4ODMA

Structure of slyd from thermus thermophilus in complex with s2-w23a peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 33
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odmA00
2KI3A 2LJ4A 2FKEA 3CGMA 3RGCA 4JYSA 1FKIA 1J4HA 3UQBA 1D7HA 2PPOA 1FKDA 3UI6A 3O5IA 3O5QA 4DRMA 3UQAA 2LGOA 3JYMA 1D7JA 5I98A 1YW5A 1ROTA 2M2AA 2XPAA 2FAPA 2K8IA 3OOBA 4C02B 4DRPA 3PRBA 2F2DA 4TNSA 4G2PA 2LPVA 3KABA 3RFWA 4DROA 4LAVA 3IKGA 4JFJA 4ODRA 5DIVA 2MF9A 1P5QA 1T11A 3UI4A 2PPNA 3B7XA 2XP3A 5HW7A 2Q5AA 1Q6UA 2RSEA 1FKBA 4IQCA 3IKDA 5GPGA 1ZK6A 4LAXA 1FD9A 2VCDA 3O5EA 4TW6A 3FAPA 3O5LA 1Q6IA 1D6OA 1ZCNA 4DZ3A 4GGQA 4W9PA 2M08A 1U79A 3GPKA 2ZQUA 4J4NA 2DG3A 3KAGA 1FKHA 1JNSA 1KT1A 3O5DA 3KADA 4MSPA 2PV3A 4ODNA 1QPFA 1QPLA 2JZVA 4BF8A 4IPXA 2PV2A 5DITA 1J6YA 1J4IA 2XP5A 2RUDA 2LKNA 3O5GA 4GIVA 4DT4A 4TX0A 3JXVA 5DIUA 4DRHA 5B8IC 4LAYA 2ZR4A 3KAFA 1QZ2A 2XP4A 3PRDA 1F40A 1Q6HA 1C9HA 1NMWA 3KCEA 3MDYB 3O5JA 4J4OA 3NI6A 4DH0A 2DG9A 1YATA 5HKGA 5HW8A 1HXVA 2RUCA 4LAWA 4ODPA 1FKKA 2M1IA 4QIBA 3NTPA 2MLXA 1B6CA 1PINA 4ITZA 2KR7A 3VAWA 2UZ5A 1FJDA 1A7XA 1PBKA 2ITKA 4W9OA 3JYJA 1BL4A 3O5FA 2XP6A 2KO7A 2N87A 2PBCA 2L2SA 1F8AB 3PA7A 4QT2A 1JNTA 2AWGA 2DG4A 2IF4A 4TW7A 1EQ3A 1NSGA 4G50A 2F21A 1J4RA 5HW6A 1N1AA 3IK8A 1FKRA 3KAIA 3O5RA 1Y0OA 5HTGA 4IQ2A 3TDBA 1NMVA 2XP7A 2ZQTA 5J6EA 4DRKA 1W26A 4JFLA 2XP8A 3IHZA 1FKJA 2MLZA 3UI5A 1L1PA 1M5YA 4QT3A 4DRJA 3O5KA 1FKSA 1R9HA 4FN2A 1EYMA 2MLYA 1D7IA 1FKTA 3UF8A 4DRQA 4ODKA 2ZQSA 4JFKA 2KFWA 4JFMA 4U85A 3WH0A 3UQIA 4FAPA 2OFNA 2KE0A 3NRKA 4NNRA 4ODQA 4DZ2A 2RURA 2ZQVA 4JFIA 1TCOC 4DRNA 5HUAA 5HWCA 2MPHA 3KACA 4DIPA 1FKLA 5HWBA 2VN1A 4W9QA 3TC5A 1FKFA 4N19A 3KAHA 4MGVA 3O5PA 2RQSA 4TYOA 2MNTA 1FAPA 3EY6A 3I6CA 2Y78A 4DRIA 3ODKA 2ZR6A 2ZR5A 3LUOA 1Q1CA 3O5MA 1ROUA 1KT0A 3KZ7A 2KGJA 4ODMA 5BXJA 1JVWA 4R0XA 2XPBA 2PPPA 3O5OA 3H9RB 4O2TA 4U84A 3TCZA 2XP9A 2RUQA 4TW8A 4U86A 5HT1A 2PV1A 3CGNA 4ODLA 2F4EA 4ODOA 5D75A 1FKGA 2D9FA 1BKFA
chains in the Genus database with same CATH superfamily
3WL0A 2FKEA 1XHGA 3AS0A 3ARZA 4MTVA 3RGCA 1J4HA 4W5UA 1D7HA 3WD2A 3JYMA 1E6RA 1ROTA 2M2AA 4DRPA 2FAPA 2K8IA 3OOBA 1GRJA 3CH9A 3KABA 4ODRA 5DEZA 2PN0A 1D2KA 1Q6UA 4R5EA 2RSEA 5DF0A 4AY1A 5GPGA 4MNLA 3O5EA 4PTMA 3PR9A 1D6OA 2DT0A 4GGQA 2M08A 1U79A 4HBEA 3KAGA 1NWTA 3WIJA 3ARQA 2PV3A 2EULA 3RM4A 1K9TA 3WQVA 4IPXA 3W4RA 1EIBA 4GIVA 5B8IC 2ZR4A 1LL4A 1F40A 1NMWA 3KCEA 1CTNA 1W9VA 1HKIA 4ODPA 1NWSA 2DSWA 4MNMA 1PBKA 1BL4A 2N87A 2A3BA 1F8AB 3PA7A 1SR0A 1EQ3A 2IF4A 2DG4A 1FFRA 2WLYA 5GPRA 1FKRA 3IK8A 3KAIA 3WD0A 1Y0OA 1E6PA 2ZQTA 5J6EA 4DRKA 1W26A 3IHZA 1NWUA 4Z2KA 3O5KA 1FKSA 1JCHB 3UF8A 4Q7NA 4JFMA 4U85A 3ALFA 4FAPA 2OFNA 2KE0A 2O9OA 4NNRA 4ODQA 3RM8A 1TCOC 3KACA 1HJWA 4Z2LA 4NZCA 4W9QA 4Z2JA 2F23A 3TC5A 3KAHA 2DSUA 1FAPA 3AQUA 1ROUA 2KGJA 5BXJA 1JVWA 4U84A 4TW8A 2KI3A 2G41A 3CGMA 3B9AA 3UQBA 1FFQA 1LG2A 3UI6A 3CHDA 3O5IA 5I98A 1D7JA 2XPAA 3GU0A 2G8ZA 1WNOA 2F2DA 4G2PA 3FXYA 4TNSA 1W9PA 1LJYA 4UDMA 3BXWA 2MF9A 1P5QA 2DPEA 3AS2A 3B7XA 3ARRA 2YBUA 2PI6A 1UR8A 3IKDA 4LAXA 2VCDA 1NWRA 1X6NA 3O5LA 1ZCNA 3RM9A 4DWSD 4W9PA 3GPKA 1GUVA 2ZQUA 1FKHA 1H0IA 1JNSA 3KADA 4ODNA 1QPFA 2PV2A 1JNEA 5DITA 1J6YA 1J4IA 2LKNA 3AS3A 4DRHA 1QZ2A 2AOSA 3B9DA 2WM0A 3O5JA 4DH0A 2A3CA 4WKHA 4LAWA 2M1IA 4QIBA 3NTPA 3WD4A 1HKKA 2MLXA 1PINA 2KR7A 4IT4A 2UZ5A 3VAWA 2ITKA 1HJVA 2XP6A 2KO7A 2PBCA 2DSZA 4QT2A 2AWGA 1NSGA 4Z2HA 5HTGA 3AS1A 4IQ2A 1NMVA 1NH6A 4JFLA 3WD1A 1RD6A 1L1PA 3UQIA 4ZPWR 1E6ZA 1LQ0A 2RURA 5HUAA 5HWCA 3B8SA 2B31A 2MPHA 3GTYX 4DWSB 1W1TA 4LGXA 4MGVA 4TYOA 3EY6A 4HBOA 1HKJA 1X6LA 2ZR5A 1KT0A 4ODMA 4R0XA 3H9RB 3AROA 5HT1A 3ARPA 3CGNA 2DT2A 2F4EA 4ODLA 1E6NA 1FKGA 4URIA 1BKFA 2LJ4A 3ARWA 3WKZA 2PPOA 3O5QA 1ZBKA 2WK2A 3PRBA 3G6LA 4P8VA 2LPVA 3BMBA 1ZU8A 5GQBA 4LAVA 3RFWA 4DROA 1ZL1A 5DIVA 4Z2GA 2XP3A 5HW7A 2Q5AA 3ARSA 4IQCA 5DO2A 1ZK6A 1FD9A 4Z2IA 1SYTA 1EHNA 1Q6IA 4DZ3A 4J4NA 2DG3A 3CHCA 1W1VA 5HBFA 1KT1A 1OGBA 3O5DA 4MSPA 1QPLA 4BF8A 4MPKA 2XP5A 3O5GA 4QZVB 3JXVA 4WIWA 4LAYA 3WD3A 1O6IA 2XP4A 3PRDA 1Q6HA 4DWSA 1C9HA 4J4OA 3MDYB 5HKGA 2DG9A 1YATA 5HW8A 1WB0A 2RUCA 4ZPTR 4S3KA 1FKKA 1ITXA 5JH8A 1B6CA 1FJDA 3ARTA 4W9OA 3JYJA 2L2SA 4MNJA 1JNTA 4G50A 5HW6A 1N1AA 3O5RA 1HKMA 3TDBA 1GPFA 2P4VA 2DSVA 1GOIA 2XP8A 2B5UB 1FKJA 2MLZA 4XAKA 1M5YA 4QT3A 4DRJA 1HJXA 4L72B 1R9HA 1EYMA 2MLYA 1D7IA 4DRQA 3WL1A 2KFWA 4DIPA 1E9LA 1FKLA 5HWBA 2VN1A 4KQZA 1FKFA 1JNDA 3O5PA 2RQSA 4S3JA 3I6CA 2Y78A 4DRIA 3ODKA 3WQWA 2ZR6A 3LUOA 1Q1CA 3O5MA 4Q22A 3KZ7A 3QOKA 4L3NA 1LG1A 3G6MA 1UR9A 3O5OA 4O2TA 3TCZA 4U86A 2PV1A 4WJXA 3CHEA 1W9UA 1ZBCA 2D9FA 1E15A 1HXVA 4HARA 4JYSA 1FKIA 4DRMA 1FKDA 3UQAA 2LGOA 1YW5A 4C02B 4NSBA 1KFWA 1TFVA 3IKGA 4JFJA 1T11A 3UI4A 2PPNA 4P8WA 4DWSC 1FKBA 1OWQA 3ARYA 2WLZA 3ALGA 4TW6A 1XRVA 3FAPA 3ARXA 1LL7A 1IX5A 2IUZA 4IT6A 2JZVA 4WK9A 2DT3A 2RUDA 4DT4A 4TX0A 5DIUA 2A3EA 3KAFA 2QF8A 1W1PA 2A3AA 3NI6A 3OA5A 1W1YA 4ITZA 1A7XA 3O5FA 1ZBWA 3ARVA 3EIPA 4TW7A 2F21A 3CZ8A 1J4RA 3FY1A 4P8UA 4MAVA 1WAWA 2XP7A 3B9EA 4ZS6A 4MNKA 3RMEA 3UI5A 2ETNA 4FN2A 1FKTA 4ODKA 2ZQSA 4JFKA 3WH0A 1EDQA 2O92A 2DT1A 3NRKA 4DZ2A 2ZQVA 4DRNA 4JFIA 1ZB5A 4ML4A 1LL6A 2ESCA 2YBTA 1OGGA 4WKFA 4N19A 1H0GA 4KR0B 2MNTA 3CHFA 4P8XA 4WKAA 2XPBA 1VF8A 2PPPA 2XP9A 2RUQA 2OLHA 3PRAA 4ZPVR 1E44A 4ODOA 1ZBVA 5D75A 3ARUA 2FDMA
chains in the Genus database with same CATH topology
3WL0A 2FKEA 1XHGA 3AS0A 3ARZA 4MTVA 3RGCA 1J4HA 4W5UA 1D7HA 3WD2A 3JYMA 1E6RA 1ROTA 2M2AA 4DRPA 2FAPA 2K8IA 3OOBA 3KABA 3CH9A 4ODRA 5DEZA 1D2KA 1Q6UA 4R5EA 2RSEA 5DF0A 4AY1A 5GPGA 4MNLA 3O5EA 4PTMA 3PR9A 1D6OA 2DT0A 4GGQA 2M08A 1U79A 4HBEA 3KAGA 1NWTA 3WIJA 3ARQA 2PV3A 3RM4A 1K9TA 3WQVA 4IPXA 3W4RA 1EIBA 4GIVA 5B8IC 2ZR4A 1LL4A 1F40A 1NMWA 3KCEA 1CTNA 1W9VA 1HKIA 4ODPA 1NWSA 2DSWA 4MNMA 1PBKA 1BL4A 2N87A 2A3BA 1F8AB 3PA7A 1SR0A 1EQ3A 2IF4A 2DG4A 1FFRA 2WLYA 5GPRA 1FKRA 3IK8A 3KAIA 3WD0A 1Y0OA 1E6PA 2ZQTA 5J6EA 4DRKA 1W26A 3IHZA 1NWUA 4Z2KA 3O5KA 1FKSA 3UF8A 4Q7NA 4JFMA 4U85A 3ALFA 4FAPA 2OFNA 2KE0A 2O9OA 4NNRA 4ODQA 3RM8A 1TCOC 3KACA 1HJWA 4Z2LA 4NZCA 4W9QA 4Z2JA 3TC5A 3KAHA 2DSUA 1FAPA 3AQUA 1ROUA 2KGJA 5BXJA 1JVWA 4U84A 4TW8A 2KI3A 2G41A 3CGMA 3B9AA 3UQBA 1FFQA 1LG2A 3UI6A 3CHDA 3O5IA 5I98A 1D7JA 2XPAA 2G8ZA 1WNOA 2F2DA 4G2PA 3FXYA 4TNSA 1W9PA 1LJYA 3BXWA 2MF9A 1P5QA 2DPEA 3AS2A 3B7XA 3ARRA 2YBUA 2PI6A 1UR8A 3IKDA 4LAXA 2VCDA 1NWRA 3O5LA 1X6NA 1ZCNA 3RM9A 4DWSD 4W9PA 3GPKA 1GUVA 2ZQUA 1FKHA 1H0IA 1JNSA 3KADA 4ODNA 1QPFA 2PV2A 1JNEA 5DITA 1J6YA 1J4IA 2LKNA 3AS3A 4DRHA 1QZ2A 2AOSA 3B9DA 2WM0A 3O5JA 4DH0A 2A3CA 4WKHA 4LAWA 2M1IA 4QIBA 3NTPA 3WD4A 1HKKA 2MLXA 1PINA 2KR7A 4IT4A 2UZ5A 3VAWA 2ITKA 1HJVA 2XP6A 2KO7A 2PBCA 2DSZA 4QT2A 2AWGA 1NSGA 4Z2HA 5HTGA 3AS1A 4IQ2A 1NMVA 1NH6A 4JFLA 3WD1A 1RD6A 1L1PA 3UQIA 4ZPWR 1E6ZA 1LQ0A 2RURA 5HUAA 5HWCA 3B8SA 2B31A 2MPHA 4DWSB 1W1TA 4LGXA 4MGVA 4TYOA 3EY6A 4HBOA 1HKJA 1X6LA 2ZR5A 1KT0A 4ODMA 4R0XA 3H9RB 3AROA 5HT1A 3ARPA 3CGNA 2DT2A 2F4EA 4ODLA 1E6NA 1FKGA 4URIA 1BKFA 2LJ4A 3ARWA 3WKZA 2PPOA 3O5QA 1ZBKA 2WK2A 3PRBA 3G6LA 4P8VA 2LPVA 4DROA 1ZU8A 5GQBA 4LAVA 3RFWA 1ZL1A 5DIVA 4Z2GA 2XP3A 5HW7A 2Q5AA 3ARSA 4IQCA 5DO2A 1ZK6A 1FD9A 4Z2IA 1SYTA 1EHNA 1Q6IA 4DZ3A 4J4NA 2DG3A 3CHCA 1W1VA 5HBFA 1KT1A 1OGBA 3O5DA 4MSPA 1QPLA 4BF8A 4MPKA 2XP5A 3O5GA 4QZVB 3JXVA 4WIWA 4LAYA 3WD3A 1O6IA 2XP4A 3PRDA 1Q6HA 4DWSA 1C9HA 4J4OA 3MDYB 5HKGA 2DG9A 1YATA 5HW8A 1WB0A 2RUCA 4ZPTR 4S3KA 1FKKA 1ITXA 5JH8A 1B6CA 1FJDA 3ARTA 4W9OA 3JYJA 2L2SA 4MNJA 1JNTA 4G50A 5HW6A 1N1AA 3O5RA 1HKMA 3TDBA 1GPFA 2DSVA 1GOIA 2XP8A 1FKJA 2MLZA 4XAKA 1M5YA 4QT3A 4DRJA 1HJXA 4L72B 1R9HA 1EYMA 2MLYA 1D7IA 4DRQA 3WL1A 2KFWA 4DIPA 1E9LA 1FKLA 5HWBA 2VN1A 4KQZA 1FKFA 1JNDA 3O5PA 2RQSA 4S3JA 3I6CA 2Y78A 4DRIA 3ODKA 3WQWA 2ZR6A 3LUOA 1Q1CA 3O5MA 4Q22A 3KZ7A 3QOKA 4L3NA 1LG1A 3G6MA 1UR9A 3O5OA 4O2TA 3TCZA 4U86A 2PV1A 4WJXA 3CHEA 1W9UA 1ZBCA 2D9FA 1E15A 1HXVA 4HARA 4JYSA 1FKIA 4DRMA 1FKDA 3UQAA 2LGOA 1YW5A 4C02B 4NSBA 1KFWA 1TFVA 3IKGA 4JFJA 1T11A 3UI4A 2PPNA 4P8WA 4DWSC 1FKBA 1OWQA 3ARYA 2WLZA 3ALGA 4TW6A 1XRVA 3FAPA 3ARXA 1LL7A 1IX5A 2IUZA 4IT6A 2JZVA 4WK9A 2DT3A 2RUDA 4DT4A 4TX0A 5DIUA 2A3EA 3KAFA 2QF8A 1W1PA 2A3AA 3NI6A 3OA5A 1W1YA 4ITZA 1A7XA 3O5FA 1ZBWA 3ARVA 4TW7A 2F21A 3CZ8A 1J4RA 3FY1A 4P8UA 4MAVA 1WAWA 2XP7A 3B9EA 4ZS6A 4MNKA 3RMEA 3UI5A 4FN2A 1FKTA 4ODKA 2ZQSA 4JFKA 3WH0A 1EDQA 2O92A 2DT1A 3NRKA 4DZ2A 2ZQVA 4DRNA 4JFIA 1ZB5A 4ML4A 1LL6A 2ESCA 2YBTA 1OGGA 4WKFA 4N19A 1H0GA 4KR0B 2MNTA 3CHFA 4P8XA 4WKAA 2XPBA 1VF8A 2PPPA 2XP9A 2RUQA 2OLHA 3PRAA 4ZPVR 4ODOA 1ZBVA 5D75A 3ARUA 2FDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI3 A;  2LJ4 A;  2FKE A;  3CGM A;  3RGC A;  4JYS A;  1FKI A;  1J4H A;  3UQB A;  1D7H A;  2PPO A;  1FKD A;  3UI6 A;  3O5I A;  3O5Q A;  4DRM A;  3UQA A;  2LGO A;  3JYM A;  1D7J A;  5I98 A;  1YW5 A;  1ROT A;  2M2A A;  2XPA A;  2FAP A;  2K8I A;  3OOB A;  4C02 B;  4DRP A;  3PRB A;  2F2D A;  4TNS A;  4G2P A;  2LPV A;  3KAB A;  3RFW A;  4DRO A;  4LAV A;  3IKG A;  4JFJ A;  4ODR A;  5DIV A;  2MF9 A;  1P5Q A;  1T11 A;  3UI4 A;  2PPN A;  3B7X A;  2XP3 A;  5HW7 A;  2Q5A A;  1Q6U A;  2RSE A;  1FKB A;  4IQC A;  3IKD A;  5GPG A;  1ZK6 A;  4LAX A;  1FD9 A;  2VCD A;  3O5E A;  4TW6 A;  3FAP A;  3O5L A;  1Q6I A;  1D6O A;  1ZCN A;  4DZ3 A;  4GGQ A;  4W9P A;  2M08 A;  1U79 A;  3GPK A;  2ZQU A;  4J4N A;  2DG3 A;  3KAG A;  1FKH A;  1JNS A;  1KT1 A;  3O5D A;  3KAD A;  4MSP A;  2PV3 A;  4ODN A;  1QPF A;  1QPL A;  2JZV A;  4BF8 A;  4IPX A;  2PV2 A;  5DIT A;  1J6Y A;  1J4I A;  2XP5 A;  2RUD A;  2LKN A;  3O5G A;  4GIV A;  4DT4 A;  4TX0 A;  3JXV A;  5DIU A;  4DRH A;  5B8I C;  4LAY A;  2ZR4 A;  3KAF A;  1QZ2 A;  2XP4 A;  3PRD A;  1F40 A;  1Q6H A;  1C9H A;  1NMW A;  3KCE A;  3MDY B;  3O5J A;  4J4O A;  3NI6 A;  4DH0 A;  2DG9 A;  1YAT A;  5HKG A;  5HW8 A;  1HXV A;  2RUC A;  4LAW A;  4ODP A;  1FKK A;  2M1I A;  4QIB A;  3NTP A;  2MLX A;  1B6C A;  1PIN A;  4ITZ A;  2KR7 A;  3VAW A;  2UZ5 A;  1FJD A;  1A7X A;  1PBK A;  2ITK A;  4W9O A;  3JYJ A;  1BL4 A;  3O5F A;  2XP6 A;  2KO7 A;  2N87 A;  2PBC A;  2L2S A;  1F8A B;  3PA7 A;  4QT2 A;  1JNT A;  2AWG A;  2DG4 A;  2IF4 A;  4TW7 A;  1EQ3 A;  1NSG A;  4G50 A;  2F21 A;  1J4R A;  5HW6 A;  1N1A A;  3IK8 A;  1FKR A;  3KAI A;  3O5R A;  1Y0O A;  5HTG A;  4IQ2 A;  3TDB A;  1NMV A;  2XP7 A;  2ZQT A;  5J6E A;  4DRK A;  1W26 A;  4JFL A;  2XP8 A;  3IHZ A;  1FKJ A;  2MLZ A;  3UI5 A;  1L1P A;  1M5Y A;  4QT3 A;  4DRJ A;  3O5K A;  1FKS A;  1R9H A;  4FN2 A;  1EYM A;  2MLY A;  1D7I A;  1FKT A;  3UF8 A;  4DRQ A;  4ODK A;  2ZQS A;  4JFK A;  2KFW A;  4JFM A;  4U85 A;  3WH0 A;  3UQI A;  4FAP A;  2OFN A;  2KE0 A;  3NRK A;  4NNR A;  4ODQ A;  4DZ2 A;  2RUR A;  2ZQV A;  4JFI A;  1TCO C;  4DRN A;  5HUA A;  5HWC A;  2MPH A;  3KAC A;  4DIP A;  1FKL A;  5HWB A;  2VN1 A;  4W9Q A;  3TC5 A;  1FKF A;  4N19 A;  3KAH A;  4MGV A;  3O5P A;  2RQS A;  4TYO A;  2MNT A;  1FAP A;  3EY6 A;  3I6C A;  2Y78 A;  4DRI A;  3ODK A;  2ZR6 A;  2ZR5 A;  3LUO A;  1Q1C A;  3O5M A;  1ROU A;  1KT0 A;  3KZ7 A;  2KGJ A;  4ODM A;  5BXJ A;  1JVW A;  4R0X A;  2XPB A;  2PPP A;  3O5O A;  3H9R B;  4O2T A;  4U84 A;  3TCZ A;  2XP9 A;  2RUQ A;  4TW8 A;  4U86 A;  5HT1 A;  2PV1 A;  3CGN A;  4ODL A;  2F4E A;  4ODO A;  5D75 A;  1FKG A;  2D9F A;  1BKF A; 
#chains in the Genus database with same CATH topology
 3WL0 A;  2FKE A;  1XHG A;  3AS0 A;  3ARZ A;  4MTV A;  3RGC A;  1J4H A;  4W5U A;  1D7H A;  3WD2 A;  3JYM A;  1E6R A;  1ROT A;  2M2A A;  4DRP A;  2FAP A;  2K8I A;  3OOB A;  1GRJ A;  3CH9 A;  3KAB A;  4ODR A;  5DEZ A;  2PN0 A;  1D2K A;  1Q6U A;  4R5E A;  2RSE A;  5DF0 A;  4AY1 A;  5GPG A;  4MNL A;  3O5E A;  4PTM A;  3PR9 A;  1D6O A;  2DT0 A;  4GGQ A;  2M08 A;  1U79 A;  4HBE A;  3KAG A;  1NWT A;  3WIJ A;  3ARQ A;  2PV3 A;  2EUL A;  3RM4 A;  1K9T A;  3WQV A;  4IPX A;  3W4R A;  1EIB A;  4GIV A;  5B8I C;  2ZR4 A;  1LL4 A;  1F40 A;  1NMW A;  3KCE A;  1CTN A;  1W9V A;  1HKI A;  4ODP A;  1NWS A;  2DSW A;  4MNM A;  1PBK A;  1BL4 A;  2N87 A;  2A3B A;  1F8A B;  3PA7 A;  1SR0 A;  1EQ3 A;  2IF4 A;  2DG4 A;  1FFR A;  2WLY A;  5GPR A;  1FKR A;  3IK8 A;  3KAI A;  3WD0 A;  1Y0O A;  1E6P A;  2ZQT A;  5J6E A;  4DRK A;  1W26 A;  3IHZ A;  1NWU A;  4Z2K A;  3O5K A;  1FKS A;  1JCH B;  3UF8 A;  4Q7N A;  4JFM A;  4U85 A;  3ALF A;  4FAP A;  2OFN A;  2KE0 A;  2O9O A;  4NNR A;  4ODQ A;  3RM8 A;  1TCO C;  3KAC A;  1HJW A;  4Z2L A;  4NZC A;  4W9Q A;  4Z2J A;  2F23 A;  3TC5 A;  3KAH A;  2DSU A;  1FAP A;  3AQU A;  1ROU A;  2KGJ A;  5BXJ A;  1JVW A;  4U84 A;  4TW8 A;  2KI3 A;  2G41 A;  3CGM A;  3B9A A;  3UQB A;  1FFQ A;  1LG2 A;  3UI6 A;  3CHD A;  3O5I A;  5I98 A;  1D7J A;  2XPA A;  3GU0 A;  2G8Z A;  1WNO A;  2F2D A;  4G2P A;  3FXY A;  4TNS A;  1W9P A;  1LJY A;  4UDM A;  3BXW A;  2MF9 A;  1P5Q A;  2DPE A;  3AS2 A;  3B7X A;  3ARR A;  2YBU A;  2PI6 A;  1UR8 A;  3IKD A;  4LAX A;  2VCD A;  1NWR A;  1X6N A;  3O5L A;  1ZCN A;  3RM9 A;  4DWS D;  4W9P A;  3GPK A;  1GUV A;  2ZQU A;  1FKH A;  1H0I A;  1JNS A;  3KAD A;  4ODN A;  1QPF A;  2PV2 A;  1JNE A;  5DIT A;  1J6Y A;  1J4I A;  2LKN A;  3AS3 A;  4DRH A;  1QZ2 A;  2AOS A;  3B9D A;  2WM0 A;  3O5J A;  4DH0 A;  2A3C A;  4WKH A;  4LAW A;  2M1I A;  4QIB A;  3NTP A;  3WD4 A;  1HKK A;  2MLX A;  1PIN A;  2KR7 A;  4IT4 A;  2UZ5 A;  3VAW A;  2ITK A;  1HJV A;  2XP6 A;  2KO7 A;  2PBC A;  2DSZ A;  4QT2 A;  2AWG A;  1NSG A;  4Z2H A;  5HTG A;  3AS1 A;  4IQ2 A;  1NMV A;  1NH6 A;  4JFL A;  3WD1 A;  1RD6 A;  1L1P A;  3UQI A;  4ZPW R;  1E6Z A;  1LQ0 A;  2RUR A;  5HUA A;  5HWC A;  3B8S A;  2B31 A;  2MPH A;  3GTY X;  4DWS B;  1W1T A;  4LGX A;  4MGV A;  4TYO A;  3EY6 A;  4HBO A;  1HKJ A;  1X6L A;  2ZR5 A;  1KT0 A;  4ODM A;  4R0X A;  3H9R B;  3ARO A;  5HT1 A;  3ARP A;  3CGN A;  2DT2 A;  2F4E A;  4ODL A;  1E6N A;  1FKG A;  4URI A;  1BKF A;  2LJ4 A;  3ARW A;  3WKZ A;  2PPO A;  3O5Q A;  1ZBK A;  2WK2 A;  3PRB A;  3G6L A;  4P8V A;  2LPV A;  3BMB A;  1ZU8 A;  5GQB A;  4LAV A;  3RFW A;  4DRO A;  1ZL1 A;  5DIV A;  4Z2G A;  2XP3 A;  5HW7 A;  2Q5A A;  3ARS A;  4IQC A;  5DO2 A;  1ZK6 A;  1FD9 A;  4Z2I A;  1SYT A;  1EHN A;  1Q6I A;  4DZ3 A;  4J4N A;  2DG3 A;  3CHC A;  1W1V A;  5HBF A;  1KT1 A;  1OGB A;  3O5D A;  4MSP A;  1QPL A;  4BF8 A;  4MPK A;  2XP5 A;  3O5G A;  4QZV B;  3JXV A;  4WIW A;  4LAY A;  3WD3 A;  1O6I A;  2XP4 A;  3PRD A;  1Q6H A;  4DWS A;  1C9H A;  4J4O A;  3MDY B;  5HKG A;  2DG9 A;  1YAT A;  5HW8 A;  1WB0 A;  2RUC A;  4ZPT R;  4S3K A;  1FKK A;  1ITX A;  5JH8 A;  1B6C A;  1FJD A;  3ART A;  4W9O A;  3JYJ A;  2L2S A;  4MNJ A;  1JNT A;  4G50 A;  5HW6 A;  1N1A A;  3O5R A;  1HKM A;  3TDB A;  1GPF A;  2P4V A;  2DSV A;  1GOI A;  2XP8 A;  2B5U B;  1FKJ A;  2MLZ A;  4XAK A;  1M5Y A;  4QT3 A;  4DRJ A;  1HJX A;  4L72 B;  1R9H A;  1EYM A;  2MLY A;  1D7I A;  4DRQ A;  3WL1 A;  2KFW A;  4DIP A;  1E9L A;  1FKL A;  5HWB A;  2VN1 A;  4KQZ A;  1FKF A;  1JND A;  3O5P A;  2RQS A;  4S3J A;  3I6C A;  2Y78 A;  4DRI A;  3ODK A;  3WQW A;  2ZR6 A;  3LUO A;  1Q1C A;  3O5M A;  4Q22 A;  3KZ7 A;  3QOK A;  4L3N A;  1LG1 A;  3G6M A;  1UR9 A;  3O5O A;  4O2T A;  3TCZ A;  4U86 A;  2PV1 A;  4WJX A;  3CHE A;  1W9U A;  1ZBC A;  2D9F A;  1E15 A;  1HXV A;  4HAR A;  4JYS A;  1FKI A;  4DRM A;  1FKD A;  3UQA A;  2LGO A;  1YW5 A;  4C02 B;  4NSB A;  1KFW A;  1TFV A;  3IKG A;  4JFJ A;  1T11 A;  3UI4 A;  2PPN A;  4P8W A;  4DWS C;  1FKB A;  1OWQ A;  3ARY A;  2WLZ A;  3ALG A;  4TW6 A;  1XRV A;  3FAP A;  3ARX A;  1LL7 A;  1IX5 A;  2IUZ A;  4IT6 A;  2JZV A;  4WK9 A;  2DT3 A;  2RUD A;  4DT4 A;  4TX0 A;  5DIU A;  2A3E A;  3KAF A;  2QF8 A;  1W1P A;  2A3A A;  3NI6 A;  3OA5 A;  1W1Y A;  4ITZ A;  1A7X A;  3O5F A;  1ZBW A;  3ARV A;  3EIP A;  4TW7 A;  2F21 A;  3CZ8 A;  1J4R A;  3FY1 A;  4P8U A;  4MAV A;  1WAW A;  2XP7 A;  3B9E A;  4ZS6 A;  4MNK A;  3RME A;  3UI5 A;  2ETN A;  4FN2 A;  1FKT A;  4ODK A;  2ZQS A;  4JFK A;  3WH0 A;  1EDQ A;  2O92 A;  2DT1 A;  3NRK A;  4DZ2 A;  2ZQV A;  4DRN A;  4JFI A;  1ZB5 A;  4ML4 A;  1LL6 A;  2ESC A;  2YBT A;  1OGG A;  4WKF A;  4N19 A;  1H0G A;  4KR0 B;  2MNT A;  3CHF A;  4P8X A;  4WKA A;  2XPB A;  1VF8 A;  2PPP A;  2XP9 A;  2RUQ A;  2OLH A;  3PRA A;  4ZPV R;  1E44 A;  4ODO A;  1ZBV A;  5D75 A;  3ARU A;  2FDM A; 
#chains in the Genus database with same CATH homology
 3WL0 A;  2FKE A;  1XHG A;  3AS0 A;  3ARZ A;  4MTV A;  3RGC A;  1J4H A;  4W5U A;  1D7H A;  3WD2 A;  3JYM A;  1E6R A;  1ROT A;  2M2A A;  4DRP A;  2FAP A;  2K8I A;  3OOB A;  3KAB A;  3CH9 A;  4ODR A;  5DEZ A;  1D2K A;  1Q6U A;  4R5E A;  2RSE A;  5DF0 A;  4AY1 A;  5GPG A;  4MNL A;  3O5E A;  4PTM A;  3PR9 A;  1D6O A;  2DT0 A;  4GGQ A;  2M08 A;  1U79 A;  4HBE A;  3KAG A;  1NWT A;  3WIJ A;  3ARQ A;  2PV3 A;  3RM4 A;  1K9T A;  3WQV A;  4IPX A;  3W4R A;  1EIB A;  4GIV A;  5B8I C;  2ZR4 A;  1LL4 A;  1F40 A;  1NMW A;  3KCE A;  1CTN A;  1W9V A;  1HKI A;  4ODP A;  1NWS A;  2DSW A;  4MNM A;  1PBK A;  1BL4 A;  2N87 A;  2A3B A;  1F8A B;  3PA7 A;  1SR0 A;  1EQ3 A;  2IF4 A;  2DG4 A;  1FFR A;  2WLY A;  5GPR A;  1FKR A;  3IK8 A;  3KAI A;  3WD0 A;  1Y0O A;  1E6P A;  2ZQT A;  5J6E A;  4DRK A;  1W26 A;  3IHZ A;  1NWU A;  4Z2K A;  3O5K A;  1FKS A;  3UF8 A;  4Q7N A;  4JFM A;  4U85 A;  3ALF A;  4FAP A;  2OFN A;  2KE0 A;  2O9O A;  4NNR A;  4ODQ A;  3RM8 A;  1TCO C;  3KAC A;  1HJW A;  4Z2L A;  4NZC A;  4W9Q A;  4Z2J A;  3TC5 A;  3KAH A;  2DSU A;  1FAP A;  3AQU A;  1ROU A;  2KGJ A;  5BXJ A;  1JVW A;  4U84 A;  4TW8 A;  2KI3 A;  2G41 A;  3CGM A;  3B9A A;  3UQB A;  1FFQ A;  1LG2 A;  3UI6 A;  3CHD A;  3O5I A;  5I98 A;  1D7J A;  2XPA A;  2G8Z A;  1WNO A;  2F2D A;  4G2P A;  3FXY A;  4TNS A;  1W9P A;  1LJY A;  3BXW A;  2MF9 A;  1P5Q A;  2DPE A;  3AS2 A;  3B7X A;  3ARR A;  2YBU A;  2PI6 A;  1UR8 A;  3IKD A;  4LAX A;  2VCD A;  1NWR A;  3O5L A;  1X6N A;  1ZCN A;  3RM9 A;  4DWS D;  4W9P A;  3GPK A;  1GUV A;  2ZQU A;  1FKH A;  1H0I A;  1JNS A;  3KAD A;  4ODN A;  1QPF A;  2PV2 A;  1JNE A;  5DIT A;  1J6Y A;  1J4I A;  2LKN A;  3AS3 A;  4DRH A;  1QZ2 A;  2AOS A;  3B9D A;  2WM0 A;  3O5J A;  4DH0 A;  2A3C A;  4WKH A;  4LAW A;  2M1I A;  4QIB A;  3NTP A;  3WD4 A;  1HKK A;  2MLX A;  1PIN A;  2KR7 A;  4IT4 A;  2UZ5 A;  3VAW A;  2ITK A;  1HJV A;  2XP6 A;  2KO7 A;  2PBC A;  2DSZ A;  4QT2 A;  2AWG A;  1NSG A;  4Z2H A;  5HTG A;  3AS1 A;  4IQ2 A;  1NMV A;  1NH6 A;  4JFL A;  3WD1 A;  1RD6 A;  1L1P A;  3UQI A;  4ZPW R;  1E6Z A;  1LQ0 A;  2RUR A;  5HUA A;  5HWC A;  3B8S A;  2B31 A;  2MPH A;  4DWS B;  1W1T A;  4LGX A;  4MGV A;  4TYO A;  3EY6 A;  4HBO A;  1HKJ A;  1X6L A;  2ZR5 A;  1KT0 A;  4ODM A;  4R0X A;  3H9R B;  3ARO A;  5HT1 A;  3ARP A;  3CGN A;  2DT2 A;  2F4E A;  4ODL A;  1E6N A;  1FKG A;  4URI A;  1BKF A;  2LJ4 A;  3ARW A;  3WKZ A;  2PPO A;  3O5Q A;  1ZBK A;  2WK2 A;  3PRB A;  3G6L A;  4P8V A;  2LPV A;  4DRO A;  1ZU8 A;  5GQB A;  4LAV A;  3RFW A;  1ZL1 A;  5DIV A;  4Z2G A;  2XP3 A;  5HW7 A;  2Q5A A;  3ARS A;  4IQC A;  5DO2 A;  1ZK6 A;  1FD9 A;  4Z2I A;  1SYT A;  1EHN A;  1Q6I A;  4DZ3 A;  4J4N A;  2DG3 A;  3CHC A;  1W1V A;  5HBF A;  1KT1 A;  1OGB A;  3O5D A;  4MSP A;  1QPL A;  4BF8 A;  4MPK A;  2XP5 A;  3O5G A;  4QZV B;  3JXV A;  4WIW A;  4LAY A;  3WD3 A;  1O6I A;  2XP4 A;  3PRD A;  1Q6H A;  4DWS A;  1C9H A;  4J4O A;  3MDY B;  5HKG A;  2DG9 A;  1YAT A;  5HW8 A;  1WB0 A;  2RUC A;  4ZPT R;  4S3K A;  1FKK A;  1ITX A;  5JH8 A;  1B6C A;  1FJD A;  3ART A;  4W9O A;  3JYJ A;  2L2S A;  4MNJ A;  1JNT A;  4G50 A;  5HW6 A;  1N1A A;  3O5R A;  1HKM A;  3TDB A;  1GPF A;  2DSV A;  1GOI A;  2XP8 A;  1FKJ A;  2MLZ A;  4XAK A;  1M5Y A;  4QT3 A;  4DRJ A;  1HJX A;  4L72 B;  1R9H A;  1EYM A;  2MLY A;  1D7I A;  4DRQ A;  3WL1 A;  2KFW A;  4DIP A;  1E9L A;  1FKL A;  5HWB A;  2VN1 A;  4KQZ A;  1FKF A;  1JND A;  3O5P A;  2RQS A;  4S3J A;  3I6C A;  2Y78 A;  4DRI A;  3ODK A;  3WQW A;  2ZR6 A;  3LUO A;  1Q1C A;  3O5M A;  4Q22 A;  3KZ7 A;  3QOK A;  4L3N A;  1LG1 A;  3G6M A;  1UR9 A;  3O5O A;  4O2T A;  3TCZ A;  4U86 A;  2PV1 A;  4WJX A;  3CHE A;  1W9U A;  1ZBC A;  2D9F A;  1E15 A;  1HXV A;  4HAR A;  4JYS A;  1FKI A;  4DRM A;  1FKD A;  3UQA A;  2LGO A;  1YW5 A;  4C02 B;  4NSB A;  1KFW A;  1TFV A;  3IKG A;  4JFJ A;  1T11 A;  3UI4 A;  2PPN A;  4P8W A;  4DWS C;  1FKB A;  1OWQ A;  3ARY A;  2WLZ A;  3ALG A;  4TW6 A;  1XRV A;  3FAP A;  3ARX A;  1LL7 A;  1IX5 A;  2IUZ A;  4IT6 A;  2JZV A;  4WK9 A;  2DT3 A;  2RUD A;  4DT4 A;  4TX0 A;  5DIU A;  2A3E A;  3KAF A;  2QF8 A;  1W1P A;  2A3A A;  3NI6 A;  3OA5 A;  1W1Y A;  4ITZ A;  1A7X A;  3O5F A;  1ZBW A;  3ARV A;  4TW7 A;  2F21 A;  3CZ8 A;  1J4R A;  3FY1 A;  4P8U A;  4MAV A;  1WAW A;  2XP7 A;  3B9E A;  4ZS6 A;  4MNK A;  3RME A;  3UI5 A;  4FN2 A;  1FKT A;  4ODK A;  2ZQS A;  4JFK A;  3WH0 A;  1EDQ A;  2O92 A;  2DT1 A;  3NRK A;  4DZ2 A;  2ZQV A;  4DRN A;  4JFI A;  1ZB5 A;  4ML4 A;  1LL6 A;  2ESC A;  2YBT A;  1OGG A;  4WKF A;  4N19 A;  1H0G A;  4KR0 B;  2MNT A;  3CHF A;  4P8X A;  4WKA A;  2XPB A;  1VF8 A;  2PPP A;  2XP9 A;  2RUQ A;  2OLH A;  3PRA A;  4ZPV R;  4ODO A;  1ZBV A;  5D75 A;  3ARU A;  2FDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...