4ODMA

Structure of slyd from thermus thermophilus in complex with s2-w23a peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
total genus 33
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odmA00
3H9RB 3JYJA 3O5GA 1ZCNA 2XP9A 3ODKA 3O5MA 4TYOA 1FKLA 1FKSA 3KAHA 1FKTA 2D9FA 2FAPA 4J4NA 4IQ2A 2Q5AA 1FKHA 2KI3A 2XP3A 4ODNA 3KZ7A 2M1IA 4IQCA 1QPFA 5HKGA 1P5QA 2DG4A 3PRDA 2RUQA 1B6CA 1D7IA 1JNTA 3KABA 2UZ5A 3JXVA 3NRKA 1L1PA 3IKDA 1YATA 2ZQTA 3O5EA 3VAWA 5BXJA 1F8AB 2DG3A 2N87A 5HTGA 2LKNA 1FD9A 2XP7A 4DH0A 4JFJA 3IHZA 4TW6A 3LUOA 3PA7A 4G2PA 4JYSA 4NNRA 3O5OA 3B7XA 4G50A 1F40A 3KADA 2Y78A 3NTPA 4C02B 1J4HA 4GIVA 4DIPA 1EYMA 5HT1A 4ODMA 5DITA 5B8IC 3O5DA 4JFLA 1HXVA 2KO7A 1YW5A 1Q6IA 2K8IA 2PV2A 2MF9A 4ODPA 2LGOA 3KACA 3KCEA 4QT3A 4DRHA 1BKFA 4DZ2A 1KT0A 2ZQUA 4TW8A 5HWCA 2XP4A 3UI4A 3O5QA 4ODRA 5GPGA 3UF8A 1QZ2A 2PV1A 4TX0A 3JYMA 3UQBA 1Y0OA 4BF8A 1FKKA 1J4IA 3WH0A 1D7JA 3CGMA 3I6CA 2MLZA 1TCOC 4JFMA 2ZR5A 3PRBA 2RURA 2ZQVA 1C9HA 1PBKA 2PPPA 3KAGA 4W9PA 4J4OA 4FAPA 4U84A 2M08A 4JFIA 3O5PA 4ODKA 4TW7A 3TDBA 1T11A 2KGJA 2ZQSA 1FKRA 4DRQA 2ZR6A 4LAWA 1NMWA 2F4EA 1FKBA 3O5RA 4ITZA 2VN1A 2DG9A 3UQAA 4DRMA 2AWGA 3RFWA 4DRJA 3GPKA 1D7HA 4ODQA 2RSEA 1PINA 2FKEA 2OFNA 4W9OA 2PV3A 3IK8A 1FAPA 4DRKA 2LPVA 1W26A 4IPXA 3O5KA 5I98A 2M2AA 1FKIA 1Q6UA 1R9HA 2RQSA 3FAPA 3OOBA 4W9QA 5J6EA 1FKFA 1NMVA 3MDYB 4U86A 1JNSA 5HW6A 5HW7A 3UQIA 4DT4A 4GGQA 4U85A 4QIBA 1NSGA 2VCDA 3UI5A 2LJ4A 4MSPA 1QPLA 2KR7A 4N19A 3NI6A 4DRPA 2ZR4A 3TCZA 5D75A 2L2SA 4LAVA 3UI6A 4QT2A 2XP5A 1U79A 2MLXA 1KT1A 3KAFA 3O5FA 4O2TA 2JZVA 2KE0A 4DRNA 5HWBA 1JVWA 2XP8A 2MPHA 4DRIA 4LAYA 4ODOA 2RUCA 2XPAA 2MLYA 1FJDA 3O5LA 1Q1CA 4JFKA 5HUAA 2KFWA 4ODLA 4TNSA 2PBCA 1FKJA 1FKGA 4DZ3A 1J6YA 1EQ3A 3EY6A 4FN2A 1BL4A 2IF4A 3TC5A 4LAXA 5DIUA 3O5JA 5DIVA 1N1AA 1FKDA 1ROUA 3KAIA 4MGVA 2MNTA 4R0XA 3O5IA 1J4RA 1Q6HA 2F21A 3RGCA 2XPBA 2F2DA 3IKGA 1ZK6A 2RUDA 1D6OA 3CGNA 2ITKA 5HW8A 2XP6A 1A7XA 4DROA 2PPNA 1M5YA 1ROTA 2PPOA
chains in the Genus database with same CATH superfamily
3H9RB 4TYOA 1FKLA 4Q22A 3KAHA 2B31A 2D9FA 4IQ2A 2Q5AA 1CTNA 1QPFA 3PRDA 1D7IA 3IKDA 1OGBA 2ZQTA 3O5EA 1JNEA 3VAWA 2O9OA 1FD9A 3ARZA 1TFVA 3WKZA 1NWRA 4Z2LA 1J4HA 1LJYA 4ODMA 1HXVA 4JFLA 1YW5A 5JH8A 2PV2A 3FXYA 2DSVA 3KCEA 4DRHA 1E6PA 3CH9A 2XP4A 3UI4A 1H0GA 4Z2HA 1LL4A 1QZ2A 1W1PA 4TX0A 3WH0A 1J4IA 3AROA 1OGGA 2RURA 1UR8A 3RM9A 2B5UB 4DWSD 2PPPA 4ZPTR 4W9PA 4JFIA 3O5PA 3TDBA 2FDMA 2F4EA 4MNJA 3CHCA 4XAKA 1HKIA 2G41A 3CHFA 3GPKA 2DSZA 1HKMA 4LGXA 1E9LA 2RSEA 2OFNA 3RMEA 3IK8A 2QF8A 5J6EA 3OOBA 4W9QA 3MDYB 4U86A 5HW6A 3UQIA 4DT4A 1LL6A 2VCDA 4P8WA 4MSPA 1QPLA 2ESCA 2ZR4A 1EDQA 4WIWA 2XP5A 3GU0A 1W9VA 2KE0A 1IX5A 1JVWA 3WD0A 4Q7NA 2MPHA 4NSBA 2XPAA 1LG2A 1M5YA 1O6IA 3O5LA 4JFKA 1HKJA 2DPEA 2KFWA 2DT0A 2PBCA 1ZBCA 3EY6A 1ROUA 3KAIA 2MNTA 1Q6HA 3GTYX 2XPBA 2F2DA 2DT2A 2RUDA 3CGNA 4MPKA 2ITKA 1NH6A 2XP6A 1A7XA 3BXWA 3ARRA 3O5GA 2XP9A 3O5MA 3WIJA 1ZBWA 2FAPA 4J4NA 4HBOA 2XP3A 3OA5A 1GPFA 2RUQA 1B6CA 3NRKA 3JXVA 1W1TA 1WAWA 1F8AB 3ALFA 2N87A 4P8XA 2IUZA 3IHZA 1OWQA 3LUOA 3PA7A 4NNRA 3O5OA 3B7XA 1W9UA 1NWTA 2YBTA 4C02B 4MAVA 1EYMA 5HT1A 5DITA 2KO7A 2K8IA 1D2KA 3KACA 4WKAA 4DWSC 4ODRA 5GPGA 2AOSA 2PV1A 1NWSA 1W1YA 1TCOC 4W5UA 5DEZA 4IT6A 1X6NA 1EIBA 4J4OA 4FAPA 1XHGA 4Z2IA 4TW7A 1FKRA 1ZBKA 5GPRA 1FKBA 1H0IA 2DG9A 2P4VA 3UQAA 1ZBVA 2AWGA 5HBFA 4DRJA 3W4RA 1PINA 4W9OA 4L3NA 1FAPA 4P8UA 1NWUA 1W26A 5I98A 3O5KA 4ZS6A 1FKIA 1R9HA 2DT3A 4S3JA 1FKFA 1LL7A 1NSGA 4MNMA 4S3KA 4N19A 3TCZA 4LAVA 1FFRA 1VF8A 3UI6A 1U79A 1HJXA 3O5FA 4O2TA 3AS1A 5HWBA 1HJWA 4QZVB 4LAYA 2RUCA 4Z2KA 4Z2JA 3AQUA 2DT1A 1W1VA 1Q1CA 4ML4A 1SR0A 3PR9A 4DZ3A 2EULA 5DIUA 1N1AA 2WM0A 1W9PA 4MGVA 4WKHA 4URIA 4KQZA 3IKGA 3ARQA 1JCHB 1D6OA 2G8ZA 1ZU8A 3WQVA 3JYJA 3ARVA 1FKSA 1FKHA 2KI3A 3KZ7A 2M1IA 4IQCA 3ARSA 2YBUA 4ZPWR 5HTGA 5BXJA 2DG3A 2LKNA 3ARXA 2XP7A 4DH0A 4TW6A 4G2PA 4JYSA 3ALGA 3KADA 2Y78A 3ARWA 3NTPA 4GIVA 2WLZA 5B8IC 3O5DA 3CHEA 2F23A 3PRAA 2LGOA 1RD6A 1BKFA 4UDMA 4DZ2A 2ZQUA 4WK9A 3O5QA 4R5EA 3UF8A 2WK2A 4P8VA 3ARTA 1Y0OA 3ARYA 3CGMA 3B9DA 4JFMA 1E6NA 3PRBA 4MNLA 3WD4A 2ZQVA 2ETNA 1PBKA 1ZL1A 4U84A 2M08A 1LG1A 4ODKA 1T11A 2ZR6A 4ITZA 2VN1A 3AS0A 3RFWA 2DSUA 1GRJA 3RM4A 2FKEA 2PV3A 4DRKA 2LPVA 3CHDA 4IPXA 2M2AA 5GQBA 1Q6UA 3FAPA 1E6RA 1UR9A 4GGQA 4QIBA 3ARUA 1K9TA 2LJ4A 2PI6A 4QT2A 2MLXA 2WLYA 2JZVA 4DRNA 2XP8A 4IT4A 4DRIA 4ODOA 1FJDA 4PTMA 1ITXA 1GOIA 1LQ0A 1FFQA 4TNSA 1J6YA 1EQ3A 3AS2A 1BL4A 3O5JA 5DIVA 1E44A 4HARA 4ZPVR 4DWSB 3O5IA 2DSWA 1J4RA 2F21A 3RGCA 3FY1A 5HW8A 1GUVA 4DROA 4MTVA 2PPNA 3B9EA 3CZ8A 1ZCNA 3ODKA 1HJVA 1FKTA 1JNDA 4ODNA 4L72B 5HKGA 1HKKA 1P5QA 2DG4A 1JNTA 3KABA 2UZ5A 3WD1A 1L1PA 1EHNA 4KR0B 1YATA 3ARPA 3WD2A 1WNOA 4JFJA 1XRVA 4G50A 1F40A 4DIPA 1Q6IA 2A3CA 4ODPA 2MF9A 3RM8A 4QT3A 5DF0A 1KT0A 5HWCA 4TW8A 3WL1A 3EIPA 2A3BA 3UQBA 3JYMA 4BF8A 1FKKA 1D7JA 3I6CA 3BMBA 2MLZA 2ZR5A 3B8SA 1C9HA 3KAGA 2A3AA 2O92A 2KGJA 2ZQSA 4MNKA 4WKFA 3WD3A 4DRQA 4LAWA 1NMWA 3O5RA 4HBEA 3B9AA 4DRMA 3WL0A 1D7HA 4ODQA 1E6ZA 3AS3A 4DWSA 2RQSA 1KFWA 1JNSA 1NMVA 5HW7A 3G6MA 4U85A 3UI5A 2OLHA 2KR7A 4DRPA 3NI6A 5D75A 1X6LA 2L2SA 4Z2GA 3KAFA 3QOKA 1KT1A 1WB0A 1ZB5A 4NZCA 2MLYA 2A3EA 5DO2A 2PN0A 5HUAA 4WJXA 4ODLA 1FKJA 1FKGA 3G6LA 4FN2A 3TC5A 2IF4A 4LAXA 1SYTA 4AY1A 1FKDA 4R0XA 3WQWA 1ZK6A 1E15A 1ROTA 2PPOA
chains in the Genus database with same CATH topology
3H9RB 4TYOA 1FKLA 4Q22A 3KAHA 2B31A 2D9FA 4IQ2A 2Q5AA 1CTNA 1QPFA 3PRDA 1D7IA 3IKDA 1OGBA 2ZQTA 3O5EA 1JNEA 3VAWA 2O9OA 1FD9A 3ARZA 1TFVA 3WKZA 1NWRA 4Z2LA 1J4HA 1LJYA 4ODMA 1HXVA 4JFLA 1YW5A 5JH8A 2PV2A 3FXYA 2DSVA 3KCEA 4DRHA 1E6PA 3CH9A 2XP4A 3UI4A 1H0GA 4Z2HA 1LL4A 1QZ2A 1W1PA 4TX0A 3WH0A 1J4IA 3AROA 1OGGA 2RURA 1UR8A 3RM9A 4DWSD 2PPPA 4ZPTR 4W9PA 4JFIA 3O5PA 3TDBA 2FDMA 2F4EA 4MNJA 3CHCA 4XAKA 1HKIA 2G41A 3CHFA 3GPKA 2DSZA 1HKMA 4LGXA 1E9LA 2RSEA 2OFNA 3RMEA 3IK8A 2QF8A 5J6EA 3OOBA 4W9QA 3MDYB 4U86A 5HW6A 3UQIA 4DT4A 1LL6A 2VCDA 4P8WA 4MSPA 1QPLA 2ESCA 2ZR4A 1EDQA 4WIWA 2XP5A 1W9VA 2KE0A 1IX5A 1JVWA 3WD0A 4Q7NA 2MPHA 4NSBA 2XPAA 1LG2A 1M5YA 1O6IA 3O5LA 4JFKA 1HKJA 2DPEA 2KFWA 2DT0A 2PBCA 1ZBCA 3EY6A 1ROUA 3KAIA 2MNTA 1Q6HA 2XPBA 2F2DA 2DT2A 2RUDA 3CGNA 4MPKA 2ITKA 1NH6A 2XP6A 1A7XA 3BXWA 3ARRA 3O5GA 2XP9A 3O5MA 3WIJA 1ZBWA 2FAPA 4J4NA 4HBOA 2XP3A 3OA5A 1GPFA 2RUQA 1B6CA 3NRKA 3JXVA 1W1TA 1WAWA 1F8AB 3ALFA 2N87A 4P8XA 2IUZA 3IHZA 1OWQA 3LUOA 3PA7A 4NNRA 3O5OA 3B7XA 1W9UA 1NWTA 2YBTA 4C02B 4MAVA 1EYMA 5HT1A 5DITA 2KO7A 2K8IA 1D2KA 3KACA 4WKAA 4DWSC 4ODRA 5GPGA 2AOSA 2PV1A 1NWSA 1W1YA 1TCOC 4W5UA 5DEZA 4IT6A 1X6NA 1EIBA 4J4OA 4FAPA 1XHGA 4Z2IA 4TW7A 1FKRA 1ZBKA 5GPRA 1FKBA 1H0IA 2DG9A 3UQAA 1ZBVA 2AWGA 5HBFA 4DRJA 3W4RA 1PINA 4W9OA 4L3NA 1FAPA 4P8UA 1NWUA 1W26A 5I98A 3O5KA 4ZS6A 1FKIA 1R9HA 2DT3A 4S3JA 1FKFA 1LL7A 1NSGA 4MNMA 4S3KA 4N19A 3TCZA 4LAVA 1FFRA 1VF8A 3UI6A 1U79A 1HJXA 3O5FA 4O2TA 3AS1A 5HWBA 1HJWA 4QZVB 4LAYA 2RUCA 4Z2KA 4Z2JA 3AQUA 2DT1A 1W1VA 1Q1CA 4ML4A 1SR0A 3PR9A 4DZ3A 5DIUA 1N1AA 2WM0A 1W9PA 4MGVA 4WKHA 4URIA 4KQZA 3IKGA 3ARQA 1D6OA 2G8ZA 1ZU8A 3WQVA 3JYJA 3ARVA 1FKSA 1FKHA 2KI3A 3KZ7A 2M1IA 4IQCA 3ARSA 2YBUA 4ZPWR 5HTGA 5BXJA 2DG3A 2LKNA 3ARXA 2XP7A 4DH0A 4TW6A 4G2PA 4JYSA 3ALGA 3KADA 2Y78A 3ARWA 3NTPA 4GIVA 2WLZA 5B8IC 3O5DA 3CHEA 3PRAA 2LGOA 1RD6A 1BKFA 4DZ2A 2ZQUA 4WK9A 3O5QA 4R5EA 3UF8A 2WK2A 4P8VA 3ARTA 1Y0OA 3ARYA 3CGMA 3B9DA 4JFMA 1E6NA 3PRBA 4MNLA 3WD4A 2ZQVA 1PBKA 1ZL1A 4U84A 2M08A 1LG1A 4ODKA 1T11A 2ZR6A 4ITZA 2VN1A 3AS0A 3RFWA 2DSUA 3RM4A 2FKEA 2PV3A 4DRKA 2LPVA 3CHDA 4IPXA 2M2AA 5GQBA 1Q6UA 3FAPA 1E6RA 1UR9A 4GGQA 4QIBA 3ARUA 1K9TA 2LJ4A 2PI6A 4QT2A 2MLXA 2WLYA 2JZVA 4DRNA 2XP8A 4IT4A 4DRIA 4ODOA 1FJDA 4PTMA 1ITXA 1GOIA 1LQ0A 1FFQA 4TNSA 1J6YA 1EQ3A 3AS2A 1BL4A 3O5JA 5DIVA 4HARA 4ZPVR 4DWSB 3O5IA 2DSWA 1J4RA 2F21A 3RGCA 3FY1A 5HW8A 1GUVA 4DROA 4MTVA 2PPNA 3B9EA 3CZ8A 1ZCNA 3ODKA 1HJVA 1FKTA 1JNDA 4ODNA 4L72B 5HKGA 1HKKA 1P5QA 2DG4A 1JNTA 3KABA 2UZ5A 3WD1A 1L1PA 1EHNA 4KR0B 1YATA 3ARPA 3WD2A 1WNOA 4JFJA 1XRVA 4G50A 1F40A 4DIPA 1Q6IA 2A3CA 4ODPA 2MF9A 3RM8A 4QT3A 5DF0A 1KT0A 5HWCA 4TW8A 3WL1A 2A3BA 3UQBA 3JYMA 4BF8A 1FKKA 1D7JA 3I6CA 2MLZA 2ZR5A 3B8SA 1C9HA 3KAGA 2A3AA 2O92A 2KGJA 2ZQSA 4MNKA 4WKFA 3WD3A 4DRQA 4LAWA 1NMWA 3O5RA 4HBEA 3B9AA 4DRMA 3WL0A 1D7HA 4ODQA 1E6ZA 3AS3A 4DWSA 2RQSA 1KFWA 1JNSA 1NMVA 5HW7A 3G6MA 4U85A 3UI5A 2OLHA 2KR7A 4DRPA 3NI6A 5D75A 1X6LA 2L2SA 4Z2GA 3KAFA 3QOKA 1KT1A 1WB0A 1ZB5A 4NZCA 2MLYA 2A3EA 5DO2A 5HUAA 4WJXA 4ODLA 1FKJA 1FKGA 3G6LA 4FN2A 3TC5A 2IF4A 4LAXA 1SYTA 4AY1A 1FKDA 4R0XA 3WQWA 1ZK6A 1E15A 1ROTA 2PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9R B;  3JYJ A;  3O5G A;  1ZCN A;  2XP9 A;  3ODK A;  3O5M A;  4TYO A;  1FKL A;  1FKS A;  3KAH A;  1FKT A;  2D9F A;  2FAP A;  4J4N A;  4IQ2 A;  2Q5A A;  1FKH A;  2KI3 A;  2XP3 A;  4ODN A;  3KZ7 A;  2M1I A;  4IQC A;  1QPF A;  5HKG A;  1P5Q A;  2DG4 A;  3PRD A;  2RUQ A;  1B6C A;  1D7I A;  1JNT A;  3KAB A;  2UZ5 A;  3JXV A;  3NRK A;  1L1P A;  3IKD A;  1YAT A;  2ZQT A;  3O5E A;  3VAW A;  5BXJ A;  1F8A B;  2DG3 A;  2N87 A;  5HTG A;  2LKN A;  1FD9 A;  2XP7 A;  4DH0 A;  4JFJ A;  3IHZ A;  4TW6 A;  3LUO A;  3PA7 A;  4G2P A;  4JYS A;  4NNR A;  3O5O A;  3B7X A;  4G50 A;  1F40 A;  3KAD A;  2Y78 A;  3NTP A;  4C02 B;  1J4H A;  4GIV A;  4DIP A;  1EYM A;  5HT1 A;  4ODM A;  5DIT A;  5B8I C;  3O5D A;  4JFL A;  1HXV A;  2KO7 A;  1YW5 A;  1Q6I A;  2K8I A;  2PV2 A;  2MF9 A;  4ODP A;  2LGO A;  3KAC A;  3KCE A;  4QT3 A;  4DRH A;  1BKF A;  4DZ2 A;  1KT0 A;  2ZQU A;  4TW8 A;  5HWC A;  2XP4 A;  3UI4 A;  3O5Q A;  4ODR A;  5GPG A;  3UF8 A;  1QZ2 A;  2PV1 A;  4TX0 A;  3JYM A;  3UQB A;  1Y0O A;  4BF8 A;  1FKK A;  1J4I A;  3WH0 A;  1D7J A;  3CGM A;  3I6C A;  2MLZ A;  1TCO C;  4JFM A;  2ZR5 A;  3PRB A;  2RUR A;  2ZQV A;  1C9H A;  1PBK A;  2PPP A;  3KAG A;  4W9P A;  4J4O A;  4FAP A;  4U84 A;  2M08 A;  4JFI A;  3O5P A;  4ODK A;  4TW7 A;  3TDB A;  1T11 A;  2KGJ A;  2ZQS A;  1FKR A;  4DRQ A;  2ZR6 A;  4LAW A;  1NMW A;  2F4E A;  1FKB A;  3O5R A;  4ITZ A;  2VN1 A;  2DG9 A;  3UQA A;  4DRM A;  2AWG A;  3RFW A;  4DRJ A;  3GPK A;  1D7H A;  4ODQ A;  2RSE A;  1PIN A;  2FKE A;  2OFN A;  4W9O A;  2PV3 A;  3IK8 A;  1FAP A;  4DRK A;  2LPV A;  1W26 A;  4IPX A;  3O5K A;  5I98 A;  2M2A A;  1FKI A;  1Q6U A;  1R9H A;  2RQS A;  3FAP A;  3OOB A;  4W9Q A;  5J6E A;  1FKF A;  1NMV A;  3MDY B;  4U86 A;  1JNS A;  5HW6 A;  5HW7 A;  3UQI A;  4DT4 A;  4GGQ A;  4U85 A;  4QIB A;  1NSG A;  2VCD A;  3UI5 A;  2LJ4 A;  4MSP A;  1QPL A;  2KR7 A;  4N19 A;  3NI6 A;  4DRP A;  2ZR4 A;  3TCZ A;  5D75 A;  2L2S A;  4LAV A;  3UI6 A;  4QT2 A;  2XP5 A;  1U79 A;  2MLX A;  1KT1 A;  3KAF A;  3O5F A;  4O2T A;  2JZV A;  2KE0 A;  4DRN A;  5HWB A;  1JVW A;  2XP8 A;  2MPH A;  4DRI A;  4LAY A;  4ODO A;  2RUC A;  2XPA A;  2MLY A;  1FJD A;  3O5L A;  1Q1C A;  4JFK A;  5HUA A;  2KFW A;  4ODL A;  4TNS A;  2PBC A;  1FKJ A;  1FKG A;  4DZ3 A;  1J6Y A;  1EQ3 A;  3EY6 A;  4FN2 A;  1BL4 A;  2IF4 A;  3TC5 A;  4LAX A;  5DIU A;  3O5J A;  5DIV A;  1N1A A;  1FKD A;  1ROU A;  3KAI A;  4MGV A;  2MNT A;  4R0X A;  3O5I A;  1J4R A;  1Q6H A;  2F21 A;  3RGC A;  2XPB A;  2F2D A;  3IKG A;  1ZK6 A;  2RUD A;  1D6O A;  3CGN A;  2ITK A;  5HW8 A;  2XP6 A;  1A7X A;  4DRO A;  2PPN A;  1M5Y A;  1ROT A;  2PPO A; 
#chains in the Genus database with same CATH topology
 3H9R B;  4TYO A;  1FKL A;  4Q22 A;  3KAH A;  2B31 A;  2D9F A;  4IQ2 A;  2Q5A A;  1CTN A;  1QPF A;  3PRD A;  1D7I A;  3IKD A;  1OGB A;  2ZQT A;  3O5E A;  1JNE A;  3VAW A;  2O9O A;  1FD9 A;  3ARZ A;  1TFV A;  3WKZ A;  1NWR A;  4Z2L A;  1J4H A;  1LJY A;  4ODM A;  1HXV A;  4JFL A;  1YW5 A;  5JH8 A;  2PV2 A;  3FXY A;  2DSV A;  3KCE A;  4DRH A;  1E6P A;  3CH9 A;  2XP4 A;  3UI4 A;  1H0G A;  4Z2H A;  1LL4 A;  1QZ2 A;  1W1P A;  4TX0 A;  3WH0 A;  1J4I A;  3ARO A;  1OGG A;  2RUR A;  1UR8 A;  3RM9 A;  2B5U B;  4DWS D;  2PPP A;  4ZPT R;  4W9P A;  4JFI A;  3O5P A;  3TDB A;  2FDM A;  2F4E A;  4MNJ A;  3CHC A;  4XAK A;  1HKI A;  2G41 A;  3CHF A;  3GPK A;  2DSZ A;  1HKM A;  4LGX A;  1E9L A;  2RSE A;  2OFN A;  3RME A;  3IK8 A;  2QF8 A;  5J6E A;  3OOB A;  4W9Q A;  3MDY B;  4U86 A;  5HW6 A;  3UQI A;  4DT4 A;  1LL6 A;  2VCD A;  4P8W A;  4MSP A;  1QPL A;  2ESC A;  2ZR4 A;  1EDQ A;  4WIW A;  2XP5 A;  3GU0 A;  1W9V A;  2KE0 A;  1IX5 A;  1JVW A;  3WD0 A;  4Q7N A;  2MPH A;  4NSB A;  2XPA A;  1LG2 A;  1M5Y A;  1O6I A;  3O5L A;  4JFK A;  1HKJ A;  2DPE A;  2KFW A;  2DT0 A;  2PBC A;  1ZBC A;  3EY6 A;  1ROU A;  3KAI A;  2MNT A;  1Q6H A;  3GTY X;  2XPB A;  2F2D A;  2DT2 A;  2RUD A;  3CGN A;  4MPK A;  2ITK A;  1NH6 A;  2XP6 A;  1A7X A;  3BXW A;  3ARR A;  3O5G A;  2XP9 A;  3O5M A;  3WIJ A;  1ZBW A;  2FAP A;  4J4N A;  4HBO A;  2XP3 A;  3OA5 A;  1GPF A;  2RUQ A;  1B6C A;  3NRK A;  3JXV A;  1W1T A;  1WAW A;  1F8A B;  3ALF A;  2N87 A;  4P8X A;  2IUZ A;  3IHZ A;  1OWQ A;  3LUO A;  3PA7 A;  4NNR A;  3O5O A;  3B7X A;  1W9U A;  1NWT A;  2YBT A;  4C02 B;  4MAV A;  1EYM A;  5HT1 A;  5DIT A;  2KO7 A;  2K8I A;  1D2K A;  3KAC A;  4WKA A;  4DWS C;  4ODR A;  5GPG A;  2AOS A;  2PV1 A;  1NWS A;  1W1Y A;  1TCO C;  4W5U A;  5DEZ A;  4IT6 A;  1X6N A;  1EIB A;  4J4O A;  4FAP A;  1XHG A;  4Z2I A;  4TW7 A;  1FKR A;  1ZBK A;  5GPR A;  1FKB A;  1H0I A;  2DG9 A;  2P4V A;  3UQA A;  1ZBV A;  2AWG A;  5HBF A;  4DRJ A;  3W4R A;  1PIN A;  4W9O A;  4L3N A;  1FAP A;  4P8U A;  1NWU A;  1W26 A;  5I98 A;  3O5K A;  4ZS6 A;  1FKI A;  1R9H A;  2DT3 A;  4S3J A;  1FKF A;  1LL7 A;  1NSG A;  4MNM A;  4S3K A;  4N19 A;  3TCZ A;  4LAV A;  1FFR A;  1VF8 A;  3UI6 A;  1U79 A;  1HJX A;  3O5F A;  4O2T A;  3AS1 A;  5HWB A;  1HJW A;  4QZV B;  4LAY A;  2RUC A;  4Z2K A;  4Z2J A;  3AQU A;  2DT1 A;  1W1V A;  1Q1C A;  4ML4 A;  1SR0 A;  3PR9 A;  4DZ3 A;  2EUL A;  5DIU A;  1N1A A;  2WM0 A;  1W9P A;  4MGV A;  4WKH A;  4URI A;  4KQZ A;  3IKG A;  3ARQ A;  1JCH B;  1D6O A;  2G8Z A;  1ZU8 A;  3WQV A;  3JYJ A;  3ARV A;  1FKS A;  1FKH A;  2KI3 A;  3KZ7 A;  2M1I A;  4IQC A;  3ARS A;  2YBU A;  4ZPW R;  5HTG A;  5BXJ A;  2DG3 A;  2LKN A;  3ARX A;  2XP7 A;  4DH0 A;  4TW6 A;  4G2P A;  4JYS A;  3ALG A;  3KAD A;  2Y78 A;  3ARW A;  3NTP A;  4GIV A;  2WLZ A;  5B8I C;  3O5D A;  3CHE A;  2F23 A;  3PRA A;  2LGO A;  1RD6 A;  1BKF A;  4UDM A;  4DZ2 A;  2ZQU A;  4WK9 A;  3O5Q A;  4R5E A;  3UF8 A;  2WK2 A;  4P8V A;  3ART A;  1Y0O A;  3ARY A;  3CGM A;  3B9D A;  4JFM A;  1E6N A;  3PRB A;  4MNL A;  3WD4 A;  2ZQV A;  2ETN A;  1PBK A;  1ZL1 A;  4U84 A;  2M08 A;  1LG1 A;  4ODK A;  1T11 A;  2ZR6 A;  4ITZ A;  2VN1 A;  3AS0 A;  3RFW A;  2DSU A;  1GRJ A;  3RM4 A;  2FKE A;  2PV3 A;  4DRK A;  2LPV A;  3CHD A;  4IPX A;  2M2A A;  5GQB A;  1Q6U A;  3FAP A;  1E6R A;  1UR9 A;  4GGQ A;  4QIB A;  3ARU A;  1K9T A;  2LJ4 A;  2PI6 A;  4QT2 A;  2MLX A;  2WLY A;  2JZV A;  4DRN A;  2XP8 A;  4IT4 A;  4DRI A;  4ODO A;  1FJD A;  4PTM A;  1ITX A;  1GOI A;  1LQ0 A;  1FFQ A;  4TNS A;  1J6Y A;  1EQ3 A;  3AS2 A;  1BL4 A;  3O5J A;  5DIV A;  1E44 A;  4HAR A;  4ZPV R;  4DWS B;  3O5I A;  2DSW A;  1J4R A;  2F21 A;  3RGC A;  3FY1 A;  5HW8 A;  1GUV A;  4DRO A;  4MTV A;  2PPN A;  3B9E A;  3CZ8 A;  1ZCN A;  3ODK A;  1HJV A;  1FKT A;  1JND A;  4ODN A;  4L72 B;  5HKG A;  1HKK A;  1P5Q A;  2DG4 A;  1JNT A;  3KAB A;  2UZ5 A;  3WD1 A;  1L1P A;  1EHN A;  4KR0 B;  1YAT A;  3ARP A;  3WD2 A;  1WNO A;  4JFJ A;  1XRV A;  4G50 A;  1F40 A;  4DIP A;  1Q6I A;  2A3C A;  4ODP A;  2MF9 A;  3RM8 A;  4QT3 A;  5DF0 A;  1KT0 A;  5HWC A;  4TW8 A;  3WL1 A;  3EIP A;  2A3B A;  3UQB A;  3JYM A;  4BF8 A;  1FKK A;  1D7J A;  3I6C A;  3BMB A;  2MLZ A;  2ZR5 A;  3B8S A;  1C9H A;  3KAG A;  2A3A A;  2O92 A;  2KGJ A;  2ZQS A;  4MNK A;  4WKF A;  3WD3 A;  4DRQ A;  4LAW A;  1NMW A;  3O5R A;  4HBE A;  3B9A A;  4DRM A;  3WL0 A;  1D7H A;  4ODQ A;  1E6Z A;  3AS3 A;  4DWS A;  2RQS A;  1KFW A;  1JNS A;  1NMV A;  5HW7 A;  3G6M A;  4U85 A;  3UI5 A;  2OLH A;  2KR7 A;  4DRP A;  3NI6 A;  5D75 A;  1X6L A;  2L2S A;  4Z2G A;  3KAF A;  3QOK A;  1KT1 A;  1WB0 A;  1ZB5 A;  4NZC A;  2MLY A;  2A3E A;  5DO2 A;  2PN0 A;  5HUA A;  4WJX A;  4ODL A;  1FKJ A;  1FKG A;  3G6L A;  4FN2 A;  3TC5 A;  2IF4 A;  4LAX A;  1SYT A;  4AY1 A;  1FKD A;  4R0X A;  3WQW A;  1ZK6 A;  1E15 A;  1ROT A;  2PPO A; 
#chains in the Genus database with same CATH homology
 3H9R B;  4TYO A;  1FKL A;  4Q22 A;  3KAH A;  2B31 A;  2D9F A;  4IQ2 A;  2Q5A A;  1CTN A;  1QPF A;  3PRD A;  1D7I A;  3IKD A;  1OGB A;  2ZQT A;  3O5E A;  1JNE A;  3VAW A;  2O9O A;  1FD9 A;  3ARZ A;  1TFV A;  3WKZ A;  1NWR A;  4Z2L A;  1J4H A;  1LJY A;  4ODM A;  1HXV A;  4JFL A;  1YW5 A;  5JH8 A;  2PV2 A;  3FXY A;  2DSV A;  3KCE A;  4DRH A;  1E6P A;  3CH9 A;  2XP4 A;  3UI4 A;  1H0G A;  4Z2H A;  1LL4 A;  1QZ2 A;  1W1P A;  4TX0 A;  3WH0 A;  1J4I A;  3ARO A;  1OGG A;  2RUR A;  1UR8 A;  3RM9 A;  4DWS D;  2PPP A;  4ZPT R;  4W9P A;  4JFI A;  3O5P A;  3TDB A;  2FDM A;  2F4E A;  4MNJ A;  3CHC A;  4XAK A;  1HKI A;  2G41 A;  3CHF A;  3GPK A;  2DSZ A;  1HKM A;  4LGX A;  1E9L A;  2RSE A;  2OFN A;  3RME A;  3IK8 A;  2QF8 A;  5J6E A;  3OOB A;  4W9Q A;  3MDY B;  4U86 A;  5HW6 A;  3UQI A;  4DT4 A;  1LL6 A;  2VCD A;  4P8W A;  4MSP A;  1QPL A;  2ESC A;  2ZR4 A;  1EDQ A;  4WIW A;  2XP5 A;  1W9V A;  2KE0 A;  1IX5 A;  1JVW A;  3WD0 A;  4Q7N A;  2MPH A;  4NSB A;  2XPA A;  1LG2 A;  1M5Y A;  1O6I A;  3O5L A;  4JFK A;  1HKJ A;  2DPE A;  2KFW A;  2DT0 A;  2PBC A;  1ZBC A;  3EY6 A;  1ROU A;  3KAI A;  2MNT A;  1Q6H A;  2XPB A;  2F2D A;  2DT2 A;  2RUD A;  3CGN A;  4MPK A;  2ITK A;  1NH6 A;  2XP6 A;  1A7X A;  3BXW A;  3ARR A;  3O5G A;  2XP9 A;  3O5M A;  3WIJ A;  1ZBW A;  2FAP A;  4J4N A;  4HBO A;  2XP3 A;  3OA5 A;  1GPF A;  2RUQ A;  1B6C A;  3NRK A;  3JXV A;  1W1T A;  1WAW A;  1F8A B;  3ALF A;  2N87 A;  4P8X A;  2IUZ A;  3IHZ A;  1OWQ A;  3LUO A;  3PA7 A;  4NNR A;  3O5O A;  3B7X A;  1W9U A;  1NWT A;  2YBT A;  4C02 B;  4MAV A;  1EYM A;  5HT1 A;  5DIT A;  2KO7 A;  2K8I A;  1D2K A;  3KAC A;  4WKA A;  4DWS C;  4ODR A;  5GPG A;  2AOS A;  2PV1 A;  1NWS A;  1W1Y A;  1TCO C;  4W5U A;  5DEZ A;  4IT6 A;  1X6N A;  1EIB A;  4J4O A;  4FAP A;  1XHG A;  4Z2I A;  4TW7 A;  1FKR A;  1ZBK A;  5GPR A;  1FKB A;  1H0I A;  2DG9 A;  3UQA A;  1ZBV A;  2AWG A;  5HBF A;  4DRJ A;  3W4R A;  1PIN A;  4W9O A;  4L3N A;  1FAP A;  4P8U A;  1NWU A;  1W26 A;  5I98 A;  3O5K A;  4ZS6 A;  1FKI A;  1R9H A;  2DT3 A;  4S3J A;  1FKF A;  1LL7 A;  1NSG A;  4MNM A;  4S3K A;  4N19 A;  3TCZ A;  4LAV A;  1FFR A;  1VF8 A;  3UI6 A;  1U79 A;  1HJX A;  3O5F A;  4O2T A;  3AS1 A;  5HWB A;  1HJW A;  4QZV B;  4LAY A;  2RUC A;  4Z2K A;  4Z2J A;  3AQU A;  2DT1 A;  1W1V A;  1Q1C A;  4ML4 A;  1SR0 A;  3PR9 A;  4DZ3 A;  5DIU A;  1N1A A;  2WM0 A;  1W9P A;  4MGV A;  4WKH A;  4URI A;  4KQZ A;  3IKG A;  3ARQ A;  1D6O A;  2G8Z A;  1ZU8 A;  3WQV A;  3JYJ A;  3ARV A;  1FKS A;  1FKH A;  2KI3 A;  3KZ7 A;  2M1I A;  4IQC A;  3ARS A;  2YBU A;  4ZPW R;  5HTG A;  5BXJ A;  2DG3 A;  2LKN A;  3ARX A;  2XP7 A;  4DH0 A;  4TW6 A;  4G2P A;  4JYS A;  3ALG A;  3KAD A;  2Y78 A;  3ARW A;  3NTP A;  4GIV A;  2WLZ A;  5B8I C;  3O5D A;  3CHE A;  3PRA A;  2LGO A;  1RD6 A;  1BKF A;  4DZ2 A;  2ZQU A;  4WK9 A;  3O5Q A;  4R5E A;  3UF8 A;  2WK2 A;  4P8V A;  3ART A;  1Y0O A;  3ARY A;  3CGM A;  3B9D A;  4JFM A;  1E6N A;  3PRB A;  4MNL A;  3WD4 A;  2ZQV A;  1PBK A;  1ZL1 A;  4U84 A;  2M08 A;  1LG1 A;  4ODK A;  1T11 A;  2ZR6 A;  4ITZ A;  2VN1 A;  3AS0 A;  3RFW A;  2DSU A;  3RM4 A;  2FKE A;  2PV3 A;  4DRK A;  2LPV A;  3CHD A;  4IPX A;  2M2A A;  5GQB A;  1Q6U A;  3FAP A;  1E6R A;  1UR9 A;  4GGQ A;  4QIB A;  3ARU A;  1K9T A;  2LJ4 A;  2PI6 A;  4QT2 A;  2MLX A;  2WLY A;  2JZV A;  4DRN A;  2XP8 A;  4IT4 A;  4DRI A;  4ODO A;  1FJD A;  4PTM A;  1ITX A;  1GOI A;  1LQ0 A;  1FFQ A;  4TNS A;  1J6Y A;  1EQ3 A;  3AS2 A;  1BL4 A;  3O5J A;  5DIV A;  4HAR A;  4ZPV R;  4DWS B;  3O5I A;  2DSW A;  1J4R A;  2F21 A;  3RGC A;  3FY1 A;  5HW8 A;  1GUV A;  4DRO A;  4MTV A;  2PPN A;  3B9E A;  3CZ8 A;  1ZCN A;  3ODK A;  1HJV A;  1FKT A;  1JND A;  4ODN A;  4L72 B;  5HKG A;  1HKK A;  1P5Q A;  2DG4 A;  1JNT A;  3KAB A;  2UZ5 A;  3WD1 A;  1L1P A;  1EHN A;  4KR0 B;  1YAT A;  3ARP A;  3WD2 A;  1WNO A;  4JFJ A;  1XRV A;  4G50 A;  1F40 A;  4DIP A;  1Q6I A;  2A3C A;  4ODP A;  2MF9 A;  3RM8 A;  4QT3 A;  5DF0 A;  1KT0 A;  5HWC A;  4TW8 A;  3WL1 A;  2A3B A;  3UQB A;  3JYM A;  4BF8 A;  1FKK A;  1D7J A;  3I6C A;  2MLZ A;  2ZR5 A;  3B8S A;  1C9H A;  3KAG A;  2A3A A;  2O92 A;  2KGJ A;  2ZQS A;  4MNK A;  4WKF A;  3WD3 A;  4DRQ A;  4LAW A;  1NMW A;  3O5R A;  4HBE A;  3B9A A;  4DRM A;  3WL0 A;  1D7H A;  4ODQ A;  1E6Z A;  3AS3 A;  4DWS A;  2RQS A;  1KFW A;  1JNS A;  1NMV A;  5HW7 A;  3G6M A;  4U85 A;  3UI5 A;  2OLH A;  2KR7 A;  4DRP A;  3NI6 A;  5D75 A;  1X6L A;  2L2S A;  4Z2G A;  3KAF A;  3QOK A;  1KT1 A;  1WB0 A;  1ZB5 A;  4NZC A;  2MLY A;  2A3E A;  5DO2 A;  5HUA A;  4WJX A;  4ODL A;  1FKJ A;  1FKG A;  3G6L A;  4FN2 A;  3TC5 A;  2IF4 A;  4LAX A;  1SYT A;  4AY1 A;  1FKD A;  4R0X A;  3WQW A;  1ZK6 A;  1E15 A;  1ROT A;  2PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...