4ODMA

Structure of slyd from thermus thermophilus in complex with s2-w23a peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 33
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odmA00
1NMVA 2K8IA 4FAPA 2LJ4A 4JFMA 1Q1CA 5GPGA 1BKFA 2ZR6A 4TW7A 4W9QA 1F8AB 5DIVA 4DRIA 3LUOA 5DIUA 5HWCA 3ODKA 1NSGA 3NTPA 4DROA 5DITA 2XP4A 2PBCA 3EY6A 2DG3A 4U85A 4DRQA 3H9RB 3UI6A 3WH0A 2VCDA 4J4NA 4QT2A 3O5DA 2ZQVA 3O5KA 4DRHA 2ZQSA 1FD9A 1YATA 3VAWA 3JYJA 2M2AA 4DRJA 4DZ3A 2M08A 3UI5A 1ROTA 3I6CA 1R9HA 3FAPA 4DZ2A 1PINA 3O5MA 4R0XA 2PPOA 2RSEA 2IF4A 1FKSA 3MDYB 3PA7A 4ODLA 5HW7A 5HUAA 2KI3A 4U86A 4W9PA 3UF8A 1B6CA 4JFKA 2LGOA 3RFWA 3KCEA 2XP6A 3KADA 1J6YA 1Q6UA 2ZQUA 4MSPA 3PRDA 3UI4A 4ODMA 4ITZA 2F4EA 2AWGA 2N87A 3NI6A 2M1IA 1FKRA 2ZR5A 1FKBA 2MF9A 2RURA 1QPFA 4N19A 4W9OA 3KAIA 3UQAA 4IQ2A 2RUDA 1J4RA 1D6OA 1W26A 2MLXA 5HT1A 4ODOA 4QIBA 1FKLA 4TW6A 4MGVA 4ODRA 1YW5A 1QZ2A 2PV2A 4G50A 1PBKA 4JFLA 4JYSA 1KT1A 1Q6IA 1QPLA 1D7IA 3JXVA 2PPPA 4LAVA 4BF8A 2XP3A 4DRMA 2DG4A 3IKGA 2FAPA 2MPHA 3TDBA 5J6EA 3KACA 5B8IC 3CGNA 2KO7A 3TC5A 4NNRA 2XP5A 3IK8A 4GIVA 4ODQA 2JZVA 1N1AA 2F21A 2MNTA 4QT3A 4LAWA 3PRBA 4IQCA 3UQIA 1ROUA 1A7XA 3O5QA 3IKDA 4DIPA 1FKIA 1Q6HA 2Y78A 5BXJA 4DRNA 1M5YA 4ODPA 3UQBA 1HXVA 5HW6A 1JVWA 3GPKA 3IHZA 1FAPA 4FN2A 3TCZA 1EQ3A 2LPVA 2XP9A 2PV3A 2UZ5A 3OOBA 3KAHA 1L1PA 2DG9A 4O2TA 3O5RA 4GGQA 4LAXA 1TCOC 2D9FA 4ODNA 2VN1A 2MLZA 1FKJA 2KFWA 1JNSA 2ZR4A 2ZQTA 1KT0A 4C02B 5D75A 4TYOA 3JYMA 3O5LA 4DT4A 2F2DA 4DRKA 1ZCNA 1ZK6A 4J4OA 5HWBA 2XPAA 3O5OA 3O5FA 2KR7A 5HKGA 5HTGA 4TX0A 1D7HA 1FKHA 1FKKA 2KGJA 2LKNA 3O5GA 3O5IA 4LAYA 5I98A 1T11A 3CGMA 3KAFA 1FKFA 2RQSA 1FKTA 1NMWA 4DH0A 1FJDA 2KE0A 3O5PA 2RUQA 1F40A 4ODKA 3KZ7A 4TNSA 3O5EA 3KAGA 2L2SA 1FKDA 1D7JA 2ITKA 1C9HA 4G2PA 3NRKA 3KABA 2OFNA 4DRPA 2MLYA 1U79A 1J4IA 4TW8A 1BL4A 4U84A 2PV1A 2XP7A 3O5JA 1Y0OA 2Q5AA 4IPXA 2PPNA 1P5QA 3B7XA 2XPBA 3RGCA 1FKGA 2RUCA 4JFIA 4JFJA 1JNTA 5HW8A 2XP8A 1J4HA 1EYMA 2FKEA
chains in the Genus database with same CATH superfamily
2LJ4A 5GPGA 4DWSB 3ODKA 4P8WA 3NTPA 5DITA 1LJYA 1W1TA 1EIBA 1WAWA 3H9RB 3UI6A 3O5DA 3O5KA 3AS0A 1FD9A 3AS3A 2A3BA 4MNKA 4DRJA 1KFWA 4DZ2A 3FAPA 1PINA 3WKZA 2PPOA 3CZ8A 3MDYB 3PA7A 4ODLA 3FXYA 3RFWA 1E6RA 2XP6A 1EHNA 4Z2HA 3WD0A 4HBEA 2DSUA 4ZPWR 1GUVA 2ZR5A 4N19A 4W9OA 4HARA 3ARZA 2RUDA 1J4RA 2DT2A 1FKLA 3ARSA 2DSVA 1LL6A 2PV2A 1JNDA 1ITXA 1PBKA 1KT1A 2ESCA 4JYSA 4BF8A 2B31A 2XP3A 4QZVB 4XAKA 3KACA 4NNRA 2XP5A 1IX5A 3PRAA 2F21A 2MNTA 2EULA 4NZCA 4IQCA 4P8XA 1A7XA 4Z2KA 1GOIA 1W1PA 1FKIA 3GPKA 4FN2A 2LPVA 4S3KA 2XP9A 3OOBA 1JNSA 2KFWA 2ZR4A 2ZQTA 4TYOA 4DRKA 1ZK6A 2OLHA 4TX0A 1W1YA 1FKHA 1FKKA 5DO2A 4LAYA 4AY1A 1FKFA 1FKTA 4IT4A 3ARRA 1FJDA 1NWUA 2RUQA 3CHFA 3O5PA 4ODKA 1VF8A 3CHDA 4KQZA 2L2SA 1ZBCA 1HKIA 4W5UA 3WD3A 4ZPTR 3NRKA 1JCHB 1U79A 1EDQA 1J4IA 4WK9A 1BL4A 2PI6A 4IPXA 3AQUA 2YBUA 1X6NA 2AOSA 1HJXA 1J4HA 3EIPA 4Z2LA 1NMVA 4JFMA 1Q1CA 1BKFA 2ZR6A 4TW7A 5DIVA 3LUOA 3ALGA 5DIUA 3BMBA 3PR9A 2XP4A 2PBCA 4U85A 2DG3A 5JH8A 3WH0A 2VCDA 4QT2A 2ZQSA 1YATA 3JYJA 2M2AA 5DF0A 4KR0B 4R0XA 3O5MA 4MNMA 1FFQA 2A3AA 2DT3A 4U86A 1O6IA 4JFKA 2LGOA 3KADA 2ZQUA 3ARUA 1OGBA 2F4EA 2DPEA 2DSWA 2N87A 2O92A 3AROA 1FKBA 2RURA 1W9UA 4IQ2A 5HT1A 4ODOA 1NWSA 4MGVA 1YW5A 1Q6IA 2PPPA 2YBTA 4LAVA 4DRMA 1W9PA 3IKGA 2O9OA 2FAPA 4ODQA 1N1AA 4DWSA 1ROUA 4IT6A 4DRNA 4ODPA 3UQBA 3IHZA 1FAPA 1UR9A 2PV3A 1L1PA 2DG9A 4O2TA 3O5RA 4P8VA 1E6ZA 2MLZA 1UR8A 3GTYX 4C02B 3ARYA 5D75A 3JYMA 4Z2JA 2F2DA 2XPAA 2KR7A 2LKNA 3O5IA 5I98A 2G41A 4WKFA 1LL4A 1ZB5A 1CTNA 4DH0A 1WNOA 4DWSC 3G6LA 3ARWA 4MNJA 3KABA 2A3CA 2OFNA 2MLYA 4R5EA 4U84A 3WD1A 2XPBA 1FKGA 2RUCA 4ZPVR 1HKMA 5HW8A 4FAPA 2FKEA 2DT0A 2K8IA 1NWRA 1LQ0A 4MAVA 4NSBA 1NSGA 4DROA 3EY6A 3CHEA 2ZQVA 1WB0A 4DRHA 2M08A 3UI5A 3I6CA 1R9HA 2PN0A 1E6NA 2IF4A 5HW7A 4W9PA 1B6CA 4WIWA 3OA5A 1TFVA 1J6YA 3WL1A 4ITZA 2AWGA 3NI6A 2M1IA 3AS2A 4Z2IA 3UQAA 1D6OA 5GQBA 2MLXA 3BXWA 4MTVA 3UQIA 1QZ2A 3B9AA 4G50A 3RM8A 3FY1A 1D7IA 1D2KA 1E6PA 2DG4A 5B8IC 1FFRA 3CGNA 3TC5A 1LG1A 3IK8A 2JZVA 4LAWA 1ZBWA 3PRBA 4PTMA 3O5QA 3IKDA 3CHCA 1Q6HA 2Y78A 5BXJA 1HXVA 3ALFA 5HW6A 1JVWA 3TCZA 2FDMA 1E44A 1XHGA 2UZ5A 4WJXA 3W4RA 3KAHA 1ZBVA 1HJWA 4LAXA 4ODNA 2P4VA 2VN1A 1FKJA 1KT0A 1ZL1A 5GPRA 3O5LA 1ZCNA 4J4OA 4WKHA 5HTGA 1D7HA 2KGJA 4WKAA 2IUZA 2RQSA 1NMWA 4MNLA 3WQVA 1NH6A 1GRJA 3KZ7A 3O5EA 3KAGA 3B8SA 1FKDA 1D7JA 2ITKA 1C9HA 4G2PA 4Z2GA 2DT1A 3QOKA 3WD4A 1JNEA 2XP7A 3WQWA 2Q5AA 3B7XA 1SR0A 3AS1A 2DSZA 1OWQA 1ZU8A 3WD2A 4JFIA 4JFJA 4DZ3A 4DWSD 1EYMA 4L3NA 3RM4A 4W9QA 2F23A 1HKKA 1F8AB 2WLZA 1LL7A 4DRIA 2A3EA 3ARTA 5HWCA 1NWTA 2ETNA 4ZS6A 4DRQA 1ZBKA 4J4NA 3VAWA 4URIA 1XRVA 1RD6A 1ROTA 4Q7NA 1HKJA 2RSEA 1SYTA 1FKSA 5HUAA 2KI3A 3UF8A 1H0GA 1X6LA 3KCEA 3ARPA 1Q6UA 4MSPA 3PRDA 3UI4A 4ODMA 2B5UB 3ARQA 2G8ZA 2MF9A 3RM9A 1QPFA 3G6MA 3KAIA 1W9VA 1W26A 4QIBA 4TW6A 4ODRA 4JFLA 1QPLA 3JXVA 2WM0A 1K9TA 4ML4A 4LGXA 5J6EA 2MPHA 3TDBA 2KO7A 4GIVA 4QT3A 3B9DA 4HBOA 4UDMA 4DIPA 1W1VA 4S3JA 1M5YA 2WLYA 1E15A 1EQ3A 4GGQA 1TCOC 2D9FA 5HBFA 1H0IA 3WL0A 4DT4A 5HWBA 4P8UA 3O5OA 3O5FA 5HKGA 3RMEA 3O5GA 3GU0A 1T11A 3CGMA 3KAFA 2WK2A 4L72B 2KE0A 4Q22A 1F40A 1GPFA 3WIJA 3CH9A 4TNSA 1E9LA 4DRPA 1OGGA 3ARVA 4TW8A 2PV1A 3B9EA 3O5JA 1Y0OA 4MPKA 2PPNA 1P5QA 3RGCA 1HJVA 3ARXA 2QF8A 5DEZA 1JNTA 1LG2A 2XP8A 1FKRA
chains in the Genus database with same CATH topology
2LJ4A 5GPGA 4DWSB 3ODKA 4P8WA 3NTPA 5DITA 1LJYA 1W1TA 1EIBA 1WAWA 3H9RB 3UI6A 3O5DA 3O5KA 3AS0A 1FD9A 3AS3A 2A3BA 4MNKA 4DRJA 1KFWA 4DZ2A 3FAPA 1PINA 3WKZA 2PPOA 3CZ8A 3MDYB 3PA7A 4ODLA 3FXYA 3RFWA 1E6RA 2XP6A 1EHNA 4Z2HA 3WD0A 4HBEA 2DSUA 4ZPWR 1GUVA 2ZR5A 4N19A 4W9OA 4HARA 3ARZA 2RUDA 1J4RA 2DT2A 1FKLA 3ARSA 2DSVA 1LL6A 2PV2A 1JNDA 1ITXA 1PBKA 1KT1A 2ESCA 4JYSA 4BF8A 2B31A 2XP3A 4QZVB 4XAKA 3KACA 4NNRA 2XP5A 1IX5A 3PRAA 2F21A 2MNTA 4NZCA 4IQCA 4P8XA 1A7XA 4Z2KA 1GOIA 1W1PA 1FKIA 3GPKA 4FN2A 2LPVA 4S3KA 2XP9A 3OOBA 1JNSA 2KFWA 2ZR4A 2ZQTA 4TYOA 4DRKA 1ZK6A 2OLHA 4TX0A 1W1YA 1FKHA 1FKKA 5DO2A 4LAYA 4AY1A 1FKFA 1FKTA 4IT4A 3ARRA 1FJDA 1NWUA 2RUQA 3CHFA 3O5PA 4ODKA 1VF8A 3CHDA 4KQZA 2L2SA 1ZBCA 1HKIA 4W5UA 3WD3A 4ZPTR 3NRKA 1U79A 1EDQA 1J4IA 4WK9A 1BL4A 2PI6A 4IPXA 3AQUA 2YBUA 1X6NA 2AOSA 1HJXA 1J4HA 4Z2LA 1NMVA 4JFMA 1Q1CA 1BKFA 2ZR6A 4TW7A 5DIVA 3LUOA 3ALGA 5DIUA 3PR9A 2XP4A 2PBCA 4U85A 2DG3A 5JH8A 3WH0A 2VCDA 4QT2A 2ZQSA 1YATA 3JYJA 2M2AA 5DF0A 4KR0B 4R0XA 3O5MA 4MNMA 1FFQA 2A3AA 2DT3A 4U86A 1O6IA 4JFKA 2LGOA 3KADA 2ZQUA 3ARUA 1OGBA 2F4EA 2DPEA 2DSWA 2N87A 2O92A 3AROA 1FKBA 2RURA 1W9UA 4IQ2A 5HT1A 4ODOA 1NWSA 4MGVA 1YW5A 1Q6IA 2PPPA 2YBTA 4LAVA 4DRMA 1W9PA 3IKGA 2O9OA 2FAPA 4ODQA 1N1AA 4DWSA 1ROUA 4IT6A 4DRNA 4ODPA 3UQBA 3IHZA 1FAPA 1UR9A 2PV3A 1L1PA 2DG9A 4O2TA 3O5RA 4P8VA 1E6ZA 2MLZA 1UR8A 4C02B 3ARYA 5D75A 3JYMA 4Z2JA 2F2DA 2XPAA 2KR7A 2LKNA 3O5IA 5I98A 2G41A 4WKFA 1LL4A 1ZB5A 1CTNA 4DH0A 1WNOA 4DWSC 3G6LA 3ARWA 4MNJA 3KABA 2A3CA 2OFNA 2MLYA 4R5EA 4U84A 3WD1A 2XPBA 1FKGA 2RUCA 4ZPVR 1HKMA 5HW8A 4FAPA 2FKEA 2DT0A 2K8IA 1NWRA 1LQ0A 4MAVA 4NSBA 1NSGA 4DROA 3EY6A 3CHEA 2ZQVA 1WB0A 4DRHA 2M08A 3UI5A 3I6CA 1R9HA 1E6NA 2IF4A 5HW7A 4W9PA 1B6CA 4WIWA 3OA5A 1TFVA 1J6YA 3WL1A 4ITZA 2AWGA 3NI6A 2M1IA 3AS2A 4Z2IA 3UQAA 1D6OA 5GQBA 2MLXA 3BXWA 4MTVA 3UQIA 1QZ2A 3B9AA 4G50A 3RM8A 3FY1A 1D7IA 1D2KA 1E6PA 2DG4A 5B8IC 1FFRA 3CGNA 3TC5A 1LG1A 3IK8A 2JZVA 4LAWA 1ZBWA 3PRBA 4PTMA 3O5QA 3IKDA 3CHCA 1Q6HA 2Y78A 5BXJA 1HXVA 3ALFA 5HW6A 1JVWA 3TCZA 2FDMA 1XHGA 2UZ5A 4WJXA 3W4RA 3KAHA 1ZBVA 1HJWA 4LAXA 4ODNA 2VN1A 1FKJA 1KT0A 1ZL1A 5GPRA 3O5LA 1ZCNA 4J4OA 4WKHA 5HTGA 1D7HA 2KGJA 4WKAA 2IUZA 2RQSA 1NMWA 4MNLA 3WQVA 1NH6A 3KZ7A 3O5EA 3KAGA 3B8SA 1FKDA 1D7JA 2ITKA 1C9HA 4G2PA 4Z2GA 2DT1A 3QOKA 3WD4A 1JNEA 2XP7A 3WQWA 2Q5AA 3B7XA 1SR0A 3AS1A 2DSZA 1OWQA 1ZU8A 3WD2A 4JFIA 4JFJA 4DZ3A 4DWSD 1EYMA 4L3NA 3RM4A 4W9QA 1HKKA 1F8AB 2WLZA 1LL7A 4DRIA 2A3EA 3ARTA 5HWCA 1NWTA 4ZS6A 4DRQA 1ZBKA 4J4NA 3VAWA 4URIA 1XRVA 1RD6A 1ROTA 4Q7NA 1HKJA 2RSEA 1SYTA 1FKSA 5HUAA 2KI3A 3UF8A 1H0GA 1X6LA 3KCEA 3ARPA 1Q6UA 4MSPA 3PRDA 3UI4A 4ODMA 3ARQA 2G8ZA 2MF9A 3RM9A 1QPFA 3G6MA 3KAIA 1W9VA 1W26A 4QIBA 4TW6A 4ODRA 4JFLA 1QPLA 3JXVA 2WM0A 1K9TA 4ML4A 4LGXA 5J6EA 2MPHA 3TDBA 2KO7A 4GIVA 4QT3A 3B9DA 4HBOA 4DIPA 1W1VA 4S3JA 1M5YA 2WLYA 1E15A 1EQ3A 4GGQA 1TCOC 2D9FA 5HBFA 1H0IA 3WL0A 4DT4A 5HWBA 4P8UA 3O5OA 3O5FA 5HKGA 3RMEA 3O5GA 1T11A 3CGMA 3KAFA 2WK2A 4L72B 2KE0A 4Q22A 1F40A 1GPFA 3WIJA 3CH9A 4TNSA 1E9LA 4DRPA 1OGGA 3ARVA 4TW8A 2PV1A 3B9EA 3O5JA 1Y0OA 4MPKA 2PPNA 1P5QA 3RGCA 1HJVA 3ARXA 2QF8A 5DEZA 1JNTA 1LG2A 2XP8A 1FKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMV A;  2K8I A;  4FAP A;  2LJ4 A;  4JFM A;  1Q1C A;  5GPG A;  1BKF A;  2ZR6 A;  4TW7 A;  4W9Q A;  1F8A B;  5DIV A;  4DRI A;  3LUO A;  5DIU A;  5HWC A;  3ODK A;  1NSG A;  3NTP A;  4DRO A;  5DIT A;  2XP4 A;  2PBC A;  3EY6 A;  2DG3 A;  4U85 A;  4DRQ A;  3H9R B;  3UI6 A;  3WH0 A;  2VCD A;  4J4N A;  4QT2 A;  3O5D A;  2ZQV A;  3O5K A;  4DRH A;  2ZQS A;  1FD9 A;  1YAT A;  3VAW A;  3JYJ A;  2M2A A;  4DRJ A;  4DZ3 A;  2M08 A;  3UI5 A;  1ROT A;  3I6C A;  1R9H A;  3FAP A;  4DZ2 A;  1PIN A;  3O5M A;  4R0X A;  2PPO A;  2RSE A;  2IF4 A;  1FKS A;  3MDY B;  3PA7 A;  4ODL A;  5HW7 A;  5HUA A;  2KI3 A;  4U86 A;  4W9P A;  3UF8 A;  1B6C A;  4JFK A;  2LGO A;  3RFW A;  3KCE A;  2XP6 A;  3KAD A;  1J6Y A;  1Q6U A;  2ZQU A;  4MSP A;  3PRD A;  3UI4 A;  4ODM A;  4ITZ A;  2F4E A;  2AWG A;  2N87 A;  3NI6 A;  2M1I A;  1FKR A;  2ZR5 A;  1FKB A;  2MF9 A;  2RUR A;  1QPF A;  4N19 A;  4W9O A;  3KAI A;  3UQA A;  4IQ2 A;  2RUD A;  1J4R A;  1D6O A;  1W26 A;  2MLX A;  5HT1 A;  4ODO A;  4QIB A;  1FKL A;  4TW6 A;  4MGV A;  4ODR A;  1YW5 A;  1QZ2 A;  2PV2 A;  4G50 A;  1PBK A;  4JFL A;  4JYS A;  1KT1 A;  1Q6I A;  1QPL A;  1D7I A;  3JXV A;  2PPP A;  4LAV A;  4BF8 A;  2XP3 A;  4DRM A;  2DG4 A;  3IKG A;  2FAP A;  2MPH A;  3TDB A;  5J6E A;  3KAC A;  5B8I C;  3CGN A;  2KO7 A;  3TC5 A;  4NNR A;  2XP5 A;  3IK8 A;  4GIV A;  4ODQ A;  2JZV A;  1N1A A;  2F21 A;  2MNT A;  4QT3 A;  4LAW A;  3PRB A;  4IQC A;  3UQI A;  1ROU A;  1A7X A;  3O5Q A;  3IKD A;  4DIP A;  1FKI A;  1Q6H A;  2Y78 A;  5BXJ A;  4DRN A;  1M5Y A;  4ODP A;  3UQB A;  1HXV A;  5HW6 A;  1JVW A;  3GPK A;  3IHZ A;  1FAP A;  4FN2 A;  3TCZ A;  1EQ3 A;  2LPV A;  2XP9 A;  2PV3 A;  2UZ5 A;  3OOB A;  3KAH A;  1L1P A;  2DG9 A;  4O2T A;  3O5R A;  4GGQ A;  4LAX A;  1TCO C;  2D9F A;  4ODN A;  2VN1 A;  2MLZ A;  1FKJ A;  2KFW A;  1JNS A;  2ZR4 A;  2ZQT A;  1KT0 A;  4C02 B;  5D75 A;  4TYO A;  3JYM A;  3O5L A;  4DT4 A;  2F2D A;  4DRK A;  1ZCN A;  1ZK6 A;  4J4O A;  5HWB A;  2XPA A;  3O5O A;  3O5F A;  2KR7 A;  5HKG A;  5HTG A;  4TX0 A;  1D7H A;  1FKH A;  1FKK A;  2KGJ A;  2LKN A;  3O5G A;  3O5I A;  4LAY A;  5I98 A;  1T11 A;  3CGM A;  3KAF A;  1FKF A;  2RQS A;  1FKT A;  1NMW A;  4DH0 A;  1FJD A;  2KE0 A;  3O5P A;  2RUQ A;  1F40 A;  4ODK A;  3KZ7 A;  4TNS A;  3O5E A;  3KAG A;  2L2S A;  1FKD A;  1D7J A;  2ITK A;  1C9H A;  4G2P A;  3NRK A;  3KAB A;  2OFN A;  4DRP A;  2MLY A;  1U79 A;  1J4I A;  4TW8 A;  1BL4 A;  4U84 A;  2PV1 A;  2XP7 A;  3O5J A;  1Y0O A;  2Q5A A;  4IPX A;  2PPN A;  1P5Q A;  3B7X A;  2XPB A;  3RGC A;  1FKG A;  2RUC A;  4JFI A;  4JFJ A;  1JNT A;  5HW8 A;  2XP8 A;  1J4H A;  1EYM A;  2FKE A; 
#chains in the Genus database with same CATH topology
 2LJ4 A;  5GPG A;  4DWS B;  3ODK A;  4P8W A;  3NTP A;  5DIT A;  1LJY A;  1W1T A;  1EIB A;  1WAW A;  3H9R B;  3UI6 A;  3O5D A;  3O5K A;  3AS0 A;  1FD9 A;  3AS3 A;  2A3B A;  4MNK A;  4DRJ A;  1KFW A;  4DZ2 A;  3FAP A;  1PIN A;  3WKZ A;  2PPO A;  3CZ8 A;  3MDY B;  3PA7 A;  4ODL A;  3FXY A;  3RFW A;  1E6R A;  2XP6 A;  1EHN A;  4Z2H A;  3WD0 A;  4HBE A;  2DSU A;  4ZPW R;  1GUV A;  2ZR5 A;  4N19 A;  4W9O A;  4HAR A;  3ARZ A;  2RUD A;  1J4R A;  2DT2 A;  1FKL A;  3ARS A;  2DSV A;  1LL6 A;  2PV2 A;  1JND A;  1ITX A;  1PBK A;  1KT1 A;  2ESC A;  4JYS A;  4BF8 A;  2B31 A;  2XP3 A;  4QZV B;  4XAK A;  3KAC A;  4NNR A;  2XP5 A;  1IX5 A;  3PRA A;  2F21 A;  2MNT A;  2EUL A;  4NZC A;  4IQC A;  4P8X A;  1A7X A;  4Z2K A;  1GOI A;  1W1P A;  1FKI A;  3GPK A;  4FN2 A;  2LPV A;  4S3K A;  2XP9 A;  3OOB A;  1JNS A;  2KFW A;  2ZR4 A;  2ZQT A;  4TYO A;  4DRK A;  1ZK6 A;  2OLH A;  4TX0 A;  1W1Y A;  1FKH A;  1FKK A;  5DO2 A;  4LAY A;  4AY1 A;  1FKF A;  1FKT A;  4IT4 A;  3ARR A;  1FJD A;  1NWU A;  2RUQ A;  3CHF A;  3O5P A;  4ODK A;  1VF8 A;  3CHD A;  4KQZ A;  2L2S A;  1ZBC A;  1HKI A;  4W5U A;  3WD3 A;  4ZPT R;  3NRK A;  1JCH B;  1U79 A;  1EDQ A;  1J4I A;  4WK9 A;  1BL4 A;  2PI6 A;  4IPX A;  3AQU A;  2YBU A;  1X6N A;  2AOS A;  1HJX A;  1J4H A;  3EIP A;  4Z2L A;  1NMV A;  4JFM A;  1Q1C A;  1BKF A;  2ZR6 A;  4TW7 A;  5DIV A;  3LUO A;  3ALG A;  5DIU A;  3BMB A;  3PR9 A;  2XP4 A;  2PBC A;  4U85 A;  2DG3 A;  5JH8 A;  3WH0 A;  2VCD A;  4QT2 A;  2ZQS A;  1YAT A;  3JYJ A;  2M2A A;  5DF0 A;  4KR0 B;  4R0X A;  3O5M A;  4MNM A;  1FFQ A;  2A3A A;  2DT3 A;  4U86 A;  1O6I A;  4JFK A;  2LGO A;  3KAD A;  2ZQU A;  3ARU A;  1OGB A;  2F4E A;  2DPE A;  2DSW A;  2N87 A;  2O92 A;  3ARO A;  1FKB A;  2RUR A;  1W9U A;  4IQ2 A;  5HT1 A;  4ODO A;  1NWS A;  4MGV A;  1YW5 A;  1Q6I A;  2PPP A;  2YBT A;  4LAV A;  4DRM A;  1W9P A;  3IKG A;  2O9O A;  2FAP A;  4ODQ A;  1N1A A;  4DWS A;  1ROU A;  4IT6 A;  4DRN A;  4ODP A;  3UQB A;  3IHZ A;  1FAP A;  1UR9 A;  2PV3 A;  1L1P A;  2DG9 A;  4O2T A;  3O5R A;  4P8V A;  1E6Z A;  2MLZ A;  1UR8 A;  3GTY X;  4C02 B;  3ARY A;  5D75 A;  3JYM A;  4Z2J A;  2F2D A;  2XPA A;  2KR7 A;  2LKN A;  3O5I A;  5I98 A;  2G41 A;  4WKF A;  1LL4 A;  1ZB5 A;  1CTN A;  4DH0 A;  1WNO A;  4DWS C;  3G6L A;  3ARW A;  4MNJ A;  3KAB A;  2A3C A;  2OFN A;  2MLY A;  4R5E A;  4U84 A;  3WD1 A;  2XPB A;  1FKG A;  2RUC A;  4ZPV R;  1HKM A;  5HW8 A;  4FAP A;  2FKE A;  2DT0 A;  2K8I A;  1NWR A;  1LQ0 A;  4MAV A;  4NSB A;  1NSG A;  4DRO A;  3EY6 A;  3CHE A;  2ZQV A;  1WB0 A;  4DRH A;  2M08 A;  3UI5 A;  3I6C A;  1R9H A;  2PN0 A;  1E6N A;  2IF4 A;  5HW7 A;  4W9P A;  1B6C A;  4WIW A;  3OA5 A;  1TFV A;  1J6Y A;  3WL1 A;  4ITZ A;  2AWG A;  3NI6 A;  2M1I A;  3AS2 A;  4Z2I A;  3UQA A;  1D6O A;  5GQB A;  2MLX A;  3BXW A;  4MTV A;  3UQI A;  1QZ2 A;  3B9A A;  4G50 A;  3RM8 A;  3FY1 A;  1D7I A;  1D2K A;  1E6P A;  2DG4 A;  5B8I C;  1FFR A;  3CGN A;  3TC5 A;  1LG1 A;  3IK8 A;  2JZV A;  4LAW A;  1ZBW A;  3PRB A;  4PTM A;  3O5Q A;  3IKD A;  3CHC A;  1Q6H A;  2Y78 A;  5BXJ A;  1HXV A;  3ALF A;  5HW6 A;  1JVW A;  3TCZ A;  2FDM A;  1E44 A;  1XHG A;  2UZ5 A;  4WJX A;  3W4R A;  3KAH A;  1ZBV A;  1HJW A;  4LAX A;  4ODN A;  2P4V A;  2VN1 A;  1FKJ A;  1KT0 A;  1ZL1 A;  5GPR A;  3O5L A;  1ZCN A;  4J4O A;  4WKH A;  5HTG A;  1D7H A;  2KGJ A;  4WKA A;  2IUZ A;  2RQS A;  1NMW A;  4MNL A;  3WQV A;  1NH6 A;  1GRJ A;  3KZ7 A;  3O5E A;  3KAG A;  3B8S A;  1FKD A;  1D7J A;  2ITK A;  1C9H A;  4G2P A;  4Z2G A;  2DT1 A;  3QOK A;  3WD4 A;  1JNE A;  2XP7 A;  3WQW A;  2Q5A A;  3B7X A;  1SR0 A;  3AS1 A;  2DSZ A;  1OWQ A;  1ZU8 A;  3WD2 A;  4JFI A;  4JFJ A;  4DZ3 A;  4DWS D;  1EYM A;  4L3N A;  3RM4 A;  4W9Q A;  2F23 A;  1HKK A;  1F8A B;  2WLZ A;  1LL7 A;  4DRI A;  2A3E A;  3ART A;  5HWC A;  1NWT A;  2ETN A;  4ZS6 A;  4DRQ A;  1ZBK A;  4J4N A;  3VAW A;  4URI A;  1XRV A;  1RD6 A;  1ROT A;  4Q7N A;  1HKJ A;  2RSE A;  1SYT A;  1FKS A;  5HUA A;  2KI3 A;  3UF8 A;  1H0G A;  1X6L A;  3KCE A;  3ARP A;  1Q6U A;  4MSP A;  3PRD A;  3UI4 A;  4ODM A;  2B5U B;  3ARQ A;  2G8Z A;  2MF9 A;  3RM9 A;  1QPF A;  3G6M A;  3KAI A;  1W9V A;  1W26 A;  4QIB A;  4TW6 A;  4ODR A;  4JFL A;  1QPL A;  3JXV A;  2WM0 A;  1K9T A;  4ML4 A;  4LGX A;  5J6E A;  2MPH A;  3TDB A;  2KO7 A;  4GIV A;  4QT3 A;  3B9D A;  4HBO A;  4UDM A;  4DIP A;  1W1V A;  4S3J A;  1M5Y A;  2WLY A;  1E15 A;  1EQ3 A;  4GGQ A;  1TCO C;  2D9F A;  5HBF A;  1H0I A;  3WL0 A;  4DT4 A;  5HWB A;  4P8U A;  3O5O A;  3O5F A;  5HKG A;  3RME A;  3O5G A;  3GU0 A;  1T11 A;  3CGM A;  3KAF A;  2WK2 A;  4L72 B;  2KE0 A;  4Q22 A;  1F40 A;  1GPF A;  3WIJ A;  3CH9 A;  4TNS A;  1E9L A;  4DRP A;  1OGG A;  3ARV A;  4TW8 A;  2PV1 A;  3B9E A;  3O5J A;  1Y0O A;  4MPK A;  2PPN A;  1P5Q A;  3RGC A;  1HJV A;  3ARX A;  2QF8 A;  5DEZ A;  1JNT A;  1LG2 A;  2XP8 A;  1FKR A; 
#chains in the Genus database with same CATH homology
 2LJ4 A;  5GPG A;  4DWS B;  3ODK A;  4P8W A;  3NTP A;  5DIT A;  1LJY A;  1W1T A;  1EIB A;  1WAW A;  3H9R B;  3UI6 A;  3O5D A;  3O5K A;  3AS0 A;  1FD9 A;  3AS3 A;  2A3B A;  4MNK A;  4DRJ A;  1KFW A;  4DZ2 A;  3FAP A;  1PIN A;  3WKZ A;  2PPO A;  3CZ8 A;  3MDY B;  3PA7 A;  4ODL A;  3FXY A;  3RFW A;  1E6R A;  2XP6 A;  1EHN A;  4Z2H A;  3WD0 A;  4HBE A;  2DSU A;  4ZPW R;  1GUV A;  2ZR5 A;  4N19 A;  4W9O A;  4HAR A;  3ARZ A;  2RUD A;  1J4R A;  2DT2 A;  1FKL A;  3ARS A;  2DSV A;  1LL6 A;  2PV2 A;  1JND A;  1ITX A;  1PBK A;  1KT1 A;  2ESC A;  4JYS A;  4BF8 A;  2B31 A;  2XP3 A;  4QZV B;  4XAK A;  3KAC A;  4NNR A;  2XP5 A;  1IX5 A;  3PRA A;  2F21 A;  2MNT A;  4NZC A;  4IQC A;  4P8X A;  1A7X A;  4Z2K A;  1GOI A;  1W1P A;  1FKI A;  3GPK A;  4FN2 A;  2LPV A;  4S3K A;  2XP9 A;  3OOB A;  1JNS A;  2KFW A;  2ZR4 A;  2ZQT A;  4TYO A;  4DRK A;  1ZK6 A;  2OLH A;  4TX0 A;  1W1Y A;  1FKH A;  1FKK A;  5DO2 A;  4LAY A;  4AY1 A;  1FKF A;  1FKT A;  4IT4 A;  3ARR A;  1FJD A;  1NWU A;  2RUQ A;  3CHF A;  3O5P A;  4ODK A;  1VF8 A;  3CHD A;  4KQZ A;  2L2S A;  1ZBC A;  1HKI A;  4W5U A;  3WD3 A;  4ZPT R;  3NRK A;  1U79 A;  1EDQ A;  1J4I A;  4WK9 A;  1BL4 A;  2PI6 A;  4IPX A;  3AQU A;  2YBU A;  1X6N A;  2AOS A;  1HJX A;  1J4H A;  4Z2L A;  1NMV A;  4JFM A;  1Q1C A;  1BKF A;  2ZR6 A;  4TW7 A;  5DIV A;  3LUO A;  3ALG A;  5DIU A;  3PR9 A;  2XP4 A;  2PBC A;  4U85 A;  2DG3 A;  5JH8 A;  3WH0 A;  2VCD A;  4QT2 A;  2ZQS A;  1YAT A;  3JYJ A;  2M2A A;  5DF0 A;  4KR0 B;  4R0X A;  3O5M A;  4MNM A;  1FFQ A;  2A3A A;  2DT3 A;  4U86 A;  1O6I A;  4JFK A;  2LGO A;  3KAD A;  2ZQU A;  3ARU A;  1OGB A;  2F4E A;  2DPE A;  2DSW A;  2N87 A;  2O92 A;  3ARO A;  1FKB A;  2RUR A;  1W9U A;  4IQ2 A;  5HT1 A;  4ODO A;  1NWS A;  4MGV A;  1YW5 A;  1Q6I A;  2PPP A;  2YBT A;  4LAV A;  4DRM A;  1W9P A;  3IKG A;  2O9O A;  2FAP A;  4ODQ A;  1N1A A;  4DWS A;  1ROU A;  4IT6 A;  4DRN A;  4ODP A;  3UQB A;  3IHZ A;  1FAP A;  1UR9 A;  2PV3 A;  1L1P A;  2DG9 A;  4O2T A;  3O5R A;  4P8V A;  1E6Z A;  2MLZ A;  1UR8 A;  4C02 B;  3ARY A;  5D75 A;  3JYM A;  4Z2J A;  2F2D A;  2XPA A;  2KR7 A;  2LKN A;  3O5I A;  5I98 A;  2G41 A;  4WKF A;  1LL4 A;  1ZB5 A;  1CTN A;  4DH0 A;  1WNO A;  4DWS C;  3G6L A;  3ARW A;  4MNJ A;  3KAB A;  2A3C A;  2OFN A;  2MLY A;  4R5E A;  4U84 A;  3WD1 A;  2XPB A;  1FKG A;  2RUC A;  4ZPV R;  1HKM A;  5HW8 A;  4FAP A;  2FKE A;  2DT0 A;  2K8I A;  1NWR A;  1LQ0 A;  4MAV A;  4NSB A;  1NSG A;  4DRO A;  3EY6 A;  3CHE A;  2ZQV A;  1WB0 A;  4DRH A;  2M08 A;  3UI5 A;  3I6C A;  1R9H A;  1E6N A;  2IF4 A;  5HW7 A;  4W9P A;  1B6C A;  4WIW A;  3OA5 A;  1TFV A;  1J6Y A;  3WL1 A;  4ITZ A;  2AWG A;  3NI6 A;  2M1I A;  3AS2 A;  4Z2I A;  3UQA A;  1D6O A;  5GQB A;  2MLX A;  3BXW A;  4MTV A;  3UQI A;  1QZ2 A;  3B9A A;  4G50 A;  3RM8 A;  3FY1 A;  1D7I A;  1D2K A;  1E6P A;  2DG4 A;  5B8I C;  1FFR A;  3CGN A;  3TC5 A;  1LG1 A;  3IK8 A;  2JZV A;  4LAW A;  1ZBW A;  3PRB A;  4PTM A;  3O5Q A;  3IKD A;  3CHC A;  1Q6H A;  2Y78 A;  5BXJ A;  1HXV A;  3ALF A;  5HW6 A;  1JVW A;  3TCZ A;  2FDM A;  1XHG A;  2UZ5 A;  4WJX A;  3W4R A;  3KAH A;  1ZBV A;  1HJW A;  4LAX A;  4ODN A;  2VN1 A;  1FKJ A;  1KT0 A;  1ZL1 A;  5GPR A;  3O5L A;  1ZCN A;  4J4O A;  4WKH A;  5HTG A;  1D7H A;  2KGJ A;  4WKA A;  2IUZ A;  2RQS A;  1NMW A;  4MNL A;  3WQV A;  1NH6 A;  3KZ7 A;  3O5E A;  3KAG A;  3B8S A;  1FKD A;  1D7J A;  2ITK A;  1C9H A;  4G2P A;  4Z2G A;  2DT1 A;  3QOK A;  3WD4 A;  1JNE A;  2XP7 A;  3WQW A;  2Q5A A;  3B7X A;  1SR0 A;  3AS1 A;  2DSZ A;  1OWQ A;  1ZU8 A;  3WD2 A;  4JFI A;  4JFJ A;  4DZ3 A;  4DWS D;  1EYM A;  4L3N A;  3RM4 A;  4W9Q A;  1HKK A;  1F8A B;  2WLZ A;  1LL7 A;  4DRI A;  2A3E A;  3ART A;  5HWC A;  1NWT A;  4ZS6 A;  4DRQ A;  1ZBK A;  4J4N A;  3VAW A;  4URI A;  1XRV A;  1RD6 A;  1ROT A;  4Q7N A;  1HKJ A;  2RSE A;  1SYT A;  1FKS A;  5HUA A;  2KI3 A;  3UF8 A;  1H0G A;  1X6L A;  3KCE A;  3ARP A;  1Q6U A;  4MSP A;  3PRD A;  3UI4 A;  4ODM A;  3ARQ A;  2G8Z A;  2MF9 A;  3RM9 A;  1QPF A;  3G6M A;  3KAI A;  1W9V A;  1W26 A;  4QIB A;  4TW6 A;  4ODR A;  4JFL A;  1QPL A;  3JXV A;  2WM0 A;  1K9T A;  4ML4 A;  4LGX A;  5J6E A;  2MPH A;  3TDB A;  2KO7 A;  4GIV A;  4QT3 A;  3B9D A;  4HBO A;  4DIP A;  1W1V A;  4S3J A;  1M5Y A;  2WLY A;  1E15 A;  1EQ3 A;  4GGQ A;  1TCO C;  2D9F A;  5HBF A;  1H0I A;  3WL0 A;  4DT4 A;  5HWB A;  4P8U A;  3O5O A;  3O5F A;  5HKG A;  3RME A;  3O5G A;  1T11 A;  3CGM A;  3KAF A;  2WK2 A;  4L72 B;  2KE0 A;  4Q22 A;  1F40 A;  1GPF A;  3WIJ A;  3CH9 A;  4TNS A;  1E9L A;  4DRP A;  1OGG A;  3ARV A;  4TW8 A;  2PV1 A;  3B9E A;  3O5J A;  1Y0O A;  4MPK A;  2PPN A;  1P5Q A;  3RGC A;  1HJV A;  3ARX A;  2QF8 A;  5DEZ A;  1JNT A;  1LG2 A;  2XP8 A;  1FKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...