;  1D2K A;  1JNS A;  3NI6 A;  4XAK A;  2ZR6 A;  2OLH A;  1ZBW A;  3ARW A;  2XP9 A;  2MPH A;  2DT0 A;  1FKK A;  4TW6 A;  4IQ2 A;  1C9H A;  3MDY B;  4JYS A;  3BXW A;  1W1V A;  2RUC A;  4IT4 A;  3JYM A;  1FKR A;  4Q22 A;  1HJV A;  2L2S A;  1R9H A;  4BF8 A;  4NZC A;  4QT2 A;  1HKM A;  5GPG A;  1LG1 A;  1W9V A;  4TW7 A;  3CGM A;  1J4H A;  1JND A;  3WD2 A;  1CTN A;  1FKI A;  1E6P A;  3AS1 A;  1NMW A;  1M5Y A;  3TCZ A;  2PI6 A;  3CHE A;  1ZK6 A;  4DRM A;  3B8S A;  4TW8 A;  4P8V A;  1QPL A;  1LQ0 A;  2XP8 A;  1WNO A;  3O5D A;  3WKZ A;  1ROU A;  4J4N A;  4DH0 A;  4WKA A;  2PV3 A;  4PTM A;  3PRD A;  4ODM A;  2A3B A;  1RD6 A;  5HT1 A;  4DRN A;  2RUR A;  1LJY A;  3EIP A;  2O9O A;  2AOS A;  5DIU A;  4W9Q A;  3O5P A;  4MNK A;  1ZBV A;  4P8U A;  4MNL A;  4WK9 A;  4IPX A;  3RFW A;  2LJ4 A;  2KE0 A;  2KGJ A;  2DSZ A;  3ARP A;  5HKG A;  3ARO A;  3O5R A;  1ZBC A;  2P4V A;  3ODK A;  3EY6 A;  5JH8 A;  4R5E A;  1D6O A;  4DRP A;  4MPK A;  4WJX A;  4MNM A;  3KAI A;  2N87 A;  1FKT A;  2Q5A A;  1LL4 A;  4URI A;  1HXV A;  1NMV A;  2A3A A;  2FAP A;  3JYJ A;  3ARV A;  1HJW A;  2PPN A;  3WIJ A;  2DG3 A;  2A3C A;  4TYO A;  1EYM A;  1W1P A;  4ZPT R;  4Z2J A;  1FJD A;  2MLY A;  3LUO A;  2AWG A;  3KAB A;  2DPE A;  1D7I A;  2O92 A;  3I6C A;  5DEZ A;  1L1P A;  2K8I A;  2PV1 A;  5B8I C;  2QF8 A;  3H9R B;  4TNS A;  1ZBK A;  2PPO A;  4WIW A;  3CHF A;  5DO2 A;  3TDB A;  1NH6 A;  2DSV A;  1HJX A;  1NWS A;  4P8W A;  4MGV A;  3B9D A;  3QOK A;  1D7J A;  2F21 A;  5D75 A;  1FD9 A;  1FKJ A;  3O5F A;  2ZQS A;  5BXJ A;  4HBE A;  2XP5 A;  3UQB A;  4NSB A;  2FKE A;  2F4E A;  1FFR A;  1FKB A;  2ETN A;  1TFV A;  4U84 A;  4IQC A;  1FKL A;  1NWT A;  3WL0 A;  5HW7 A;  4MAV A;  4U86 A;  1UR9 A;  3WQW A;  1PIN A;  5I98 A;  3ARR A;  1ZCN A;  1W9P A;  4DWS C;  3UI5 A;  5GPR A;  2XP4 A;  5DF0 A;  5HUA A;  3ARU A;  4KQZ A;  1Q6H A;  1XHG A;  3TC5 A;  3KAH A;  4ZPV R;  1X6L A;  3O5G A;  3B9A A;  3AS2 A;  2JZV A;  2DT1 A;  3B7X A;  1ITX A;  3WH0 A;  2WM0 A;  4DWS A;  4S3J A;  3AS0 A;  2F2D A;  2KFW A;  1GUV A;  2EUL A;  3KAC A;  1W1T A;  3CHD A;  1FKD A;  1TCO C;  2ITK A;  3CH9 A;  2XPA A;  1WAW A;  5HBF A;  4QT3 A;  2WK2 A;  3WL1 A;  2VN1 A;  1BKF A;  1A7X A;  1GPF A;  1LG2 A;  3ARS A;  2PV2 A;  4W9O A;  4L3N A;  1QZ2 A;  1W1Y A;  2ZR5 A;  1JCH B;  4MNJ A;  4ODK A;  5J6E A;  1HKK A;  2RQS A;  3RM8 A;  4JFK A;  1YAT A;  1B6C A;  2LKN A;  4P8X A;  4GIV A;  2ZQT A;  3KAD A;  5DIV A;  4O2T A;  3UI4 A;  3ALG A;  4HBO A;  2DG4 A;  3NRK A;  2RUD A;  2F23 A;  3NTP A;  4FN2 A;  4DWS D;  3UQA A;  4G50 A;  4QIB A;  1O6I A;  1QPF A;  4Z2H A;  4DT4 A;  4ODL A;  1WB0 A;  2A3E A;  1EQ3 A;  1BL4 A;  2XPB A;  2WLZ A;  2DG9 A;  1P5Q A;  4ZPW R;  2ZR4 A;  3O5I A;  4ODO A;  4ZS6 A;  3KZ7 A;  4DIP A;  1EDQ A;  4DWS B;  4Z2G A;  1E6R A;  1E9L A;  4DZ3 A;  2M08 A;  4R0X A;  2ESC A;  5HTG A;  1NSG A;  2RUQ A;  3G6M A;  4MSP A;  1JNT A;  3O5L A;  3UI6 A;  2LGO A;  3RME A;  2G8Z A;  4ODP A;  1W26 A;  4C02 B;  1FAP A;  1KT0 A;  5HWB A;  1FKF A;  2IF4 A;  3IKG A;  1FKH A;  1JVW A;  4UDM A;  3AQU A;  1YW5 A;  3RM9 A;  4JFL A;  3WD0 A;  4ODQ A;  1ZL1 A;  4DRJ A;  4DRO A;  1J6Y A;  2DT3 A;  1LL6 A;  3O5J A;  1PBK A;  2XP6 A;  1Q6U A;  2ZQV A;  4ODN A;  3B9E A;  1ROT A;  3ARX A;  4Z2I A;  1KT1 A;  4LAV A;  4DRQ A;  5HWC A;  1E15 A;  1ZU8 A;  5HW8 A;  1E44 A;  1GOI A;  2VCD A;  3WD4 A;  1LL7 A;  1Q6I A;  1SYT A;  3WQV A;  3ALF A;  3KAG A;  3G6L A;  3FXY A;  1E6N A;  4ODR A;  3IKD A;  1EHN A;  3OA5 A;  2M2A A;  4JFJ A;  4ITZ A;  1E6Z A;  4Q7N A;  3UF8 A;  2MLZ A;  4LAW A;  2KR7 A;  2MF9 A;  1W9U A;  1ZB5 A;  4Z2L A;  4IT6 A;  1T11 A;  3WD1 A;  3ARZ A;  3PRB A;  2MLX A; 
#chains in the Genus database with same CATH homology
 4HAR A;  1NWU A;  3O5M A;  2PPP A;  2B31 A;  4ML4 A;  1XRV A;  1FKG A;  3VAW A;  4JFM A;  4TX0 A;  2XP7 A;  3O5E A;  3IHZ A;  1F40 A;  3UQI A;  1FFQ A;  3IK8 A;  1FKS A;  2FDM A;  2DT2 A;  3O5Q A;  4AY1 A;  2YBU A;  2PBC A;  1SR0 A;  1H0G A;  2XP3 A;  2Y78 A;  2OFN A;  4W5U A;  3ARQ A;  3RGC A;  4FAP A;  1VF8 A;  2MNT A;  4GGQ A;  4G2P A;  4MTV A;  4S3K A;  4U85 A;  2DSW A;  1H0I A;  2ZQU A;  1NWR A;  2KO7 A;  3KCE A;  2D9F A;  2DSU A;  1HKI A;  4LAY A;  3ART A;  1K9T A;  1X6N A;  3FY1 A;  1U79 A;  1N1A A;  4LAX A;  2G41 A;  2KI3 A;  4L72 B;  3OOB A;  2WLY A;  4J4O A;  3GPK A;  3PA7 A;  2RSE A;  1J4I A;  2IUZ A;  3FAP A;  3RM4 A;  2YBT A;  1KFW A;  3ARY A;  1Y0O A;  2M1I A;  4LGX A;  1EIB A;  1OWQ A;  5GQB A;  1F8A B;  4Z2K A;  1OGB A;  3O5O A;  3CGN A;  1UR8 A;  1JNE A;  1HKJ A;  4W9P A;  5DIT A;  3AS3 A;  1Q1C A;  4DZ2 A;  4DRH A;  1D7H A;  2LPV A;  3WD3 A;  4QZV B;  4WKF A;  4DRI A;  1OGG A;  3O5K A;  3PRA A;  4DRK A;  3CHC A;  3W4R A;  1IX5 A;  4WKH A;  3JXV A;  4NNR A;  3CZ8 A;  1J4R A;  3KAF A;  4N19 A;  2UZ5 A;  4KR0 B;  4JFI A;  3PR9 A;  5HW6 A;  1D2K A;  1JNS A;  3NI6 A;  4XAK A;  2ZR6 A;  2OLH A;  1ZBW A;  3ARW A;  2XP9 A;  2MPH A;  2DT0 A;  1FKK A;  4TW6 A;  4IQ2 A;  1C9H A;  3MDY B;  4JYS A;  3BXW A;  1W1V A;  2RUC A;  4IT4 A;  3JYM A;  1FKR A;  4Q22 A;  1HJV A;  2L2S A;  1R9H A;  4BF8 A;  4NZC A;  4QT2 A;  1HKM A;  5GPG A;  1LG1 A;  1W9V A;  4TW7 A;  3CGM A;  1J4H A;  1JND A;  3WD2 A;  1CTN A;  1FKI A;  1E6P A;  3AS1 A;  1NMW A;  1M5Y A;  3TCZ A;  2PI6 A;  3CHE A;  1ZK6 A;  4DRM A;  3B8S A;  4TW8 A;  4P8V A;  1QPL A;  1LQ0 A;  2XP8 A;  1WNO A;  3O5D A;  3WKZ A;  1ROU A;  4J4N A;  4DH0 A;  4WKA A;  2PV3 A;  4PTM A;  3PRD A;  4ODM A;  2A3B A;  1RD6 A;  5HT1 A;  4DRN A;  2RUR A;  1LJY A;  2O9O A;  2AOS A;  5DIU A;  4W9Q A;  3O5P A;  4MNK A;  1ZBV A;  4P8U A;  4MNL A;  4WK9 A;  4IPX A;  3RFW A;  2LJ4 A;  2KE0 A;  2KGJ A;  2DSZ A;  3ARP A;  5HKG A;  3ARO A;  3O5R A;  1ZBC A;  3ODK A;  3EY6 A;  5JH8 A;  4R5E A;  1D6O A;  4DRP A;  4MPK A;  4WJX A;  4MNM A;  3KAI A;  2N87 A;  1FKT A;  2Q5A A;  1LL4 A;  4URI A;  1HXV A;  1NMV A;  2A3A A;  2FAP A;  3JYJ A;  3ARV A;  1HJW A;  2PPN A;  3WIJ A;  2DG3 A;  2A3C A;  4TYO A;  1EYM A;  1W1P A;  4ZPT R;  4Z2J A;  1FJD A;  2MLY A;  3LUO A;  2AWG A;  3KAB A;  2DPE A;  1D7I A;  2O92 A;  3I6C A;  5DEZ A;  1L1P A;  2K8I A;  2PV1 A;  5B8I C;  2QF8 A;  3H9R B;  4TNS A;  1ZBK A;  2PPO A;  4WIW A;  3CHF A;  5DO2 A;  3TDB A;  1NH6 A;  2DSV A;  1HJX A;  1NWS A;  4P8W A;  4MGV A;  3B9D A;  3QOK A;  1D7J A;  2F21 A;  5D75 A;  1FD9 A;  1FKJ A;  3O5F A;  2ZQS A;  5BXJ A;  4HBE A;  2XP5 A;  3UQB A;  4NSB A;  2FKE A;  2F4E A;  1FFR A;  1FKB A;  1TFV A;  4U84 A;  4IQC A;  1FKL A;  1NWT A;  3WL0 A;  5HW7 A;  4MAV A;  4U86 A;  1UR9 A;  3WQW A;  1PIN A;  5I98 A;  3ARR A;  1ZCN A;  1W9P A;  4DWS C;  3UI5 A;  5GPR A;  2XP4 A;  5DF0 A;  5HUA A;  3ARU A;  4KQZ A;  1Q6H A;  1XHG A;  3TC5 A;  3KAH A;  4ZPV R;  1X6L A;  3O5G A;  3B9A A;  3AS2 A;  2JZV A;  2DT1 A;  3B7X A;  1ITX A;  3WH0 A;  2WM0 A;  4DWS A;  4S3J A;  3AS0 A;  2F2D A;  2KFW A;  1GUV A;  3KAC A;  1W1T A;  3CHD A;  1FKD A;  1TCO C;  2ITK A;  3CH9 A;  2XPA A;  1WAW A;  5HBF A;  4QT3 A;  2WK2 A;  3WL1 A;  2VN1 A;  1BKF A;  1A7X A;  1GPF A;  1LG2 A;  3ARS A;  2PV2 A;  4W9O A;  4L3N A;  1QZ2 A;  1W1Y A;  2ZR5 A;  4MNJ A;  4ODK A;  5J6E A;  1HKK A;  2RQS A;  3RM8 A;  4JFK A;  1YAT A;  1B6C A;  2LKN A;  4P8X A;  4GIV A;  2ZQT A;  3KAD A;  5DIV A;  4O2T A;  3UI4 A;  3ALG A;  4HBO A;  2DG4 A;  3NRK A;  2RUD A;  3NTP A;  4DWS D;  4FN2 A;  3UQA A;  4G50 A;  4QIB A;  1O6I A;  1QPF A;  4Z2H A;  4DT4 A;  4ODL A;  1WB0 A;  2A3E A;  1EQ3 A;  1BL4 A;  2XPB A;  2WLZ A;  2DG9 A;  1P5Q A;  4ZPW R;  2ZR4 A;  3O5I A;  4ODO A;  4ZS6 A;  3KZ7 A;  4DIP A;  1EDQ A;  4DWS B;  4Z2G A;  1E6R A;  1E9L A;  4DZ3 A;  2M08 A;  4R0X A;  2ESC A;  5HTG A;  1NSG A;  2RUQ A;  3G6M A;  4MSP A;  1JNT A;  3O5L A;  3UI6 A;  2LGO A;  3RME A;  2G8Z A;  4ODP A;  1W26 A;  4C02 B;  1FAP A;  1KT0 A;  5HWB A;  1FKF A;  2IF4 A;  3IKG A;  1FKH A;  1JVW A;  3AQU A;  1YW5 A;  3RM9 A;  4JFL A;  3WD0 A;  4ODQ A;  1ZL1 A;  4DRJ A;  4DRO A;  1J6Y A;  2DT3 A;  1LL6 A;  3O5J A;  1PBK A;  2XP6 A;  1Q6U A;  2ZQV A;  4ODN A;  3B9E A;  1ROT A;  3ARX A;  4Z2I A;  1KT1 A;  4LAV A;  4DRQ A;  5HWC A;  1E15 A;  1ZU8 A;  5HW8 A;  1GOI A;  2VCD A;  3WD4 A;  1LL7 A;  1Q6I A;  1SYT A;  3WQV A;  3ALF A;  3KAG A;  3G6L A;  3FXY A;  1E6N A;  4ODR A;  3IKD A;  1EHN A;  3OA5 A;  2M2A A;  4JFJ A;  4ITZ A;  1E6Z A;  4Q7N A;  3UF8 A;  2MLZ A;  4LAW A;  2KR7 A;  2MF9 A;  1W9U A;  1ZB5 A;  4Z2L A;  4IT6 A;  1T11 A;  3WD1 A;  3ARZ A;  3PRB A;  2MLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...