4ODKA

Structure of slyd from thermus thermophilus in complex with t1 peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
156
structure length
153
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
total genus 34
structure length 153
sequence length 156
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odkA00
1FKHA 2OFNA 4FN2A 1FKBA 2RSEA 1U79A 1C9HA 1Q6IA 3JYJA 1JNTA 2ZR4A 3KAFA 4TW6A 3TC5A 4FAPA 1D7JA 2XP3A 5HWBA 3CGNA 4DRNA 4DT4A 4U84A 1F40A 4ODMA 4W9PA 1TCOC 3PRBA 5HWCA 4W9OA 5HTGA 4JFIA 3O5PA 5BXJA 1FKIA 1D7IA 2PPPA 2PV1A 4QIBA 4JFMA 3UQIA 3IK8A 4GIVA 2RUDA 5J6EA 4DRHA 3H9RB 4U85A 1ROUA 3KZ7A 1FD9A 3O5JA 4DRQA 4J4NA 1R9HA 1FKJA 2XPAA 1EYMA 4DROA 1FKFA 1J4HA 4ODRA 2MLXA 2KR7A 1D7HA 1FKDA 2FKEA 2JZVA 1QPFA 1W26A 2ITKA 2KO7A 2MF9A 4ODPA 4DRJA 4LAYA 5B8IC 4N19A 3O5OA 2RURA 1FAPA 1PBKA 3O5LA 4ITZA 2KGJA 2MLYA 4ODQA 2ZQTA 3WH0A 4JFLA 2ZR5A 3OOBA 2L2SA 1FKSA 1ROTA 1P5QA 3B7XA 3IKGA 4R0XA 1JVWA 1NSGA 3CGMA 4ODNA 4DIPA 2RUQA 2K8IA 1BKFA 1QPLA 4LAXA 4G50A 4DRIA 2KE0A 2AWGA 4JYSA 4TNSA 3JXVA 1F8AB 1KT0A 1NMWA 3KAIA 4GGQA 2ZQVA 4J4OA 1PINA 5HW8A 4DRKA 3TCZA 3IHZA 4TW8A 3NRKA 3UQBA 2VN1A 1QZ2A 3UF8A 1BL4A 2VCDA 1ZCNA 5GPGA 4IPXA 1J6YA 4NNRA 2F4EA 3PA7A 2XP5A 2MLZA 2XP7A 2XP8A 4ODLA 2PPOA 3O5FA 5HKGA 1HXVA 3O5RA 4QT3A 3O5DA 5HT1A 1ZK6A 3O5GA 1A7XA 4JFKA 4LAVA 3RGCA 3ODKA 4DH0A 2M1IA 3KABA 3UI5A 4C02B 2DG9A 2Q5AA 3PRDA 3O5KA 3VAWA 1FKGA 2PV2A 2ZQSA 3MDYB 5DITA 3UQAA 2XP9A 2XP4A 4MSPA 3O5EA 1YATA 3LUOA 3NI6A 1T11A 2PV3A 4TYOA 1JNSA 3GPKA 2KI3A 2MNTA 1B6CA 2ZR6A 1N1AA 2LKNA 4DZ2A 1FJDA 1D6OA 2FAPA 3KADA 3O5IA 2PBCA 3NTPA 5HW7A 5I98A 2XP6A 3JYMA 3FAPA 5HW6A 4U86A 3IKDA 2F2DA 1Q6HA 2LJ4A 4MGVA 3UI4A 4DRPA 1J4IA 1YW5A 4QT2A 1M5YA 2M2AA 2RUCA 2Y78A 3O5MA 5D75A 4DZ3A 4O2TA 1EQ3A 2DG3A 2M08A 2XPBA 3KCEA 3UI6A 2KFWA 1KT1A 2MPHA 4LAWA 1L1PA 1Y0OA 3O5QA 3KACA 3KAGA 1FKTA 2LPVA 3I6CA 2IF4A 3EY6A 4TX0A 4DRMA 2F21A 4G2PA 1Q1CA 4ODKA 4TW7A 5HUAA 2LGOA 5DIVA 1J4RA 4IQ2A 1Q6UA 1FKKA 3KAHA 4IQCA 2N87A 4W9QA 3TDBA 2DG4A 1FKLA 2D9FA 4JFJA 2RQSA 2ZQUA 4BF8A 3RFWA 5DIUA 1NMVA 1FKRA 4ODOA 2UZ5A 2PPNA
chains in the Genus database with same CATH superfamily
1FKHA 2DSVA 1FKBA 1U79A 1SYTA 1JNTA 1ZBCA 2A3BA 2FDMA 1E6PA 1LQ0A 3ALGA 4DT4A 1F40A 2WLZA 4ODMA 4W9PA 5HTGA 1WAWA 1ZBKA 2PPPA 4JFMA 3AS0A 3IK8A 1FFQA 3ARWA 3WD4A 4DROA 1EYMA 4ODRA 3QOKA 4ODPA 5B8IC 4UDMA 2RURA 4HARA 4ZPTR 4WK9A 2OLHA 3G6LA 1NWSA 1UR8A 2ZR5A 3WD1A 1KFWA 1ZU8A 2G8ZA 5HWBA 2L2SA 3ARUA 1NSGA 1X6LA 4DWSD 1QPLA 4DRIA 2AWGA 1KT0A 3KAIA 4GGQA 3TCZA 1CTNA 1H0GA 1W1TA 1BL4A 2VCDA 1J6YA 2XP5A 2MLZA 4Z2KA 2XP8A 1O6IA 3O5GA 3RGCA 4DH0A 2M1IA 4C02B 2Q5AA 5DEZA 1NWTA 1YATA 3LUOA 4Q7NA 1JNSA 1JCHB 2LKNA 2O92A 3WKZA 3KADA 1JNEA 3NTPA 1ZBWA 1HKMA 5HW6A 2A3EA 4U86A 2F2DA 4S3JA 4DRPA 3RM8A 4Z2LA 3O5MA 4O2TA 5DO2A 2DG3A 4XAKA 3ARXA 2DSWA 3O5QA 3BMBA 1LL6A 3AROA 4G2PA 4Z2JA 4AY1A 1WB0A 4Z2IA 1EHNA 1Q6UA 1RD6A 2N87A 1GOIA 2DG4A 3MDYB 4FN2A 1W1PA 1GRJA 3JYJA 3KAFA 4LGXA 4FAPA 4S3KA 3WD3A 4DRNA 1HJVA 1TCOC 3PRBA 4W9OA 1FKIA 1D7IA 1XHGA 2PV1A 4QIBA 3FXYA 1ROUA 3KZ7A 5HBFA 1FD9A 4DRQA 2MLXA 1D7HA 1FKDA 2KR7A 2O9OA 2P4VA 3W4RA 2ITKA 3B8SA 4LAYA 4KQZA 3PRAA 1HKJA 1P5QA 3IKGA 4DIPA 4W5UA 4G50A 1E6NA 3ARQA 4JYSA 3ARSA 3AQUA 3JXVA 1F8AB 1PINA 5HW8A 1LL7A 3G6MA 1W1VA 3OA5A 2B31A 3WIJA 4Z2HA 1HKKA 1X6NA 3ARZA 5GPGA 4WJXA 2PPOA 3O5FA 4MNMA 3O5DA 5HT1A 1ZK6A 4JFKA 2WK2A 3UI5A 1HJXA 3KABA 2DG9A 3O5KA 4MNJA 5DITA 2XP9A 4MSPA 3O5EA 3NI6A 4L3NA 1ZBVA 3WQWA 2ZR6A 1N1AA 3ARPA 1FJDA 4KR0B 2PBCA 5I98A 4PTMA 1ZB5A 3JYMA 2LJ4A 5D75A 2M2AA 1HJWA 2M08A 3KCEA 2KFWA 2MPHA 1Y0OA 3RM9A 3KAGA 4P8XA 1FKTA 2LPVA 4IT4A 2WLYA 2IF4A 1LL4A 4DRMA 3ALFA 4P8UA 2LGOA 1IX5A 2B5UB 1FKLA 4JFJA 2RQSA 2PN0A 1FKRA 4L72B 2UZ5A 3RM4A 2PPNA 2OFNA 1XRVA 4TW6A 3TC5A 4ZS6A 1FFRA 1D7JA 2XP3A 3CGNA 4U84A 4MNLA 5GPRA 4JFIA 3O5PA 4URIA 3UQIA 4HBOA 5J6EA 4U85A 4MTVA 1FKJA 2XPAA 2MF9A 1QPFA 2KO7A 1OGBA 1VF8A 1HKIA 4DRJA 1W9PA 4DWSB 4N19A 3O5OA 3O5LA 4NSBA 2KGJA 2ZQTA 5GQBA 4JFLA 3B9DA 1E6RA 1FKSA 1ROTA 4R0XA 1GUVA 4ODNA 3EIPA 2F23A 1BKFA 3WD0A 2KE0A 4TNSA 4WKFA 1H0IA 2DT1A 4DRKA 3ARTA 3IHZA 3NRKA 2ESCA 1QZ2A 1TFVA 1ZCNA 1NWUA 4NNRA 3PA7A 2YBTA 1OGGA 3CHFA 4ODLA 3CH9A 1SR0A 3ODKA 2EULA 3PRDA 3VAWA 3UQAA 2ZQSA 4P8VA 2WM0A 1OWQA 1EDQA 1T11A 1UR9A 3GPKA 2MNTA 1B6CA 2FAPA 2XP6A 3ARYA 3UI4A 1J4IA 3ARVA 4QT2A 2RUCA 2Y78A 1EQ3A 4Q22A 4DZ3A 4Z2GA 2XPBA 3UI6A 4LAWA 1KT1A 3CHEA 1E9LA 3CZ8A 1L1PA 2DSZA 3CHDA 3AS1A 3I6CA 4TX0A 2F21A 1Q1CA 4TW7A 1E44A 5DIVA 4R5EA 1JNDA 2G41A 4MAVA 2A3CA 4DWSC 4W9QA 2D9FA 4BF8A 3RFWA 5DIUA 1NMVA 4ODOA 1W1YA 4P8WA 2RSEA 1C9HA 1Q6IA 2DT0A 2ZR4A 1E15A 4ML4A 1W9UA 5HWCA 1D2KA 1K9TA 5BXJA 3WQVA 4ZPWR 2DT3A 4GIVA 2RUDA 1GPFA 4DRHA 3H9RB 1NH6A 3O5JA 4J4NA 1R9HA 1NWRA 1FKFA 1J4HA 3AS2A 4ODQA 2JZVA 2FKEA 4WKHA 1W26A 4MNKA 3WD2A 4WIWA 1EIBA 1FAPA 1PBKA 4ITZA 2DPEA 2MLYA 2PI6A 3WH0A 1WNOA 4NZCA 3OOBA 3B7XA 2ETNA 4QZVB 1JVWA 2RUQA 2K8IA 4LAXA 1LJYA 3ARRA 3GU0A 1NMWA 4J4OA 2ZQVA 1W9VA 3B9AA 4WKAA 2YBUA 4TW8A 3CHCA 3UQBA 2VN1A 3UF8A 2IUZA 4IPXA 3PR9A 2F4EA 2XP7A 2AOSA 5HKGA 1HXVA 1ITXA 3O5RA 4QT3A 3GTYX 1A7XA 4LAVA 1E6ZA 4MPKA 3BXWA 4HBEA 5JH8A 5DF0A 1FKGA 2PV2A 2QF8A 1LG1A 2XP4A 3WL1A 2PV3A 4TYOA 2KI3A 4DZ2A 1D6OA 2A3AA 3O5IA 5HW7A 3FAPA 3IKDA 3WL0A 1Q6HA 4MGVA 1YW5A 3FY1A 1M5YA 3B9EA 4IT6A 3AS3A 3KACA 2DT2A 3RMEA 2DSUA 4DWSA 3EY6A 4ODKA 5HUAA 1J4RA 1ZL1A 4IQ2A 1FKKA 3KAHA 4IQCA 3TDBA 2ZQUA 4ZPVR 3CGMA 1LG2A
chains in the Genus database with same CATH topology
1FKHA 2DSVA 1FKBA 1U79A 1SYTA 1JNTA 1ZBCA 2A3BA 2FDMA 1E6PA 1LQ0A 3ALGA 4DT4A 1F40A 2WLZA 4ODMA 4W9PA 5HTGA 1WAWA 1ZBKA 2PPPA 4JFMA 3AS0A 3IK8A 1FFQA 3ARWA 3WD4A 4DROA 1EYMA 4ODRA 3QOKA 4ODPA 5B8IC 2RURA 4HARA 4ZPTR 4WK9A 2OLHA 3G6LA 1NWSA 1UR8A 2ZR5A 3WD1A 1KFWA 1ZU8A 2G8ZA 5HWBA 2L2SA 3ARUA 1NSGA 1X6LA 4DWSD 1QPLA 4DRIA 2AWGA 1KT0A 3KAIA 4GGQA 3TCZA 1CTNA 1H0GA 1W1TA 1BL4A 2VCDA 1J6YA 2XP5A 2MLZA 4Z2KA 2XP8A 1O6IA 3O5GA 3RGCA 4DH0A 2M1IA 4C02B 2Q5AA 5DEZA 1NWTA 1YATA 3LUOA 4Q7NA 1JNSA 2LKNA 2O92A 3WKZA 3KADA 1JNEA 3NTPA 1ZBWA 1HKMA 5HW6A 2A3EA 4U86A 2F2DA 4S3JA 4DRPA 3RM8A 4Z2LA 3O5MA 4O2TA 5DO2A 2DG3A 4XAKA 3ARXA 2DSWA 3O5QA 1LL6A 3AROA 4G2PA 4Z2JA 4AY1A 1WB0A 4Z2IA 1EHNA 1Q6UA 1RD6A 2N87A 1GOIA 2DG4A 3MDYB 4FN2A 1W1PA 3JYJA 3KAFA 4LGXA 4FAPA 4S3KA 3WD3A 4DRNA 1HJVA 1TCOC 3PRBA 4W9OA 1FKIA 1D7IA 1XHGA 2PV1A 4QIBA 3FXYA 1ROUA 3KZ7A 5HBFA 1FD9A 4DRQA 2MLXA 1D7HA 1FKDA 2KR7A 2O9OA 3W4RA 2ITKA 3B8SA 4LAYA 4KQZA 3PRAA 1HKJA 1P5QA 3IKGA 4DIPA 4W5UA 4G50A 1E6NA 3ARQA 4JYSA 3ARSA 3AQUA 3JXVA 1F8AB 1PINA 5HW8A 1LL7A 3G6MA 1W1VA 3OA5A 2B31A 3WIJA 4Z2HA 1HKKA 1X6NA 3ARZA 5GPGA 4WJXA 2PPOA 3O5FA 4MNMA 3O5DA 5HT1A 1ZK6A 4JFKA 2WK2A 3UI5A 1HJXA 3KABA 2DG9A 3O5KA 4MNJA 5DITA 2XP9A 4MSPA 3O5EA 3NI6A 4L3NA 1ZBVA 3WQWA 2ZR6A 1N1AA 3ARPA 1FJDA 4KR0B 2PBCA 5I98A 4PTMA 1ZB5A 3JYMA 2LJ4A 5D75A 2M2AA 1HJWA 2M08A 3KCEA 2KFWA 2MPHA 1Y0OA 3RM9A 3KAGA 4P8XA 1FKTA 2LPVA 4IT4A 2WLYA 2IF4A 1LL4A 4DRMA 3ALFA 4P8UA 2LGOA 1IX5A 1FKLA 4JFJA 2RQSA 1FKRA 4L72B 2UZ5A 3RM4A 2PPNA 2OFNA 1XRVA 4TW6A 3TC5A 4ZS6A 1FFRA 1D7JA 2XP3A 3CGNA 4U84A 4MNLA 5GPRA 4JFIA 3O5PA 4URIA 3UQIA 4HBOA 5J6EA 4U85A 4MTVA 1FKJA 2XPAA 2MF9A 1QPFA 2KO7A 1OGBA 1VF8A 1HKIA 4DRJA 1W9PA 4DWSB 4N19A 3O5OA 3O5LA 4NSBA 2KGJA 2ZQTA 5GQBA 4JFLA 3B9DA 1E6RA 1FKSA 1ROTA 4R0XA 1GUVA 4ODNA 1BKFA 3WD0A 2KE0A 4TNSA 4WKFA 1H0IA 2DT1A 4DRKA 3ARTA 3IHZA 3NRKA 2ESCA 1QZ2A 1TFVA 1ZCNA 1NWUA 4NNRA 3PA7A 2YBTA 1OGGA 3CHFA 4ODLA 3CH9A 1SR0A 3ODKA 3PRDA 3VAWA 3UQAA 2ZQSA 4P8VA 2WM0A 1OWQA 1EDQA 1T11A 1UR9A 3GPKA 2MNTA 1B6CA 2FAPA 2XP6A 3ARYA 3UI4A 1J4IA 3ARVA 4QT2A 2RUCA 2Y78A 1EQ3A 4Q22A 4DZ3A 4Z2GA 2XPBA 3UI6A 4LAWA 1KT1A 3CHEA 1E9LA 3CZ8A 1L1PA 2DSZA 3CHDA 3AS1A 3I6CA 4TX0A 2F21A 1Q1CA 4TW7A 5DIVA 4R5EA 1JNDA 2G41A 4MAVA 2A3CA 4DWSC 4W9QA 2D9FA 4BF8A 3RFWA 5DIUA 1NMVA 4ODOA 1W1YA 4P8WA 2RSEA 1C9HA 1Q6IA 2DT0A 2ZR4A 1E15A 4ML4A 1W9UA 5HWCA 1D2KA 1K9TA 5BXJA 3WQVA 4ZPWR 2DT3A 4GIVA 2RUDA 1GPFA 4DRHA 3H9RB 1NH6A 3O5JA 4J4NA 1R9HA 1NWRA 1FKFA 1J4HA 3AS2A 4ODQA 2JZVA 2FKEA 4WKHA 1W26A 4MNKA 3WD2A 4WIWA 1EIBA 1FAPA 1PBKA 4ITZA 2DPEA 2MLYA 2PI6A 3WH0A 1WNOA 4NZCA 3OOBA 3B7XA 4QZVB 1JVWA 2RUQA 2K8IA 4LAXA 1LJYA 3ARRA 1NMWA 4J4OA 2ZQVA 1W9VA 3B9AA 4WKAA 2YBUA 4TW8A 3CHCA 3UQBA 2VN1A 3UF8A 2IUZA 4IPXA 3PR9A 2F4EA 2XP7A 2AOSA 5HKGA 1HXVA 1ITXA 3O5RA 4QT3A 1A7XA 4LAVA 1E6ZA 4MPKA 3BXWA 4HBEA 5JH8A 5DF0A 1FKGA 2PV2A 2QF8A 1LG1A 2XP4A 3WL1A 2PV3A 4TYOA 2KI3A 4DZ2A 1D6OA 2A3AA 3O5IA 5HW7A 3FAPA 3IKDA 3WL0A 1Q6HA 4MGVA 1YW5A 3FY1A 1M5YA 3B9EA 4IT6A 3AS3A 3KACA 2DT2A 3RMEA 2DSUA 4DWSA 3EY6A 4ODKA 5HUAA 1J4RA 1ZL1A 4IQ2A 1FKKA 3KAHA 4IQCA 3TDBA 2ZQUA 4ZPVR 3CGMA 1LG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKH A;  2OFN A;  4FN2 A;  1FKB A;  2RSE A;  1U79 A;  1C9H A;  1Q6I A;  3JYJ A;  1JNT A;  2ZR4 A;  3KAF A;  4TW6 A;  3TC5 A;  4FAP A;  1D7J A;  2XP3 A;  5HWB A;  3CGN A;  4DRN A;  4DT4 A;  4U84 A;  1F40 A;  4ODM A;  4W9P A;  1TCO C;  3PRB A;  5HWC A;  4W9O A;  5HTG A;  4JFI A;  3O5P A;  5BXJ A;  1FKI A;  1D7I A;  2PPP A;  2PV1 A;  4QIB A;  4JFM A;  3UQI A;  3IK8 A;  4GIV A;  2RUD A;  5J6E A;  4DRH A;  3H9R B;  4U85 A;  1ROU A;  3KZ7 A;  1FD9 A;  3O5J A;  4DRQ A;  4J4N A;  1R9H A;  1FKJ A;  2XPA A;  1EYM A;  4DRO A;  1FKF A;  1J4H A;  4ODR A;  2MLX A;  2KR7 A;  1D7H A;  1FKD A;  2FKE A;  2JZV A;  1QPF A;  1W26 A;  2ITK A;  2KO7 A;  2MF9 A;  4ODP A;  4DRJ A;  4LAY A;  5B8I C;  4N19 A;  3O5O A;  2RUR A;  1FAP A;  1PBK A;  3O5L A;  4ITZ A;  2KGJ A;  2MLY A;  4ODQ A;  2ZQT A;  3WH0 A;  4JFL A;  2ZR5 A;  3OOB A;  2L2S A;  1FKS A;  1ROT A;  1P5Q A;  3B7X A;  3IKG A;  4R0X A;  1JVW A;  1NSG A;  3CGM A;  4ODN A;  4DIP A;  2RUQ A;  2K8I A;  1BKF A;  1QPL A;  4LAX A;  4G50 A;  4DRI A;  2KE0 A;  2AWG A;  4JYS A;  4TNS A;  3JXV A;  1F8A B;  1KT0 A;  1NMW A;  3KAI A;  4GGQ A;  2ZQV A;  4J4O A;  1PIN A;  5HW8 A;  4DRK A;  3TCZ A;  3IHZ A;  4TW8 A;  3NRK A;  3UQB A;  2VN1 A;  1QZ2 A;  3UF8 A;  1BL4 A;  2VCD A;  1ZCN A;  5GPG A;  4IPX A;  1J6Y A;  4NNR A;  2F4E A;  3PA7 A;  2XP5 A;  2MLZ A;  2XP7 A;  2XP8 A;  4ODL A;  2PPO A;  3O5F A;  5HKG A;  1HXV A;  3O5R A;  4QT3 A;  3O5D A;  5HT1 A;  1ZK6 A;  3O5G A;  1A7X A;  4JFK A;  4LAV A;  3RGC A;  3ODK A;  4DH0 A;  2M1I A;  3KAB A;  3UI5 A;  4C02 B;  2DG9 A;  2Q5A A;  3PRD A;  3O5K A;  3VAW A;  1FKG A;  2PV2 A;  2ZQS A;  3MDY B;  5DIT A;  3UQA A;  2XP9 A;  2XP4 A;  4MSP A;  3O5E A;  1YAT A;  3LUO A;  3NI6 A;  1T11 A;  2PV3 A;  4TYO A;  1JNS A;  3GPK A;  2KI3 A;  2MNT A;  1B6C A;  2ZR6 A;  1N1A A;  2LKN A;  4DZ2 A;  1FJD A;  1D6O A;  2FAP A;  3KAD A;  3O5I A;  2PBC A;  3NTP A;  5HW7 A;  5I98 A;  2XP6 A;  3JYM A;  3FAP A;  5HW6 A;  4U86 A;  3IKD A;  2F2D A;  1Q6H A;  2LJ4 A;  4MGV A;  3UI4 A;  4DRP A;  1J4I A;  1YW5 A;  4QT2 A;  1M5Y A;  2M2A A;  2RUC A;  2Y78 A;  3O5M A;  5D75 A;  4DZ3 A;  4O2T A;  1EQ3 A;  2DG3 A;  2M08 A;  2XPB A;  3KCE A;  3UI6 A;  2KFW A;  1KT1 A;  2MPH A;  4LAW A;  1L1P A;  1Y0O A;  3O5Q A;  3KAC A;  3KAG A;  1FKT A;  2LPV A;  3I6C A;  2IF4 A;  3EY6 A;  4TX0 A;  4DRM A;  2F21 A;  4G2P A;  1Q1C A;  4ODK A;  4TW7 A;  5HUA A;  2LGO A;  5DIV A;  1J4R A;  4IQ2 A;  1Q6U A;  1FKK A;  3KAH A;  4IQC A;  2N87 A;  4W9Q A;  3TDB A;  2DG4 A;  1FKL A;  2D9F A;  4JFJ A;  2RQS A;  2ZQU A;  4BF8 A;  3RFW A;  5DIU A;  1NMV A;  1FKR A;  4ODO A;  2UZ5 A;  2PPN A; 
#chains in the Genus database with same CATH topology
 1FKH A;  2DSV A;  1FKB A;  1U79 A;  1SYT A;  1JNT A;  1ZBC A;  2A3B A;  2FDM A;  1E6P A;  1LQ0 A;  3ALG A;  4DT4 A;  1F40 A;  2WLZ A;  4ODM A;  4W9P A;  5HTG A;  1WAW A;  1ZBK A;  2PPP A;  4JFM A;  3AS0 A;  3IK8 A;  1FFQ A;  3ARW A;  3WD4 A;  4DRO A;  1EYM A;  4ODR A;  3QOK A;  4ODP A;  5B8I C;  4UDM A;  2RUR A;  4HAR A;  4ZPT R;  4WK9 A;  2OLH A;  3G6L A;  1NWS A;  1UR8 A;  2ZR5 A;  3WD1 A;  1KFW A;  1ZU8 A;  2G8Z A;  5HWB A;  2L2S A;  3ARU A;  1NSG A;  1X6L A;  4DWS D;  1QPL A;  4DRI A;  2AWG A;  1KT0 A;  3KAI A;  4GGQ A;  3TCZ A;  1CTN A;  1H0G A;  1W1T A;  1BL4 A;  2VCD A;  1J6Y A;  2XP5 A;  2MLZ A;  4Z2K A;  2XP8 A;  1O6I A;  3O5G A;  3RGC A;  4DH0 A;  2M1I A;  4C02 B;  2Q5A A;  5DEZ A;  1NWT A;  1YAT A;  3LUO A;  4Q7N A;  1JNS A;  1JCH B;  2LKN A;  2O92 A;  3WKZ A;  3KAD A;  1JNE A;  3NTP A;  1ZBW A;  1HKM A;  5HW6 A;  2A3E A;  4U86 A;  2F2D A;  4S3J A;  4DRP A;  3RM8 A;  4Z2L A;  3O5M A;  4O2T A;  5DO2 A;  2DG3 A;  4XAK A;  3ARX A;  2DSW A;  3O5Q A;  3BMB A;  1LL6 A;  3ARO A;  4G2P A;  4Z2J A;  4AY1 A;  1WB0 A;  4Z2I A;  1EHN A;  1Q6U A;  1RD6 A;  2N87 A;  1GOI A;  2DG4 A;  3MDY B;  4FN2 A;  1W1P A;  1GRJ A;  3JYJ A;  3KAF A;  4LGX A;  4FAP A;  4S3K A;  3WD3 A;  4DRN A;  1HJV A;  1TCO C;  3PRB A;  4W9O A;  1FKI A;  1D7I A;  1XHG A;  2PV1 A;  4QIB A;  3FXY A;  1ROU A;  3KZ7 A;  5HBF A;  1FD9 A;  4DRQ A;  2MLX A;  1D7H A;  1FKD A;  2KR7 A;  2O9O A;  2P4V A;  3W4R A;  2ITK A;  3B8S A;  4LAY A;  4KQZ A;  3PRA A;  1HKJ A;  1P5Q A;  3IKG A;  4DIP A;  4W5U A;  4G50 A;  1E6N A;  3ARQ A;  4JYS A;  3ARS A;  3AQU A;  3JXV A;  1F8A B;  1PIN A;  5HW8 A;  1LL7 A;  3G6M A;  1W1V A;  3OA5 A;  2B31 A;  3WIJ A;  4Z2H A;  1HKK A;  1X6N A;  3ARZ A;  5GPG A;  4WJX A;  2PPO A;  3O5F A;  4MNM A;  3O5D A;  5HT1 A;  1ZK6 A;  4JFK A;  2WK2 A;  3UI5 A;  1HJX A;  3KAB A;  2DG9 A;  3O5K A;  4MNJ A;  5DIT A;  2XP9 A;  4MSP A;  3O5E A;  3NI6 A;  4L3N A;  1ZBV A;  3WQW A;  2ZR6 A;  1N1A A;  3ARP A;  1FJD A;  4KR0 B;  2PBC A;  5I98 A;  4PTM A;  1ZB5 A;  3JYM A;  2LJ4 A;  5D75 A;  2M2A A;  1HJW A;  2M08 A;  3KCE A;  2KFW A;  2MPH A;  1Y0O A;  3RM9 A;  3KAG A;  4P8X A;  1FKT A;  2LPV A;  4IT4 A;  2WLY A;  2IF4 A;  1LL4 A;  4DRM A;  3ALF A;  4P8U A;  2LGO A;  1IX5 A;  2B5U B;  1FKL A;  4JFJ A;  2RQS A;  2PN0 A;  1FKR A;  4L72 B;  2UZ5 A;  3RM4 A;  2PPN A;  2OFN A;  1XRV A;  4TW6 A;  3TC5 A;  4ZS6 A;  1FFR A;  1D7J A;  2XP3 A;  3CGN A;  4U84 A;  4MNL A;  5GPR A;  4JFI A;  3O5P A;  4URI A;  3UQI A;  4HBO A;  5J6E A;  4U85 A;  4MTV A;  1FKJ A;  2XPA A;  2MF9 A;  1QPF A;  2KO7 A;  1OGB A;  1VF8 A;  1HKI A;  4DRJ A;  1W9P A;  4DWS B;  4N19 A;  3O5O A;  3O5L A;  4NSB A;  2KGJ A;  2ZQT A;  5GQB A;  4JFL A;  3B9D A;  1E6R A;  1FKS A;  1ROT A;  4R0X A;  1GUV A;  4ODN A;  3EIP A;  2F23 A;  1BKF A;  3WD0 A;  2KE0 A;  4TNS A;  4WKF A;  1H0I A;  2DT1 A;  4DRK A;  3ART A;  3IHZ A;  3NRK A;  2ESC A;  1QZ2 A;  1TFV A;  1ZCN A;  1NWU A;  4NNR A;  3PA7 A;  2YBT A;  1OGG A;  3CHF A;  4ODL A;  3CH9 A;  1SR0 A;  3ODK A;  2EUL A;  3PRD A;  3VAW A;  3UQA A;  2ZQS A;  4P8V A;  2WM0 A;  1OWQ A;  1EDQ A;  1T11 A;  1UR9 A;  3GPK A;  2MNT A;  1B6C A;  2FAP A;  2XP6 A;  3ARY A;  3UI4 A;  1J4I A;  3ARV A;  4QT2 A;  2RUC A;  2Y78 A;  1EQ3 A;  4Q22 A;  4DZ3 A;  4Z2G A;  2XPB A;  3UI6 A;  4LAW A;  1KT1 A;  3CHE A;  1E9L A;  3CZ8 A;  1L1P A;  2DSZ A;  3CHD A;  3AS1 A;  3I6C A;  4TX0 A;  2F21 A;  1Q1C A;  4TW7 A;  1E44 A;  5DIV A;  4R5E A;  1JND A;  2G41 A;  4MAV A;  2A3C A;  4DWS C;  4W9Q A;  2D9F A;  4BF8 A;  3RFW A;  5DIU A;  1NMV A;  4ODO A;  1W1Y A;  4P8W A;  2RSE A;  1C9H A;  1Q6I A;  2DT0 A;  2ZR4 A;  1E15 A;  4ML4 A;  1W9U A;  5HWC A;  1D2K A;  1K9T A;  5BXJ A;  3WQV A;  4ZPW R;  2DT3 A;  4GIV A;  2RUD A;  1GPF A;  4DRH A;  3H9R B;  1NH6 A;  3O5J A;  4J4N A;  1R9H A;  1NWR A;  1FKF A;  1J4H A;  3AS2 A;  4ODQ A;  2JZV A;  2FKE A;  4WKH A;  1W26 A;  4MNK A;  3WD2 A;  4WIW A;  1EIB A;  1FAP A;  1PBK A;  4ITZ A;  2DPE A;  2MLY A;  2PI6 A;  3WH0 A;  1WNO A;  4NZC A;  3OOB A;  3B7X A;  2ETN A;  4QZV B;  1JVW A;  2RUQ A;  2K8I A;  4LAX A;  1LJY A;  3ARR A;  3GU0 A;  1NMW A;  4J4O A;  2ZQV A;  1W9V A;  3B9A A;  4WKA A;  2YBU A;  4TW8 A;  3CHC A;  3UQB A;  2VN1 A;  3UF8 A;  2IUZ A;  4IPX A;  3PR9 A;  2F4E A;  2XP7 A;  2AOS A;  5HKG A;  1HXV A;  1ITX A;  3O5R A;  4QT3 A;  3GTY X;  1A7X A;  4LAV A;  1E6Z A;  4MPK A;  3BXW A;  4HBE A;  5JH8 A;  5DF0 A;  1FKG A;  2PV2 A;  2QF8 A;  1LG1 A;  2XP4 A;  3WL1 A;  2PV3 A;  4TYO A;  2KI3 A;  4DZ2 A;  1D6O A;  2A3A A;  3O5I A;  5HW7 A;  3FAP A;  3IKD A;  3WL0 A;  1Q6H A;  4MGV A;  1YW5 A;  3FY1 A;  1M5Y A;  3B9E A;  4IT6 A;  3AS3 A;  3KAC A;  2DT2 A;  3RME A;  2DSU A;  4DWS A;  3EY6 A;  4ODK A;  5HUA A;  1J4R A;  1ZL1 A;  4IQ2 A;  1FKK A;  3KAH A;  4IQC A;  3TDB A;  2ZQU A;  4ZPV R;  3CGM A;  1LG2 A; 
#chains in the Genus database with same CATH homology
 1FKH A;  2DSV A;  1FKB A;  1U79 A;  1SYT A;  1JNT A;  1ZBC A;  2A3B A;  2FDM A;  1E6P A;  1LQ0 A;  3ALG A;  4DT4 A;  1F40 A;  2WLZ A;  4ODM A;  4W9P A;  5HTG A;  1WAW A;  1ZBK A;  2PPP A;  4JFM A;  3AS0 A;  3IK8 A;  1FFQ A;  3ARW A;  3WD4 A;  4DRO A;  1EYM A;  4ODR A;  3QOK A;  4ODP A;  5B8I C;  2RUR A;  4HAR A;  4ZPT R;  4WK9 A;  2OLH A;  3G6L A;  1NWS A;  1UR8 A;  2ZR5 A;  3WD1 A;  1KFW A;  1ZU8 A;  2G8Z A;  5HWB A;  2L2S A;  3ARU A;  1NSG A;  1X6L A;  4DWS D;  1QPL A;  4DRI A;  2AWG A;  1KT0 A;  3KAI A;  4GGQ A;  3TCZ A;  1CTN A;  1H0G A;  1W1T A;  1BL4 A;  2VCD A;  1J6Y A;  2XP5 A;  2MLZ A;  4Z2K A;  2XP8 A;  1O6I A;  3O5G A;  3RGC A;  4DH0 A;  2M1I A;  4C02 B;  2Q5A A;  5DEZ A;  1NWT A;  1YAT A;  3LUO A;  4Q7N A;  1JNS A;  2LKN A;  2O92 A;  3WKZ A;  3KAD A;  1JNE A;  3NTP A;  1ZBW A;  1HKM A;  5HW6 A;  2A3E A;  4U86 A;  2F2D A;  4S3J A;  4DRP A;  3RM8 A;  4Z2L A;  3O5M A;  4O2T A;  5DO2 A;  2DG3 A;  4XAK A;  3ARX A;  2DSW A;  3O5Q A;  1LL6 A;  3ARO A;  4G2P A;  4Z2J A;  4AY1 A;  1WB0 A;  4Z2I A;  1EHN A;  1Q6U A;  1RD6 A;  2N87 A;  1GOI A;  2DG4 A;  3MDY B;  4FN2 A;  1W1P A;  3JYJ A;  3KAF A;  4LGX A;  4FAP A;  4S3K A;  3WD3 A;  4DRN A;  1HJV A;  1TCO C;  3PRB A;  4W9O A;  1FKI A;  1D7I A;  1XHG A;  2PV1 A;  4QIB A;  3FXY A;  1ROU A;  3KZ7 A;  5HBF A;  1FD9 A;  4DRQ A;  2MLX A;  1D7H A;  1FKD A;  2KR7 A;  2O9O A;  3W4R A;  2ITK A;  3B8S A;  4LAY A;  4KQZ A;  3PRA A;  1HKJ A;  1P5Q A;  3IKG A;  4DIP A;  4W5U A;  4G50 A;  1E6N A;  3ARQ A;  4JYS A;  3ARS A;  3AQU A;  3JXV A;  1F8A B;  1PIN A;  5HW8 A;  1LL7 A;  3G6M A;  1W1V A;  3OA5 A;  2B31 A;  3WIJ A;  4Z2H A;  1HKK A;  1X6N A;  3ARZ A;  5GPG A;  4WJX A;  2PPO A;  3O5F A;  4MNM A;  3O5D A;  5HT1 A;  1ZK6 A;  4JFK A;  2WK2 A;  3UI5 A;  1HJX A;  3KAB A;  2DG9 A;  3O5K A;  4MNJ A;  5DIT A;  2XP9 A;  4MSP A;  3O5E A;  3NI6 A;  4L3N A;  1ZBV A;  3WQW A;  2ZR6 A;  1N1A A;  3ARP A;  1FJD A;  4KR0 B;  2PBC A;  5I98 A;  4PTM A;  1ZB5 A;  3JYM A;  2LJ4 A;  5D75 A;  2M2A A;  1HJW A;  2M08 A;  3KCE A;  2KFW A;  2MPH A;  1Y0O A;  3RM9 A;  3KAG A;  4P8X A;  1FKT A;  2LPV A;  4IT4 A;  2WLY A;  2IF4 A;  1LL4 A;  4DRM A;  3ALF A;  4P8U A;  2LGO A;  1IX5 A;  1FKL A;  4JFJ A;  2RQS A;  1FKR A;  4L72 B;  2UZ5 A;  3RM4 A;  2PPN A;  2OFN A;  1XRV A;  4TW6 A;  3TC5 A;  4ZS6 A;  1FFR A;  1D7J A;  2XP3 A;  3CGN A;  4U84 A;  4MNL A;  5GPR A;  4JFI A;  3O5P A;  4URI A;  3UQI A;  4HBO A;  5J6E A;  4U85 A;  4MTV A;  1FKJ A;  2XPA A;  2MF9 A;  1QPF A;  2KO7 A;  1OGB A;  1VF8 A;  1HKI A;  4DRJ A;  1W9P A;  4DWS B;  4N19 A;  3O5O A;  3O5L A;  4NSB A;  2KGJ A;  2ZQT A;  5GQB A;  4JFL A;  3B9D A;  1E6R A;  1FKS A;  1ROT A;  4R0X A;  1GUV A;  4ODN A;  1BKF A;  3WD0 A;  2KE0 A;  4TNS A;  4WKF A;  1H0I A;  2DT1 A;  4DRK A;  3ART A;  3IHZ A;  3NRK A;  2ESC A;  1QZ2 A;  1TFV A;  1ZCN A;  1NWU A;  4NNR A;  3PA7 A;  2YBT A;  1OGG A;  3CHF A;  4ODL A;  3CH9 A;  1SR0 A;  3ODK A;  3PRD A;  3VAW A;  3UQA A;  2ZQS A;  4P8V A;  2WM0 A;  1OWQ A;  1EDQ A;  1T11 A;  1UR9 A;  3GPK A;  2MNT A;  1B6C A;  2FAP A;  2XP6 A;  3ARY A;  3UI4 A;  1J4I A;  3ARV A;  4QT2 A;  2RUC A;  2Y78 A;  1EQ3 A;  4Q22 A;  4DZ3 A;  4Z2G A;  2XPB A;  3UI6 A;  4LAW A;  1KT1 A;  3CHE A;  1E9L A;  3CZ8 A;  1L1P A;  2DSZ A;  3CHD A;  3AS1 A;  3I6C A;  4TX0 A;  2F21 A;  1Q1C A;  4TW7 A;  5DIV A;  4R5E A;  1JND A;  2G41 A;  4MAV A;  2A3C A;  4DWS C;  4W9Q A;  2D9F A;  4BF8 A;  3RFW A;  5DIU A;  1NMV A;  4ODO A;  1W1Y A;  4P8W A;  2RSE A;  1C9H A;  1Q6I A;  2DT0 A;  2ZR4 A;  1E15 A;  4ML4 A;  1W9U A;  5HWC A;  1D2K A;  1K9T A;  5BXJ A;  3WQV A;  4ZPW R;  2DT3 A;  4GIV A;  2RUD A;  1GPF A;  4DRH A;  3H9R B;  1NH6 A;  3O5J A;  4J4N A;  1R9H A;  1NWR A;  1FKF A;  1J4H A;  3AS2 A;  4ODQ A;  2JZV A;  2FKE A;  4WKH A;  1W26 A;  4MNK A;  3WD2 A;  4WIW A;  1EIB A;  1FAP A;  1PBK A;  4ITZ A;  2DPE A;  2MLY A;  2PI6 A;  3WH0 A;  1WNO A;  4NZC A;  3OOB A;  3B7X A;  4QZV B;  1JVW A;  2RUQ A;  2K8I A;  4LAX A;  1LJY A;  3ARR A;  1NMW A;  4J4O A;  2ZQV A;  1W9V A;  3B9A A;  4WKA A;  2YBU A;  4TW8 A;  3CHC A;  3UQB A;  2VN1 A;  3UF8 A;  2IUZ A;  4IPX A;  3PR9 A;  2F4E A;  2XP7 A;  2AOS A;  5HKG A;  1HXV A;  1ITX A;  3O5R A;  4QT3 A;  1A7X A;  4LAV A;  1E6Z A;  4MPK A;  3BXW A;  4HBE A;  5JH8 A;  5DF0 A;  1FKG A;  2PV2 A;  2QF8 A;  1LG1 A;  2XP4 A;  3WL1 A;  2PV3 A;  4TYO A;  2KI3 A;  4DZ2 A;  1D6O A;  2A3A A;  3O5I A;  5HW7 A;  3FAP A;  3IKD A;  3WL0 A;  1Q6H A;  4MGV A;  1YW5 A;  3FY1 A;  1M5Y A;  3B9E A;  4IT6 A;  3AS3 A;  3KAC A;  2DT2 A;  3RME A;  2DSU A;  4DWS A;  3EY6 A;  4ODK A;  5HUA A;  1J4R A;  1ZL1 A;  4IQ2 A;  1FKK A;  3KAH A;  4IQC A;  3TDB A;  2ZQU A;  4ZPV R;  3CGM A;  1LG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...