4ODLA

Structure of slyd from thermus thermophilus in complex with s2 peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 31
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odlA00
2PPNA 1ZK6A 2MLZA 4JFLA 4ODLA 4ODKA 3FAPA 2MPHA 1J4HA 1Y0OA 3H9RB 1PBKA 2K8IA 2VN1A 2KE0A 3O5GA 4ODOA 3MDYB 4GGQA 3LUOA 4TW6A 2RURA 5D75A 3O5OA 1FKIA 4DRMA 3O5FA 1FKTA 1FKSA 2ZQTA 3NRKA 4FN2A 4IQ2A 1NSGA 4DRIA 1Q6UA 2LGOA 1J4IA 1NMWA 2N87A 4JFKA 4MSPA 4TX0A 2M08A 2XP9A 1NMVA 1M5YA 2F21A 2LKNA 2KO7A 4QIBA 3RFWA 2KI3A 2Y78A 3WH0A 2RUCA 3NI6A 1JNSA 1FKGA 3IKGA 2FAPA 3KCEA 4LAVA 1R9HA 1HXVA 2M2AA 3KAIA 5HW7A 1FD9A 3GPKA 1JNTA 3KAGA 1A7XA 2KGJA 5J6EA 4JFJA 3UQBA 2MNTA 2PV2A 2ZQVA 4TW8A 3O5QA 2VCDA 3TC5A 2ZR4A 1JVWA 4TW7A 1F40A 3EY6A 4ODNA 1FKJA 4GIVA 4MGVA 3I6CA 4W9QA 1FKKA 4DIPA 2XP5A 2LJ4A 3KZ7A 4ODPA 4O2TA 1ZCNA 3KAHA 2RQSA 1Q1CA 1ROTA 1QPFA 3KACA 2OFNA 3O5IA 4U84A 3OOBA 5HWBA 2MF9A 1FKBA 1TCOC 4DH0A 4DROA 2JZVA 2L2SA 1D7IA 1U79A 3O5PA 2ITKA 2M1IA 2PBCA 3ODKA 1FKHA 3VAWA 4C02B 4DRJA 4QT2A 1KT0A 3NTPA 4TNSA 5DIUA 4N19A 2DG9A 3O5JA 4W9OA 1BL4A 1FJDA 1YATA 1P5QA 3KABA 4JFIA 1QPLA 1KT1A 5DITA 3UQIA 1EYMA 2ZR6A 4LAWA 4BF8A 2PPPA 4JYSA 3UI6A 3TCZA 2XP4A 1YW5A 4G2PA 1FKRA 1Q6IA 3IK8A 2PPOA 3IHZA 2DG3A 2IF4A 3RGCA 1QZ2A 3UF8A 2MLYA 4DRQA 5BXJA 5I98A 4J4NA 5HWCA 4G50A 2FKEA 4J4OA 3IKDA 4LAXA 1FKFA 2LPVA 3O5DA 3UQAA 3O5KA 2ZQSA 4JFMA 1ROUA 3PRDA 4DZ2A 1T11A 3JXVA 4R0XA 1D7HA 1FKLA 3JYMA 1PINA 1B6CA 4DT4A 4U85A 2ZR5A 2RSEA 2F2DA 1J6YA 2DG4A 2D9FA 5HT1A 4DZ3A 2XP6A 4ODRA 2MLXA 5HW6A 5HW8A 3UI4A 4FAPA 1J4RA 2RUDA 2PV3A 3O5RA 3KAFA 3JYJA 4QT3A 4DRKA 1FAPA 2RUQA 3O5EA 1W26A 2PV1A 3O5LA 4IQCA 5GPGA 2XPAA 2XP8A 2KFWA 5HTGA 4W9PA 5DIVA 1C9HA 2Q5AA 2UZ5A 4DRHA 5HUAA 1FKDA 5HKGA 4DRPA 4U86A 1D7JA 2AWGA 4LAYA 2XP7A 3UI5A 1EQ3A 2XPBA 4ODQA 3KADA 1N1AA 2XP3A 4IPXA 3B7XA 4TYOA 2ZQUA 2KR7A 4ODMA 4DRNA 1D6OA 3O5MA 1L1PA 3TDBA 3PA7A 4NNRA 1BKFA 3PRBA 5B8IC 4ITZA 1F8AB 3CGMA 1Q6HA 3CGNA 2F4EA
chains in the Genus database with same CATH superfamily
1ZK6A 3ARPA 2G8ZA 1EIBA 1J4HA 3QOKA 4GGQA 5D75A 1FKIA 3NRKA 4IQ2A 1RD6A 4Q22A 4MSPA 4JFKA 4TX0A 1E6RA 3WQVA 1E44A 2KO7A 1UR8A 3RFWA 2Y78A 3AQUA 4WK9A 2RUCA 1K9TA 1JNSA 1FKGA 2FAPA 1HXVA 3KAIA 1A7XA 2KGJA 5J6EA 3PRAA 1E6ZA 2ZQVA 3AS3A 4UDMA 3TC5A 1FFRA 1SYTA 4TW7A 4L3NA 3EY6A 4ODNA 4W9QA 1FKKA 3RMEA 1WB0A 5JH8A 1IX5A 1ZBWA 4WJXA 2OFNA 3O5IA 3WL1A 5HWBA 1JNDA 1TCOC 1FKHA 3NTPA 1HKJA 2FDMA 1BL4A 3KABA 3G6LA 4JFIA 5DITA 4WKHA 4Q7NA 5DEZA 4KQZA 4BF8A 1NWSA 2DSVA 4G2PA 1Q6IA 3RGCA 2DG3A 5DO2A 5BXJA 5HWCA 2DT3A 1EDQA 3IKDA 3WD0A 1NWUA 1HKKA 1H0GA 3UQAA 3O5KA 4JFMA 1ROUA 2O9OA 4WKFA 4R0XA 1FKLA 4DT4A 4L72B 4DWSC 4Z2IA 2F2DA 3AS1A 2DT1A 1J6YA 4ODRA 2MLXA 3CHEA 1NH6A 3UI4A 3WKZA 3ARSA 1J4RA 2O92A 2RUDA 3KAFA 4DRKA 1W26A 5HTGA 5DIVA 1OGBA 4MAVA 4PTMA 1W9PA 1FKDA 3AS0A 4URIA 4WIWA 1VF8A 4U86A 2XPBA 2XP3A 2KR7A 4XAKA 4DRNA 3O5MA 1L1PA 3CHDA 3WD4A 2A3BA 1GPFA 3CGNA 2F4EA 2EULA 4ODLA 4ODKA 1NWTA 3H9RB 2KE0A 4ODOA 3MDYB 1HKIA 3O5OA 1ZL1A 1FKTA 2ZQTA 2G41A 1J4IA 3WQWA 1WAWA 4MTVA 2F23A 3RM4A 3WH0A 2A3EA 2DSWA 3NI6A 1FD9A 3GPKA 1JNTA 3UQBA 2MNTA 5GQBA 1F40A 1LJYA 3AS2A 4GIVA 4ML4A 3I6CA 3CZ8A 2LJ4A 1W9VA 4ODPA 4QZVB 4AY1A 1ZCNA 3KAHA 4HARA 1ROTA 3ARXA 3G6MA 1D7IA 1CTNA 2ITKA 3VAWA 4DRJA 1ZBVA 4QT2A 1UR9A 4N19A 3O5JA 4W9OA 1YATA 1WNOA 3BXWA 2PPPA 4JYSA 3UI6A 2XP4A 1FFQA 3IK8A 2PPOA 2IF4A 3UF8A 4DRQA 3B8SA 4Z2HA 3FXYA 4J4OA 3EIPA 4MNMA 2YBTA 2ZQSA 1TFVA 1T11A 3JXVA 1D7HA 3JYMA 1PINA 4U85A 2ZR5A 1LG1A 3WD3A 1GOIA 2D9FA 2XP6A 3ARVA 1HJWA 2DSUA 3AROA 1FAPA 2IUZA 1ZU8A 3WIJA 2PV1A 1LL6A 1W1YA 4IQCA 4IT4A 5GPGA 2XPAA 4W5UA 1XHGA 3BMBA 4S3KA 5HUAA 4ZPTR 4DRPA 3CHCA 4LAYA 1EQ3A 4ODQA 3ALGA 4TYOA 4ODMA 1E15A 1D6OA 2WLYA 3RM8A 3TDBA 4ZS6A 1D2KA 4ITZA 1F8AB 5HT1A 2MLZA 4JFLA 5GPRA 2MPHA 1Y0OA 1PBKA 3O5GA 2VN1A 4TW6A 1W9UA 2RURA 4DRMA 3O5FA 4NZCA 4DWSB 1NSGA 2B5UB 3CHFA 2LGOA 3GTYX 2XP9A 1NMVA 1ITXA 4LGXA 2LKNA 4QIBA 2KI3A 3KCEA 4LAVA 2M2AA 3GU0A 3KAGA 3WD1A 4TW8A 3O5QA 1OWQA 1GUVA 4ZPVR 4MGVA 2PN0A 1KFWA 3KZ7A 1W1TA 2OLHA 4DWSA 4O2TA 5DF0A 1QPFA 4MNJA 3B9EA 1O6IA 2MF9A 1E6PA 2JZVA 1U79A 3ODKA 4TNSA 1KT0A 1ZBKA 2ESCA 3WD2A 1LL7A 1KT1A 3CH9A 4R5EA 3W4RA 4Z2GA 2ZR6A 4LAWA 3ARWA 1HJXA 2DT2A 3TCZA 2YBUA 3IHZA 1HJVA 4J4NA 4G50A 2LPVA 4ZPWR 3PR9A 1LQ0A 1SR0A 4DZ2A 4MNLA 1B6CA 1JNEA 5HW6A 1ZBCA 5HW8A 3RM9A 4MNKA 2P4VA 4KR0B 3O5RA 3O5LA 2XP8A 2KFWA 3ARYA 1OGGA 1C9HA 4W9PA 2UZ5A 2PI6A 5HKGA 3WL0A 2AWGA 3UI5A 2XP7A 3KADA 1N1AA 1HKMA 2ZQUA 1GRJA 2WK2A 2DPEA 3PA7A 1BKFA 3CGMA 1Q6HA 2PPNA 3FAPA 2QF8A 2K8IA 3ARRA 3LUOA 3ALFA 1LL4A 5HBFA 1FKSA 4FN2A 3OA5A 4DRIA 1Q6UA 2N87A 1NMWA 2M08A 2WM0A 1M5YA 1NWRA 2F21A 1JCHB 1W1VA 1X6NA 3IKGA 4P8XA 1R9HA 5HW7A 4HBOA 4JFJA 2PV2A 1E6NA 2VCDA 2ZR4A 1JVWA 1FKJA 3ARUA 2A3AA 1LG2A 2XP5A 4DIPA 4P8UA 2RQSA 3ARZA 1Q1CA 3KACA 4U84A 2DT0A 3OOBA 2WLZA 1FKBA 4DH0A 1W1PA 1H0IA 4DROA 2L2SA 3O5PA 2PBCA 2M1IA 4C02B 4MPKA 5DIUA 2DG9A 1FJDA 1P5QA 1QPLA 3UQIA 1EYMA 3B9DA 1YW5A 1FKRA 1XRVA 4P8VA 1E9LA 4NSBA 1QZ2A 2MLYA 4Z2LA 4HBEA 2B31A 5I98A 2FKEA 4LAXA 1FKFA 2AOSA 3O5DA 4S3JA 2A3CA 3PRDA 1ZB5A 3FY1A 4P8WA 3B9AA 4DWSD 2RSEA 2DG4A 4DZ3A 4WKAA 4Z2JA 4FAPA 2DSZA 2PV3A 4QT3A 3JYJA 4Z2KA 2RUQA 3O5EA 1EHNA 2Q5AA 4DRHA 1D7JA 3ARTA 4IPXA 3B7XA 2ETNA 3ARQA 4NNRA 3PRBA 5B8IC 4IT6A 1X6LA
chains in the Genus database with same CATH topology
1ZK6A 3ARPA 2G8ZA 1EIBA 1J4HA 3QOKA 4GGQA 5D75A 1FKIA 3NRKA 4IQ2A 1RD6A 4Q22A 4MSPA 4JFKA 4TX0A 1E6RA 3WQVA 2KO7A 1UR8A 3RFWA 2Y78A 3AQUA 4WK9A 2RUCA 1K9TA 1JNSA 1FKGA 2FAPA 1HXVA 3KAIA 1A7XA 2KGJA 5J6EA 3PRAA 1E6ZA 2ZQVA 3AS3A 3TC5A 1FFRA 1SYTA 4TW7A 4L3NA 3EY6A 4ODNA 4W9QA 1FKKA 3RMEA 1WB0A 5JH8A 1IX5A 1ZBWA 4WJXA 2OFNA 3O5IA 3WL1A 5HWBA 1JNDA 1TCOC 1FKHA 3NTPA 1HKJA 2FDMA 1BL4A 3KABA 3G6LA 4JFIA 5DITA 4WKHA 4Q7NA 5DEZA 4KQZA 4BF8A 1NWSA 2DSVA 4G2PA 1Q6IA 3RGCA 2DG3A 5DO2A 5BXJA 5HWCA 2DT3A 1EDQA 3IKDA 3WD0A 1NWUA 1HKKA 1H0GA 3UQAA 3O5KA 4JFMA 1ROUA 2O9OA 4WKFA 4R0XA 1FKLA 4DT4A 4L72B 4DWSC 4Z2IA 2F2DA 3AS1A 2DT1A 1J6YA 4ODRA 2MLXA 3CHEA 1NH6A 3UI4A 3WKZA 3ARSA 1J4RA 2O92A 2RUDA 3KAFA 4DRKA 1W26A 5HTGA 5DIVA 1OGBA 4MAVA 4PTMA 1W9PA 1FKDA 3AS0A 4URIA 4WIWA 1VF8A 4U86A 2XPBA 2XP3A 2KR7A 4XAKA 4DRNA 3O5MA 1L1PA 3CHDA 3WD4A 2A3BA 1GPFA 3CGNA 2F4EA 4ODLA 4ODKA 1NWTA 3H9RB 2KE0A 4ODOA 3MDYB 1HKIA 3O5OA 1ZL1A 1FKTA 2ZQTA 2G41A 1J4IA 3WQWA 1WAWA 4MTVA 3RM4A 3WH0A 2A3EA 2DSWA 3NI6A 1FD9A 3GPKA 1JNTA 3UQBA 2MNTA 5GQBA 1F40A 1LJYA 3AS2A 4GIVA 4ML4A 3I6CA 3CZ8A 2LJ4A 1W9VA 4ODPA 4QZVB 4AY1A 1ZCNA 3KAHA 4HARA 1ROTA 3ARXA 3G6MA 1D7IA 1CTNA 2ITKA 3VAWA 4DRJA 1ZBVA 4QT2A 1UR9A 4N19A 3O5JA 4W9OA 1YATA 1WNOA 3BXWA 2PPPA 4JYSA 3UI6A 2XP4A 1FFQA 3IK8A 2PPOA 2IF4A 3UF8A 4DRQA 3B8SA 4Z2HA 3FXYA 4J4OA 4MNMA 2YBTA 2ZQSA 1TFVA 1T11A 3JXVA 1D7HA 3JYMA 1PINA 4U85A 2ZR5A 1LG1A 3WD3A 1GOIA 2D9FA 2XP6A 3ARVA 1HJWA 2DSUA 3AROA 1FAPA 2IUZA 1ZU8A 3WIJA 2PV1A 1LL6A 1W1YA 4IQCA 4IT4A 5GPGA 2XPAA 4W5UA 1XHGA 4S3KA 5HUAA 4ZPTR 4DRPA 3CHCA 4LAYA 1EQ3A 4ODQA 3ALGA 4TYOA 4ODMA 1E15A 1D6OA 2WLYA 3RM8A 3TDBA 4ZS6A 1D2KA 4ITZA 1F8AB 5HT1A 2MLZA 4JFLA 5GPRA 2MPHA 1Y0OA 1PBKA 3O5GA 2VN1A 4TW6A 1W9UA 2RURA 4DRMA 3O5FA 4NZCA 4DWSB 1NSGA 3CHFA 2LGOA 2XP9A 1NMVA 1ITXA 4LGXA 2LKNA 4QIBA 2KI3A 3KCEA 4LAVA 2M2AA 3KAGA 3WD1A 4TW8A 3O5QA 1OWQA 1GUVA 4ZPVR 4MGVA 1KFWA 3KZ7A 1W1TA 2OLHA 4DWSA 4O2TA 5DF0A 1QPFA 4MNJA 3B9EA 1O6IA 2MF9A 1E6PA 2JZVA 1U79A 3ODKA 4TNSA 1KT0A 1ZBKA 2ESCA 3WD2A 1LL7A 1KT1A 3CH9A 4R5EA 3W4RA 4Z2GA 2ZR6A 4LAWA 3ARWA 1HJXA 2DT2A 3TCZA 2YBUA 3IHZA 1HJVA 4J4NA 4G50A 2LPVA 4ZPWR 3PR9A 1LQ0A 1SR0A 4DZ2A 4MNLA 1B6CA 1JNEA 5HW6A 1ZBCA 5HW8A 3RM9A 4MNKA 4KR0B 3O5RA 3O5LA 2XP8A 2KFWA 3ARYA 1OGGA 1C9HA 4W9PA 2UZ5A 2PI6A 5HKGA 3WL0A 2AWGA 3UI5A 2XP7A 3KADA 1N1AA 1HKMA 2ZQUA 2WK2A 2DPEA 3PA7A 1BKFA 3CGMA 1Q6HA 2PPNA 3FAPA 2QF8A 2K8IA 3ARRA 3LUOA 3ALFA 1LL4A 5HBFA 1FKSA 4FN2A 3OA5A 4DRIA 1Q6UA 2N87A 1NMWA 2M08A 2WM0A 1M5YA 1NWRA 2F21A 1W1VA 1X6NA 3IKGA 4P8XA 1R9HA 5HW7A 4HBOA 4JFJA 2PV2A 1E6NA 2VCDA 2ZR4A 1JVWA 1FKJA 3ARUA 2A3AA 1LG2A 2XP5A 4DIPA 4P8UA 2RQSA 3ARZA 1Q1CA 3KACA 4U84A 2DT0A 3OOBA 2WLZA 1FKBA 4DH0A 1W1PA 1H0IA 4DROA 2L2SA 3O5PA 2PBCA 2M1IA 4C02B 4MPKA 5DIUA 2DG9A 1FJDA 1P5QA 1QPLA 3UQIA 1EYMA 3B9DA 1YW5A 1FKRA 1XRVA 4P8VA 1E9LA 4NSBA 1QZ2A 2MLYA 4Z2LA 4HBEA 2B31A 5I98A 2FKEA 4LAXA 1FKFA 2AOSA 3O5DA 4S3JA 2A3CA 3PRDA 1ZB5A 3FY1A 4P8WA 3B9AA 4DWSD 2RSEA 2DG4A 4DZ3A 4WKAA 4Z2JA 4FAPA 2DSZA 2PV3A 4QT3A 3JYJA 4Z2KA 2RUQA 3O5EA 1EHNA 2Q5AA 4DRHA 1D7JA 3ARTA 4IPXA 3B7XA 3ARQA 4NNRA 3PRBA 5B8IC 4IT6A 1X6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPN A;  1ZK6 A;  2MLZ A;  4JFL A;  4ODL A;  4ODK A;  3FAP A;  2MPH A;  1J4H A;  1Y0O A;  3H9R B;  1PBK A;  2K8I A;  2VN1 A;  2KE0 A;  3O5G A;  4ODO A;  3MDY B;  4GGQ A;  3LUO A;  4TW6 A;  2RUR A;  5D75 A;  3O5O A;  1FKI A;  4DRM A;  3O5F A;  1FKT A;  1FKS A;  2ZQT A;  3NRK A;  4FN2 A;  4IQ2 A;  1NSG A;  4DRI A;  1Q6U A;  2LGO A;  1J4I A;  1NMW A;  2N87 A;  4JFK A;  4MSP A;  4TX0 A;  2M08 A;  2XP9 A;  1NMV A;  1M5Y A;  2F21 A;  2LKN A;  2KO7 A;  4QIB A;  3RFW A;  2KI3 A;  2Y78 A;  3WH0 A;  2RUC A;  3NI6 A;  1JNS A;  1FKG A;  3IKG A;  2FAP A;  3KCE A;  4LAV A;  1R9H A;  1HXV A;  2M2A A;  3KAI A;  5HW7 A;  1FD9 A;  3GPK A;  1JNT A;  3KAG A;  1A7X A;  2KGJ A;  5J6E A;  4JFJ A;  3UQB A;  2MNT A;  2PV2 A;  2ZQV A;  4TW8 A;  3O5Q A;  2VCD A;  3TC5 A;  2ZR4 A;  1JVW A;  4TW7 A;  1F40 A;  3EY6 A;  4ODN A;  1FKJ A;  4GIV A;  4MGV A;  3I6C A;  4W9Q A;  1FKK A;  4DIP A;  2XP5 A;  2LJ4 A;  3KZ7 A;  4ODP A;  4O2T A;  1ZCN A;  3KAH A;  2RQS A;  1Q1C A;  1ROT A;  1QPF A;  3KAC A;  2OFN A;  3O5I A;  4U84 A;  3OOB A;  5HWB A;  2MF9 A;  1FKB A;  1TCO C;  4DH0 A;  4DRO A;  2JZV A;  2L2S A;  1D7I A;  1U79 A;  3O5P A;  2ITK A;  2M1I A;  2PBC A;  3ODK A;  1FKH A;  3VAW A;  4C02 B;  4DRJ A;  4QT2 A;  1KT0 A;  3NTP A;  4TNS A;  5DIU A;  4N19 A;  2DG9 A;  3O5J A;  4W9O A;  1BL4 A;  1FJD A;  1YAT A;  1P5Q A;  3KAB A;  4JFI A;  1QPL A;  1KT1 A;  5DIT A;  3UQI A;  1EYM A;  2ZR6 A;  4LAW A;  4BF8 A;  2PPP A;  4JYS A;  3UI6 A;  3TCZ A;  2XP4 A;  1YW5 A;  4G2P A;  1FKR A;  1Q6I A;  3IK8 A;  2PPO A;  3IHZ A;  2DG3 A;  2IF4 A;  3RGC A;  1QZ2 A;  3UF8 A;  2MLY A;  4DRQ A;  5BXJ A;  5I98 A;  4J4N A;  5HWC A;  4G50 A;  2FKE A;  4J4O A;  3IKD A;  4LAX A;  1FKF A;  2LPV A;  3O5D A;  3UQA A;  3O5K A;  2ZQS A;  4JFM A;  1ROU A;  3PRD A;  4DZ2 A;  1T11 A;  3JXV A;  4R0X A;  1D7H A;  1FKL A;  3JYM A;  1PIN A;  1B6C A;  4DT4 A;  4U85 A;  2ZR5 A;  2RSE A;  2F2D A;  1J6Y A;  2DG4 A;  2D9F A;  5HT1 A;  4DZ3 A;  2XP6 A;  4ODR A;  2MLX A;  5HW6 A;  5HW8 A;  3UI4 A;  4FAP A;  1J4R A;  2RUD A;  2PV3 A;  3O5R A;  3KAF A;  3JYJ A;  4QT3 A;  4DRK A;  1FAP A;  2RUQ A;  3O5E A;  1W26 A;  2PV1 A;  3O5L A;  4IQC A;  5GPG A;  2XPA A;  2XP8 A;  2KFW A;  5HTG A;  4W9P A;  5DIV A;  1C9H A;  2Q5A A;  2UZ5 A;  4DRH A;  5HUA A;  1FKD A;  5HKG A;  4DRP A;  4U86 A;  1D7J A;  2AWG A;  4LAY A;  2XP7 A;  3UI5 A;  1EQ3 A;  2XPB A;  4ODQ A;  3KAD A;  1N1A A;  2XP3 A;  4IPX A;  3B7X A;  4TYO A;  2ZQU A;  2KR7 A;  4ODM A;  4DRN A;  1D6O A;  3O5M A;  1L1P A;  3TDB A;  3PA7 A;  4NNR A;  1BKF A;  3PRB A;  5B8I C;  4ITZ A;  1F8A B;  3CGM A;  1Q6H A;  3CGN A;  2F4E A; 
#chains in the Genus database with same CATH topology
 1ZK6 A;  3ARP A;  2G8Z A;  1EIB A;  1J4H A;  3QOK A;  4GGQ A;  5D75 A;  1FKI A;  3NRK A;  4IQ2 A;  1RD6 A;  4Q22 A;  4MSP A;  4JFK A;  4TX0 A;  1E6R A;  3WQV A;  1E44 A;  2KO7 A;  1UR8 A;  3RFW A;  2Y78 A;  3AQU A;  4WK9 A;  2RUC A;  1K9T A;  1JNS A;  1FKG A;  2FAP A;  1HXV A;  3KAI A;  1A7X A;  2KGJ A;  5J6E A;  3PRA A;  1E6Z A;  2ZQV A;  3AS3 A;  4UDM A;  3TC5 A;  1FFR A;  1SYT A;  4TW7 A;  4L3N A;  3EY6 A;  4ODN A;  4W9Q A;  1FKK A;  3RME A;  1WB0 A;  5JH8 A;  1IX5 A;  1ZBW A;  4WJX A;  2OFN A;  3O5I A;  3WL1 A;  5HWB A;  1JND A;  1TCO C;  1FKH A;  3NTP A;  1HKJ A;  2FDM A;  1BL4 A;  3KAB A;  3G6L A;  4JFI A;  5DIT A;  4WKH A;  4Q7N A;  5DEZ A;  4KQZ A;  4BF8 A;  1NWS A;  2DSV A;  4G2P A;  1Q6I A;  3RGC A;  2DG3 A;  5DO2 A;  5BXJ A;  5HWC A;  2DT3 A;  1EDQ A;  3IKD A;  3WD0 A;  1NWU A;  1HKK A;  1H0G A;  3UQA A;  3O5K A;  4JFM A;  1ROU A;  2O9O A;  4WKF A;  4R0X A;  1FKL A;  4DT4 A;  4L72 B;  4DWS C;  4Z2I A;  2F2D A;  3AS1 A;  2DT1 A;  1J6Y A;  4ODR A;  2MLX A;  3CHE A;  1NH6 A;  3UI4 A;  3WKZ A;  3ARS A;  1J4R A;  2O92 A;  2RUD A;  3KAF A;  4DRK A;  1W26 A;  5HTG A;  5DIV A;  1OGB A;  4MAV A;  4PTM A;  1W9P A;  1FKD A;  3AS0 A;  4URI A;  4WIW A;  1VF8 A;  4U86 A;  2XPB A;  2XP3 A;  2KR7 A;  4XAK A;  4DRN A;  3O5M A;  1L1P A;  3CHD A;  3WD4 A;  2A3B A;  1GPF A;  3CGN A;  2F4E A;  2EUL A;  4ODL A;  4ODK A;  1NWT A;  3H9R B;  2KE0 A;  4ODO A;  3MDY B;  1HKI A;  3O5O A;  1ZL1 A;  1FKT A;  2ZQT A;  2G41 A;  1J4I A;  3WQW A;  1WAW A;  4MTV A;  2F23 A;  3RM4 A;  3WH0 A;  2A3E A;  2DSW A;  3NI6 A;  1FD9 A;  3GPK A;  1JNT A;  3UQB A;  2MNT A;  5GQB A;  1F40 A;  1LJY A;  3AS2 A;  4GIV A;  4ML4 A;  3I6C A;  3CZ8 A;  2LJ4 A;  1W9V A;  4ODP A;  4QZV B;  4AY1 A;  1ZCN A;  3KAH A;  4HAR A;  1ROT A;  3ARX A;  3G6M A;  1D7I A;  1CTN A;  2ITK A;  3VAW A;  4DRJ A;  1ZBV A;  4QT2 A;  1UR9 A;  4N19 A;  3O5J A;  4W9O A;  1YAT A;  1WNO A;  3BXW A;  2PPP A;  4JYS A;  3UI6 A;  2XP4 A;  1FFQ A;  3IK8 A;  2PPO A;  2IF4 A;  3UF8 A;  4DRQ A;  3B8S A;  4Z2H A;  3FXY A;  4J4O A;  3EIP A;  4MNM A;  2YBT A;  2ZQS A;  1TFV A;  1T11 A;  3JXV A;  1D7H A;  3JYM A;  1PIN A;  4U85 A;  2ZR5 A;  1LG1 A;  3WD3 A;  1GOI A;  2D9F A;  2XP6 A;  3ARV A;  1HJW A;  2DSU A;  3ARO A;  1FAP A;  2IUZ A;  1ZU8 A;  3WIJ A;  2PV1 A;  1LL6 A;  1W1Y A;  4IQC A;  4IT4 A;  5GPG A;  2XPA A;  4W5U A;  1XHG A;  3BMB A;  4S3K A;  5HUA A;  4ZPT R;  4DRP A;  3CHC A;  4LAY A;  1EQ3 A;  4ODQ A;  3ALG A;  4TYO A;  4ODM A;  1E15 A;  1D6O A;  2WLY A;  3RM8 A;  3TDB A;  4ZS6 A;  1D2K A;  4ITZ A;  1F8A B;  5HT1 A;  2MLZ A;  4JFL A;  5GPR A;  2MPH A;  1Y0O A;  1PBK A;  3O5G A;  2VN1 A;  4TW6 A;  1W9U A;  2RUR A;  4DRM A;  3O5F A;  4NZC A;  4DWS B;  1NSG A;  2B5U B;  3CHF A;  2LGO A;  3GTY X;  2XP9 A;  1NMV A;  1ITX A;  4LGX A;  2LKN A;  4QIB A;  2KI3 A;  3KCE A;  4LAV A;  2M2A A;  3GU0 A;  3KAG A;  3WD1 A;  4TW8 A;  3O5Q A;  1OWQ A;  1GUV A;  4ZPV R;  4MGV A;  2PN0 A;  1KFW A;  3KZ7 A;  1W1T A;  2OLH A;  4DWS A;  4O2T A;  5DF0 A;  1QPF A;  4MNJ A;  3B9E A;  1O6I A;  2MF9 A;  1E6P A;  2JZV A;  1U79 A;  3ODK A;  4TNS A;  1KT0 A;  1ZBK A;  2ESC A;  3WD2 A;  1LL7 A;  1KT1 A;  3CH9 A;  4R5E A;  3W4R A;  4Z2G A;  2ZR6 A;  4LAW A;  3ARW A;  1HJX A;  2DT2 A;  3TCZ A;  2YBU A;  3IHZ A;  1HJV A;  4J4N A;  4G50 A;  2LPV A;  4ZPW R;  3PR9 A;  1LQ0 A;  1SR0 A;  4DZ2 A;  4MNL A;  1B6C A;  1JNE A;  5HW6 A;  1ZBC A;  5HW8 A;  3RM9 A;  4MNK A;  2P4V A;  4KR0 B;  3O5R A;  3O5L A;  2XP8 A;  2KFW A;  3ARY A;  1OGG A;  1C9H A;  4W9P A;  2UZ5 A;  2PI6 A;  5HKG A;  3WL0 A;  2AWG A;  3UI5 A;  2XP7 A;  3KAD A;  1N1A A;  1HKM A;  2ZQU A;  1GRJ A;  2WK2 A;  2DPE A;  3PA7 A;  1BKF A;  3CGM A;  1Q6H A;  2PPN A;  3FAP A;  2QF8 A;  2K8I A;  3ARR A;  3LUO A;  3ALF A;  1LL4 A;  5HBF A;  1FKS A;  4FN2 A;  3OA5 A;  4DRI A;  1Q6U A;  2N87 A;  1NMW A;  2M08 A;  2WM0 A;  1M5Y A;  1NWR A;  2F21 A;  1JCH B;  1W1V A;  1X6N A;  3IKG A;  4P8X A;  1R9H A;  5HW7 A;  4HBO A;  4JFJ A;  2PV2 A;  1E6N A;  2VCD A;  2ZR4 A;  1JVW A;  1FKJ A;  3ARU A;  2A3A A;  1LG2 A;  2XP5 A;  4DIP A;  4P8U A;  2RQS A;  3ARZ A;  1Q1C A;  3KAC A;  4U84 A;  2DT0 A;  3OOB A;  2WLZ A;  1FKB A;  4DH0 A;  1W1P A;  1H0I A;  4DRO A;  2L2S A;  3O5P A;  2PBC A;  2M1I A;  4C02 B;  4MPK A;  5DIU A;  2DG9 A;  1FJD A;  1P5Q A;  1QPL A;  3UQI A;  1EYM A;  3B9D A;  1YW5 A;  1FKR A;  1XRV A;  4P8V A;  1E9L A;  4NSB A;  1QZ2 A;  2MLY A;  4Z2L A;  4HBE A;  2B31 A;  5I98 A;  2FKE A;  4LAX A;  1FKF A;  2AOS A;  3O5D A;  4S3J A;  2A3C A;  3PRD A;  1ZB5 A;  3FY1 A;  4P8W A;  3B9A A;  4DWS D;  2RSE A;  2DG4 A;  4DZ3 A;  4WKA A;  4Z2J A;  4FAP A;  2DSZ A;  2PV3 A;  4QT3 A;  3JYJ A;  4Z2K A;  2RUQ A;  3O5E A;  1EHN A;  2Q5A A;  4DRH A;  1D7J A;  3ART A;  4IPX A;  3B7X A;  2ETN A;  3ARQ A;  4NNR A;  3PRB A;  5B8I C;  4IT6 A;  1X6L A; 
#chains in the Genus database with same CATH homology
 1ZK6 A;  3ARP A;  2G8Z A;  1EIB A;  1J4H A;  3QOK A;  4GGQ A;  5D75 A;  1FKI A;  3NRK A;  4IQ2 A;  1RD6 A;  4Q22 A;  4MSP A;  4JFK A;  4TX0 A;  1E6R A;  3WQV A;  2KO7 A;  1UR8 A;  3RFW A;  2Y78 A;  3AQU A;  4WK9 A;  2RUC A;  1K9T A;  1JNS A;  1FKG A;  2FAP A;  1HXV A;  3KAI A;  1A7X A;  2KGJ A;  5J6E A;  3PRA A;  1E6Z A;  2ZQV A;  3AS3 A;  3TC5 A;  1FFR A;  1SYT A;  4TW7 A;  4L3N A;  3EY6 A;  4ODN A;  4W9Q A;  1FKK A;  3RME A;  1WB0 A;  5JH8 A;  1IX5 A;  1ZBW A;  4WJX A;  2OFN A;  3O5I A;  3WL1 A;  5HWB A;  1JND A;  1TCO C;  1FKH A;  3NTP A;  1HKJ A;  2FDM A;  1BL4 A;  3KAB A;  3G6L A;  4JFI A;  5DIT A;  4WKH A;  4Q7N A;  5DEZ A;  4KQZ A;  4BF8 A;  1NWS A;  2DSV A;  4G2P A;  1Q6I A;  3RGC A;  2DG3 A;  5DO2 A;  5BXJ A;  5HWC A;  2DT3 A;  1EDQ A;  3IKD A;  3WD0 A;  1NWU A;  1HKK A;  1H0G A;  3UQA A;  3O5K A;  4JFM A;  1ROU A;  2O9O A;  4WKF A;  4R0X A;  1FKL A;  4DT4 A;  4L72 B;  4DWS C;  4Z2I A;  2F2D A;  3AS1 A;  2DT1 A;  1J6Y A;  4ODR A;  2MLX A;  3CHE A;  1NH6 A;  3UI4 A;  3WKZ A;  3ARS A;  1J4R A;  2O92 A;  2RUD A;  3KAF A;  4DRK A;  1W26 A;  5HTG A;  5DIV A;  1OGB A;  4MAV A;  4PTM A;  1W9P A;  1FKD A;  3AS0 A;  4URI A;  4WIW A;  1VF8 A;  4U86 A;  2XPB A;  2XP3 A;  2KR7 A;  4XAK A;  4DRN A;  3O5M A;  1L1P A;  3CHD A;  3WD4 A;  2A3B A;  1GPF A;  3CGN A;  2F4E A;  4ODL A;  4ODK A;  1NWT A;  3H9R B;  2KE0 A;  4ODO A;  3MDY B;  1HKI A;  3O5O A;  1ZL1 A;  1FKT A;  2ZQT A;  2G41 A;  1J4I A;  3WQW A;  1WAW A;  4MTV A;  3RM4 A;  3WH0 A;  2A3E A;  2DSW A;  3NI6 A;  1FD9 A;  3GPK A;  1JNT A;  3UQB A;  2MNT A;  5GQB A;  1F40 A;  1LJY A;  3AS2 A;  4GIV A;  4ML4 A;  3I6C A;  3CZ8 A;  2LJ4 A;  1W9V A;  4ODP A;  4QZV B;  4AY1 A;  1ZCN A;  3KAH A;  4HAR A;  1ROT A;  3ARX A;  3G6M A;  1D7I A;  1CTN A;  2ITK A;  3VAW A;  4DRJ A;  1ZBV A;  4QT2 A;  1UR9 A;  4N19 A;  3O5J A;  4W9O A;  1YAT A;  1WNO A;  3BXW A;  2PPP A;  4JYS A;  3UI6 A;  2XP4 A;  1FFQ A;  3IK8 A;  2PPO A;  2IF4 A;  3UF8 A;  4DRQ A;  3B8S A;  4Z2H A;  3FXY A;  4J4O A;  4MNM A;  2YBT A;  2ZQS A;  1TFV A;  1T11 A;  3JXV A;  1D7H A;  3JYM A;  1PIN A;  4U85 A;  2ZR5 A;  1LG1 A;  3WD3 A;  1GOI A;  2D9F A;  2XP6 A;  3ARV A;  1HJW A;  2DSU A;  3ARO A;  1FAP A;  2IUZ A;  1ZU8 A;  3WIJ A;  2PV1 A;  1LL6 A;  1W1Y A;  4IQC A;  4IT4 A;  5GPG A;  2XPA A;  4W5U A;  1XHG A;  4S3K A;  5HUA A;  4ZPT R;  4DRP A;  3CHC A;  4LAY A;  1EQ3 A;  4ODQ A;  3ALG A;  4TYO A;  4ODM A;  1E15 A;  1D6O A;  2WLY A;  3RM8 A;  3TDB A;  4ZS6 A;  1D2K A;  4ITZ A;  1F8A B;  5HT1 A;  2MLZ A;  4JFL A;  5GPR A;  2MPH A;  1Y0O A;  1PBK A;  3O5G A;  2VN1 A;  4TW6 A;  1W9U A;  2RUR A;  4DRM A;  3O5F A;  4NZC A;  4DWS B;  1NSG A;  3CHF A;  2LGO A;  2XP9 A;  1NMV A;  1ITX A;  4LGX A;  2LKN A;  4QIB A;  2KI3 A;  3KCE A;  4LAV A;  2M2A A;  3KAG A;  3WD1 A;  4TW8 A;  3O5Q A;  1OWQ A;  1GUV A;  4ZPV R;  4MGV A;  1KFW A;  3KZ7 A;  1W1T A;  2OLH A;  4DWS A;  4O2T A;  5DF0 A;  1QPF A;  4MNJ A;  3B9E A;  1O6I A;  2MF9 A;  1E6P A;  2JZV A;  1U79 A;  3ODK A;  4TNS A;  1KT0 A;  1ZBK A;  2ESC A;  3WD2 A;  1LL7 A;  1KT1 A;  3CH9 A;  4R5E A;  3W4R A;  4Z2G A;  2ZR6 A;  4LAW A;  3ARW A;  1HJX A;  2DT2 A;  3TCZ A;  2YBU A;  3IHZ A;  1HJV A;  4J4N A;  4G50 A;  2LPV A;  4ZPW R;  3PR9 A;  1LQ0 A;  1SR0 A;  4DZ2 A;  4MNL A;  1B6C A;  1JNE A;  5HW6 A;  1ZBC A;  5HW8 A;  3RM9 A;  4MNK A;  4KR0 B;  3O5R A;  3O5L A;  2XP8 A;  2KFW A;  3ARY A;  1OGG A;  1C9H A;  4W9P A;  2UZ5 A;  2PI6 A;  5HKG A;  3WL0 A;  2AWG A;  3UI5 A;  2XP7 A;  3KAD A;  1N1A A;  1HKM A;  2ZQU A;  2WK2 A;  2DPE A;  3PA7 A;  1BKF A;  3CGM A;  1Q6H A;  2PPN A;  3FAP A;  2QF8 A;  2K8I A;  3ARR A;  3LUO A;  3ALF A;  1LL4 A;  5HBF A;  1FKS A;  4FN2 A;  3OA5 A;  4DRI A;  1Q6U A;  2N87 A;  1NMW A;  2M08 A;  2WM0 A;  1M5Y A;  1NWR A;  2F21 A;  1W1V A;  1X6N A;  3IKG A;  4P8X A;  1R9H A;  5HW7 A;  4HBO A;  4JFJ A;  2PV2 A;  1E6N A;  2VCD A;  2ZR4 A;  1JVW A;  1FKJ A;  3ARU A;  2A3A A;  1LG2 A;  2XP5 A;  4DIP A;  4P8U A;  2RQS A;  3ARZ A;  1Q1C A;  3KAC A;  4U84 A;  2DT0 A;  3OOB A;  2WLZ A;  1FKB A;  4DH0 A;  1W1P A;  1H0I A;  4DRO A;  2L2S A;  3O5P A;  2PBC A;  2M1I A;  4C02 B;  4MPK A;  5DIU A;  2DG9 A;  1FJD A;  1P5Q A;  1QPL A;  3UQI A;  1EYM A;  3B9D A;  1YW5 A;  1FKR A;  1XRV A;  4P8V A;  1E9L A;  4NSB A;  1QZ2 A;  2MLY A;  4Z2L A;  4HBE A;  2B31 A;  5I98 A;  2FKE A;  4LAX A;  1FKF A;  2AOS A;  3O5D A;  4S3J A;  2A3C A;  3PRD A;  1ZB5 A;  3FY1 A;  4P8W A;  3B9A A;  4DWS D;  2RSE A;  2DG4 A;  4DZ3 A;  4WKA A;  4Z2J A;  4FAP A;  2DSZ A;  2PV3 A;  4QT3 A;  3JYJ A;  4Z2K A;  2RUQ A;  3O5E A;  1EHN A;  2Q5A A;  4DRH A;  1D7J A;  3ART A;  4IPX A;  3B7X A;  3ARQ A;  4NNR A;  3PRB A;  5B8I C;  4IT6 A;  1X6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...