4ODKA

Structure of slyd from thermus thermophilus in complex with t1 peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
156
structure length
153
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 34
structure length 153
sequence length 156
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odkA00
2KR7A 3KZ7A 4TYOA 1FKBA 3NRKA 2XP4A 2MLYA 4TX0A 1D7HA 4W9PA 3RGCA 3KACA 4TW7A 1ROUA 3KADA 1NSGA 4MSPA 4JFMA 1QPFA 4JFJA 4J4OA 2RUDA 4QT3A 2XP9A 1D7JA 1Q1CA 1QPLA 3NTPA 2LPVA 4J4NA 3JYMA 3O5LA 3O5GA 1FKHA 2ZQVA 2F2DA 4ODMA 3UF8A 2AWGA 3O5IA 3CGNA 4TNSA 5HWBA 1N1AA 2K8IA 2Y78A 2UZ5A 4GIVA 2PBCA 4ODQA 4ODPA 3ODKA 2KFWA 4ODNA 4O2TA 1ZK6A 2D9FA 2XP8A 1D6OA 1W26A 1R9HA 2XP6A 4ODRA 5DIVA 4DIPA 1YW5A 1FD9A 2MNTA 4LAWA 2ZQUA 3UQBA 3IHZA 1P5QA 2F21A 3O5EA 1FKJA 5HW6A 4DROA 2ZQTA 3KAIA 4ODOA 1J4HA 4R0XA 3UI6A 3UI5A 2DG3A 1C9HA 3O5DA 4U84A 1KT0A 2PPPA 1F40A 1JNSA 3O5PA 1YATA 3FAPA 3JYJA 4FAPA 4JYSA 3NI6A 5HT1A 1QZ2A 1Q6HA 1EQ3A 4JFKA 2XP3A 4JFLA 2ZQSA 5BXJA 2DG4A 2PV2A 2XPBA 1Q6IA 3B7XA 3KAGA 1J6YA 4G50A 2ITKA 2PV1A 3O5FA 2Q5AA 3TCZA 4U86A 3UI4A 3PRDA 3PRBA 4DRKA 3I6CA 3IK8A 3JXVA 1A7XA 4DRIA 5HW8A 4QIBA 4IQCA 4DZ3A 1HXVA 1FKSA 2MF9A 4N19A 1BKFA 1FKRA 2RQSA 4W9OA 3IKGA 4DRJA 3O5KA 4DRMA 1FKLA 2KO7A 4GGQA 3O5JA 4LAVA 2LGOA 2RSEA 2ZR6A 1FKDA 1FKTA 4DRNA 4DT4A 2XPAA 1NMVA 3LUOA 5DITA 5HUAA 1NMWA 5HWCA 2DG9A 5GPGA 2M1IA 2MPHA 3UQIA 2F4EA 3O5RA 2L2SA 1ZCNA 1KT1A 2IF4A 1JNTA 4ODLA 4DRHA 2RURA 4JFIA 2MLXA 2PPOA 4TW8A 2PPNA 5D75A 3RFWA 4DH0A 1FJDA 4IPXA 3UQAA 3PA7A 2M2AA 2PV3A 1FKGA 3EY6A 1D7IA 2JZVA 3O5OA 4LAXA 5DIUA 3TDBA 4QT2A 3KABA 3O5QA 4W9QA 2KI3A 4LAYA 3H9RB 5B8IC 1FKIA 2MLZA 1M5YA 4ODKA 2KGJA 4IQ2A 5HTGA 2ZR5A 5HKGA 3VAWA 3KAHA 1JVWA 2XP5A 3GPKA 1FKKA 2OFNA 1PINA 4DRQA 1B6CA 1FAPA 2LJ4A 1Q6UA 3OOBA 4MGVA 1J4IA 3TC5A 2LKNA 5J6EA 1T11A 4NNRA 2XP7A 5I98A 1ROTA 1BL4A 3WH0A 4C02B 3CGMA 1L1PA 1FKFA 2FKEA 2FAPA 2N87A 1J4RA 3O5MA 1U79A 4BF8A 4TW6A 1F8AB 4FN2A 4ITZA 4G2PA 3MDYB 2KE0A 2ZR4A 1EYMA 1Y0OA 3IKDA 3KAFA 2RUCA 2VCDA 2VN1A 4DZ2A 5HW7A 2M08A 1PBKA 2RUQA 4U85A 3KCEA 1TCOC 4DRPA
chains in the Genus database with same CATH superfamily
1JNDA 1EDQA 1FKBA 1LL4A 3FXYA 2DT1A 3WD3A 2A3EA 3KADA 1ZBWA 4JFMA 4J4OA 2XP9A 1D7JA 1Q1CA 3NTPA 4J4NA 3UF8A 3CGNA 2Y78A 4ODPA 3ODKA 4ZPTR 1WNOA 4O2TA 4QZVB 2D9FA 5DIVA 1D6OA 1W26A 1E9LA 3B9AA 4WIWA 1FD9A 4LAWA 1W1TA 4XAKA 1LQ0A 4Z2GA 3WQVA 2QF8A 3O5EA 5HW6A 1IX5A 3CHDA 4DROA 1HJVA 1NWTA 3UI5A 3RM4A 1KT0A 1F40A 3O5PA 1YATA 3RM9A 1W1PA 1EQ3A 2XP3A 1HKJA 5BXJA 2DG4A 3ARSA 1Q6IA 2PN0A 2PV1A 3O5FA 3TCZA 4U86A 1ZB5A 3IK8A 3JXVA 4P8XA 1W9VA 5HW8A 3G6LA 3PR9A 1BKFA 2LGOA 1FKTA 1NMVA 1CTNA 1OGBA 5DITA 5HUAA 1NMWA 3GU0A 2F23A 5HWCA 5GPGA 1RD6A 3AS2A 3O5RA 3WL0A 3B9DA 4P8WA 2OLHA 3BXWA 4DRHA 2RURA 4Z2IA 2PPOA 2PPNA 4DH0A 3BMBA 4IPXA 3UQAA 4MNKA 3CH9A 1HJWA 1XRVA 3ARXA 1D2KA 4LGXA 1WB0A 3O5QA 5B8IC 2MLZA 1M5YA 4ODKA 2KGJA 1SYTA 4Z2LA 3KAHA 2WM0A 2OFNA 4MNJA 5DO2A 2XP7A 1ROTA 4C02B 2N87A 2KE0A 4DZ2A 1HJXA 1LJYA 1W9PA 4W5UA 4Z2HA 4IT6A 3KCEA 4MSPA 3CHEA 2IUZA 4DWSC 3KZ7A 2DSUA 3AROA 4WKFA 1OWQA 4W9PA 1HKIA 3RGCA 1ROUA 1QPLA 3JYMA 2ZQVA 4DWSB 5HWBA 1N1AA 4UDMA 4NSBA 2UZ5A 4GIVA 2PBCA 1WAWA 1ZK6A 2XP8A 5DF0A 1L1PA 1YW5A 2MNTA 2ZQTA 1J4HA 1C9HA 4U84A 2PPPA 1JNSA 3FAPA 3JYJA 4FAPA 5HT1A 4JFKA 2A3BA 2XPBA 3ARZA 3B7XA 3KAGA 4IT4A 4S3KA 5GPRA 1GPFA 4HARA 3FY1A 3W4RA 4ZS6A 4DRKA 4DRIA 1FKSA 3WD0A 3AS3A 3IKGA 3B9EA 4DRMA 1FKLA 4KQZA 1FKDA 3LUOA 3ARQA 1ITXA 2MPHA 2F4EA 1UR9A 1ZCNA 2IF4A 1W1VA 1JNTA 4ODLA 4JFIA 4R5EA 3PA7A 3WKZA 3TDBA 2JZVA 5DIUA 4QT2A 2ESCA 4LAYA 3H9RB 1FKIA 2AOSA 5HKGA 3VAWA 1JVWA 2PI6A 1FKKA 1NH6A 1PINA 1W1YA 1B6CA 4P8UA 3TC5A 1E6RA 1JCHB 4MAVA 1U79A 4WKAA 4ITZA 1W9UA 1EYMA 1Y0OA 2ZR4A 3IKDA 5HW7A 2M08A 4DRPA 3RM8A 3WD2A 3ARYA 4TYOA 4Q7NA 2XP4A 4TX0A 1D7HA 3AS1A 1ZBVA 3KACA 2DPEA 4DWSA 1QPFA 2RUDA 1GRJA 4P8VA 1ZBCA 2LPVA 3O5GA 4ODMA 2AWGA 4TNSA 5GQBA 3WQWA 2KFWA 4DIPA 4ODRA 2YBUA 3G6MA 3IHZA 1P5QA 1SR0A 2F21A 1FKJA 1EHNA 2DT3A 3KAIA 3GTYX 2DG3A 4WKHA 3ARTA 3WL1A 4JYSA 3NI6A 2YBTA 4JFLA 2PV2A 3CZ8A 2A3AA 1E6ZA 1J6YA 2B31A 2Q5AA 3PRBA 1X6NA 1ZU8A 3I6CA 1A7XA 1HXVA 2MF9A 1GOIA 4MPKA 1FKRA 3ARPA 1FFQA 3ARWA 3O5KA 1E15A 4GGQA 3O5JA 4LAVA 3ALGA 1E6PA 2RSEA 2ZR6A 4DRNA 2XPAA 4URIA 2DSWA 1XHGA 2DG9A 3UQIA 3AS0A 2L2SA 3CHCA 1KT1A 1E44A 2MLXA 1FJDA 5D75A 1NWSA 3RFWA 2M2AA 2PV3A 3O5OA 1D7IA 4LAXA 4W9QA 3RMEA 2WLYA 2G41A 2WK2A 5HTGA 5HBFA 2ZR5A 3WIJA 1LL6A 2XP5A 1NWRA 2ETNA 4WK9A 4DRQA 4MGVA 1J4IA 4KR0B 2LKNA 2O9OA 5J6EA 4Q22A 3QOKA 2FKEA 2B5UB 2DSZA 1FFRA 2FAPA 1J4RA 4BF8A 4TW6A 1F8AB 4FN2A 2A3CA 2G8ZA 3OA5A 2RUCA 2VN1A 1LL7A 1PBKA 2RUQA 1TCOC 2FDMA 2KR7A 4Z2JA 4HBOA 1H0IA 1LG1A 3NRKA 4L3NA 3ARVA 2MLYA 4ZPWR 4TW7A 1NSGA 1HKKA 4JFJA 4QT3A 4ZPVR 4MNMA 4S3JA 3O5LA 3WD4A 1FKHA 2F2DA 3O5IA 1K9TA 4ML4A 2K8IA 1ZL1A 4MTVA 4ODQA 4ODNA 1EIBA 1VF8A 1O6IA 2XP6A 1R9HA 3ARUA 3UQBA 2ZQUA 1ZBKA 1KFWA 4ODOA 4R0XA 3UI6A 1GUVA 3O5DA 2DT2A 1QZ2A 1Q6HA 2ZQSA 3CHFA 4G50A 2ITKA 5DEZA 3UI4A 3PRDA 1JNEA 1E6NA 3EIPA 4MNLA 4PTMA 4QIBA 4IQCA 4DZ3A 3WD1A 4N19A 2RQSA 4W9OA 4DRJA 2KO7A 4L72B 2DSVA 4DT4A 4DWSD 2M1IA 2WLZA 4NZCA 2EULA 1HKMA 4Z2KA 4TW8A 3EY6A 1H0GA 1FKGA 3KABA 2KI3A 3B8SA 2P4VA 4IQ2A 3GPKA 1UR8A 1LG2A 1FAPA 1NWUA 2LJ4A 1Q6UA 3OOBA 3AQUA 1TFVA 2O92A 4HBEA 1T11A 4NNRA 5I98A 1OGGA 3PRAA 1BL4A 3WH0A 3CGMA 1FKFA 4WJXA 5JH8A 3O5MA 1X6LA 3ALFA 4G2PA 3MDYB 3KAFA 2VCDA 3ARRA 4AY1A 2DT0A 4U85A
chains in the Genus database with same CATH topology
1JNDA 1EDQA 1FKBA 1LL4A 3FXYA 2DT1A 3WD3A 2A3EA 3KADA 1ZBWA 4JFMA 4J4OA 2XP9A 1D7JA 1Q1CA 3NTPA 4J4NA 3UF8A 3CGNA 2Y78A 4ODPA 3ODKA 4ZPTR 1WNOA 4O2TA 4QZVB 2D9FA 5DIVA 1D6OA 1W26A 1E9LA 3B9AA 4WIWA 1FD9A 4LAWA 1W1TA 4XAKA 1LQ0A 4Z2GA 3WQVA 2QF8A 3O5EA 5HW6A 1IX5A 3CHDA 4DROA 1HJVA 1NWTA 3UI5A 3RM4A 1KT0A 1F40A 3O5PA 1YATA 3RM9A 1W1PA 1EQ3A 2XP3A 1HKJA 5BXJA 2DG4A 3ARSA 1Q6IA 2PV1A 3O5FA 3TCZA 4U86A 1ZB5A 3IK8A 3JXVA 4P8XA 1W9VA 5HW8A 3G6LA 3PR9A 1BKFA 2LGOA 1FKTA 1NMVA 1CTNA 1OGBA 5DITA 5HUAA 1NMWA 5HWCA 5GPGA 1RD6A 3AS2A 3O5RA 3WL0A 3B9DA 4P8WA 2OLHA 3BXWA 4DRHA 2RURA 4Z2IA 2PPOA 2PPNA 4DH0A 4IPXA 3UQAA 4MNKA 3CH9A 1HJWA 1XRVA 3ARXA 1D2KA 4LGXA 1WB0A 3O5QA 5B8IC 2MLZA 1M5YA 4ODKA 2KGJA 1SYTA 4Z2LA 3KAHA 2WM0A 2OFNA 4MNJA 5DO2A 2XP7A 1ROTA 4C02B 2N87A 2KE0A 4DZ2A 1HJXA 1LJYA 1W9PA 4W5UA 4Z2HA 4IT6A 3KCEA 4MSPA 3CHEA 2IUZA 4DWSC 3KZ7A 2DSUA 3AROA 4WKFA 1OWQA 4W9PA 1HKIA 3RGCA 1ROUA 1QPLA 3JYMA 2ZQVA 4DWSB 5HWBA 1N1AA 4NSBA 2UZ5A 4GIVA 2PBCA 1WAWA 1ZK6A 2XP8A 5DF0A 1L1PA 1YW5A 2MNTA 2ZQTA 1J4HA 1C9HA 4U84A 2PPPA 1JNSA 3FAPA 3JYJA 4FAPA 5HT1A 4JFKA 2A3BA 2XPBA 3ARZA 3B7XA 3KAGA 4IT4A 4S3KA 5GPRA 1GPFA 4HARA 3FY1A 3W4RA 4ZS6A 4DRKA 4DRIA 1FKSA 3WD0A 3AS3A 3IKGA 3B9EA 4DRMA 1FKLA 4KQZA 1FKDA 3LUOA 3ARQA 1ITXA 2MPHA 2F4EA 1UR9A 1ZCNA 2IF4A 1W1VA 1JNTA 4ODLA 4JFIA 4R5EA 3PA7A 3WKZA 3TDBA 2JZVA 5DIUA 4QT2A 2ESCA 4LAYA 3H9RB 1FKIA 2AOSA 5HKGA 3VAWA 1JVWA 2PI6A 1FKKA 1NH6A 1PINA 1W1YA 1B6CA 4P8UA 3TC5A 1E6RA 4MAVA 1U79A 4WKAA 4ITZA 1W9UA 1EYMA 1Y0OA 2ZR4A 3IKDA 5HW7A 2M08A 4DRPA 3RM8A 3WD2A 3ARYA 4TYOA 4Q7NA 2XP4A 4TX0A 1D7HA 3AS1A 1ZBVA 3KACA 2DPEA 4DWSA 1QPFA 2RUDA 4P8VA 1ZBCA 2LPVA 3O5GA 4ODMA 2AWGA 4TNSA 5GQBA 3WQWA 2KFWA 4DIPA 4ODRA 2YBUA 3G6MA 3IHZA 1P5QA 1SR0A 2F21A 1FKJA 1EHNA 2DT3A 3KAIA 2DG3A 4WKHA 3ARTA 3WL1A 4JYSA 3NI6A 2YBTA 4JFLA 2PV2A 3CZ8A 2A3AA 1E6ZA 1J6YA 2B31A 2Q5AA 3PRBA 1X6NA 1ZU8A 3I6CA 1A7XA 1HXVA 2MF9A 1GOIA 4MPKA 1FKRA 3ARPA 1FFQA 3ARWA 3O5KA 1E15A 4GGQA 3O5JA 4LAVA 3ALGA 1E6PA 2RSEA 2ZR6A 4DRNA 2XPAA 4URIA 2DSWA 1XHGA 2DG9A 3UQIA 3AS0A 2L2SA 3CHCA 1KT1A 2MLXA 1FJDA 5D75A 1NWSA 3RFWA 2M2AA 2PV3A 3O5OA 1D7IA 4LAXA 4W9QA 3RMEA 2WLYA 2G41A 2WK2A 5HTGA 5HBFA 2ZR5A 3WIJA 1LL6A 2XP5A 1NWRA 4WK9A 4DRQA 4MGVA 1J4IA 4KR0B 2LKNA 2O9OA 5J6EA 4Q22A 3QOKA 2FKEA 2DSZA 1FFRA 2FAPA 1J4RA 4BF8A 4TW6A 1F8AB 4FN2A 2A3CA 2G8ZA 3OA5A 2RUCA 2VN1A 1LL7A 1PBKA 2RUQA 1TCOC 2FDMA 2KR7A 4Z2JA 4HBOA 1H0IA 1LG1A 3NRKA 4L3NA 3ARVA 2MLYA 4ZPWR 4TW7A 1NSGA 1HKKA 4JFJA 4QT3A 4ZPVR 4MNMA 4S3JA 3O5LA 3WD4A 1FKHA 2F2DA 3O5IA 1K9TA 4ML4A 2K8IA 1ZL1A 4MTVA 4ODQA 4ODNA 1EIBA 1VF8A 1O6IA 2XP6A 1R9HA 3ARUA 3UQBA 2ZQUA 1ZBKA 1KFWA 4ODOA 4R0XA 3UI6A 1GUVA 3O5DA 2DT2A 1QZ2A 1Q6HA 2ZQSA 3CHFA 4G50A 2ITKA 5DEZA 3UI4A 3PRDA 1JNEA 1E6NA 4MNLA 4PTMA 4QIBA 4IQCA 4DZ3A 3WD1A 4N19A 2RQSA 4W9OA 4DRJA 2KO7A 4L72B 2DSVA 4DT4A 4DWSD 2M1IA 2WLZA 4NZCA 1HKMA 4Z2KA 4TW8A 3EY6A 1H0GA 1FKGA 3KABA 2KI3A 3B8SA 4IQ2A 3GPKA 1UR8A 1LG2A 1FAPA 1NWUA 2LJ4A 1Q6UA 3OOBA 3AQUA 1TFVA 2O92A 4HBEA 1T11A 4NNRA 5I98A 1OGGA 3PRAA 1BL4A 3WH0A 3CGMA 1FKFA 4WJXA 5JH8A 3O5MA 1X6LA 3ALFA 4G2PA 3MDYB 3KAFA 2VCDA 3ARRA 4AY1A 2DT0A 4U85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR7 A;  3KZ7 A;  4TYO A;  1FKB A;  3NRK A;  2XP4 A;  2MLY A;  4TX0 A;  1D7H A;  4W9P A;  3RGC A;  3KAC A;  4TW7 A;  1ROU A;  3KAD A;  1NSG A;  4MSP A;  4JFM A;  1QPF A;  4JFJ A;  4J4O A;  2RUD A;  4QT3 A;  2XP9 A;  1D7J A;  1Q1C A;  1QPL A;  3NTP A;  2LPV A;  4J4N A;  3JYM A;  3O5L A;  3O5G A;  1FKH A;  2ZQV A;  2F2D A;  4ODM A;  3UF8 A;  2AWG A;  3O5I A;  3CGN A;  4TNS A;  5HWB A;  1N1A A;  2K8I A;  2Y78 A;  2UZ5 A;  4GIV A;  2PBC A;  4ODQ A;  4ODP A;  3ODK A;  2KFW A;  4ODN A;  4O2T A;  1ZK6 A;  2D9F A;  2XP8 A;  1D6O A;  1W26 A;  1R9H A;  2XP6 A;  4ODR A;  5DIV A;  4DIP A;  1YW5 A;  1FD9 A;  2MNT A;  4LAW A;  2ZQU A;  3UQB A;  3IHZ A;  1P5Q A;  2F21 A;  3O5E A;  1FKJ A;  5HW6 A;  4DRO A;  2ZQT A;  3KAI A;  4ODO A;  1J4H A;  4R0X A;  3UI6 A;  3UI5 A;  2DG3 A;  1C9H A;  3O5D A;  4U84 A;  1KT0 A;  2PPP A;  1F40 A;  1JNS A;  3O5P A;  1YAT A;  3FAP A;  3JYJ A;  4FAP A;  4JYS A;  3NI6 A;  5HT1 A;  1QZ2 A;  1Q6H A;  1EQ3 A;  4JFK A;  2XP3 A;  4JFL A;  2ZQS A;  5BXJ A;  2DG4 A;  2PV2 A;  2XPB A;  1Q6I A;  3B7X A;  3KAG A;  1J6Y A;  4G50 A;  2ITK A;  2PV1 A;  3O5F A;  2Q5A A;  3TCZ A;  4U86 A;  3UI4 A;  3PRD A;  3PRB A;  4DRK A;  3I6C A;  3IK8 A;  3JXV A;  1A7X A;  4DRI A;  5HW8 A;  4QIB A;  4IQC A;  4DZ3 A;  1HXV A;  1FKS A;  2MF9 A;  4N19 A;  1BKF A;  1FKR A;  2RQS A;  4W9O A;  3IKG A;  4DRJ A;  3O5K A;  4DRM A;  1FKL A;  2KO7 A;  4GGQ A;  3O5J A;  4LAV A;  2LGO A;  2RSE A;  2ZR6 A;  1FKD A;  1FKT A;  4DRN A;  4DT4 A;  2XPA A;  1NMV A;  3LUO A;  5DIT A;  5HUA A;  1NMW A;  5HWC A;  2DG9 A;  5GPG A;  2M1I A;  2MPH A;  3UQI A;  2F4E A;  3O5R A;  2L2S A;  1ZCN A;  1KT1 A;  2IF4 A;  1JNT A;  4ODL A;  4DRH A;  2RUR A;  4JFI A;  2MLX A;  2PPO A;  4TW8 A;  2PPN A;  5D75 A;  3RFW A;  4DH0 A;  1FJD A;  4IPX A;  3UQA A;  3PA7 A;  2M2A A;  2PV3 A;  1FKG A;  3EY6 A;  1D7I A;  2JZV A;  3O5O A;  4LAX A;  5DIU A;  3TDB A;  4QT2 A;  3KAB A;  3O5Q A;  4W9Q A;  2KI3 A;  4LAY A;  3H9R B;  5B8I C;  1FKI A;  2MLZ A;  1M5Y A;  4ODK A;  2KGJ A;  4IQ2 A;  5HTG A;  2ZR5 A;  5HKG A;  3VAW A;  3KAH A;  1JVW A;  2XP5 A;  3GPK A;  1FKK A;  2OFN A;  1PIN A;  4DRQ A;  1B6C A;  1FAP A;  2LJ4 A;  1Q6U A;  3OOB A;  4MGV A;  1J4I A;  3TC5 A;  2LKN A;  5J6E A;  1T11 A;  4NNR A;  2XP7 A;  5I98 A;  1ROT A;  1BL4 A;  3WH0 A;  4C02 B;  3CGM A;  1L1P A;  1FKF A;  2FKE A;  2FAP A;  2N87 A;  1J4R A;  3O5M A;  1U79 A;  4BF8 A;  4TW6 A;  1F8A B;  4FN2 A;  4ITZ A;  4G2P A;  3MDY B;  2KE0 A;  2ZR4 A;  1EYM A;  1Y0O A;  3IKD A;  3KAF A;  2RUC A;  2VCD A;  2VN1 A;  4DZ2 A;  5HW7 A;  2M08 A;  1PBK A;  2RUQ A;  4U85 A;  3KCE A;  1TCO C;  4DRP A; 
#chains in the Genus database with same CATH topology
 1JND A;  1EDQ A;  1FKB A;  1LL4 A;  3FXY A;  2DT1 A;  3WD3 A;  2A3E A;  3KAD A;  1ZBW A;  4JFM A;  4J4O A;  2XP9 A;  1D7J A;  1Q1C A;  3NTP A;  4J4N A;  3UF8 A;  3CGN A;  2Y78 A;  4ODP A;  3ODK A;  4ZPT R;  1WNO A;  4O2T A;  4QZV B;  2D9F A;  5DIV A;  1D6O A;  1W26 A;  1E9L A;  3B9A A;  4WIW A;  1FD9 A;  4LAW A;  1W1T A;  4XAK A;  1LQ0 A;  4Z2G A;  3WQV A;  2QF8 A;  3O5E A;  5HW6 A;  1IX5 A;  3CHD A;  4DRO A;  1HJV A;  1NWT A;  3UI5 A;  3RM4 A;  1KT0 A;  1F40 A;  3O5P A;  1YAT A;  3RM9 A;  1W1P A;  1EQ3 A;  2XP3 A;  1HKJ A;  5BXJ A;  2DG4 A;  3ARS A;  1Q6I A;  2PN0 A;  2PV1 A;  3O5F A;  3TCZ A;  4U86 A;  1ZB5 A;  3IK8 A;  3JXV A;  4P8X A;  1W9V A;  5HW8 A;  3G6L A;  3PR9 A;  1BKF A;  2LGO A;  1FKT A;  1NMV A;  1CTN A;  1OGB A;  5DIT A;  5HUA A;  1NMW A;  3GU0 A;  2F23 A;  5HWC A;  5GPG A;  1RD6 A;  3AS2 A;  3O5R A;  3WL0 A;  3B9D A;  4P8W A;  2OLH A;  3BXW A;  4DRH A;  2RUR A;  4Z2I A;  2PPO A;  2PPN A;  4DH0 A;  3BMB A;  4IPX A;  3UQA A;  4MNK A;  3CH9 A;  1HJW A;  1XRV A;  3ARX A;  1D2K A;  4LGX A;  1WB0 A;  3O5Q A;  5B8I C;  2MLZ A;  1M5Y A;  4ODK A;  2KGJ A;  1SYT A;  4Z2L A;  3KAH A;  2WM0 A;  2OFN A;  4MNJ A;  5DO2 A;  2XP7 A;  1ROT A;  4C02 B;  2N87 A;  2KE0 A;  4DZ2 A;  1HJX A;  1LJY A;  1W9P A;  4W5U A;  4Z2H A;  4IT6 A;  3KCE A;  4MSP A;  3CHE A;  2IUZ A;  4DWS C;  3KZ7 A;  2DSU A;  3ARO A;  4WKF A;  1OWQ A;  4W9P A;  1HKI A;  3RGC A;  1ROU A;  1QPL A;  3JYM A;  2ZQV A;  4DWS B;  5HWB A;  1N1A A;  4UDM A;  4NSB A;  2UZ5 A;  4GIV A;  2PBC A;  1WAW A;  1ZK6 A;  2XP8 A;  5DF0 A;  1L1P A;  1YW5 A;  2MNT A;  2ZQT A;  1J4H A;  1C9H A;  4U84 A;  2PPP A;  1JNS A;  3FAP A;  3JYJ A;  4FAP A;  5HT1 A;  4JFK A;  2A3B A;  2XPB A;  3ARZ A;  3B7X A;  3KAG A;  4IT4 A;  4S3K A;  5GPR A;  1GPF A;  4HAR A;  3FY1 A;  3W4R A;  4ZS6 A;  4DRK A;  4DRI A;  1FKS A;  3WD0 A;  3AS3 A;  3IKG A;  3B9E A;  4DRM A;  1FKL A;  4KQZ A;  1FKD A;  3LUO A;  3ARQ A;  1ITX A;  2MPH A;  2F4E A;  1UR9 A;  1ZCN A;  2IF4 A;  1W1V A;  1JNT A;  4ODL A;  4JFI A;  4R5E A;  3PA7 A;  3WKZ A;  3TDB A;  2JZV A;  5DIU A;  4QT2 A;  2ESC A;  4LAY A;  3H9R B;  1FKI A;  2AOS A;  5HKG A;  3VAW A;  1JVW A;  2PI6 A;  1FKK A;  1NH6 A;  1PIN A;  1W1Y A;  1B6C A;  4P8U A;  3TC5 A;  1E6R A;  1JCH B;  4MAV A;  1U79 A;  4WKA A;  4ITZ A;  1W9U A;  1EYM A;  1Y0O A;  2ZR4 A;  3IKD A;  5HW7 A;  2M08 A;  4DRP A;  3RM8 A;  3WD2 A;  3ARY A;  4TYO A;  4Q7N A;  2XP4 A;  4TX0 A;  1D7H A;  3AS1 A;  1ZBV A;  3KAC A;  2DPE A;  4DWS A;  1QPF A;  2RUD A;  1GRJ A;  4P8V A;  1ZBC A;  2LPV A;  3O5G A;  4ODM A;  2AWG A;  4TNS A;  5GQB A;  3WQW A;  2KFW A;  4DIP A;  4ODR A;  2YBU A;  3G6M A;  3IHZ A;  1P5Q A;  1SR0 A;  2F21 A;  1FKJ A;  1EHN A;  2DT3 A;  3KAI A;  3GTY X;  2DG3 A;  4WKH A;  3ART A;  3WL1 A;  4JYS A;  3NI6 A;  2YBT A;  4JFL A;  2PV2 A;  3CZ8 A;  2A3A A;  1E6Z A;  1J6Y A;  2B31 A;  2Q5A A;  3PRB A;  1X6N A;  1ZU8 A;  3I6C A;  1A7X A;  1HXV A;  2MF9 A;  1GOI A;  4MPK A;  1FKR A;  3ARP A;  1FFQ A;  3ARW A;  3O5K A;  1E15 A;  4GGQ A;  3O5J A;  4LAV A;  3ALG A;  1E6P A;  2RSE A;  2ZR6 A;  4DRN A;  2XPA A;  4URI A;  2DSW A;  1XHG A;  2DG9 A;  3UQI A;  3AS0 A;  2L2S A;  3CHC A;  1KT1 A;  1E44 A;  2MLX A;  1FJD A;  5D75 A;  1NWS A;  3RFW A;  2M2A A;  2PV3 A;  3O5O A;  1D7I A;  4LAX A;  4W9Q A;  3RME A;  2WLY A;  2G41 A;  2WK2 A;  5HTG A;  5HBF A;  2ZR5 A;  3WIJ A;  1LL6 A;  2XP5 A;  1NWR A;  2ETN A;  4WK9 A;  4DRQ A;  4MGV A;  1J4I A;  4KR0 B;  2LKN A;  2O9O A;  5J6E A;  4Q22 A;  3QOK A;  2FKE A;  2B5U B;  2DSZ A;  1FFR A;  2FAP A;  1J4R A;  4BF8 A;  4TW6 A;  1F8A B;  4FN2 A;  2A3C A;  2G8Z A;  3OA5 A;  2RUC A;  2VN1 A;  1LL7 A;  1PBK A;  2RUQ A;  1TCO C;  2FDM A;  2KR7 A;  4Z2J A;  4HBO A;  1H0I A;  1LG1 A;  3NRK A;  4L3N A;  3ARV A;  2MLY A;  4ZPW R;  4TW7 A;  1NSG A;  1HKK A;  4JFJ A;  4QT3 A;  4ZPV R;  4MNM A;  4S3J A;  3O5L A;  3WD4 A;  1FKH A;  2F2D A;  3O5I A;  1K9T A;  4ML4 A;  2K8I A;  1ZL1 A;  4MTV A;  4ODQ A;  4ODN A;  1EIB A;  1VF8 A;  1O6I A;  2XP6 A;  1R9H A;  3ARU A;  3UQB A;  2ZQU A;  1ZBK A;  1KFW A;  4ODO A;  4R0X A;  3UI6 A;  1GUV A;  3O5D A;  2DT2 A;  1QZ2 A;  1Q6H A;  2ZQS A;  3CHF A;  4G50 A;  2ITK A;  5DEZ A;  3UI4 A;  3PRD A;  1JNE A;  1E6N A;  3EIP A;  4MNL A;  4PTM A;  4QIB A;  4IQC A;  4DZ3 A;  3WD1 A;  4N19 A;  2RQS A;  4W9O A;  4DRJ A;  2KO7 A;  4L72 B;  2DSV A;  4DT4 A;  4DWS D;  2M1I A;  2WLZ A;  4NZC A;  2EUL A;  1HKM A;  4Z2K A;  4TW8 A;  3EY6 A;  1H0G A;  1FKG A;  3KAB A;  2KI3 A;  3B8S A;  2P4V A;  4IQ2 A;  3GPK A;  1UR8 A;  1LG2 A;  1FAP A;  1NWU A;  2LJ4 A;  1Q6U A;  3OOB A;  3AQU A;  1TFV A;  2O92 A;  4HBE A;  1T11 A;  4NNR A;  5I98 A;  1OGG A;  3PRA A;  1BL4 A;  3WH0 A;  3CGM A;  1FKF A;  4WJX A;  5JH8 A;  3O5M A;  1X6L A;  3ALF A;  4G2P A;  3MDY B;  3KAF A;  2VCD A;  3ARR A;  4AY1 A;  2DT0 A;  4U85 A; 
#chains in the Genus database with same CATH homology
 1JND A;  1EDQ A;  1FKB A;  1LL4 A;  3FXY A;  2DT1 A;  3WD3 A;  2A3E A;  3KAD A;  1ZBW A;  4JFM A;  4J4O A;  2XP9 A;  1D7J A;  1Q1C A;  3NTP A;  4J4N A;  3UF8 A;  3CGN A;  2Y78 A;  4ODP A;  3ODK A;  4ZPT R;  1WNO A;  4O2T A;  4QZV B;  2D9F A;  5DIV A;  1D6O A;  1W26 A;  1E9L A;  3B9A A;  4WIW A;  1FD9 A;  4LAW A;  1W1T A;  4XAK A;  1LQ0 A;  4Z2G A;  3WQV A;  2QF8 A;  3O5E A;  5HW6 A;  1IX5 A;  3CHD A;  4DRO A;  1HJV A;  1NWT A;  3UI5 A;  3RM4 A;  1KT0 A;  1F40 A;  3O5P A;  1YAT A;  3RM9 A;  1W1P A;  1EQ3 A;  2XP3 A;  1HKJ A;  5BXJ A;  2DG4 A;  3ARS A;  1Q6I A;  2PV1 A;  3O5F A;  3TCZ A;  4U86 A;  1ZB5 A;  3IK8 A;  3JXV A;  4P8X A;  1W9V A;  5HW8 A;  3G6L A;  3PR9 A;  1BKF A;  2LGO A;  1FKT A;  1NMV A;  1CTN A;  1OGB A;  5DIT A;  5HUA A;  1NMW A;  5HWC A;  5GPG A;  1RD6 A;  3AS2 A;  3O5R A;  3WL0 A;  3B9D A;  4P8W A;  2OLH A;  3BXW A;  4DRH A;  2RUR A;  4Z2I A;  2PPO A;  2PPN A;  4DH0 A;  4IPX A;  3UQA A;  4MNK A;  3CH9 A;  1HJW A;  1XRV A;  3ARX A;  1D2K A;  4LGX A;  1WB0 A;  3O5Q A;  5B8I C;  2MLZ A;  1M5Y A;  4ODK A;  2KGJ A;  1SYT A;  4Z2L A;  3KAH A;  2WM0 A;  2OFN A;  4MNJ A;  5DO2 A;  2XP7 A;  1ROT A;  4C02 B;  2N87 A;  2KE0 A;  4DZ2 A;  1HJX A;  1LJY A;  1W9P A;  4W5U A;  4Z2H A;  4IT6 A;  3KCE A;  4MSP A;  3CHE A;  2IUZ A;  4DWS C;  3KZ7 A;  2DSU A;  3ARO A;  4WKF A;  1OWQ A;  4W9P A;  1HKI A;  3RGC A;  1ROU A;  1QPL A;  3JYM A;  2ZQV A;  4DWS B;  5HWB A;  1N1A A;  4NSB A;  2UZ5 A;  4GIV A;  2PBC A;  1WAW A;  1ZK6 A;  2XP8 A;  5DF0 A;  1L1P A;  1YW5 A;  2MNT A;  2ZQT A;  1J4H A;  1C9H A;  4U84 A;  2PPP A;  1JNS A;  3FAP A;  3JYJ A;  4FAP A;  5HT1 A;  4JFK A;  2A3B A;  2XPB A;  3ARZ A;  3B7X A;  3KAG A;  4IT4 A;  4S3K A;  5GPR A;  1GPF A;  4HAR A;  3FY1 A;  3W4R A;  4ZS6 A;  4DRK A;  4DRI A;  1FKS A;  3WD0 A;  3AS3 A;  3IKG A;  3B9E A;  4DRM A;  1FKL A;  4KQZ A;  1FKD A;  3LUO A;  3ARQ A;  1ITX A;  2MPH A;  2F4E A;  1UR9 A;  1ZCN A;  2IF4 A;  1W1V A;  1JNT A;  4ODL A;  4JFI A;  4R5E A;  3PA7 A;  3WKZ A;  3TDB A;  2JZV A;  5DIU A;  4QT2 A;  2ESC A;  4LAY A;  3H9R B;  1FKI A;  2AOS A;  5HKG A;  3VAW A;  1JVW A;  2PI6 A;  1FKK A;  1NH6 A;  1PIN A;  1W1Y A;  1B6C A;  4P8U A;  3TC5 A;  1E6R A;  4MAV A;  1U79 A;  4WKA A;  4ITZ A;  1W9U A;  1EYM A;  1Y0O A;  2ZR4 A;  3IKD A;  5HW7 A;  2M08 A;  4DRP A;  3RM8 A;  3WD2 A;  3ARY A;  4TYO A;  4Q7N A;  2XP4 A;  4TX0 A;  1D7H A;  3AS1 A;  1ZBV A;  3KAC A;  2DPE A;  4DWS A;  1QPF A;  2RUD A;  4P8V A;  1ZBC A;  2LPV A;  3O5G A;  4ODM A;  2AWG A;  4TNS A;  5GQB A;  3WQW A;  2KFW A;  4DIP A;  4ODR A;  2YBU A;  3G6M A;  3IHZ A;  1P5Q A;  1SR0 A;  2F21 A;  1FKJ A;  1EHN A;  2DT3 A;  3KAI A;  2DG3 A;  4WKH A;  3ART A;  3WL1 A;  4JYS A;  3NI6 A;  2YBT A;  4JFL A;  2PV2 A;  3CZ8 A;  2A3A A;  1E6Z A;  1J6Y A;  2B31 A;  2Q5A A;  3PRB A;  1X6N A;  1ZU8 A;  3I6C A;  1A7X A;  1HXV A;  2MF9 A;  1GOI A;  4MPK A;  1FKR A;  3ARP A;  1FFQ A;  3ARW A;  3O5K A;  1E15 A;  4GGQ A;  3O5J A;  4LAV A;  3ALG A;  1E6P A;  2RSE A;  2ZR6 A;  4DRN A;  2XPA A;  4URI A;  2DSW A;  1XHG A;  2DG9 A;  3UQI A;  3AS0 A;  2L2S A;  3CHC A;  1KT1 A;  2MLX A;  1FJD A;  5D75 A;  1NWS A;  3RFW A;  2M2A A;  2PV3 A;  3O5O A;  1D7I A;  4LAX A;  4W9Q A;  3RME A;  2WLY A;  2G41 A;  2WK2 A;  5HTG A;  5HBF A;  2ZR5 A;  3WIJ A;  1LL6 A;  2XP5 A;  1NWR A;  4WK9 A;  4DRQ A;  4MGV A;  1J4I A;  4KR0 B;  2LKN A;  2O9O A;  5J6E A;  4Q22 A;  3QOK A;  2FKE A;  2DSZ A;  1FFR A;  2FAP A;  1J4R A;  4BF8 A;  4TW6 A;  1F8A B;  4FN2 A;  2A3C A;  2G8Z A;  3OA5 A;  2RUC A;  2VN1 A;  1LL7 A;  1PBK A;  2RUQ A;  1TCO C;  2FDM A;  2KR7 A;  4Z2J A;  4HBO A;  1H0I A;  1LG1 A;  3NRK A;  4L3N A;  3ARV A;  2MLY A;  4ZPW R;  4TW7 A;  1NSG A;  1HKK A;  4JFJ A;  4QT3 A;  4ZPV R;  4MNM A;  4S3J A;  3O5L A;  3WD4 A;  1FKH A;  2F2D A;  3O5I A;  1K9T A;  4ML4 A;  2K8I A;  1ZL1 A;  4MTV A;  4ODQ A;  4ODN A;  1EIB A;  1VF8 A;  1O6I A;  2XP6 A;  1R9H A;  3ARU A;  3UQB A;  2ZQU A;  1ZBK A;  1KFW A;  4ODO A;  4R0X A;  3UI6 A;  1GUV A;  3O5D A;  2DT2 A;  1QZ2 A;  1Q6H A;  2ZQS A;  3CHF A;  4G50 A;  2ITK A;  5DEZ A;  3UI4 A;  3PRD A;  1JNE A;  1E6N A;  4MNL A;  4PTM A;  4QIB A;  4IQC A;  4DZ3 A;  3WD1 A;  4N19 A;  2RQS A;  4W9O A;  4DRJ A;  2KO7 A;  4L72 B;  2DSV A;  4DT4 A;  4DWS D;  2M1I A;  2WLZ A;  4NZC A;  1HKM A;  4Z2K A;  4TW8 A;  3EY6 A;  1H0G A;  1FKG A;  3KAB A;  2KI3 A;  3B8S A;  4IQ2 A;  3GPK A;  1UR8 A;  1LG2 A;  1FAP A;  1NWU A;  2LJ4 A;  1Q6U A;  3OOB A;  3AQU A;  1TFV A;  2O92 A;  4HBE A;  1T11 A;  4NNR A;  5I98 A;  1OGG A;  3PRA A;  1BL4 A;  3WH0 A;  3CGM A;  1FKF A;  4WJX A;  5JH8 A;  3O5M A;  1X6L A;  3ALF A;  4G2P A;  3MDY B;  3KAF A;  2VCD A;  3ARR A;  4AY1 A;  2DT0 A;  4U85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...