4ODLA

Structure of slyd from thermus thermophilus in complex with s2 peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
total genus 31
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odlA00
2DG9A 2LPVA 1FKBA 1QPFA 2RURA 3PRBA 3PRDA 2LGOA 3O5KA 5DIVA 1JNSA 4IQCA 2F2DA 4ODMA 1FKTA 5D75A 4W9QA 2ZR4A 3CGNA 1YATA 4MSPA 4MGVA 4DH0A 1R9HA 2XP4A 2ZR6A 2K8IA 1BKFA 3KAFA 4ODNA 1T11A 3I6CA 5B8IC 2LJ4A 2MLZA 2XP9A 3IHZA 5HW6A 3IKDA 2KI3A 1FKKA 1Q1CA 3KACA 1EYMA 2RUCA 5HUAA 1HXVA 1D7JA 2XPAA 3GPKA 3JYJA 4ODRA 3VAWA 1J4IA 4DRKA 1J4HA 3KAIA 4ITZA 3KABA 4R0XA 2FAPA 2AWGA 2ZQSA 4ODKA 3TDBA 3OOBA 3UI4A 2PPOA 4ODPA 1JNTA 1NMVA 4DRPA 4DZ2A 2ZQTA 4U84A 2FKEA 4IQ2A 2JZVA 1FAPA 3UF8A 2Q5AA 1EQ3A 3ODKA 2XPBA 4BF8A 1QZ2A 2VN1A 1D7HA 1BL4A 4LAVA 2KE0A 1FKLA 2ITKA 3O5LA 4J4NA 4DZ3A 4IPXA 4DRQA 1D7IA 1J6YA 4TX0A 1JVWA 3NTPA 1ZCNA 2MLXA 3CGMA 2M2AA 1W26A 2D9FA 2L2SA 3O5MA 3LUOA 4TYOA 4ODLA 3UI6A 1D6OA 1M5YA 1U79A 2MF9A 3TCZA 1FKSA 4DRNA 5HTGA 1FKFA 2LKNA 4JFKA 3JYMA 3PA7A 4GGQA 3KAHA 1ROUA 4DRMA 4JFIA 1KT0A 3H9RB 3O5OA 2Y78A 2KR7A 4JYSA 3RGCA 3KADA 3MDYB 4DT4A 2KFWA 3O5JA 3O5QA 1ROTA 4GIVA 1ZK6A 4J4OA 5HT1A 1F8AB 2XP3A 2M08A 2ZR5A 4TW7A 2ZQVA 4TW8A 2MNTA 1PINA 1FKHA 1J4RA 3UQAA 5BXJA 2XP6A 1FKJA 3EY6A 5HKGA 1KT1A 1P5QA 1A7XA 4G2PA 3UI5A 4O2TA 5I98A 2RQSA 4JFLA 4FN2A 5J6EA 1FKGA 3O5FA 3UQIA 1B6CA 2F21A 1F40A 1Q6HA 1TCOC 1YW5A 3JXVA 4LAYA 5GPGA 3WH0A 3RFWA 5HWCA 2PBCA 4DIPA 3UQBA 2N87A 1FD9A 2PPNA 2M1IA 2PV2A 3O5GA 2F4EA 4LAXA 4C02B 3O5RA 2PPPA 3B7XA 1FKIA 1FJDA 4U85A 3NI6A 3O5DA 1QPLA 2KGJA 1N1AA 2VCDA 4QIBA 3KCEA 5HW8A 1FKRA 3O5EA 2OFNA 5DIUA 1C9HA 3IKGA 4TNSA 4DRIA 4FAPA 4U86A 4JFJA 2XP7A 3KAGA 1NMWA 2MLYA 4DRJA 2RSEA 4JFMA 4QT2A 4W9OA 4G50A 2MPHA 4QT3A 1Q6UA 1NSGA 1Q6IA 3IK8A 3O5IA 4DROA 4DRHA 4LAWA 2RUDA 2PV1A 3NRKA 2UZ5A 5DITA 5HWBA 1FKDA 2ZQUA 1Y0OA 4NNRA 3O5PA 3FAPA 2IF4A 3KZ7A 4TW6A 4N19A 4W9PA 2RUQA 2DG3A 4ODQA 1PBKA 5HW7A 2KO7A 1L1PA 2DG4A 2XP5A 4ODOA 3TC5A 2XP8A 2PV3A
chains in the Genus database with same CATH superfamily
4MNMA 1FKBA 2RURA 3PRDA 4KQZA 3RM8A 2F2DA 1WNOA 2A3BA 4W9QA 4MGVA 4L72B 1BKFA 3IHZA 2WK2A 3IKDA 1FKKA 4L3NA 1VF8A 3GPKA 4DRKA 1J4IA 4ZS6A 4DWSC 3KABA 4R0XA 2FAPA 2AWGA 3TDBA 3WQWA 1X6NA 1FFRA 1OGBA 1HKIA 2YBUA 4Z2GA 4IQ2A 2JZVA 1HJVA 3ARTA 3ODKA 2VN1A 1D7HA 3ARQA 3WKZA 1E15A 1FKLA 4J4NA 1J6YA 1D7IA 1OWQA 1E6PA 4ODLA 1M5YA 4P8WA 5HTGA 3G6MA 2F23A 1FKFA 4GGQA 4JFIA 2KR7A 3RGCA 3MDYB 3O5JA 1ROTA 2P4VA 4GIVA 1JCHB 1FFQA 4Z2LA 1PINA 2A3AA 3UQAA 3WD4A 4O2TA 5I98A 1RD6A 4P8VA 3UQIA 1GRJA 4WKHA 3WH0A 5HWCA 3RFWA 3UQBA 2M1IA 3O5GA 4LAXA 3RM4A 4C02B 3O5RA 3B9EA 4AY1A 2DT0A 3FY1A 1NWSA 4S3KA 3IKGA 4TNSA 1X6LA 2XP7A 3KAGA 1NMWA 2RSEA 4W9OA 4QT3A 4WK9A 4MAVA 1JNDA 1H0GA 2RUDA 3NRKA 2UZ5A 4P8XA 1XHGA 1Y0OA 4NNRA 3ARUA 3KZ7A 4ODQA 5HW7A 1UR9A 3PRBA 3OA5A 1IX5A 4URIA 1JNSA 3CZ8A 3WD0A 3CGNA 4DH0A 2G8ZA 1HKMA 3QOKA 4IT4A 4IT6A 1T11A 1XRVA 2LJ4A 1Q1CA 3KACA 1NWTA 5HUAA 1GOIA 3ARWA 3VAWA 1J4HA 4MTVA 3OOBA 3RM9A 3UI4A 1NMVA 4MNKA 4DRPA 4DZ2A 2FKEA 1OGGA 3W4RA 1QZ2A 1ZBWA 3O5LA 4UDMA 3WL1A 4NSBA 3AS3A 2DT2A 4DZ3A 1HKKA 1LL6A 1JVWA 2M2AA 1W26A 2D9FA 2L2SA 4TYOA 3LUOA 1EDQA 1D6OA 3ARRA 4DWSD 4JFKA 2DSVA 1HJWA 1WB0A 2Y78A 4DT4A 2KFWA 3O5QA 4WJXA 1ZK6A 4HARA 4MPKA 1F8AB 2M08A 4TW7A 2ZQVA 2MNTA 3ARVA 1J4RA 1W9PA 5BXJA 3EY6A 4NZCA 4HBEA 4JFLA 2DSWA 4FN2A 2O92A 1B6CA 2EULA 1TCOC 1E6RA 1EHNA 1ZL1A 5GPGA 2DT3A 4LAYA 4DIPA 2IUZA 1SR0A 3AS2A 2OLHA 4S3JA 5DO2A 3WL0A 1QPLA 2VCDA 3O5EA 5DIUA 4ML4A 1C9HA 4P8UA 1GPFA 4FAPA 4JFJA 4JFMA 3WQVA 1NSGA 3GU0A 3IK8A 4DROA 5DITA 3PR9A 5HWBA 4TW6A 1ITXA 2WLZA 4W9PA 2KO7A 2DG4A 1NH6A 4WIWA 2DG9A 2LPVA 1QPFA 2LGOA 2FDMA 4IQCA 4ODMA 1HJXA 5D75A 4WKFA 1YATA 4MSPA 4Q22A 2PI6A 2ZR6A 1W1TA 2K8IA 4ODNA 3I6CA 2MLZA 5HW6A 2ETNA 5GPRA 2KI3A 2RUCA 1HXVA 2XPAA 3JYJA 3ARSA 2G41A 4ODRA 3ARYA 4ITZA 4KR0B 3WD3A 2PPOA 4ODPA 2DPEA 2Q5AA 1EQ3A 2XPBA 1BL4A 4LAVA 3ALGA 2ITKA 2QF8A 4DRQA 4LGXA 2DSZA 3NTPA 3O5MA 3GTYX 4U86A 4Q7NA 3UI6A 1U79A 2YBTA 5GQBA 2MF9A 1FKSA 1LL4A 3B8SA 4MNLA 3JYMA 1HKJA 1ROUA 4DRMA 1KT0A 3O5OA 1ZB5A 3KADA 4J4OA 5HT1A 2XP3A 4Z2IA 1FKHA 4PTMA 4ZPVR 3WD2A 1FKJA 1P5QA 4G2PA 5J6EA 3O5FA 1GUVA 3JXVA 5HBFA 2PBCA 2N87A 1FD9A 2PPNA 2PV2A 1KFWA 2DT1A 2PPPA 4R5EA 3AQUA 1N1AA 2WLYA 3CHFA 3KCEA 4QIBA 2OFNA 1ZBCA 2PN0A 1LJYA 4QZVB 3B9DA 5DF0A 1NWRA 2MLYA 4MNJA 4DRJA 4QT2A 4G50A 1ZU8A 2MPHA 1Q6IA 3O5IA 2PV1A 1LL7A 4Z2KA 1ZBKA 1FKDA 2ZQUA 3ARZA 3FAPA 2IF4A 3BMBA 4N19A 2DG3A 2XP5A 3TC5A 3UF8A 4ZPWR 4DWSA 2AOSA 3O5KA 5DIVA 2O9OA 1WAWA 1FKTA 1SYTA 2ZR4A 1R9HA 2XP4A 3KAFA 5B8IC 2XP9A 4XAKA 3RMEA 1D2KA 2A3CA 1EYMA 1D7JA 3AS0A 3KAIA 1E6ZA 1UR8A 2ZQSA 4ODKA 4DWSB 3ARPA 3WD1A 1JNTA 2ZQTA 4U84A 1H0IA 1LG2A 1FAPA 1W1VA 1K9TA 1TFVA 2B5UB 4BF8A 5JH8A 2KE0A 1LQ0A 4IPXA 4TX0A 4W5UA 1W9UA 1ZCNA 2MLXA 3CGMA 3AROA 4ZPTR 1O6IA 2B31A 3FXYA 3TCZA 3ARXA 4DRNA 4Z2JA 2LKNA 2DSUA 3PA7A 3KAHA 1W9VA 3BXWA 3H9RB 4JYSA 2A3EA 3CHDA 1JNEA 1EIBA 2ZR5A 1CTNA 1NWUA 4TW8A 2WM0A 3CHEA 2XP6A 5HKGA 1KT1A 2ESCA 5DEZA 1A7XA 3UI5A 1E6NA 2RQSA 1FKGA 1W1PA 2F21A 3CHCA 1F40A 3G6LA 1Q6HA 1YW5A 3PRAA 1E44A 3AS1A 2F4EA 3B7XA 1FKIA 3ALFA 1E9LA 1FJDA 4U85A 3NI6A 3O5DA 4Z2HA 2KGJA 5HW8A 1FKRA 3EIPA 4DRIA 1ZBVA 1W1YA 1LG1A 4HBOA 1Q6UA 3B9AA 4DRHA 4LAWA 4WKAA 3O5PA 2RUQA 3WIJA 1PBKA 1L1PA 4ODOA 3CH9A 2XP8A 2PV3A
chains in the Genus database with same CATH topology
4MNMA 1FKBA 2RURA 3PRDA 4KQZA 3RM8A 2F2DA 1WNOA 2A3BA 4W9QA 4MGVA 4L72B 1BKFA 3IHZA 2WK2A 3IKDA 1FKKA 4L3NA 1VF8A 3GPKA 4DRKA 1J4IA 4ZS6A 4DWSC 3KABA 4R0XA 2FAPA 2AWGA 3TDBA 3WQWA 1X6NA 1FFRA 1OGBA 1HKIA 2YBUA 4Z2GA 4IQ2A 2JZVA 1HJVA 3ARTA 3ODKA 2VN1A 1D7HA 3ARQA 3WKZA 1E15A 1FKLA 4J4NA 1J6YA 1D7IA 1OWQA 1E6PA 4ODLA 1M5YA 4P8WA 5HTGA 3G6MA 1FKFA 4GGQA 4JFIA 2KR7A 3RGCA 3MDYB 3O5JA 1ROTA 4GIVA 1FFQA 4Z2LA 1PINA 2A3AA 3UQAA 3WD4A 4O2TA 5I98A 1RD6A 4P8VA 3UQIA 4WKHA 3WH0A 5HWCA 3RFWA 3UQBA 2M1IA 3O5GA 4LAXA 3RM4A 4C02B 3O5RA 3B9EA 4AY1A 2DT0A 3FY1A 1NWSA 4S3KA 3IKGA 4TNSA 1X6LA 2XP7A 3KAGA 1NMWA 2RSEA 4W9OA 4QT3A 4WK9A 4MAVA 1JNDA 1H0GA 2RUDA 3NRKA 2UZ5A 4P8XA 1XHGA 1Y0OA 4NNRA 3ARUA 3KZ7A 4ODQA 5HW7A 1UR9A 3PRBA 3OA5A 1IX5A 4URIA 1JNSA 3CZ8A 3WD0A 3CGNA 4DH0A 2G8ZA 1HKMA 3QOKA 4IT4A 4IT6A 1T11A 1XRVA 2LJ4A 1Q1CA 3KACA 1NWTA 5HUAA 1GOIA 3ARWA 3VAWA 1J4HA 4MTVA 3OOBA 3RM9A 3UI4A 1NMVA 4MNKA 4DRPA 4DZ2A 2FKEA 1OGGA 3W4RA 1QZ2A 1ZBWA 3O5LA 3WL1A 4DZ3A 4NSBA 3AS3A 2DT2A 1HKKA 1LL6A 1JVWA 2M2AA 1W26A 2D9FA 2L2SA 4TYOA 3LUOA 1EDQA 1D6OA 3ARRA 4DWSD 4JFKA 2DSVA 1HJWA 1WB0A 2Y78A 4DT4A 2KFWA 3O5QA 4WJXA 1ZK6A 4HARA 4MPKA 1F8AB 2M08A 4TW7A 2ZQVA 2MNTA 3ARVA 1J4RA 1W9PA 5BXJA 3EY6A 4NZCA 4HBEA 4JFLA 2DSWA 4FN2A 2O92A 1B6CA 1TCOC 1E6RA 1EHNA 1ZL1A 5GPGA 2DT3A 4LAYA 4DIPA 2IUZA 1SR0A 3AS2A 2OLHA 4S3JA 5DO2A 3WL0A 1QPLA 2VCDA 3O5EA 5DIUA 4ML4A 1C9HA 4P8UA 1GPFA 4FAPA 4JFJA 4JFMA 3WQVA 1NSGA 3IK8A 4DROA 5DITA 3PR9A 5HWBA 4TW6A 1ITXA 2WLZA 4W9PA 2KO7A 2DG4A 1NH6A 4WIWA 2DG9A 2LPVA 1QPFA 2LGOA 2FDMA 4IQCA 4ODMA 1HJXA 5D75A 4WKFA 1YATA 4MSPA 4Q22A 2PI6A 2ZR6A 1W1TA 2K8IA 4ODNA 3I6CA 2MLZA 5HW6A 5GPRA 2KI3A 2RUCA 1HXVA 2XPAA 3JYJA 3ARSA 2G41A 4ODRA 3ARYA 4ITZA 4KR0B 3WD3A 2PPOA 4ODPA 2DPEA 2Q5AA 1EQ3A 2XPBA 1BL4A 4LAVA 3ALGA 2ITKA 2QF8A 4DRQA 4LGXA 2DSZA 3NTPA 3O5MA 4U86A 4Q7NA 3UI6A 1U79A 2YBTA 5GQBA 2MF9A 1FKSA 1LL4A 3B8SA 4MNLA 3JYMA 1HKJA 1ROUA 4DRMA 1KT0A 3O5OA 1ZB5A 3KADA 4J4OA 5HT1A 2XP3A 4Z2IA 1FKHA 4PTMA 4ZPVR 3WD2A 1FKJA 1P5QA 4G2PA 5J6EA 3O5FA 1GUVA 3JXVA 5HBFA 2PBCA 2N87A 1FD9A 2PPNA 2PV2A 1KFWA 2DT1A 2PPPA 4R5EA 3AQUA 1N1AA 2WLYA 3CHFA 3KCEA 4QIBA 2OFNA 1ZBCA 1LJYA 4QZVB 3B9DA 5DF0A 1NWRA 2MLYA 4MNJA 4DRJA 4QT2A 4G50A 1ZU8A 2MPHA 1Q6IA 3O5IA 2PV1A 1LL7A 4Z2KA 1ZBKA 1FKDA 2ZQUA 3ARZA 3FAPA 2IF4A 4N19A 2DG3A 2XP5A 3TC5A 3UF8A 4ZPWR 4DWSA 2AOSA 3O5KA 5DIVA 2O9OA 1WAWA 1FKTA 1SYTA 2ZR4A 1R9HA 2XP4A 3KAFA 5B8IC 2XP9A 4XAKA 3RMEA 1D2KA 2A3CA 1EYMA 1D7JA 3AS0A 3KAIA 1E6ZA 1UR8A 2ZQSA 4ODKA 4DWSB 3ARPA 3WD1A 1JNTA 2ZQTA 4U84A 1H0IA 1LG2A 1FAPA 1W1VA 1K9TA 1TFVA 4BF8A 5JH8A 2KE0A 1LQ0A 4IPXA 4TX0A 4W5UA 1W9UA 1ZCNA 2MLXA 3CGMA 3AROA 4ZPTR 1O6IA 2B31A 3FXYA 3TCZA 3ARXA 4DRNA 4Z2JA 2LKNA 2DSUA 3PA7A 3KAHA 1W9VA 3BXWA 3H9RB 4JYSA 2A3EA 3CHDA 1JNEA 1EIBA 2ZR5A 1CTNA 1NWUA 4TW8A 2WM0A 3CHEA 2XP6A 5HKGA 1KT1A 2ESCA 5DEZA 1A7XA 3UI5A 1E6NA 2RQSA 1FKGA 1W1PA 2F21A 3CHCA 1F40A 3G6LA 1Q6HA 1YW5A 3PRAA 3AS1A 2F4EA 3B7XA 1FKIA 3ALFA 1E9LA 1FJDA 4U85A 3NI6A 3O5DA 4Z2HA 2KGJA 5HW8A 1FKRA 4DRIA 1ZBVA 1W1YA 1LG1A 4HBOA 1Q6UA 3B9AA 4DRHA 4LAWA 4WKAA 3O5PA 2RUQA 3WIJA 1PBKA 1L1PA 4ODOA 3CH9A 2XP8A 2PV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG9 A;  2LPV A;  1FKB A;  1QPF A;  2RUR A;  3PRB A;  3PRD A;  2LGO A;  3O5K A;  5DIV A;  1JNS A;  4IQC A;  2F2D A;  4ODM A;  1FKT A;  5D75 A;  4W9Q A;  2ZR4 A;  3CGN A;  1YAT A;  4MSP A;  4MGV A;  4DH0 A;  1R9H A;  2XP4 A;  2ZR6 A;  2K8I A;  1BKF A;  3KAF A;  4ODN A;  1T11 A;  3I6C A;  5B8I C;  2LJ4 A;  2MLZ A;  2XP9 A;  3IHZ A;  5HW6 A;  3IKD A;  2KI3 A;  1FKK A;  1Q1C A;  3KAC A;  1EYM A;  2RUC A;  5HUA A;  1HXV A;  1D7J A;  2XPA A;  3GPK A;  3JYJ A;  4ODR A;  3VAW A;  1J4I A;  4DRK A;  1J4H A;  3KAI A;  4ITZ A;  3KAB A;  4R0X A;  2FAP A;  2AWG A;  2ZQS A;  4ODK A;  3TDB A;  3OOB A;  3UI4 A;  2PPO A;  4ODP A;  1JNT A;  1NMV A;  4DRP A;  4DZ2 A;  2ZQT A;  4U84 A;  2FKE A;  4IQ2 A;  2JZV A;  1FAP A;  3UF8 A;  2Q5A A;  1EQ3 A;  3ODK A;  2XPB A;  4BF8 A;  1QZ2 A;  2VN1 A;  1D7H A;  1BL4 A;  4LAV A;  2KE0 A;  1FKL A;  2ITK A;  3O5L A;  4J4N A;  4DZ3 A;  4IPX A;  4DRQ A;  1D7I A;  1J6Y A;  4TX0 A;  1JVW A;  3NTP A;  1ZCN A;  2MLX A;  3CGM A;  2M2A A;  1W26 A;  2D9F A;  2L2S A;  3O5M A;  3LUO A;  4TYO A;  4ODL A;  3UI6 A;  1D6O A;  1M5Y A;  1U79 A;  2MF9 A;  3TCZ A;  1FKS A;  4DRN A;  5HTG A;  1FKF A;  2LKN A;  4JFK A;  3JYM A;  3PA7 A;  4GGQ A;  3KAH A;  1ROU A;  4DRM A;  4JFI A;  1KT0 A;  3H9R B;  3O5O A;  2Y78 A;  2KR7 A;  4JYS A;  3RGC A;  3KAD A;  3MDY B;  4DT4 A;  2KFW A;  3O5J A;  3O5Q A;  1ROT A;  4GIV A;  1ZK6 A;  4J4O A;  5HT1 A;  1F8A B;  2XP3 A;  2M08 A;  2ZR5 A;  4TW7 A;  2ZQV A;  4TW8 A;  2MNT A;  1PIN A;  1FKH A;  1J4R A;  3UQA A;  5BXJ A;  2XP6 A;  1FKJ A;  3EY6 A;  5HKG A;  1KT1 A;  1P5Q A;  1A7X A;  4G2P A;  3UI5 A;  4O2T A;  5I98 A;  2RQS A;  4JFL A;  4FN2 A;  5J6E A;  1FKG A;  3O5F A;  3UQI A;  1B6C A;  2F21 A;  1F40 A;  1Q6H A;  1TCO C;  1YW5 A;  3JXV A;  4LAY A;  5GPG A;  3WH0 A;  3RFW A;  5HWC A;  2PBC A;  4DIP A;  3UQB A;  2N87 A;  1FD9 A;  2PPN A;  2M1I A;  2PV2 A;  3O5G A;  2F4E A;  4LAX A;  4C02 B;  3O5R A;  2PPP A;  3B7X A;  1FKI A;  1FJD A;  4U85 A;  3NI6 A;  3O5D A;  1QPL A;  2KGJ A;  1N1A A;  2VCD A;  4QIB A;  3KCE A;  5HW8 A;  1FKR A;  3O5E A;  2OFN A;  5DIU A;  1C9H A;  3IKG A;  4TNS A;  4DRI A;  4FAP A;  4U86 A;  4JFJ A;  2XP7 A;  3KAG A;  1NMW A;  2MLY A;  4DRJ A;  2RSE A;  4JFM A;  4QT2 A;  4W9O A;  4G50 A;  2MPH A;  4QT3 A;  1Q6U A;  1NSG A;  1Q6I A;  3IK8 A;  3O5I A;  4DRO A;  4DRH A;  4LAW A;  2RUD A;  2PV1 A;  3NRK A;  2UZ5 A;  5DIT A;  5HWB A;  1FKD A;  2ZQU A;  1Y0O A;  4NNR A;  3O5P A;  3FAP A;  2IF4 A;  3KZ7 A;  4TW6 A;  4N19 A;  4W9P A;  2RUQ A;  2DG3 A;  4ODQ A;  1PBK A;  5HW7 A;  2KO7 A;  1L1P A;  2DG4 A;  2XP5 A;  4ODO A;  3TC5 A;  2XP8 A;  2PV3 A; 
#chains in the Genus database with same CATH topology
 4MNM A;  1FKB A;  2RUR A;  3PRD A;  4KQZ A;  3RM8 A;  2F2D A;  1WNO A;  2A3B A;  4W9Q A;  4MGV A;  4L72 B;  1BKF A;  3IHZ A;  2WK2 A;  3IKD A;  1FKK A;  4L3N A;  1VF8 A;  3GPK A;  4DRK A;  1J4I A;  4ZS6 A;  4DWS C;  3KAB A;  4R0X A;  2FAP A;  2AWG A;  3TDB A;  3WQW A;  1X6N A;  1FFR A;  1OGB A;  1HKI A;  2YBU A;  4Z2G A;  4IQ2 A;  2JZV A;  1HJV A;  3ART A;  3ODK A;  2VN1 A;  1D7H A;  3ARQ A;  3WKZ A;  1E15 A;  1FKL A;  4J4N A;  1J6Y A;  1D7I A;  1OWQ A;  1E6P A;  4ODL A;  1M5Y A;  4P8W A;  5HTG A;  3G6M A;  2F23 A;  1FKF A;  4GGQ A;  4JFI A;  2KR7 A;  3RGC A;  3MDY B;  3O5J A;  1ROT A;  2P4V A;  4GIV A;  1JCH B;  1FFQ A;  4Z2L A;  1PIN A;  2A3A A;  3UQA A;  3WD4 A;  4O2T A;  5I98 A;  1RD6 A;  4P8V A;  3UQI A;  1GRJ A;  4WKH A;  3WH0 A;  5HWC A;  3RFW A;  3UQB A;  2M1I A;  3O5G A;  4LAX A;  3RM4 A;  4C02 B;  3O5R A;  3B9E A;  4AY1 A;  2DT0 A;  3FY1 A;  1NWS A;  4S3K A;  3IKG A;  4TNS A;  1X6L A;  2XP7 A;  3KAG A;  1NMW A;  2RSE A;  4W9O A;  4QT3 A;  4WK9 A;  4MAV A;  1JND A;  1H0G A;  2RUD A;  3NRK A;  2UZ5 A;  4P8X A;  1XHG A;  1Y0O A;  4NNR A;  3ARU A;  3KZ7 A;  4ODQ A;  5HW7 A;  1UR9 A;  3PRB A;  3OA5 A;  1IX5 A;  4URI A;  1JNS A;  3CZ8 A;  3WD0 A;  3CGN A;  4DH0 A;  2G8Z A;  1HKM A;  3QOK A;  4IT4 A;  4IT6 A;  1T11 A;  1XRV A;  2LJ4 A;  1Q1C A;  3KAC A;  1NWT A;  5HUA A;  1GOI A;  3ARW A;  3VAW A;  1J4H A;  4MTV A;  3OOB A;  3RM9 A;  3UI4 A;  1NMV A;  4MNK A;  4DRP A;  4DZ2 A;  2FKE A;  1OGG A;  3W4R A;  1QZ2 A;  1ZBW A;  3O5L A;  4UDM A;  3WL1 A;  4NSB A;  3AS3 A;  2DT2 A;  4DZ3 A;  1HKK A;  1LL6 A;  1JVW A;  2M2A A;  1W26 A;  2D9F A;  2L2S A;  4TYO A;  3LUO A;  1EDQ A;  1D6O A;  3ARR A;  4DWS D;  4JFK A;  2DSV A;  1HJW A;  1WB0 A;  2Y78 A;  4DT4 A;  2KFW A;  3O5Q A;  4WJX A;  1ZK6 A;  4HAR A;  4MPK A;  1F8A B;  2M08 A;  4TW7 A;  2ZQV A;  2MNT A;  3ARV A;  1J4R A;  1W9P A;  5BXJ A;  3EY6 A;  4NZC A;  4HBE A;  4JFL A;  2DSW A;  4FN2 A;  2O92 A;  1B6C A;  2EUL A;  1TCO C;  1E6R A;  1EHN A;  1ZL1 A;  5GPG A;  2DT3 A;  4LAY A;  4DIP A;  2IUZ A;  1SR0 A;  3AS2 A;  2OLH A;  4S3J A;  5DO2 A;  3WL0 A;  1QPL A;  2VCD A;  3O5E A;  5DIU A;  4ML4 A;  1C9H A;  4P8U A;  1GPF A;  4FAP A;  4JFJ A;  4JFM A;  3WQV A;  1NSG A;  3GU0 A;  3IK8 A;  4DRO A;  5DIT A;  3PR9 A;  5HWB A;  4TW6 A;  1ITX A;  2WLZ A;  4W9P A;  2KO7 A;  2DG4 A;  1NH6 A;  4WIW A;  2DG9 A;  2LPV A;  1QPF A;  2LGO A;  2FDM A;  4IQC A;  4ODM A;  1HJX A;  5D75 A;  4WKF A;  1YAT A;  4MSP A;  4Q22 A;  2PI6 A;  2ZR6 A;  1W1T A;  2K8I A;  4ODN A;  3I6C A;  2MLZ A;  5HW6 A;  2ETN A;  5GPR A;  2KI3 A;  2RUC A;  1HXV A;  2XPA A;  3JYJ A;  3ARS A;  2G41 A;  4ODR A;  3ARY A;  4ITZ A;  4KR0 B;  3WD3 A;  2PPO A;  4ODP A;  2DPE A;  2Q5A A;  1EQ3 A;  2XPB A;  1BL4 A;  4LAV A;  3ALG A;  2ITK A;  2QF8 A;  4DRQ A;  4LGX A;  2DSZ A;  3NTP A;  3O5M A;  3GTY X;  4U86 A;  4Q7N A;  3UI6 A;  1U79 A;  2YBT A;  5GQB A;  2MF9 A;  1FKS A;  1LL4 A;  3B8S A;  4MNL A;  3JYM A;  1HKJ A;  1ROU A;  4DRM A;  1KT0 A;  3O5O A;  1ZB5 A;  3KAD A;  4J4O A;  5HT1 A;  2XP3 A;  4Z2I A;  1FKH A;  4PTM A;  4ZPV R;  3WD2 A;  1FKJ A;  1P5Q A;  4G2P A;  5J6E A;  3O5F A;  1GUV A;  3JXV A;  5HBF A;  2PBC A;  2N87 A;  1FD9 A;  2PPN A;  2PV2 A;  1KFW A;  2DT1 A;  2PPP A;  4R5E A;  3AQU A;  1N1A A;  2WLY A;  3CHF A;  3KCE A;  4QIB A;  2OFN A;  1ZBC A;  2PN0 A;  1LJY A;  4QZV B;  3B9D A;  5DF0 A;  1NWR A;  2MLY A;  4MNJ A;  4DRJ A;  4QT2 A;  4G50 A;  1ZU8 A;  2MPH A;  1Q6I A;  3O5I A;  2PV1 A;  1LL7 A;  4Z2K A;  1ZBK A;  1FKD A;  2ZQU A;  3ARZ A;  3FAP A;  2IF4 A;  3BMB A;  4N19 A;  2DG3 A;  2XP5 A;  3TC5 A;  3UF8 A;  4ZPW R;  4DWS A;  2AOS A;  3O5K A;  5DIV A;  2O9O A;  1WAW A;  1FKT A;  1SYT A;  2ZR4 A;  1R9H A;  2XP4 A;  3KAF A;  5B8I C;  2XP9 A;  4XAK A;  3RME A;  1D2K A;  2A3C A;  1EYM A;  1D7J A;  3AS0 A;  3KAI A;  1E6Z A;  1UR8 A;  2ZQS A;  4ODK A;  4DWS B;  3ARP A;  3WD1 A;  1JNT A;  2ZQT A;  4U84 A;  1H0I A;  1LG2 A;  1FAP A;  1W1V A;  1K9T A;  1TFV A;  2B5U B;  4BF8 A;  5JH8 A;  2KE0 A;  1LQ0 A;  4IPX A;  4TX0 A;  4W5U A;  1W9U A;  1ZCN A;  2MLX A;  3CGM A;  3ARO A;  4ZPT R;  1O6I A;  2B31 A;  3FXY A;  3TCZ A;  3ARX A;  4DRN A;  4Z2J A;  2LKN A;  2DSU A;  3PA7 A;  3KAH A;  1W9V A;  3BXW A;  3H9R B;  4JYS A;  2A3E A;  3CHD A;  1JNE A;  1EIB A;  2ZR5 A;  1CTN A;  1NWU A;  4TW8 A;  2WM0 A;  3CHE A;  2XP6 A;  5HKG A;  1KT1 A;  2ESC A;  5DEZ A;  1A7X A;  3UI5 A;  1E6N A;  2RQS A;  1FKG A;  1W1P A;  2F21 A;  3CHC A;  1F40 A;  3G6L A;  1Q6H A;  1YW5 A;  3PRA A;  1E44 A;  3AS1 A;  2F4E A;  3B7X A;  1FKI A;  3ALF A;  1E9L A;  1FJD A;  4U85 A;  3NI6 A;  3O5D A;  4Z2H A;  2KGJ A;  5HW8 A;  1FKR A;  3EIP A;  4DRI A;  1ZBV A;  1W1Y A;  1LG1 A;  4HBO A;  1Q6U A;  3B9A A;  4DRH A;  4LAW A;  4WKA A;  3O5P A;  2RUQ A;  3WIJ A;  1PBK A;  1L1P A;  4ODO A;  3CH9 A;  2XP8 A;  2PV3 A; 
#chains in the Genus database with same CATH homology
 4MNM A;  1FKB A;  2RUR A;  3PRD A;  4KQZ A;  3RM8 A;  2F2D A;  1WNO A;  2A3B A;  4W9Q A;  4MGV A;  4L72 B;  1BKF A;  3IHZ A;  2WK2 A;  3IKD A;  1FKK A;  4L3N A;  1VF8 A;  3GPK A;  4DRK A;  1J4I A;  4ZS6 A;  4DWS C;  3KAB A;  4R0X A;  2FAP A;  2AWG A;  3TDB A;  3WQW A;  1X6N A;  1FFR A;  1OGB A;  1HKI A;  2YBU A;  4Z2G A;  4IQ2 A;  2JZV A;  1HJV A;  3ART A;  3ODK A;  2VN1 A;  1D7H A;  3ARQ A;  3WKZ A;  1E15 A;  1FKL A;  4J4N A;  1J6Y A;  1D7I A;  1OWQ A;  1E6P A;  4ODL A;  1M5Y A;  4P8W A;  5HTG A;  3G6M A;  1FKF A;  4GGQ A;  4JFI A;  2KR7 A;  3RGC A;  3MDY B;  3O5J A;  1ROT A;  4GIV A;  1FFQ A;  4Z2L A;  1PIN A;  2A3A A;  3UQA A;  3WD4 A;  4O2T A;  5I98 A;  1RD6 A;  4P8V A;  3UQI A;  4WKH A;  3WH0 A;  5HWC A;  3RFW A;  3UQB A;  2M1I A;  3O5G A;  4LAX A;  3RM4 A;  4C02 B;  3O5R A;  3B9E A;  4AY1 A;  2DT0 A;  3FY1 A;  1NWS A;  4S3K A;  3IKG A;  4TNS A;  1X6L A;  2XP7 A;  3KAG A;  1NMW A;  2RSE A;  4W9O A;  4QT3 A;  4WK9 A;  4MAV A;  1JND A;  1H0G A;  2RUD A;  3NRK A;  2UZ5 A;  4P8X A;  1XHG A;  1Y0O A;  4NNR A;  3ARU A;  3KZ7 A;  4ODQ A;  5HW7 A;  1UR9 A;  3PRB A;  3OA5 A;  1IX5 A;  4URI A;  1JNS A;  3CZ8 A;  3WD0 A;  3CGN A;  4DH0 A;  2G8Z A;  1HKM A;  3QOK A;  4IT4 A;  4IT6 A;  1T11 A;  1XRV A;  2LJ4 A;  1Q1C A;  3KAC A;  1NWT A;  5HUA A;  1GOI A;  3ARW A;  3VAW A;  1J4H A;  4MTV A;  3OOB A;  3RM9 A;  3UI4 A;  1NMV A;  4MNK A;  4DRP A;  4DZ2 A;  2FKE A;  1OGG A;  3W4R A;  1QZ2 A;  1ZBW A;  3O5L A;  3WL1 A;  4DZ3 A;  4NSB A;  3AS3 A;  2DT2 A;  1HKK A;  1LL6 A;  1JVW A;  2M2A A;  1W26 A;  2D9F A;  2L2S A;  4TYO A;  3LUO A;  1EDQ A;  1D6O A;  3ARR A;  4DWS D;  4JFK A;  2DSV A;  1HJW A;  1WB0 A;  2Y78 A;  4DT4 A;  2KFW A;  3O5Q A;  4WJX A;  1ZK6 A;  4HAR A;  4MPK A;  1F8A B;  2M08 A;  4TW7 A;  2ZQV A;  2MNT A;  3ARV A;  1J4R A;  1W9P A;  5BXJ A;  3EY6 A;  4NZC A;  4HBE A;  4JFL A;  2DSW A;  4FN2 A;  2O92 A;  1B6C A;  1TCO C;  1E6R A;  1EHN A;  1ZL1 A;  5GPG A;  2DT3 A;  4LAY A;  4DIP A;  2IUZ A;  1SR0 A;  3AS2 A;  2OLH A;  4S3J A;  5DO2 A;  3WL0 A;  1QPL A;  2VCD A;  3O5E A;  5DIU A;  4ML4 A;  1C9H A;  4P8U A;  1GPF A;  4FAP A;  4JFJ A;  4JFM A;  3WQV A;  1NSG A;  3IK8 A;  4DRO A;  5DIT A;  3PR9 A;  5HWB A;  4TW6 A;  1ITX A;  2WLZ A;  4W9P A;  2KO7 A;  2DG4 A;  1NH6 A;  4WIW A;  2DG9 A;  2LPV A;  1QPF A;  2LGO A;  2FDM A;  4IQC A;  4ODM A;  1HJX A;  5D75 A;  4WKF A;  1YAT A;  4MSP A;  4Q22 A;  2PI6 A;  2ZR6 A;  1W1T A;  2K8I A;  4ODN A;  3I6C A;  2MLZ A;  5HW6 A;  5GPR A;  2KI3 A;  2RUC A;  1HXV A;  2XPA A;  3JYJ A;  3ARS A;  2G41 A;  4ODR A;  3ARY A;  4ITZ A;  4KR0 B;  3WD3 A;  2PPO A;  4ODP A;  2DPE A;  2Q5A A;  1EQ3 A;  2XPB A;  1BL4 A;  4LAV A;  3ALG A;  2ITK A;  2QF8 A;  4DRQ A;  4LGX A;  2DSZ A;  3NTP A;  3O5M A;  4U86 A;  4Q7N A;  3UI6 A;  1U79 A;  2YBT A;  5GQB A;  2MF9 A;  1FKS A;  1LL4 A;  3B8S A;  4MNL A;  3JYM A;  1HKJ A;  1ROU A;  4DRM A;  1KT0 A;  3O5O A;  1ZB5 A;  3KAD A;  4J4O A;  5HT1 A;  2XP3 A;  4Z2I A;  1FKH A;  4PTM A;  4ZPV R;  3WD2 A;  1FKJ A;  1P5Q A;  4G2P A;  5J6E A;  3O5F A;  1GUV A;  3JXV A;  5HBF A;  2PBC A;  2N87 A;  1FD9 A;  2PPN A;  2PV2 A;  1KFW A;  2DT1 A;  2PPP A;  4R5E A;  3AQU A;  1N1A A;  2WLY A;  3CHF A;  3KCE A;  4QIB A;  2OFN A;  1ZBC A;  1LJY A;  4QZV B;  3B9D A;  5DF0 A;  1NWR A;  2MLY A;  4MNJ A;  4DRJ A;  4QT2 A;  4G50 A;  1ZU8 A;  2MPH A;  1Q6I A;  3O5I A;  2PV1 A;  1LL7 A;  4Z2K A;  1ZBK A;  1FKD A;  2ZQU A;  3ARZ A;  3FAP A;  2IF4 A;  4N19 A;  2DG3 A;  2XP5 A;  3TC5 A;  3UF8 A;  4ZPW R;  4DWS A;  2AOS A;  3O5K A;  5DIV A;  2O9O A;  1WAW A;  1FKT A;  1SYT A;  2ZR4 A;  1R9H A;  2XP4 A;  3KAF A;  5B8I C;  2XP9 A;  4XAK A;  3RME A;  1D2K A;  2A3C A;  1EYM A;  1D7J A;  3AS0 A;  3KAI A;  1E6Z A;  1UR8 A;  2ZQS A;  4ODK A;  4DWS B;  3ARP A;  3WD1 A;  1JNT A;  2ZQT A;  4U84 A;  1H0I A;  1LG2 A;  1FAP A;  1W1V A;  1K9T A;  1TFV A;  4BF8 A;  5JH8 A;  2KE0 A;  1LQ0 A;  4IPX A;  4TX0 A;  4W5U A;  1W9U A;  1ZCN A;  2MLX A;  3CGM A;  3ARO A;  4ZPT R;  1O6I A;  2B31 A;  3FXY A;  3TCZ A;  3ARX A;  4DRN A;  4Z2J A;  2LKN A;  2DSU A;  3PA7 A;  3KAH A;  1W9V A;  3BXW A;  3H9R B;  4JYS A;  2A3E A;  3CHD A;  1JNE A;  1EIB A;  2ZR5 A;  1CTN A;  1NWU A;  4TW8 A;  2WM0 A;  3CHE A;  2XP6 A;  5HKG A;  1KT1 A;  2ESC A;  5DEZ A;  1A7X A;  3UI5 A;  1E6N A;  2RQS A;  1FKG A;  1W1P A;  2F21 A;  3CHC A;  1F40 A;  3G6L A;  1Q6H A;  1YW5 A;  3PRA A;  3AS1 A;  2F4E A;  3B7X A;  1FKI A;  3ALF A;  1E9L A;  1FJD A;  4U85 A;  3NI6 A;  3O5D A;  4Z2H A;  2KGJ A;  5HW8 A;  1FKR A;  4DRI A;  1ZBV A;  1W1Y A;  1LG1 A;  4HBO A;  1Q6U A;  3B9A A;  4DRH A;  4LAW A;  4WKA A;  3O5P A;  2RUQ A;  3WIJ A;  1PBK A;  1L1P A;  4ODO A;  3CH9 A;  2XP8 A;  2PV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...