4ODLA

Structure of slyd from thermus thermophilus in complex with s2 peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 31
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odlA00
2M1IA 3EY6A 3JXVA 1J4HA 5D75A 2D9FA 4LAXA 1C9HA 1ZK6A 2RSEA 2MNTA 3O5OA 3O5KA 4U85A 3TC5A 4DROA 4ODNA 4IQCA 3CGNA 1ROUA 4O2TA 3UQBA 1BL4A 1B6CA 1QPFA 2RUQA 4W9OA 3KAIA 4W9QA 4ODPA 3PRBA 1EQ3A 2ZR6A 2XP9A 1Q1CA 3LUOA 1D7JA 1QZ2A 3KAHA 2FKEA 5DIUA 1T11A 2AWGA 1F40A 3NI6A 4DRIA 4JFIA 4NNRA 4JFMA 1FKGA 3WH0A 4TW7A 1EYMA 4DRMA 2FAPA 3O5MA 3FAPA 3KCEA 2Q5AA 1FKBA 1PBKA 4DT4A 3O5EA 2VN1A 2XP4A 5DITA 3UQAA 1ROTA 2ZR4A 3PRDA 1FKLA 4R0XA 3TDBA 1FJDA 4C02B 3KAGA 4IPXA 4DZ2A 2DG3A 3KACA 2XP3A 4QT3A 2Y78A 3UI5A 1FKHA 2PBCA 2ZQVA 3H9RB 3KABA 2ZQUA 2K8IA 3IKGA 1M5YA 2XPAA 2M08A 3PA7A 5HWBA 5HWCA 2IF4A 1FKIA 1A7XA 2VCDA 2XPBA 2PPOA 4MSPA 1ZCNA 2JZVA 4ITZA 1D7IA 1NMWA 3O5DA 4LAYA 3UI6A 1JNSA 1FKDA 4U86A 1Q6HA 4JYSA 1J4RA 2MF9A 2KGJA 3MDYB 4TNSA 4DRPA 1L1PA 5I98A 1FKFA 3O5LA 1D6OA 4IQ2A 1YATA 5J6EA 1R9HA 1Q6IA 1FKSA 4G2PA 4DRHA 5BXJA 3NTPA 2LKNA 1J6YA 4W9PA 5HUAA 4JFLA 2LGOA 1TCOC 2F2DA 4U84A 4G50A 2RQSA 3JYMA 4GIVA 4DZ3A 3O5GA 2ZQTA 4FN2A 3IKDA 2MLZA 1FD9A 2PV2A 4QT2A 1PINA 2KE0A 2F21A 2OFNA 2PPNA 3RFWA 3KAFA 2DG9A 4N19A 5HTGA 1Y0OA 3O5QA 4LAWA 2XP7A 4J4NA 4ODKA 3B7XA 4TW6A 3RGCA 5HW6A 4ODRA 3KADA 3O5RA 2RUDA 4DRJA 1P5QA 3IHZA 3KZ7A 3O5JA 2XP6A 2RUCA 1D7HA 4J4OA 4JFJA 1NSGA 1JNTA 5GPGA 2DG4A 3OOBA 3UI4A 2N87A 3ODKA 4DH0A 1W26A 2LJ4A 4DRKA 2XP5A 1F8AB 2F4EA 2KR7A 2PV3A 4LAVA 4TYOA 1FKKA 3O5IA 5HW7A 3IK8A 4JFKA 2M2AA 3UF8A 1YW5A 5HT1A 4ODQA 1FAPA 2L2SA 4BF8A 3I6CA 2KO7A 2KI3A 4DRQA 1KT1A 3TCZA 5HKGA 1FKTA 4ODMA 4QIBA 2RURA 5B8IC 2ZR5A 1J4IA 3GPKA 1FKRA 2ITKA 1U79A 2MPHA 1HXVA 1JVWA 3NRKA 4GGQA 1KT0A 1BKFA 3CGMA 5DIVA 2ZQSA 2MLYA 2UZ5A 4DRNA 2LPVA 4TW8A 1QPLA 3O5FA 4TX0A 2KFWA 3JYJA 3O5PA 4MGVA 4FAPA 4ODOA 1Q6UA 1FKJA 3UQIA 5HW8A 2PPPA 4DIPA 2MLXA 2PV1A 4ODLA 1NMVA 2XP8A 3VAWA 1N1AA
chains in the Genus database with same CATH superfamily
5D75A 3ALGA 1C9HA 1XRVA 4U85A 3TC5A 1EDQA 4IQCA 3CHEA 3UQBA 3AS1A 1QPFA 4W9OA 4ODPA 1E15A 2FKEA 1T11A 3NI6A 4NNRA 4JFMA 4TW7A 4MPKA 3O5MA 4HARA 4W5UA 3KCEA 4P8VA 4ZS6A 2YBUA 4ZPTR 5DITA 1ZB5A 4ZPWR 1FKLA 3ARSA 1CTNA 4DZ2A 1SR0A 4QT3A 2PBCA 2DSWA 2M08A 5HWCA 3RMEA 2IF4A 2XPBA 1D7IA 1UR9A 3ARRA 3AROA 4U86A 4JYSA 4MTVA 4TNSA 1ZBCA 5GPRA 1D6OA 1E44A 1ZBVA 2LGOA 1TCOC 4GIVA 3IKDA 2MLZA 2PV2A 2OFNA 5HTGA 4Q7NA 3B8SA 2OLHA 4WJXA 3RM8A 3GU0A 4XAKA 2O9OA 3WD3A 3ARZA 2XP6A 1JNDA 1W9UA 3AQUA 1HJVA 1NSGA 4JFJA 5GPGA 4DH0A 4DRKA 2KR7A 2F4EA 4TYOA 1E6PA 1FKKA 1O6IA 2M2AA 1YW5A 1OGBA 4KR0B 2L2SA 1HJWA 1KT1A 2WK2A 5HKGA 5B8IC 3WQVA 2MPHA 4IT4A 2A3CA 1W9PA 1BKFA 5DIVA 2ZQSA 4WIWA 2MLYA 2UZ5A 3O5FA 3OA5A 3O5PA 4ZPVR 4ODOA 4Z2JA 2PPPA 4DIPA 4P8XA 1NMVA 3ODKA 2XP8A 4R5EA 2M1IA 3JXVA 1J4HA 4QZVB 2MNTA 3WD4A 5DEZA 1ROUA 4W9QA 3ARPA 2XP9A 3LUOA 1QZ2A 5DIUA 1F40A 2AWGA 3GTYX 4DRIA 1E6ZA 3WKZA 1NWSA 2Q5AA 1PBKA 3O5EA 2EULA 1ZU8A 2XP4A 4Z2IA 4R0XA 1GPFA 4IPXA 2O92A 5GQBA 1W9VA 2XP3A 2YBTA 2Y78A 2ZQVA 2ZQUA 2K8IA 4IT6A 3ARVA 4HBEA 2ESCA 3W4RA 1FKIA 1H0IA 1TFVA 3UI6A 1GOIA 3AS0A 1L1PA 4DRPA 1NWRA 3RM9A 1FKFA 5I98A 1NH6A 2F23A 3AS2A 1FKSA 4G2PA 5BXJA 1UR8A 4P8UA 4W9PA 1LL4A 4DWSA 2F2DA 3WIJA 4DWSB 4FN2A 1FD9A 3RFWA 1PINA 4DWSC 3O5QA 2XP7A 2QF8A 1HJXA 1K9TA 3KADA 1HKIA 2RUDA 3O5RA 3IHZA 2RUCA 1D7HA 4PTMA 1GUVA 3UI4A 2N87A 2PV3A 4LAVA 5HW7A 3WQWA 3ARWA 2DT3A 4MNLA 1FKRA 1U79A 4MNKA 4L3NA 1JVWA 5HBFA 2A3BA 4GGQA 1FFQA 4DRNA 4TX0A 3JYJA 4MGVA 4KQZA 2AOSA 3CHCA 3EIPA 3UQIA 3KACA 3VAWA 3EY6A 3ARQA 1LQ0A 4ODNA 4Q22A 4O2TA 1E6RA 2RUQA 2A3EA 3KAIA 4DWSD 2ZR6A 3WD1A 1D7JA 3CHDA 4JFIA 1FKGA 3WH0A 4DRMA 1OWQA 1FKBA 2VN1A 3UQAA 2ZR4A 3PRDA 1FJDA 4C02B 2DG3A 4WK9A 1FKHA 3CH9A 1M5YA 2XPAA 5HWBA 3PA7A 4HBOA 3QOKA 5JH8A 2P4VA 2B31A 1A7XA 1SYTA 1W1PA 2PPOA 4Z2KA 2JZVA 4LAYA 1VF8A 1FKDA 3WL1A 1J4RA 2MF9A 2DSZA 3MDYB 4NZCA 4S3JA 4LGXA 3FY1A 3O5LA 4IQ2A 1YATA 5DF0A 1Q6IA 1W1VA 3NTPA 1LL7A 2A3AA 2LKNA 4L72B 2RQSA 4DZ3A 3O5GA 2DPEA 3RM4A 2PPNA 4LAWA 4J4NA 3B7XA 4TW6A 5DO2A 1LG2A 1P5QA 3FXYA 3KZ7A 3O5JA 1JNEA 1EIBA 2G8ZA 4J4OA 1JNTA 4Z2HA 1WAWA 2LJ4A 2XP5A 1F8AB 3IK8A 1IX5A 2DT0A 1JCHB 1D2KA 4ODQA 4S3KA 1FAPA 2KO7A 4DRQA 3TCZA 1FKTA 4QIBA 1J4IA 1HXVA 2ITKA 3B9DA 1WNOA 1E6NA 4Z2LA 1NWTA 2KFWA 1HKJA 1LL6A 4UDMA 2WM0A 3ARYA 4ODLA 3ARUA 1OGGA 2D9FA 4LAXA 1ZK6A 2RSEA 3O5OA 4MNJA 3O5KA 4DROA 3CGNA 1BL4A 3WL0A 1B6CA 1EHNA 1EQ3A 4WKAA 3PRBA 1Q1CA 3KAHA 3ALFA 1EYMA 1GRJA 2FAPA 4P8WA 3FAPA 4AY1A 4DT4A 3G6LA 2DSUA 1ROTA 3TDBA 3KAGA 3CHFA 3B9AA 3UI5A 3H9RB 3KABA 3IKGA 4MSPA 2VCDA 1X6NA 1ZCNA 4ITZA 1NMWA 4Z2GA 3O5DA 4URIA 1JNSA 1Q6HA 2G41A 2KGJA 3BMBA 3ARTA 1H0GA 5J6EA 1R9HA 4WKHA 2DSVA 1KFWA 2B5UB 4DRHA 1J6YA 3PRAA 5HUAA 4JFLA 1WB0A 2PN0A 3B9EA 3PR9A 4U84A 4WKFA 1NWUA 4G50A 3JYMA 2PI6A 2ZQTA 1W1TA 4QT2A 2KE0A 2F21A 3KAFA 2DG9A 4NSBA 4N19A 1XHGA 1Y0OA 1FFRA 2WLYA 5HW6A 1HKKA 4ODKA 3RGCA 1ZBWA 4ODRA 2FDMA 1LG1A 4DRJA 3WD0A 1HKMA 2DT2A 1E9LA 2DG4A 3OOBA 1W26A 3O5IA 3ARXA 4JFKA 3UF8A 1RD6A 5HT1A 3AS3A 4MNMA 2WLZA 1LJYA 4BF8A 3I6CA 2KI3A 3BXWA 4ODMA 2RURA 3G6MA 2ZR5A 3GPKA 3WD2A 1X6LA 1ZBKA 1ITXA 2ETNA 3NRKA 1KT0A 3CGMA 4MAVA 1ZL1A 2LPVA 4TW8A 1QPLA 3CZ8A 1W1YA 2DT1A 2IUZA 4FAPA 1Q6UA 1FKJA 5HW8A 2MLXA 2PV1A 4ML4A 1N1AA
chains in the Genus database with same CATH topology
5D75A 3ALGA 1C9HA 1XRVA 4U85A 3TC5A 1EDQA 4IQCA 3CHEA 3UQBA 3AS1A 1QPFA 4W9OA 4ODPA 1E15A 2FKEA 1T11A 3NI6A 4NNRA 4JFMA 4TW7A 4MPKA 3O5MA 4HARA 4W5UA 3KCEA 4P8VA 4ZS6A 2YBUA 4ZPTR 5DITA 1ZB5A 4ZPWR 1FKLA 3ARSA 1CTNA 4DZ2A 1SR0A 4QT3A 2PBCA 2DSWA 2M08A 5HWCA 3RMEA 2IF4A 2XPBA 1D7IA 1UR9A 3ARRA 3AROA 4U86A 4JYSA 4MTVA 4TNSA 1ZBCA 5GPRA 1D6OA 1ZBVA 2LGOA 1TCOC 4GIVA 3IKDA 2MLZA 2PV2A 2OFNA 5HTGA 4Q7NA 3B8SA 2OLHA 4WJXA 3RM8A 4XAKA 2O9OA 3WD3A 3ARZA 2XP6A 1JNDA 1W9UA 3AQUA 1HJVA 1NSGA 4JFJA 5GPGA 4DH0A 4DRKA 2KR7A 2F4EA 4TYOA 1E6PA 1FKKA 1O6IA 2M2AA 1YW5A 1OGBA 4KR0B 2L2SA 1HJWA 1KT1A 2WK2A 5HKGA 5B8IC 3WQVA 2MPHA 4IT4A 2A3CA 1W9PA 1BKFA 5DIVA 2ZQSA 4WIWA 2MLYA 2UZ5A 3O5FA 3OA5A 3O5PA 4ZPVR 4ODOA 4Z2JA 2PPPA 4DIPA 4P8XA 1NMVA 3ODKA 2XP8A 4R5EA 2M1IA 3JXVA 1J4HA 4QZVB 2MNTA 3WD4A 5DEZA 1ROUA 4W9QA 3ARPA 2XP9A 3LUOA 1QZ2A 5DIUA 1F40A 2AWGA 4DRIA 1E6ZA 3WKZA 1NWSA 2Q5AA 1PBKA 3O5EA 1ZU8A 2XP4A 4Z2IA 4R0XA 1GPFA 4IPXA 2O92A 5GQBA 1W9VA 2XP3A 2YBTA 2Y78A 2ZQVA 2ZQUA 2K8IA 4IT6A 3ARVA 4HBEA 2ESCA 3W4RA 1FKIA 1H0IA 1TFVA 3UI6A 1GOIA 3AS0A 1L1PA 4DRPA 1NWRA 3RM9A 1FKFA 5I98A 1NH6A 3AS2A 1FKSA 4G2PA 5BXJA 1UR8A 4P8UA 4W9PA 1LL4A 4DWSA 2F2DA 3WIJA 4DWSB 4FN2A 1FD9A 3RFWA 1PINA 4DWSC 3O5QA 2XP7A 2QF8A 1HJXA 1K9TA 3KADA 1HKIA 2RUDA 3O5RA 3IHZA 2RUCA 1D7HA 4PTMA 1GUVA 3UI4A 2N87A 2PV3A 4LAVA 5HW7A 3WQWA 3ARWA 2DT3A 4MNLA 1FKRA 1U79A 4MNKA 4L3NA 1JVWA 5HBFA 2A3BA 4GGQA 1FFQA 4DRNA 4TX0A 3JYJA 4MGVA 4KQZA 2AOSA 3CHCA 3UQIA 3KACA 3VAWA 3EY6A 3ARQA 1LQ0A 4ODNA 4Q22A 4O2TA 1E6RA 2RUQA 2A3EA 3KAIA 4DWSD 2ZR6A 3WD1A 1D7JA 3CHDA 4JFIA 1FKGA 3WH0A 4DRMA 1OWQA 1FKBA 2VN1A 3UQAA 2ZR4A 3PRDA 1FJDA 4C02B 2DG3A 4WK9A 1FKHA 3CH9A 1M5YA 2XPAA 5HWBA 3PA7A 4HBOA 3QOKA 5JH8A 2B31A 1A7XA 1SYTA 1W1PA 2PPOA 4Z2KA 2JZVA 4LAYA 1VF8A 1FKDA 3WL1A 1J4RA 2MF9A 2DSZA 3MDYB 4NZCA 4S3JA 4LGXA 3FY1A 3O5LA 4IQ2A 1YATA 5DF0A 1Q6IA 1W1VA 3NTPA 1LL7A 2A3AA 2LKNA 4L72B 2RQSA 4DZ3A 3O5GA 2DPEA 3RM4A 2PPNA 4LAWA 4J4NA 3B7XA 4TW6A 5DO2A 1LG2A 1P5QA 3FXYA 3KZ7A 3O5JA 1JNEA 1EIBA 2G8ZA 4J4OA 1JNTA 4Z2HA 1WAWA 2LJ4A 2XP5A 1F8AB 3IK8A 1IX5A 2DT0A 1D2KA 4ODQA 4S3KA 1FAPA 2KO7A 4DRQA 3TCZA 1FKTA 4QIBA 1J4IA 1HXVA 2ITKA 3B9DA 1WNOA 1E6NA 4Z2LA 1NWTA 2KFWA 1HKJA 1LL6A 2WM0A 3ARYA 4ODLA 3ARUA 1OGGA 2D9FA 4LAXA 1ZK6A 2RSEA 3O5OA 4MNJA 3O5KA 4DROA 3CGNA 1BL4A 3WL0A 1B6CA 1EHNA 1EQ3A 4WKAA 3PRBA 1Q1CA 3KAHA 3ALFA 1EYMA 2FAPA 4P8WA 3FAPA 4AY1A 4DT4A 3G6LA 2DSUA 1ROTA 3TDBA 3KAGA 3CHFA 3B9AA 3UI5A 3H9RB 3KABA 3IKGA 4MSPA 2VCDA 1X6NA 1ZCNA 4ITZA 1NMWA 4Z2GA 3O5DA 4URIA 1JNSA 1Q6HA 2G41A 2KGJA 3ARTA 1H0GA 5J6EA 1R9HA 4WKHA 2DSVA 1KFWA 4DRHA 1J6YA 3PRAA 5HUAA 4JFLA 1WB0A 4WKFA 3B9EA 3PR9A 4U84A 1NWUA 4G50A 3JYMA 2PI6A 2ZQTA 1W1TA 4QT2A 2KE0A 2F21A 3KAFA 2DG9A 4NSBA 4N19A 1XHGA 1Y0OA 1FFRA 2WLYA 5HW6A 1HKKA 4ODKA 3RGCA 1ZBWA 4ODRA 2FDMA 1LG1A 4DRJA 3WD0A 1HKMA 2DT2A 1E9LA 2DG4A 3OOBA 1W26A 3O5IA 3ARXA 4JFKA 3UF8A 1RD6A 5HT1A 3AS3A 4MNMA 2WLZA 1LJYA 4BF8A 3I6CA 2KI3A 3BXWA 4ODMA 2RURA 3G6MA 2ZR5A 3GPKA 3WD2A 1X6LA 1ZBKA 1ITXA 3NRKA 1KT0A 3CGMA 4MAVA 1ZL1A 2LPVA 4TW8A 1QPLA 3CZ8A 1W1YA 2DT1A 2IUZA 4FAPA 1Q6UA 1FKJA 5HW8A 2MLXA 2PV1A 4ML4A 1N1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1I A;  3EY6 A;  3JXV A;  1J4H A;  5D75 A;  2D9F A;  4LAX A;  1C9H A;  1ZK6 A;  2RSE A;  2MNT A;  3O5O A;  3O5K A;  4U85 A;  3TC5 A;  4DRO A;  4ODN A;  4IQC A;  3CGN A;  1ROU A;  4O2T A;  3UQB A;  1BL4 A;  1B6C A;  1QPF A;  2RUQ A;  4W9O A;  3KAI A;  4W9Q A;  4ODP A;  3PRB A;  1EQ3 A;  2ZR6 A;  2XP9 A;  1Q1C A;  3LUO A;  1D7J A;  1QZ2 A;  3KAH A;  2FKE A;  5DIU A;  1T11 A;  2AWG A;  1F40 A;  3NI6 A;  4DRI A;  4JFI A;  4NNR A;  4JFM A;  1FKG A;  3WH0 A;  4TW7 A;  1EYM A;  4DRM A;  2FAP A;  3O5M A;  3FAP A;  3KCE A;  2Q5A A;  1FKB A;  1PBK A;  4DT4 A;  3O5E A;  2VN1 A;  2XP4 A;  5DIT A;  3UQA A;  1ROT A;  2ZR4 A;  3PRD A;  1FKL A;  4R0X A;  3TDB A;  1FJD A;  4C02 B;  3KAG A;  4IPX A;  4DZ2 A;  2DG3 A;  3KAC A;  2XP3 A;  4QT3 A;  2Y78 A;  3UI5 A;  1FKH A;  2PBC A;  2ZQV A;  3H9R B;  3KAB A;  2ZQU A;  2K8I A;  3IKG A;  1M5Y A;  2XPA A;  2M08 A;  3PA7 A;  5HWB A;  5HWC A;  2IF4 A;  1FKI A;  1A7X A;  2VCD A;  2XPB A;  2PPO A;  4MSP A;  1ZCN A;  2JZV A;  4ITZ A;  1D7I A;  1NMW A;  3O5D A;  4LAY A;  3UI6 A;  1JNS A;  1FKD A;  4U86 A;  1Q6H A;  4JYS A;  1J4R A;  2MF9 A;  2KGJ A;  3MDY B;  4TNS A;  4DRP A;  1L1P A;  5I98 A;  1FKF A;  3O5L A;  1D6O A;  4IQ2 A;  1YAT A;  5J6E A;  1R9H A;  1Q6I A;  1FKS A;  4G2P A;  4DRH A;  5BXJ A;  3NTP A;  2LKN A;  1J6Y A;  4W9P A;  5HUA A;  4JFL A;  2LGO A;  1TCO C;  2F2D A;  4U84 A;  4G50 A;  2RQS A;  3JYM A;  4GIV A;  4DZ3 A;  3O5G A;  2ZQT A;  4FN2 A;  3IKD A;  2MLZ A;  1FD9 A;  2PV2 A;  4QT2 A;  1PIN A;  2KE0 A;  2F21 A;  2OFN A;  2PPN A;  3RFW A;  3KAF A;  2DG9 A;  4N19 A;  5HTG A;  1Y0O A;  3O5Q A;  4LAW A;  2XP7 A;  4J4N A;  4ODK A;  3B7X A;  4TW6 A;  3RGC A;  5HW6 A;  4ODR A;  3KAD A;  3O5R A;  2RUD A;  4DRJ A;  1P5Q A;  3IHZ A;  3KZ7 A;  3O5J A;  2XP6 A;  2RUC A;  1D7H A;  4J4O A;  4JFJ A;  1NSG A;  1JNT A;  5GPG A;  2DG4 A;  3OOB A;  3UI4 A;  2N87 A;  3ODK A;  4DH0 A;  1W26 A;  2LJ4 A;  4DRK A;  2XP5 A;  1F8A B;  2F4E A;  2KR7 A;  2PV3 A;  4LAV A;  4TYO A;  1FKK A;  3O5I A;  5HW7 A;  3IK8 A;  4JFK A;  2M2A A;  3UF8 A;  1YW5 A;  5HT1 A;  4ODQ A;  1FAP A;  2L2S A;  4BF8 A;  3I6C A;  2KO7 A;  2KI3 A;  4DRQ A;  1KT1 A;  3TCZ A;  5HKG A;  1FKT A;  4ODM A;  4QIB A;  2RUR A;  5B8I C;  2ZR5 A;  1J4I A;  3GPK A;  1FKR A;  2ITK A;  1U79 A;  2MPH A;  1HXV A;  1JVW A;  3NRK A;  4GGQ A;  1KT0 A;  1BKF A;  3CGM A;  5DIV A;  2ZQS A;  2MLY A;  2UZ5 A;  4DRN A;  2LPV A;  4TW8 A;  1QPL A;  3O5F A;  4TX0 A;  2KFW A;  3JYJ A;  3O5P A;  4MGV A;  4FAP A;  4ODO A;  1Q6U A;  1FKJ A;  3UQI A;  5HW8 A;  2PPP A;  4DIP A;  2MLX A;  2PV1 A;  4ODL A;  1NMV A;  2XP8 A;  3VAW A;  1N1A A; 
#chains in the Genus database with same CATH topology
 5D75 A;  3ALG A;  1C9H A;  1XRV A;  4U85 A;  3TC5 A;  1EDQ A;  4IQC A;  3CHE A;  3UQB A;  3AS1 A;  1QPF A;  4W9O A;  4ODP A;  1E15 A;  2FKE A;  1T11 A;  3NI6 A;  4NNR A;  4JFM A;  4TW7 A;  4MPK A;  3O5M A;  4HAR A;  4W5U A;  3KCE A;  4P8V A;  4ZS6 A;  2YBU A;  4ZPT R;  5DIT A;  1ZB5 A;  4ZPW R;  1FKL A;  3ARS A;  1CTN A;  4DZ2 A;  1SR0 A;  4QT3 A;  2PBC A;  2DSW A;  2M08 A;  5HWC A;  3RME A;  2IF4 A;  2XPB A;  1D7I A;  1UR9 A;  3ARR A;  3ARO A;  4U86 A;  4JYS A;  4MTV A;  4TNS A;  1ZBC A;  5GPR A;  1D6O A;  1E44 A;  1ZBV A;  2LGO A;  1TCO C;  4GIV A;  3IKD A;  2MLZ A;  2PV2 A;  2OFN A;  5HTG A;  4Q7N A;  3B8S A;  2OLH A;  4WJX A;  3RM8 A;  3GU0 A;  4XAK A;  2O9O A;  3WD3 A;  3ARZ A;  2XP6 A;  1JND A;  1W9U A;  3AQU A;  1HJV A;  1NSG A;  4JFJ A;  5GPG A;  4DH0 A;  4DRK A;  2KR7 A;  2F4E A;  4TYO A;  1E6P A;  1FKK A;  1O6I A;  2M2A A;  1YW5 A;  1OGB A;  4KR0 B;  2L2S A;  1HJW A;  1KT1 A;  2WK2 A;  5HKG A;  5B8I C;  3WQV A;  2MPH A;  4IT4 A;  2A3C A;  1W9P A;  1BKF A;  5DIV A;  2ZQS A;  4WIW A;  2MLY A;  2UZ5 A;  3O5F A;  3OA5 A;  3O5P A;  4ZPV R;  4ODO A;  4Z2J A;  2PPP A;  4DIP A;  4P8X A;  1NMV A;  3ODK A;  2XP8 A;  4R5E A;  2M1I A;  3JXV A;  1J4H A;  4QZV B;  2MNT A;  3WD4 A;  5DEZ A;  1ROU A;  4W9Q A;  3ARP A;  2XP9 A;  3LUO A;  1QZ2 A;  5DIU A;  1F40 A;  2AWG A;  3GTY X;  4DRI A;  1E6Z A;  3WKZ A;  1NWS A;  2Q5A A;  1PBK A;  3O5E A;  2EUL A;  1ZU8 A;  2XP4 A;  4Z2I A;  4R0X A;  1GPF A;  4IPX A;  2O92 A;  5GQB A;  1W9V A;  2XP3 A;  2YBT A;  2Y78 A;  2ZQV A;  2ZQU A;  2K8I A;  4IT6 A;  3ARV A;  4HBE A;  2ESC A;  3W4R A;  1FKI A;  1H0I A;  1TFV A;  3UI6 A;  1GOI A;  3AS0 A;  1L1P A;  4DRP A;  1NWR A;  3RM9 A;  1FKF A;  5I98 A;  1NH6 A;  2F23 A;  3AS2 A;  1FKS A;  4G2P A;  5BXJ A;  1UR8 A;  4P8U A;  4W9P A;  1LL4 A;  4DWS A;  2F2D A;  3WIJ A;  4DWS B;  4FN2 A;  1FD9 A;  3RFW A;  1PIN A;  4DWS C;  3O5Q A;  2XP7 A;  2QF8 A;  1HJX A;  1K9T A;  3KAD A;  1HKI A;  2RUD A;  3O5R A;  3IHZ A;  2RUC A;  1D7H A;  4PTM A;  1GUV A;  3UI4 A;  2N87 A;  2PV3 A;  4LAV A;  5HW7 A;  3WQW A;  3ARW A;  2DT3 A;  4MNL A;  1FKR A;  1U79 A;  4MNK A;  4L3N A;  1JVW A;  5HBF A;  2A3B A;  4GGQ A;  1FFQ A;  4DRN A;  4TX0 A;  3JYJ A;  4MGV A;  4KQZ A;  2AOS A;  3CHC A;  3EIP A;  3UQI A;  3KAC A;  3VAW A;  3EY6 A;  3ARQ A;  1LQ0 A;  4ODN A;  4Q22 A;  4O2T A;  1E6R A;  2RUQ A;  2A3E A;  3KAI A;  4DWS D;  2ZR6 A;  3WD1 A;  1D7J A;  3CHD A;  4JFI A;  1FKG A;  3WH0 A;  4DRM A;  1OWQ A;  1FKB A;  2VN1 A;  3UQA A;  2ZR4 A;  3PRD A;  1FJD A;  4C02 B;  2DG3 A;  4WK9 A;  1FKH A;  3CH9 A;  1M5Y A;  2XPA A;  5HWB A;  3PA7 A;  4HBO A;  3QOK A;  5JH8 A;  2P4V A;  2B31 A;  1A7X A;  1SYT A;  1W1P A;  2PPO A;  4Z2K A;  2JZV A;  4LAY A;  1VF8 A;  1FKD A;  3WL1 A;  1J4R A;  2MF9 A;  2DSZ A;  3MDY B;  4NZC A;  4S3J A;  4LGX A;  3FY1 A;  3O5L A;  4IQ2 A;  1YAT A;  5DF0 A;  1Q6I A;  1W1V A;  3NTP A;  1LL7 A;  2A3A A;  2LKN A;  4L72 B;  2RQS A;  4DZ3 A;  3O5G A;  2DPE A;  3RM4 A;  2PPN A;  4LAW A;  4J4N A;  3B7X A;  4TW6 A;  5DO2 A;  1LG2 A;  1P5Q A;  3FXY A;  3KZ7 A;  3O5J A;  1JNE A;  1EIB A;  2G8Z A;  4J4O A;  1JNT A;  4Z2H A;  1WAW A;  2LJ4 A;  2XP5 A;  1F8A B;  3IK8 A;  1IX5 A;  2DT0 A;  1JCH B;  1D2K A;  4ODQ A;  4S3K A;  1FAP A;  2KO7 A;  4DRQ A;  3TCZ A;  1FKT A;  4QIB A;  1J4I A;  1HXV A;  2ITK A;  3B9D A;  1WNO A;  1E6N A;  4Z2L A;  1NWT A;  2KFW A;  1HKJ A;  1LL6 A;  4UDM A;  2WM0 A;  3ARY A;  4ODL A;  3ARU A;  1OGG A;  2D9F A;  4LAX A;  1ZK6 A;  2RSE A;  3O5O A;  4MNJ A;  3O5K A;  4DRO A;  3CGN A;  1BL4 A;  3WL0 A;  1B6C A;  1EHN A;  1EQ3 A;  4WKA A;  3PRB A;  1Q1C A;  3KAH A;  3ALF A;  1EYM A;  1GRJ A;  2FAP A;  4P8W A;  3FAP A;  4AY1 A;  4DT4 A;  3G6L A;  2DSU A;  1ROT A;  3TDB A;  3KAG A;  3CHF A;  3B9A A;  3UI5 A;  3H9R B;  3KAB A;  3IKG A;  4MSP A;  2VCD A;  1X6N A;  1ZCN A;  4ITZ A;  1NMW A;  4Z2G A;  3O5D A;  4URI A;  1JNS A;  1Q6H A;  2G41 A;  2KGJ A;  3BMB A;  3ART A;  1H0G A;  5J6E A;  1R9H A;  4WKH A;  2DSV A;  1KFW A;  2B5U B;  4DRH A;  1J6Y A;  3PRA A;  5HUA A;  4JFL A;  1WB0 A;  2PN0 A;  3B9E A;  3PR9 A;  4U84 A;  4WKF A;  1NWU A;  4G50 A;  3JYM A;  2PI6 A;  2ZQT A;  1W1T A;  4QT2 A;  2KE0 A;  2F21 A;  3KAF A;  2DG9 A;  4NSB A;  4N19 A;  1XHG A;  1Y0O A;  1FFR A;  2WLY A;  5HW6 A;  1HKK A;  4ODK A;  3RGC A;  1ZBW A;  4ODR A;  2FDM A;  1LG1 A;  4DRJ A;  3WD0 A;  1HKM A;  2DT2 A;  1E9L A;  2DG4 A;  3OOB A;  1W26 A;  3O5I A;  3ARX A;  4JFK A;  3UF8 A;  1RD6 A;  5HT1 A;  3AS3 A;  4MNM A;  2WLZ A;  1LJY A;  4BF8 A;  3I6C A;  2KI3 A;  3BXW A;  4ODM A;  2RUR A;  3G6M A;  2ZR5 A;  3GPK A;  3WD2 A;  1X6L A;  1ZBK A;  1ITX A;  2ETN A;  3NRK A;  1KT0 A;  3CGM A;  4MAV A;  1ZL1 A;  2LPV A;  4TW8 A;  1QPL A;  3CZ8 A;  1W1Y A;  2DT1 A;  2IUZ A;  4FAP A;  1Q6U A;  1FKJ A;  5HW8 A;  2MLX A;  2PV1 A;  4ML4 A;  1N1A A; 
#chains in the Genus database with same CATH homology
 5D75 A;  3ALG A;  1C9H A;  1XRV A;  4U85 A;  3TC5 A;  1EDQ A;  4IQC A;  3CHE A;  3UQB A;  3AS1 A;  1QPF A;  4W9O A;  4ODP A;  1E15 A;  2FKE A;  1T11 A;  3NI6 A;  4NNR A;  4JFM A;  4TW7 A;  4MPK A;  3O5M A;  4HAR A;  4W5U A;  3KCE A;  4P8V A;  4ZS6 A;  2YBU A;  4ZPT R;  5DIT A;  1ZB5 A;  4ZPW R;  1FKL A;  3ARS A;  1CTN A;  4DZ2 A;  1SR0 A;  4QT3 A;  2PBC A;  2DSW A;  2M08 A;  5HWC A;  3RME A;  2IF4 A;  2XPB A;  1D7I A;  1UR9 A;  3ARR A;  3ARO A;  4U86 A;  4JYS A;  4MTV A;  4TNS A;  1ZBC A;  5GPR A;  1D6O A;  1ZBV A;  2LGO A;  1TCO C;  4GIV A;  3IKD A;  2MLZ A;  2PV2 A;  2OFN A;  5HTG A;  4Q7N A;  3B8S A;  2OLH A;  4WJX A;  3RM8 A;  4XAK A;  2O9O A;  3WD3 A;  3ARZ A;  2XP6 A;  1JND A;  1W9U A;  3AQU A;  1HJV A;  1NSG A;  4JFJ A;  5GPG A;  4DH0 A;  4DRK A;  2KR7 A;  2F4E A;  4TYO A;  1E6P A;  1FKK A;  1O6I A;  2M2A A;  1YW5 A;  1OGB A;  4KR0 B;  2L2S A;  1HJW A;  1KT1 A;  2WK2 A;  5HKG A;  5B8I C;  3WQV A;  2MPH A;  4IT4 A;  2A3C A;  1W9P A;  1BKF A;  5DIV A;  2ZQS A;  4WIW A;  2MLY A;  2UZ5 A;  3O5F A;  3OA5 A;  3O5P A;  4ZPV R;  4ODO A;  4Z2J A;  2PPP A;  4DIP A;  4P8X A;  1NMV A;  3ODK A;  2XP8 A;  4R5E A;  2M1I A;  3JXV A;  1J4H A;  4QZV B;  2MNT A;  3WD4 A;  5DEZ A;  1ROU A;  4W9Q A;  3ARP A;  2XP9 A;  3LUO A;  1QZ2 A;  5DIU A;  1F40 A;  2AWG A;  4DRI A;  1E6Z A;  3WKZ A;  1NWS A;  2Q5A A;  1PBK A;  3O5E A;  1ZU8 A;  2XP4 A;  4Z2I A;  4R0X A;  1GPF A;  4IPX A;  2O92 A;  5GQB A;  1W9V A;  2XP3 A;  2YBT A;  2Y78 A;  2ZQV A;  2ZQU A;  2K8I A;  4IT6 A;  3ARV A;  4HBE A;  2ESC A;  3W4R A;  1FKI A;  1H0I A;  1TFV A;  3UI6 A;  1GOI A;  3AS0 A;  1L1P A;  4DRP A;  1NWR A;  3RM9 A;  1FKF A;  5I98 A;  1NH6 A;  3AS2 A;  1FKS A;  4G2P A;  5BXJ A;  1UR8 A;  4P8U A;  4W9P A;  1LL4 A;  4DWS A;  2F2D A;  3WIJ A;  4DWS B;  4FN2 A;  1FD9 A;  3RFW A;  1PIN A;  4DWS C;  3O5Q A;  2XP7 A;  2QF8 A;  1HJX A;  1K9T A;  3KAD A;  1HKI A;  2RUD A;  3O5R A;  3IHZ A;  2RUC A;  1D7H A;  4PTM A;  1GUV A;  3UI4 A;  2N87 A;  2PV3 A;  4LAV A;  5HW7 A;  3WQW A;  3ARW A;  2DT3 A;  4MNL A;  1FKR A;  1U79 A;  4MNK A;  4L3N A;  1JVW A;  5HBF A;  2A3B A;  4GGQ A;  1FFQ A;  4DRN A;  4TX0 A;  3JYJ A;  4MGV A;  4KQZ A;  2AOS A;  3CHC A;  3UQI A;  3KAC A;  3VAW A;  3EY6 A;  3ARQ A;  1LQ0 A;  4ODN A;  4Q22 A;  4O2T A;  1E6R A;  2RUQ A;  2A3E A;  3KAI A;  4DWS D;  2ZR6 A;  3WD1 A;  1D7J A;  3CHD A;  4JFI A;  1FKG A;  3WH0 A;  4DRM A;  1OWQ A;  1FKB A;  2VN1 A;  3UQA A;  2ZR4 A;  3PRD A;  1FJD A;  4C02 B;  2DG3 A;  4WK9 A;  1FKH A;  3CH9 A;  1M5Y A;  2XPA A;  5HWB A;  3PA7 A;  4HBO A;  3QOK A;  5JH8 A;  2B31 A;  1A7X A;  1SYT A;  1W1P A;  2PPO A;  4Z2K A;  2JZV A;  4LAY A;  1VF8 A;  1FKD A;  3WL1 A;  1J4R A;  2MF9 A;  2DSZ A;  3MDY B;  4NZC A;  4S3J A;  4LGX A;  3FY1 A;  3O5L A;  4IQ2 A;  1YAT A;  5DF0 A;  1Q6I A;  1W1V A;  3NTP A;  1LL7 A;  2A3A A;  2LKN A;  4L72 B;  2RQS A;  4DZ3 A;  3O5G A;  2DPE A;  3RM4 A;  2PPN A;  4LAW A;  4J4N A;  3B7X A;  4TW6 A;  5DO2 A;  1LG2 A;  1P5Q A;  3FXY A;  3KZ7 A;  3O5J A;  1JNE A;  1EIB A;  2G8Z A;  4J4O A;  1JNT A;  4Z2H A;  1WAW A;  2LJ4 A;  2XP5 A;  1F8A B;  3IK8 A;  1IX5 A;  2DT0 A;  1D2K A;  4ODQ A;  4S3K A;  1FAP A;  2KO7 A;  4DRQ A;  3TCZ A;  1FKT A;  4QIB A;  1J4I A;  1HXV A;  2ITK A;  3B9D A;  1WNO A;  1E6N A;  4Z2L A;  1NWT A;  2KFW A;  1HKJ A;  1LL6 A;  2WM0 A;  3ARY A;  4ODL A;  3ARU A;  1OGG A;  2D9F A;  4LAX A;  1ZK6 A;  2RSE A;  3O5O A;  4MNJ A;  3O5K A;  4DRO A;  3CGN A;  1BL4 A;  3WL0 A;  1B6C A;  1EHN A;  1EQ3 A;  4WKA A;  3PRB A;  1Q1C A;  3KAH A;  3ALF A;  1EYM A;  2FAP A;  4P8W A;  3FAP A;  4AY1 A;  4DT4 A;  3G6L A;  2DSU A;  1ROT A;  3TDB A;  3KAG A;  3CHF A;  3B9A A;  3UI5 A;  3H9R B;  3KAB A;  3IKG A;  4MSP A;  2VCD A;  1X6N A;  1ZCN A;  4ITZ A;  1NMW A;  4Z2G A;  3O5D A;  4URI A;  1JNS A;  1Q6H A;  2G41 A;  2KGJ A;  3ART A;  1H0G A;  5J6E A;  1R9H A;  4WKH A;  2DSV A;  1KFW A;  4DRH A;  1J6Y A;  3PRA A;  5HUA A;  4JFL A;  1WB0 A;  4WKF A;  3B9E A;  3PR9 A;  4U84 A;  1NWU A;  4G50 A;  3JYM A;  2PI6 A;  2ZQT A;  1W1T A;  4QT2 A;  2KE0 A;  2F21 A;  3KAF A;  2DG9 A;  4NSB A;  4N19 A;  1XHG A;  1Y0O A;  1FFR A;  2WLY A;  5HW6 A;  1HKK A;  4ODK A;  3RGC A;  1ZBW A;  4ODR A;  2FDM A;  1LG1 A;  4DRJ A;  3WD0 A;  1HKM A;  2DT2 A;  1E9L A;  2DG4 A;  3OOB A;  1W26 A;  3O5I A;  3ARX A;  4JFK A;  3UF8 A;  1RD6 A;  5HT1 A;  3AS3 A;  4MNM A;  2WLZ A;  1LJY A;  4BF8 A;  3I6C A;  2KI3 A;  3BXW A;  4ODM A;  2RUR A;  3G6M A;  2ZR5 A;  3GPK A;  3WD2 A;  1X6L A;  1ZBK A;  1ITX A;  3NRK A;  1KT0 A;  3CGM A;  4MAV A;  1ZL1 A;  2LPV A;  4TW8 A;  1QPL A;  3CZ8 A;  1W1Y A;  2DT1 A;  2IUZ A;  4FAP A;  1Q6U A;  1FKJ A;  5HW8 A;  2MLX A;  2PV1 A;  4ML4 A;  1N1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...