4ODLA

Structure of slyd from thermus thermophilus in complex with s2 peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
molecule tags Isomerase, chaperone
source organism Thermus thermophilus
total genus 31
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odlA00
4FAPA 1J4IA 2PPPA 2ZQSA 3JXVA 1Q1CA 3NRKA 1QPLA 2IF4A 2RUCA 2LGOA 3O5EA 3MDYB 1L1PA 1FKHA 1ROTA 4MSPA 4JFLA 3TCZA 3O5GA 2AWGA 2KR7A 3UF8A 1BL4A 1D7IA 2F2DA 4DRHA 4TW7A 2JZVA 3IKDA 2F4EA 2M08A 2ZQVA 2MLXA 4JFKA 4QT3A 4DT4A 4N19A 1FKBA 2ZR6A 3H9RB 2PV3A 2ZQTA 4GIVA 4JFJA 1PBKA 1Q6HA 5HUAA 4U85A 3UI5A 4W9QA 2DG3A 2VN1A 2M1IA 2Y78A 1JNTA 3JYJA 3GPKA 1FKKA 3FAPA 4LAVA 3UQBA 2LJ4A 5B8IC 4G50A 1FKJA 1QPFA 5HWBA 1BKFA 4ITZA 2VCDA 2D9FA 2N87A 4LAXA 4DRNA 4DRJA 1PINA 2DG4A 1FKSA 1T11A 1FAPA 1Q6IA 4QT2A 2M2AA 5HTGA 5BXJA 5DIVA 4W9PA 2FKEA 3KAIA 3KADA 3TDBA 1FKLA 3O5PA 2XP5A 3O5DA 3UI6A 3UQAA 4TW8A 1KT0A 1ROUA 4DRQA 1U79A 1D7JA 1A7XA 2XPBA 3ODKA 3I6CA 1P5QA 4DRMA 3O5IA 1EYMA 5D75A 4DRIA 4C02B 2PPOA 4U84A 1NSGA 2RURA 2LKNA 3KZ7A 3PRDA 4DRKA 4DRPA 1W26A 3CGNA 1YW5A 5DITA 2XP9A 2XP4A 3JYMA 1JVWA 2KFWA 4JFIA 4TNSA 1FKDA 4IQ2A 2K8IA 1EQ3A 2FAPA 2UZ5A 3KAFA 1HXVA 2MLYA 2Q5AA 3IK8A 2XP6A 1NMWA 4J4OA 3RFWA 4DZ2A 1N1AA 2PV1A 1F40A 3LUOA 1F8AB 1Y0OA 4JFMA 5HW8A 2PV2A 4ODQA 1FJDA 4BF8A 2OFNA 1ZCNA 1D7HA 4ODRA 2PBCA 2ZQUA 1JNSA 2DG9A 1M5YA 2MLZA 3O5QA 2ZR4A 2MF9A 3TC5A 3UQIA 2ZR5A 5HWCA 4DH0A 4ODLA 1FKTA 1FKRA 3OOBA 1FD9A 3B7XA 1J6YA 3KAGA 4G2PA 1FKGA 2KGJA 3KAHA 1C9HA 1D6OA 1FKFA 4IQCA 3VAWA 1Q6UA 3IHZA 4J4NA 3KABA 4IPXA 4TW6A 4TYOA 1J4HA 1TCOC 4TX0A 2PPNA 3O5JA 4W9OA 4ODMA 4DIPA 4ODOA 2LPVA 2ITKA 3NI6A 3UI4A 2KE0A 5J6EA 4NNRA 3PA7A 2KI3A 2XP7A 2XP8A 3O5KA 3O5RA 4FN2A 5HT1A 4R0XA 5HKGA 5HW7A 3KACA 4ODPA 3WH0A 1B6CA 1ZK6A 4U86A 1R9HA 4DROA 3PRBA 2RSEA 4ODKA 4MGVA 4LAYA 1NMVA 3O5FA 1J4RA 2RUQA 3O5OA 2MPHA 3NTPA 4GGQA 4ODNA 5DIUA 1QZ2A 4LAWA 2RQSA 2KO7A 3KCEA 4DZ3A 5I98A 1KT1A 2F21A 1YATA 3CGMA 4JYSA 2RUDA 3O5LA 5HW6A 2L2SA 4O2TA 4QIBA 3EY6A 1FKIA 2XP3A 5GPGA 3O5MA 3IKGA 2XPAA 3RGCA 2MNTA
chains in the Genus database with same CATH superfamily
1J4IA 3JXVA 1Q1CA 3NRKA 2IF4A 2RUCA 3TCZA 3O5GA 4TW7A 4Z2KA 3H9RB 2B31A 2PN0A 3G6LA 1Q6HA 1GPFA 4ZPWR 4LAVA 4NSBA 4MAVA 4PTMA 1FKJA 1QPFA 4ITZA 2VCDA 2D9FA 2N87A 2WM0A 1FAPA 2DSZA 5HTGA 5DIVA 1ZBVA 3KADA 2B5UB 3TDBA 1FKLA 3O5PA 1X6NA 2XP5A 3O5DA 3PR9A 4L72B 3GTYX 3ODKA 4DWSC 2PPOA 4R5EA 4DRPA 3WD1A 4S3JA 2IUZA 4P8VA 1JVWA 2OLHA 2FAPA 2UZ5A 3IK8A 3RFWA 1F40A 1LL7A 5HW8A 1HKKA 1ZCNA 2DSVA 1JNSA 1HKJA 3O5QA 5HWCA 4DH0A 2F23A 4WK9A 1NWSA 1HJXA 3B7XA 3ARVA 4URIA 3ARTA 2KGJA 4Z2IA 1D6OA 1ITXA 1GRJA 3WD3A 1LQ0A 3IHZA 3KABA 3AS2A 3AS3A 2PPNA 4UDMA 2ITKA 4HBOA 4ML4A 1SYTA 2KI3A 3O5KA 3O5RA 5HT1A 3CHFA 1W9PA 5HW7A 3WH0A 1B6CA 4U86A 3PRBA 3O5FA 1J4RA 2RUQA 4GGQA 5DIUA 1KFWA 1QZ2A 2RQSA 4DZ3A 3B9EA 2F21A 3CGMA 3AS1A 3EY6A 3ARWA 3O5MA 3IKGA 2XPAA 2MNTA 4FAPA 2PPPA 3O5EA 1FKHA 1ROTA 3ARQA 3UF8A 1BL4A 3IKDA 3QOKA 4DWSD 2PV3A 4GIVA 4JFJA 4U85A 3GU0A 2VN1A 2YBUA 2M1IA 3RM9A 2Y78A 1JNTA 1IX5A 1XHGA 3FAPA 3PRAA 5JH8A 5HWBA 1W1YA 4WKHA 4DRJA 1PINA 1NWUA 4ZPTR 1FKSA 1Q6IA 5BXJA 2DPEA 4ZPVR 3UQAA 2P4VA 3AROA 5GQBA 1ROUA 4DRQA 1U79A 2XPBA 3O5IA 3CHCA 4C02B 4U84A 3B8SA 3FY1A 4MNLA 4WIWA 4Q7NA 1E6ZA 3ALGA 4JFIA 2KFWA 1NWRA 1ZBCA 4IQ2A 1EQ3A 2MLYA 4J4OA 1N1AA 1EHNA 2PV1A 3LUOA 1F8AB 2DT1A 1FJDA 1LL6A 2PBCA 1M5YA 1OGBA 2ZR4A 2MF9A 1W1VA 4P8WA 2ZR5A 1K9TA 2EULA 4Z2HA 1Q6UA 4J4NA 4IPXA 1TCOC 4TX0A 1ZBKA 4DWSA 4W9OA 1UR9A 1ZU8A 3WL1A 3UI4A 2WK2A 4FN2A 4R0XA 3CH9A 2G8ZA 1E15A 1X6LA 1E44A 3WL0A 3BXWA 3NTPA 3KCEA 2A3EA 4JYSA 5HW6A 3O5LA 2L2SA 2G41A 5GPGA 2XP3A 3RGCA 5DF0A 2ZQSA 1ZL1A 1QPLA 4AY1A 2LGOA 4MSPA 1LG1A 2KR7A 4MNMA 1D7IA 2F2DA 2JZVA 2F4EA 2M08A 2ZQVA 4DWSB 2ZR6A 1O6IA 4Z2JA 1PBKA 4W9QA 4Q22A 5DEZA 3RM4A 3GPKA 5B8IC 1BKFA 4LAXA 3CHDA 1JCHB 3KAIA 3UI6A 1KT0A 2QF8A 4IT6A 1UR8A 1A7XA 3I6CA 1EYMA 3ARPA 1E6RA 4DRIA 1NSGA 2RURA 3KZ7A 3PRDA 4DRKA 4MNJA 2AOSA 3RM8A 1ZB5A 3B9DA 2XP4A 3JYMA 3W4RA 2Q5AA 2XP6A 1XRVA 4DZ2A 4Z2GA 1Y0OA 1SR0A 1RD6A 3CHEA 4JFMA 2ETNA 4IT4A 1LL4A 2O9OA 4ODQA 3RMEA 4BF8A 2OFNA 1D7HA 4WJXA 4ODRA 4LGXA 4W5UA 2DSUA 1WAWA 4P8UA 5HBFA 3TC5A 1GUVA 3ARYA 4ODLA 3AS0A 3WQWA 1FKTA 1FKRA 1HJWA 3OOBA 1FD9A 4G2PA 1E9LA 1JNDA 1FKGA 3KAHA 2WLYA 3WD4A 1C9HA 5DO2A 2FDMA 1NWTA 3VAWA 3ARZA 3EIPA 1J4HA 2A3BA 3O5JA 2A3AA 4NZCA 4ODOA 3BMBA 5J6EA 3PA7A 2XP8A 5HKGA 2O92A 4ODPA 4DROA 2RSEA 4ODKA 4LAYA 1NMVA 3O5OA 2MPHA 1OGGA 2A3CA 4KR0B 1D2KA 5I98A 1KT1A 1H0GA 3WQVA 1YATA 1E6NA 4O2TA 4QIBA 3ARXA 4HBEA 2WLZA 2DT0A 3WKZA 3OA5A 4MTVA 1L1PA 3MDYB 4JFLA 2AWGA 4DRHA 3ARUA 3G6MA 4JFKA 4QT3A 1EIBA 2MLXA 4S3KA 4DT4A 1JNEA 4N19A 3WD2A 1FKBA 3FXYA 2ZQTA 5HUAA 3ALFA 3UI5A 2DG3A 1W9VA 1TFVA 3JYJA 1EDQA 1FKKA 5GPRA 3UQBA 2LJ4A 1W1TA 4G50A 4HARA 4DRNA 3ARSA 1T11A 2DG4A 4QT2A 2M2AA 4W9PA 2FKEA 4WKAA 4MPKA 4TW8A 3AQUA 1CTNA 1D7JA 1P5QA 4DRMA 5D75A 3B9AA 1FFQA 4KQZA 1LG2A 1W1PA 2LKNA 1W26A 3CGNA 1YW5A 5DITA 3ARRA 1OWQA 2XP9A 1HKMA 1W9UA 4TNSA 1NH6A 1FKDA 1FFRA 2K8IA 4XAKA 1HKIA 3KAFA 1HXVA 1NMWA 2PI6A 2YBTA 2DT3A 4ZS6A 1ZBWA 4L3NA 1HJVA 2PV2A 2DSWA 2ZQUA 2DG9A 1VF8A 3CZ8A 2MLZA 2ESCA 3UQIA 1GOIA 1J6YA 1WNOA 3KAGA 4Z2LA 4IQCA 1FKFA 4TW6A 4TYOA 1H0IA 3WD0A 4ODMA 4DIPA 2LPVA 3NI6A 1E6PA 2KE0A 1LJYA 4NNRA 2XP7A 3KACA 4P8XA 1ZK6A 1R9HA 2DT2A 4QZVB 4MGVA 1WB0A 3WIJA 4ODNA 4LAWA 4WKFA 2KO7A 2RUDA 1FKIA 4MNKA
chains in the Genus database with same CATH topology
1J4IA 3JXVA 1Q1CA 3NRKA 2IF4A 2RUCA 3TCZA 3O5GA 4TW7A 4Z2KA 3H9RB 2B31A 3G6LA 1Q6HA 1GPFA 4ZPWR 4LAVA 4NSBA 4MAVA 4PTMA 1FKJA 1QPFA 4ITZA 2VCDA 2D9FA 2N87A 2WM0A 1FAPA 2DSZA 5HTGA 5DIVA 1ZBVA 3KADA 3TDBA 1FKLA 3O5PA 1X6NA 2XP5A 3O5DA 3PR9A 4L72B 3ODKA 4DWSC 2PPOA 4R5EA 4DRPA 3WD1A 4S3JA 2IUZA 4P8VA 1JVWA 2OLHA 2FAPA 2UZ5A 3IK8A 3RFWA 1F40A 1LL7A 5HW8A 1HKKA 1ZCNA 2DSVA 1JNSA 1HKJA 3O5QA 5HWCA 4DH0A 4WK9A 1NWSA 1HJXA 3B7XA 3ARVA 4URIA 3ARTA 2KGJA 4Z2IA 1D6OA 1ITXA 3WD3A 1LQ0A 3IHZA 3KABA 3AS2A 3AS3A 2PPNA 2ITKA 4HBOA 4ML4A 1SYTA 2KI3A 3O5KA 3O5RA 5HT1A 3CHFA 1W9PA 5HW7A 3WH0A 1B6CA 4U86A 3PRBA 3O5FA 1J4RA 2RUQA 4GGQA 5DIUA 1KFWA 1QZ2A 2RQSA 4DZ3A 3B9EA 2F21A 3CGMA 3AS1A 3EY6A 3ARWA 3O5MA 3IKGA 2XPAA 2MNTA 4FAPA 2PPPA 3O5EA 1FKHA 1ROTA 3ARQA 3UF8A 1BL4A 3IKDA 3QOKA 4DWSD 2PV3A 4GIVA 4JFJA 4U85A 3RM9A 2VN1A 2YBUA 2M1IA 2Y78A 1JNTA 1IX5A 1XHGA 3FAPA 3PRAA 5JH8A 5HWBA 1W1YA 4WKHA 4DRJA 1PINA 1NWUA 4ZPTR 1FKSA 1Q6IA 5BXJA 2DPEA 4ZPVR 3UQAA 3AROA 5GQBA 1ROUA 4DRQA 1U79A 2XPBA 3O5IA 3CHCA 4C02B 4U84A 3B8SA 3FY1A 4MNLA 4WIWA 4Q7NA 1E6ZA 3ALGA 4JFIA 2KFWA 1NWRA 1ZBCA 4IQ2A 1EQ3A 2MLYA 4J4OA 1N1AA 1EHNA 2PV1A 3LUOA 1F8AB 2DT1A 1FJDA 1LL6A 2PBCA 1M5YA 1OGBA 2ZR4A 2MF9A 1W1VA 4P8WA 2ZR5A 1K9TA 4Z2HA 1Q6UA 4J4NA 4IPXA 1TCOC 4TX0A 1ZBKA 4DWSA 4W9OA 1UR9A 1ZU8A 3WL1A 3UI4A 2WK2A 4FN2A 4R0XA 3CH9A 2G8ZA 1E15A 1X6LA 3WL0A 3BXWA 3NTPA 3KCEA 2A3EA 4JYSA 5HW6A 3O5LA 2L2SA 2G41A 5GPGA 2XP3A 3RGCA 5DF0A 2ZQSA 1ZL1A 1QPLA 4AY1A 2LGOA 4MSPA 1LG1A 2KR7A 4MNMA 1D7IA 2F2DA 2JZVA 2F4EA 2M08A 2ZQVA 4DWSB 2ZR6A 1O6IA 4Z2JA 1PBKA 4W9QA 4Q22A 5DEZA 3RM4A 3GPKA 5B8IC 1BKFA 4LAXA 3CHDA 3KAIA 3UI6A 1KT0A 2QF8A 4IT6A 1UR8A 1A7XA 3I6CA 1EYMA 3ARPA 1E6RA 4DRIA 1NSGA 2RURA 3KZ7A 3PRDA 4DRKA 4MNJA 2AOSA 3RM8A 1ZB5A 3B9DA 2XP4A 3JYMA 3W4RA 2Q5AA 2XP6A 1XRVA 4DZ2A 4Z2GA 1Y0OA 1SR0A 1RD6A 3CHEA 4JFMA 4IT4A 1LL4A 2O9OA 4ODQA 3RMEA 4BF8A 2OFNA 1D7HA 4WJXA 4ODRA 4LGXA 4W5UA 2DSUA 1WAWA 4P8UA 5HBFA 3TC5A 1GUVA 3ARYA 4ODLA 3AS0A 3WQWA 1FKTA 1FKRA 1HJWA 3OOBA 1FD9A 4G2PA 1E9LA 1JNDA 1FKGA 3KAHA 2WLYA 3WD4A 1C9HA 5DO2A 2FDMA 1NWTA 3VAWA 3ARZA 1J4HA 2A3BA 3O5JA 2A3AA 4NZCA 4ODOA 5J6EA 3PA7A 2XP8A 5HKGA 2O92A 4ODPA 4DROA 2RSEA 4ODKA 4LAYA 1NMVA 3O5OA 2MPHA 1OGGA 2A3CA 4KR0B 1D2KA 5I98A 1KT1A 1H0GA 3WQVA 1YATA 1E6NA 4O2TA 4QIBA 3ARXA 4HBEA 2WLZA 2DT0A 3WKZA 3OA5A 4MTVA 1L1PA 3MDYB 4JFLA 2AWGA 4DRHA 3ARUA 3G6MA 4JFKA 4QT3A 1EIBA 2MLXA 4S3KA 4DT4A 1JNEA 4N19A 3WD2A 1FKBA 3FXYA 2ZQTA 5HUAA 3ALFA 3UI5A 2DG3A 1W9VA 1TFVA 3JYJA 1EDQA 1FKKA 5GPRA 3UQBA 2LJ4A 1W1TA 4G50A 4HARA 4DRNA 3ARSA 1T11A 2DG4A 4QT2A 2M2AA 4W9PA 2FKEA 4WKAA 4MPKA 4TW8A 3AQUA 1CTNA 1D7JA 1P5QA 4DRMA 5D75A 3B9AA 1FFQA 4KQZA 1LG2A 1W1PA 2LKNA 1W26A 3CGNA 1YW5A 5DITA 3ARRA 1OWQA 2XP9A 1HKMA 1W9UA 4TNSA 1NH6A 1FKDA 1FFRA 2K8IA 4XAKA 1HKIA 3KAFA 1HXVA 1NMWA 2PI6A 2YBTA 2DT3A 4ZS6A 1ZBWA 4L3NA 1HJVA 2PV2A 2DSWA 2ZQUA 2DG9A 1VF8A 3CZ8A 2MLZA 2ESCA 3UQIA 1GOIA 1J6YA 1WNOA 3KAGA 4Z2LA 4IQCA 1FKFA 4TW6A 4TYOA 1H0IA 3WD0A 4ODMA 4DIPA 2LPVA 3NI6A 1E6PA 2KE0A 1LJYA 4NNRA 2XP7A 3KACA 4P8XA 1ZK6A 1R9HA 2DT2A 4QZVB 4MGVA 1WB0A 3WIJA 4ODNA 4LAWA 4WKFA 2KO7A 2RUDA 1FKIA 4MNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAP A;  1J4I A;  2PPP A;  2ZQS A;  3JXV A;  1Q1C A;  3NRK A;  1QPL A;  2IF4 A;  2RUC A;  2LGO A;  3O5E A;  3MDY B;  1L1P A;  1FKH A;  1ROT A;  4MSP A;  4JFL A;  3TCZ A;  3O5G A;  2AWG A;  2KR7 A;  3UF8 A;  1BL4 A;  1D7I A;  2F2D A;  4DRH A;  4TW7 A;  2JZV A;  3IKD A;  2F4E A;  2M08 A;  2ZQV A;  2MLX A;  4JFK A;  4QT3 A;  4DT4 A;  4N19 A;  1FKB A;  2ZR6 A;  3H9R B;  2PV3 A;  2ZQT A;  4GIV A;  4JFJ A;  1PBK A;  1Q6H A;  5HUA A;  4U85 A;  3UI5 A;  4W9Q A;  2DG3 A;  2VN1 A;  2M1I A;  2Y78 A;  1JNT A;  3JYJ A;  3GPK A;  1FKK A;  3FAP A;  4LAV A;  3UQB A;  2LJ4 A;  5B8I C;  4G50 A;  1FKJ A;  1QPF A;  5HWB A;  1BKF A;  4ITZ A;  2VCD A;  2D9F A;  2N87 A;  4LAX A;  4DRN A;  4DRJ A;  1PIN A;  2DG4 A;  1FKS A;  1T11 A;  1FAP A;  1Q6I A;  4QT2 A;  2M2A A;  5HTG A;  5BXJ A;  5DIV A;  4W9P A;  2FKE A;  3KAI A;  3KAD A;  3TDB A;  1FKL A;  3O5P A;  2XP5 A;  3O5D A;  3UI6 A;  3UQA A;  4TW8 A;  1KT0 A;  1ROU A;  4DRQ A;  1U79 A;  1D7J A;  1A7X A;  2XPB A;  3ODK A;  3I6C A;  1P5Q A;  4DRM A;  3O5I A;  1EYM A;  5D75 A;  4DRI A;  4C02 B;  2PPO A;  4U84 A;  1NSG A;  2RUR A;  2LKN A;  3KZ7 A;  3PRD A;  4DRK A;  4DRP A;  1W26 A;  3CGN A;  1YW5 A;  5DIT A;  2XP9 A;  2XP4 A;  3JYM A;  1JVW A;  2KFW A;  4JFI A;  4TNS A;  1FKD A;  4IQ2 A;  2K8I A;  1EQ3 A;  2FAP A;  2UZ5 A;  3KAF A;  1HXV A;  2MLY A;  2Q5A A;  3IK8 A;  2XP6 A;  1NMW A;  4J4O A;  3RFW A;  4DZ2 A;  1N1A A;  2PV1 A;  1F40 A;  3LUO A;  1F8A B;  1Y0O A;  4JFM A;  5HW8 A;  2PV2 A;  4ODQ A;  1FJD A;  4BF8 A;  2OFN A;  1ZCN A;  1D7H A;  4ODR A;  2PBC A;  2ZQU A;  1JNS A;  2DG9 A;  1M5Y A;  2MLZ A;  3O5Q A;  2ZR4 A;  2MF9 A;  3TC5 A;  3UQI A;  2ZR5 A;  5HWC A;  4DH0 A;  4ODL A;  1FKT A;  1FKR A;  3OOB A;  1FD9 A;  3B7X A;  1J6Y A;  3KAG A;  4G2P A;  1FKG A;  2KGJ A;  3KAH A;  1C9H A;  1D6O A;  1FKF A;  4IQC A;  3VAW A;  1Q6U A;  3IHZ A;  4J4N A;  3KAB A;  4IPX A;  4TW6 A;  4TYO A;  1J4H A;  1TCO C;  4TX0 A;  2PPN A;  3O5J A;  4W9O A;  4ODM A;  4DIP A;  4ODO A;  2LPV A;  2ITK A;  3NI6 A;  3UI4 A;  2KE0 A;  5J6E A;  4NNR A;  3PA7 A;  2KI3 A;  2XP7 A;  2XP8 A;  3O5K A;  3O5R A;  4FN2 A;  5HT1 A;  4R0X A;  5HKG A;  5HW7 A;  3KAC A;  4ODP A;  3WH0 A;  1B6C A;  1ZK6 A;  4U86 A;  1R9H A;  4DRO A;  3PRB A;  2RSE A;  4ODK A;  4MGV A;  4LAY A;  1NMV A;  3O5F A;  1J4R A;  2RUQ A;  3O5O A;  2MPH A;  3NTP A;  4GGQ A;  4ODN A;  5DIU A;  1QZ2 A;  4LAW A;  2RQS A;  2KO7 A;  3KCE A;  4DZ3 A;  5I98 A;  1KT1 A;  2F21 A;  1YAT A;  3CGM A;  4JYS A;  2RUD A;  3O5L A;  5HW6 A;  2L2S A;  4O2T A;  4QIB A;  3EY6 A;  1FKI A;  2XP3 A;  5GPG A;  3O5M A;  3IKG A;  2XPA A;  3RGC A;  2MNT A; 
#chains in the Genus database with same CATH topology
 1J4I A;  3JXV A;  1Q1C A;  3NRK A;  2IF4 A;  2RUC A;  3TCZ A;  3O5G A;  4TW7 A;  4Z2K A;  3H9R B;  2B31 A;  2PN0 A;  3G6L A;  1Q6H A;  1GPF A;  4ZPW R;  4LAV A;  4NSB A;  4MAV A;  4PTM A;  1FKJ A;  1QPF A;  4ITZ A;  2VCD A;  2D9F A;  2N87 A;  2WM0 A;  1FAP A;  2DSZ A;  5HTG A;  5DIV A;  1ZBV A;  3KAD A;  2B5U B;  3TDB A;  1FKL A;  3O5P A;  1X6N A;  2XP5 A;  3O5D A;  3PR9 A;  4L72 B;  3GTY X;  3ODK A;  4DWS C;  2PPO A;  4R5E A;  4DRP A;  3WD1 A;  4S3J A;  2IUZ A;  4P8V A;  1JVW A;  2OLH A;  2FAP A;  2UZ5 A;  3IK8 A;  3RFW A;  1F40 A;  1LL7 A;  5HW8 A;  1HKK A;  1ZCN A;  2DSV A;  1JNS A;  1HKJ A;  3O5Q A;  5HWC A;  4DH0 A;  2F23 A;  4WK9 A;  1NWS A;  1HJX A;  3B7X A;  3ARV A;  4URI A;  3ART A;  2KGJ A;  4Z2I A;  1D6O A;  1ITX A;  1GRJ A;  3WD3 A;  1LQ0 A;  3IHZ A;  3KAB A;  3AS2 A;  3AS3 A;  2PPN A;  4UDM A;  2ITK A;  4HBO A;  4ML4 A;  1SYT A;  2KI3 A;  3O5K A;  3O5R A;  5HT1 A;  3CHF A;  1W9P A;  5HW7 A;  3WH0 A;  1B6C A;  4U86 A;  3PRB A;  3O5F A;  1J4R A;  2RUQ A;  4GGQ A;  5DIU A;  1KFW A;  1QZ2 A;  2RQS A;  4DZ3 A;  3B9E A;  2F21 A;  3CGM A;  3AS1 A;  3EY6 A;  3ARW A;  3O5M A;  3IKG A;  2XPA A;  2MNT A;  4FAP A;  2PPP A;  3O5E A;  1FKH A;  1ROT A;  3ARQ A;  3UF8 A;  1BL4 A;  3IKD A;  3QOK A;  4DWS D;  2PV3 A;  4GIV A;  4JFJ A;  4U85 A;  3GU0 A;  2VN1 A;  2YBU A;  2M1I A;  3RM9 A;  2Y78 A;  1JNT A;  1IX5 A;  1XHG A;  3FAP A;  3PRA A;  5JH8 A;  5HWB A;  1W1Y A;  4WKH A;  4DRJ A;  1PIN A;  1NWU A;  4ZPT R;  1FKS A;  1Q6I A;  5BXJ A;  2DPE A;  4ZPV R;  3UQA A;  2P4V A;  3ARO A;  5GQB A;  1ROU A;  4DRQ A;  1U79 A;  2XPB A;  3O5I A;  3CHC A;  4C02 B;  4U84 A;  3B8S A;  3FY1 A;  4MNL A;  4WIW A;  4Q7N A;  1E6Z A;  3ALG A;  4JFI A;  2KFW A;  1NWR A;  1ZBC A;  4IQ2 A;  1EQ3 A;  2MLY A;  4J4O A;  1N1A A;  1EHN A;  2PV1 A;  3LUO A;  1F8A B;  2DT1 A;  1FJD A;  1LL6 A;  2PBC A;  1M5Y A;  1OGB A;  2ZR4 A;  2MF9 A;  1W1V A;  4P8W A;  2ZR5 A;  1K9T A;  2EUL A;  4Z2H A;  1Q6U A;  4J4N A;  4IPX A;  1TCO C;  4TX0 A;  1ZBK A;  4DWS A;  4W9O A;  1UR9 A;  1ZU8 A;  3WL1 A;  3UI4 A;  2WK2 A;  4FN2 A;  4R0X A;  3CH9 A;  2G8Z A;  1E15 A;  1X6L A;  1E44 A;  3WL0 A;  3BXW A;  3NTP A;  3KCE A;  2A3E A;  4JYS A;  5HW6 A;  3O5L A;  2L2S A;  2G41 A;  5GPG A;  2XP3 A;  3RGC A;  5DF0 A;  2ZQS A;  1ZL1 A;  1QPL A;  4AY1 A;  2LGO A;  4MSP A;  1LG1 A;  2KR7 A;  4MNM A;  1D7I A;  2F2D A;  2JZV A;  2F4E A;  2M08 A;  2ZQV A;  4DWS B;  2ZR6 A;  1O6I A;  4Z2J A;  1PBK A;  4W9Q A;  4Q22 A;  5DEZ A;  3RM4 A;  3GPK A;  5B8I C;  1BKF A;  4LAX A;  3CHD A;  1JCH B;  3KAI A;  3UI6 A;  1KT0 A;  2QF8 A;  4IT6 A;  1UR8 A;  1A7X A;  3I6C A;  1EYM A;  3ARP A;  1E6R A;  4DRI A;  1NSG A;  2RUR A;  3KZ7 A;  3PRD A;  4DRK A;  4MNJ A;  2AOS A;  3RM8 A;  1ZB5 A;  3B9D A;  2XP4 A;  3JYM A;  3W4R A;  2Q5A A;  2XP6 A;  1XRV A;  4DZ2 A;  4Z2G A;  1Y0O A;  1SR0 A;  1RD6 A;  3CHE A;  4JFM A;  2ETN A;  4IT4 A;  1LL4 A;  2O9O A;  4ODQ A;  3RME A;  4BF8 A;  2OFN A;  1D7H A;  4WJX A;  4ODR A;  4LGX A;  4W5U A;  2DSU A;  1WAW A;  4P8U A;  5HBF A;  3TC5 A;  1GUV A;  3ARY A;  4ODL A;  3AS0 A;  3WQW A;  1FKT A;  1FKR A;  1HJW A;  3OOB A;  1FD9 A;  4G2P A;  1E9L A;  1JND A;  1FKG A;  3KAH A;  2WLY A;  3WD4 A;  1C9H A;  5DO2 A;  2FDM A;  1NWT A;  3VAW A;  3ARZ A;  3EIP A;  1J4H A;  2A3B A;  3O5J A;  2A3A A;  4NZC A;  4ODO A;  3BMB A;  5J6E A;  3PA7 A;  2XP8 A;  5HKG A;  2O92 A;  4ODP A;  4DRO A;  2RSE A;  4ODK A;  4LAY A;  1NMV A;  3O5O A;  2MPH A;  1OGG A;  2A3C A;  4KR0 B;  1D2K A;  5I98 A;  1KT1 A;  1H0G A;  3WQV A;  1YAT A;  1E6N A;  4O2T A;  4QIB A;  3ARX A;  4HBE A;  2WLZ A;  2DT0 A;  3WKZ A;  3OA5 A;  4MTV A;  1L1P A;  3MDY B;  4JFL A;  2AWG A;  4DRH A;  3ARU A;  3G6M A;  4JFK A;  4QT3 A;  1EIB A;  2MLX A;  4S3K A;  4DT4 A;  1JNE A;  4N19 A;  3WD2 A;  1FKB A;  3FXY A;  2ZQT A;  5HUA A;  3ALF A;  3UI5 A;  2DG3 A;  1W9V A;  1TFV A;  3JYJ A;  1EDQ A;  1FKK A;  5GPR A;  3UQB A;  2LJ4 A;  1W1T A;  4G50 A;  4HAR A;  4DRN A;  3ARS A;  1T11 A;  2DG4 A;  4QT2 A;  2M2A A;  4W9P A;  2FKE A;  4WKA A;  4MPK A;  4TW8 A;  3AQU A;  1CTN A;  1D7J A;  1P5Q A;  4DRM A;  5D75 A;  3B9A A;  1FFQ A;  4KQZ A;  1LG2 A;  1W1P A;  2LKN A;  1W26 A;  3CGN A;  1YW5 A;  5DIT A;  3ARR A;  1OWQ A;  2XP9 A;  1HKM A;  1W9U A;  4TNS A;  1NH6 A;  1FKD A;  1FFR A;  2K8I A;  4XAK A;  1HKI A;  3KAF A;  1HXV A;  1NMW A;  2PI6 A;  2YBT A;  2DT3 A;  4ZS6 A;  1ZBW A;  4L3N A;  1HJV A;  2PV2 A;  2DSW A;  2ZQU A;  2DG9 A;  1VF8 A;  3CZ8 A;  2MLZ A;  2ESC A;  3UQI A;  1GOI A;  1J6Y A;  1WNO A;  3KAG A;  4Z2L A;  4IQC A;  1FKF A;  4TW6 A;  4TYO A;  1H0I A;  3WD0 A;  4ODM A;  4DIP A;  2LPV A;  3NI6 A;  1E6P A;  2KE0 A;  1LJY A;  4NNR A;  2XP7 A;  3KAC A;  4P8X A;  1ZK6 A;  1R9H A;  2DT2 A;  4QZV B;  4MGV A;  1WB0 A;  3WIJ A;  4ODN A;  4LAW A;  4WKF A;  2KO7 A;  2RUD A;  1FKI A;  4MNK A; 
#chains in the Genus database with same CATH homology
 1J4I A;  3JXV A;  1Q1C A;  3NRK A;  2IF4 A;  2RUC A;  3TCZ A;  3O5G A;  4TW7 A;  4Z2K A;  3H9R B;  2B31 A;  3G6L A;  1Q6H A;  1GPF A;  4ZPW R;  4LAV A;  4NSB A;  4MAV A;  4PTM A;  1FKJ A;  1QPF A;  4ITZ A;  2VCD A;  2D9F A;  2N87 A;  2WM0 A;  1FAP A;  2DSZ A;  5HTG A;  5DIV A;  1ZBV A;  3KAD A;  3TDB A;  1FKL A;  3O5P A;  1X6N A;  2XP5 A;  3O5D A;  3PR9 A;  4L72 B;  3ODK A;  4DWS C;  2PPO A;  4R5E A;  4DRP A;  3WD1 A;  4S3J A;  2IUZ A;  4P8V A;  1JVW A;  2OLH A;  2FAP A;  2UZ5 A;  3IK8 A;  3RFW A;  1F40 A;  1LL7 A;  5HW8 A;  1HKK A;  1ZCN A;  2DSV A;  1JNS A;  1HKJ A;  3O5Q A;  5HWC A;  4DH0 A;  4WK9 A;  1NWS A;  1HJX A;  3B7X A;  3ARV A;  4URI A;  3ART A;  2KGJ A;  4Z2I A;  1D6O A;  1ITX A;  3WD3 A;  1LQ0 A;  3IHZ A;  3KAB A;  3AS2 A;  3AS3 A;  2PPN A;  2ITK A;  4HBO A;  4ML4 A;  1SYT A;  2KI3 A;  3O5K A;  3O5R A;  5HT1 A;  3CHF A;  1W9P A;  5HW7 A;  3WH0 A;  1B6C A;  4U86 A;  3PRB A;  3O5F A;  1J4R A;  2RUQ A;  4GGQ A;  5DIU A;  1KFW A;  1QZ2 A;  2RQS A;  4DZ3 A;  3B9E A;  2F21 A;  3CGM A;  3AS1 A;  3EY6 A;  3ARW A;  3O5M A;  3IKG A;  2XPA A;  2MNT A;  4FAP A;  2PPP A;  3O5E A;  1FKH A;  1ROT A;  3ARQ A;  3UF8 A;  1BL4 A;  3IKD A;  3QOK A;  4DWS D;  2PV3 A;  4GIV A;  4JFJ A;  4U85 A;  3RM9 A;  2VN1 A;  2YBU A;  2M1I A;  2Y78 A;  1JNT A;  1IX5 A;  1XHG A;  3FAP A;  3PRA A;  5JH8 A;  5HWB A;  1W1Y A;  4WKH A;  4DRJ A;  1PIN A;  1NWU A;  4ZPT R;  1FKS A;  1Q6I A;  5BXJ A;  2DPE A;  4ZPV R;  3UQA A;  3ARO A;  5GQB A;  1ROU A;  4DRQ A;  1U79 A;  2XPB A;  3O5I A;  3CHC A;  4C02 B;  4U84 A;  3B8S A;  3FY1 A;  4MNL A;  4WIW A;  4Q7N A;  1E6Z A;  3ALG A;  4JFI A;  2KFW A;  1NWR A;  1ZBC A;  4IQ2 A;  1EQ3 A;  2MLY A;  4J4O A;  1N1A A;  1EHN A;  2PV1 A;  3LUO A;  1F8A B;  2DT1 A;  1FJD A;  1LL6 A;  2PBC A;  1M5Y A;  1OGB A;  2ZR4 A;  2MF9 A;  1W1V A;  4P8W A;  2ZR5 A;  1K9T A;  4Z2H A;  1Q6U A;  4J4N A;  4IPX A;  1TCO C;  4TX0 A;  1ZBK A;  4DWS A;  4W9O A;  1UR9 A;  1ZU8 A;  3WL1 A;  3UI4 A;  2WK2 A;  4FN2 A;  4R0X A;  3CH9 A;  2G8Z A;  1E15 A;  1X6L A;  3WL0 A;  3BXW A;  3NTP A;  3KCE A;  2A3E A;  4JYS A;  5HW6 A;  3O5L A;  2L2S A;  2G41 A;  5GPG A;  2XP3 A;  3RGC A;  5DF0 A;  2ZQS A;  1ZL1 A;  1QPL A;  4AY1 A;  2LGO A;  4MSP A;  1LG1 A;  2KR7 A;  4MNM A;  1D7I A;  2F2D A;  2JZV A;  2F4E A;  2M08 A;  2ZQV A;  4DWS B;  2ZR6 A;  1O6I A;  4Z2J A;  1PBK A;  4W9Q A;  4Q22 A;  5DEZ A;  3RM4 A;  3GPK A;  5B8I C;  1BKF A;  4LAX A;  3CHD A;  3KAI A;  3UI6 A;  1KT0 A;  2QF8 A;  4IT6 A;  1UR8 A;  1A7X A;  3I6C A;  1EYM A;  3ARP A;  1E6R A;  4DRI A;  1NSG A;  2RUR A;  3KZ7 A;  3PRD A;  4DRK A;  4MNJ A;  2AOS A;  3RM8 A;  1ZB5 A;  3B9D A;  2XP4 A;  3JYM A;  3W4R A;  2Q5A A;  2XP6 A;  1XRV A;  4DZ2 A;  4Z2G A;  1Y0O A;  1SR0 A;  1RD6 A;  3CHE A;  4JFM A;  4IT4 A;  1LL4 A;  2O9O A;  4ODQ A;  3RME A;  4BF8 A;  2OFN A;  1D7H A;  4WJX A;  4ODR A;  4LGX A;  4W5U A;  2DSU A;  1WAW A;  4P8U A;  5HBF A;  3TC5 A;  1GUV A;  3ARY A;  4ODL A;  3AS0 A;  3WQW A;  1FKT A;  1FKR A;  1HJW A;  3OOB A;  1FD9 A;  4G2P A;  1E9L A;  1JND A;  1FKG A;  3KAH A;  2WLY A;  3WD4 A;  1C9H A;  5DO2 A;  2FDM A;  1NWT A;  3VAW A;  3ARZ A;  1J4H A;  2A3B A;  3O5J A;  2A3A A;  4NZC A;  4ODO A;  5J6E A;  3PA7 A;  2XP8 A;  5HKG A;  2O92 A;  4ODP A;  4DRO A;  2RSE A;  4ODK A;  4LAY A;  1NMV A;  3O5O A;  2MPH A;  1OGG A;  2A3C A;  4KR0 B;  1D2K A;  5I98 A;  1KT1 A;  1H0G A;  3WQV A;  1YAT A;  1E6N A;  4O2T A;  4QIB A;  3ARX A;  4HBE A;  2WLZ A;  2DT0 A;  3WKZ A;  3OA5 A;  4MTV A;  1L1P A;  3MDY B;  4JFL A;  2AWG A;  4DRH A;  3ARU A;  3G6M A;  4JFK A;  4QT3 A;  1EIB A;  2MLX A;  4S3K A;  4DT4 A;  1JNE A;  4N19 A;  3WD2 A;  1FKB A;  3FXY A;  2ZQT A;  5HUA A;  3ALF A;  3UI5 A;  2DG3 A;  1W9V A;  1TFV A;  3JYJ A;  1EDQ A;  1FKK A;  5GPR A;  3UQB A;  2LJ4 A;  1W1T A;  4G50 A;  4HAR A;  4DRN A;  3ARS A;  1T11 A;  2DG4 A;  4QT2 A;  2M2A A;  4W9P A;  2FKE A;  4WKA A;  4MPK A;  4TW8 A;  3AQU A;  1CTN A;  1D7J A;  1P5Q A;  4DRM A;  5D75 A;  3B9A A;  1FFQ A;  4KQZ A;  1LG2 A;  1W1P A;  2LKN A;  1W26 A;  3CGN A;  1YW5 A;  5DIT A;  3ARR A;  1OWQ A;  2XP9 A;  1HKM A;  1W9U A;  4TNS A;  1NH6 A;  1FKD A;  1FFR A;  2K8I A;  4XAK A;  1HKI A;  3KAF A;  1HXV A;  1NMW A;  2PI6 A;  2YBT A;  2DT3 A;  4ZS6 A;  1ZBW A;  4L3N A;  1HJV A;  2PV2 A;  2DSW A;  2ZQU A;  2DG9 A;  1VF8 A;  3CZ8 A;  2MLZ A;  2ESC A;  3UQI A;  1GOI A;  1J6Y A;  1WNO A;  3KAG A;  4Z2L A;  4IQC A;  1FKF A;  4TW6 A;  4TYO A;  1H0I A;  3WD0 A;  4ODM A;  4DIP A;  2LPV A;  3NI6 A;  1E6P A;  2KE0 A;  1LJY A;  4NNR A;  2XP7 A;  3KAC A;  4P8X A;  1ZK6 A;  1R9H A;  2DT2 A;  4QZV B;  4MGV A;  1WB0 A;  3WIJ A;  4ODN A;  4LAW A;  4WKF A;  2KO7 A;  2RUD A;  1FKI A;  4MNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...