4ODNA

Structure of slyd from thermus thermophilus in complex with s2-plus peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 32
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odnA00
4R0XA 1Q6IA 2KO7A 2LJ4A 2PV3A 3O5DA 2PPOA 4FN2A 4IQCA 4W9OA 4DRIA 1NSGA 1FKIA 4ODOA 1M5YA 3FAPA 2MLYA 2XP7A 1FJDA 4U86A 3O5FA 5HW8A 3UQBA 1NMWA 1FKTA 2XP6A 2ZR5A 3RGCA 2RUCA 4GGQA 3GPKA 3UI6A 2OFNA 1P5QA 1PBKA 2N87A 2PPPA 3JYMA 4LAYA 4ODLA 2F21A 3UQIA 2RUQA 3IKDA 3O5QA 1F40A 1D7HA 3NI6A 4ODPA 1C9HA 1FKJA 3JYJA 2UZ5A 4DRMA 2KGJA 1QZ2A 3O5PA 3JXVA 1HXVA 4DT4A 2XP8A 5DIVA 4JFIA 1FKGA 3TCZA 1FKBA 3CGNA 1J6YA 1JVWA 2KE0A 1PINA 3IK8A 3KABA 4N19A 1L1PA 2M2AA 4DRQA 3NTPA 2K8IA 5I98A 4QIBA 1FKDA 1ZCNA 4MGVA 1BL4A 5HW7A 3KCEA 3LUOA 3IKGA 4J4OA 2PPNA 3OOBA 2DG3A 3PA7A 1NMVA 2XPAA 2ZQVA 3O5GA 4G50A 2ZQSA 4TW7A 5B8IC 2M1IA 4NNRA 4JFLA 1R9HA 1KT1A 2PV2A 3I6CA 4J4NA 4ODRA 2ZQTA 1J4HA 3CGMA 1U79A 4JFJA 4DH0A 2RURA 4ODQA 4DRKA 4U84A 4DZ3A 4JFKA 2MLZA 3KADA 2M08A 3O5JA 2XP5A 2MF9A 1F8AB 2KR7A 2MNTA 2VCDA 1D7JA 4W9PA 4JYSA 2IF4A 4IQ2A 4ODMA 1YW5A 2KI3A 3KAFA 4DZ2A 1FKFA 4GIVA 1BKFA 2RSEA 3O5RA 5J6EA 1D7IA 2MLXA 1JNTA 4C02B 3O5IA 2Q5AA 2PBCA 1FAPA 2ITKA 3WH0A 4TW6A 1TCOC 1YATA 2MPHA 3IHZA 2RQSA 2LPVA 3H9RB 1J4IA 4TYOA 5HW6A 3ODKA 1ROUA 1J4RA 3VAWA 3KAHA 3UI4A 4QT2A 3MDYB 3EY6A 2Y78A 5BXJA 1T11A 3O5KA 2FAPA 2D9FA 5DITA 2LKNA 3TDBA 4LAVA 1QPLA 3O5EA 4TX0A 4O2TA 2F2DA 4MSPA 1ZK6A 2VN1A 4LAWA 3UQAA 1QPFA 4LAXA 3O5LA 4ODNA 5HWBA 2ZQUA 2DG4A 3PRBA 5HKGA 4BF8A 3UF8A 2DG9A 2KFWA 4ODKA 4DRPA 1FKRA 4TNSA 4DRNA 1EYMA 1FKKA 5GPGA 4G2PA 3O5OA 1W26A 3RFWA 3TC5A 1ROTA 2XP9A 1Q6UA 3KAGA 4IPXA 5HT1A 2XP4A 3KAIA 3NRKA 1FKLA 2XPBA 5D75A 4ITZA 4DRHA 5DIUA 4DRJA 1Y0OA 2JZVA 2PV1A 3KZ7A 4FAPA 5HUAA 1JNSA 3O5MA 2L2SA 3B7XA 1FKHA 1FD9A 2FKEA 1FKSA 2ZR6A 3KACA 4QT3A 4W9QA 1Q1CA 1EQ3A 1A7XA 1B6CA 2F4EA 3PRDA 5HTGA 3UI5A 1N1AA 4DIPA 1Q6HA 2AWGA 2LGOA 5HWCA 4TW8A 2XP3A 1D6OA 1KT0A 2ZR4A 4U85A 4DROA 4JFMA 2RUDA
chains in the Genus database with same CATH superfamily
4R0XA 2PPOA 3CHEA 4W9OA 4P8VA 3ARTA 1FJDA 2B5UB 4U86A 2XP6A 1FKTA 2DSVA 2PPPA 4LAYA 4ODLA 4ODPA 1FKJA 1UR9A 2UZ5A 3BMBA 3W4RA 1QZ2A 4DRMA 4DWSD 4Z2GA 3CH9A 3IK8A 4DRQA 2K8IA 3CHCA 5HW7A 3IKGA 2PPNA 1OGGA 3O5GA 4Z2LA 4DWSB 1LG2A 3ARXA 2M1IA 3QOKA 3WD0A 4JFLA 1KT1A 4ODRA 4JFJA 4U84A 1GUVA 3FY1A 2XP5A 2G8ZA 3KAFA 1FKFA 4GIVA 4W5UA 2MLXA 1H0GA 4C02B 3O5IA 2DT2A 2Q5AA 1FAPA 2O9OA 1TCOC 1GRJA 2WM0A 3WD3A 3G6LA 1J4RA 4QT2A 3MDYB 3EY6A 5BXJA 2FAPA 1E6PA 3RM4A 4HARA 1LL6A 1OGBA 4WKAA 1ZK6A 3WD2A 3UQAA 2DSUA 4ODNA 5HWBA 1LL4A 2B31A 5HKGA 3B9EA 4S3JA 2KFWA 3UF8A 4DWSA 3AROA 1WB0A 1W26A 3O5OA 1ROTA 2XP9A 3WIJA 1EDQA 2DT0A 2WLZA 1FKLA 4AY1A 2A3CA 2DT1A 5DIUA 4MTVA 4MNJA 4Z2KA 2JZVA 3KZ7A 1FD9A 2WLYA 1Q6HA 1KT0A 2RUDA 2KO7A 1NWSA 1ZBVA 1M5YA 3ARUA 3O5FA 3UQBA 1NMWA 3RGCA 2RUCA 1FFQA 1K9TA 1PBKA 4MNKA 4NSBA 1E9LA 3O5QA 1D7HA 1O6IA 1C9HA 3JYJA 3ARVA 1JNEA 2P4VA 3JXVA 1HXVA 4UDMA 4Z2JA 2XP8A 1X6LA 3CGNA 4Q7NA 4WK9A 3GU0A 3KABA 1W9VA 4N19A 4MAVA 1HJWA 1XRVA 5I98A 4QIBA 1ZCNA 1BL4A 3OOBA 2DG3A 1X6NA 4TW7A 4G50A 2ZQSA 4NNRA 2PV2A 3I6CA 4J4NA 4QZVB 1J4HA 3CGMA 1IX5A 2RURA 4ODQA 4DRKA 1GOIA 1ZBWA 1RD6A 1W1YA 2PN0A 3B8SA 4JFKA 3KADA 2M08A 2MF9A 2IF4A 1YW5A 4DZ2A 4R5EA 1D7IA 4P8UA 2PBCA 2ITKA 3WH0A 1E6ZA 3IHZA 3ALGA 2LPVA 4TYOA 5HW6A 2OLHA 2YBUA 3ARZA 2D9FA 5DITA 1LJYA 2LKNA 3O5EA 4TX0A 4MSPA 2A3BA 4LAWA 4ML4A 3WD1A 4NZCA 2DG4A 4ZPTR 1E44A 1W1VA 4DRPA 4WKFA 1GPFA 2PI6A 4G2PA 3RFWA 5DO2A 4IPXA 4ZPVR 2DSZA 1VF8A 3AS1A 4ITZA 2DT3A 1Y0OA 1NWUA 5HUAA 1FKHA 4IT4A 3ARRA 1Q1CA 1A7XA 1B6CA 1N1AA 2EULA 2AWGA 2LGOA 5HWCA 1WNOA 5GPGA 2LJ4A 3O5DA 4FN2A 4IQCA 1ZL1A 3FAPA 1TFVA 4L72B 3GPKA 2DPEA 1W9PA 3UI6A 3JYMA 1F40A 2F21A 4MNMA 2RUQA 3UQIA 1EIBA 1W9UA 3NI6A 3RMEA 2KGJA 3O5PA 3TCZA 1FKBA 1JVWA 1PINA 2KE0A 3PR9A 3ARPA 3NTPA 2FDMA 4P8WA 1W1PA 3KCEA 3ARSA 4J4OA 1LG1A 1NMVA 2XPAA 2ZQVA 1NH6A 2ETNA 4S3KA 3ARWA 2ZQTA 3ALFA 3WKZA 3WQWA 2ESCA 5JH8A 4DH0A 5GQBA 3O5JA 4HBEA 1F8AB 2KR7A 2MNTA 4KQZA 1ZU8A 4XAKA 4W9PA 4JYSA 4IQ2A 1H0IA 2KI3A 4ODMA 1BKFA 1ZBCA 1JNTA 1HJVA 1JNDA 3FXYA 3H9RB 2RQSA 4ZPWR 1D2KA 3ODKA 3KAHA 3WL1A 1WAWA 3UI4A 2Y78A 3O5KA 1HJXA 4LAVA 4WKHA 4O2TA 2F2DA 2VN1A 1LL7A 1QPFA 3O5LA 2A3AA 4LAXA 3ARYA 2ZQUA 1E6RA 3B9DA 4L3NA 4TNSA 4Z2IA 1CTNA 2XP4A 3KAIA 3NRKA 2O92A 3BXWA 5DEZA 4DRJA 4FAPA 1JNSA 3O5MA 3B7XA 4QT3A 3OA5A 1FKSA 2ZR6A 4KR0B 3AQUA 1EQ3A 2IUZA 3CZ8A 3UI5A 1E6NA 4DIPA 4TW8A 1D6OA 4U85A 4DROA 4JFMA 5GPRA 1Q6IA 2PV3A 4URIA 2YBTA 1ITXA 1NSGA 1HKKA 1FKIA 1ZB5A 4ODOA 4DRIA 2MLYA 2XP7A 5HW8A 1HKIA 5HBFA 2ZR5A 1SYTA 4GGQA 4MNLA 2OFNA 1P5QA 2N87A 3IKDA 3AS3A 1HKJA 4WJXA 4DT4A 3AS2A 5DIVA 4JFIA 1FKGA 1J6YA 2WK2A 3CHDA 1L1PA 2M2AA 1EHNA 1FKDA 1HKMA 2A3EA 1LQ0A 4MGVA 4MPKA 3LUOA 4Q22A 3PA7A 2F23A 5B8IC 3G6MA 1OWQA 1SR0A 1R9HA 1U79A 4DZ3A 3WD4A 1NWTA 2MLZA 1XHGA 4HBOA 2VCDA 1D7JA 3CHFA 3GTYX 3RM9A 2RSEA 3O5RA 5J6EA 4TW6A 1YATA 2MPHA 4ZS6A 1J4IA 1JCHB 3VAWA 1ROUA 4DWSC 1ZBKA 2AOSA 1KFWA 5DF0A 1T11A 1NWRA 3TDBA 1W1TA 1QPLA 4P8XA 4IT6A 4LGXA 3WQVA 3PRBA 4BF8A 2DG9A 4ODKA 2G41A 1FKRA 1E15A 2DSWA 4DRNA 4Z2HA 1EYMA 1FKKA 3TC5A 1UR8A 3B9AA 1Q6UA 3KAGA 3WL0A 5HT1A 2XPBA 3RM8A 5D75A 4DRHA 4WIWA 3AS0A 2PV1A 3EIPA 2L2SA 2FKEA 3KACA 3ARQA 4W9QA 2F4EA 3PRDA 5HTGA 2QF8A 1FFRA 3PRAA 2XP3A 2ZR4A 4PTMA
chains in the Genus database with same CATH topology
4R0XA 2PPOA 3CHEA 4W9OA 4P8VA 3ARTA 1FJDA 4U86A 2XP6A 1FKTA 2DSVA 2PPPA 4LAYA 4ODLA 4ODPA 1FKJA 1UR9A 2UZ5A 3W4RA 4DRMA 1QZ2A 4DWSD 4Z2GA 3CH9A 3IK8A 4DRQA 2K8IA 3CHCA 5HW7A 3IKGA 2PPNA 1OGGA 3O5GA 4Z2LA 4DWSB 1LG2A 3ARXA 2M1IA 3QOKA 3WD0A 4JFLA 1KT1A 4ODRA 4JFJA 4U84A 1GUVA 3FY1A 2XP5A 2G8ZA 3KAFA 1FKFA 4GIVA 4W5UA 2MLXA 1H0GA 4C02B 3O5IA 2DT2A 2Q5AA 1FAPA 2O9OA 1TCOC 2WM0A 3WD3A 3G6LA 1J4RA 4QT2A 3MDYB 3EY6A 5BXJA 2FAPA 1E6PA 3RM4A 4HARA 1LL6A 1OGBA 4WKAA 1ZK6A 3WD2A 3UQAA 2DSUA 4ODNA 5HWBA 1LL4A 2B31A 5HKGA 3B9EA 4S3JA 2KFWA 3UF8A 4DWSA 3AROA 1WB0A 1W26A 3O5OA 1ROTA 2XP9A 3WIJA 1EDQA 2DT0A 2WLZA 1FKLA 4AY1A 2A3CA 2DT1A 5DIUA 4MTVA 4MNJA 4Z2KA 2JZVA 3KZ7A 1FD9A 2WLYA 1Q6HA 1KT0A 2RUDA 2KO7A 1NWSA 1ZBVA 1M5YA 3ARUA 3O5FA 3UQBA 1NMWA 3RGCA 2RUCA 1FFQA 1K9TA 1PBKA 4MNKA 4NSBA 1E9LA 3O5QA 1D7HA 1O6IA 1C9HA 3JYJA 3ARVA 1JNEA 3JXVA 1HXVA 4Z2JA 2XP8A 1X6LA 3CGNA 4Q7NA 4WK9A 3KABA 1W9VA 4N19A 4MAVA 1HJWA 1XRVA 5I98A 4QIBA 1ZCNA 1BL4A 3OOBA 2DG3A 1X6NA 4TW7A 4G50A 2ZQSA 4NNRA 2PV2A 3I6CA 4J4NA 4QZVB 1J4HA 3CGMA 1IX5A 2RURA 4ODQA 4DRKA 1GOIA 1ZBWA 1RD6A 1W1YA 4JFKA 3B8SA 3KADA 2M08A 2MF9A 2IF4A 1YW5A 4DZ2A 4R5EA 1D7IA 4P8UA 2PBCA 2ITKA 3WH0A 1E6ZA 3IHZA 3ALGA 2LPVA 4TYOA 5HW6A 2OLHA 2YBUA 3ARZA 2D9FA 5DITA 1LJYA 2LKNA 3O5EA 4TX0A 4MSPA 2A3BA 4LAWA 4ML4A 3WD1A 4NZCA 2DG4A 4ZPTR 1W1VA 4DRPA 4WKFA 1GPFA 2PI6A 4G2PA 3RFWA 5DO2A 4IPXA 4ZPVR 2DSZA 1VF8A 3AS1A 4ITZA 2DT3A 1Y0OA 1NWUA 5HUAA 1FKHA 4IT4A 3ARRA 1Q1CA 1A7XA 1B6CA 1N1AA 2AWGA 2LGOA 5HWCA 1WNOA 5GPGA 2LJ4A 3O5DA 4FN2A 4IQCA 1ZL1A 3FAPA 1TFVA 4L72B 3GPKA 2DPEA 1W9PA 3UI6A 3JYMA 1F40A 2F21A 4MNMA 2RUQA 3UQIA 1EIBA 1W9UA 3NI6A 3RMEA 2KGJA 3O5PA 3TCZA 1FKBA 1JVWA 1PINA 2KE0A 3PR9A 3ARPA 3NTPA 2FDMA 4P8WA 1W1PA 3KCEA 3ARSA 4J4OA 1LG1A 1NMVA 2XPAA 2ZQVA 1NH6A 4S3KA 3ARWA 2ZQTA 3ALFA 3WKZA 3WQWA 2ESCA 5JH8A 4DH0A 5GQBA 3O5JA 4HBEA 1F8AB 2KR7A 2MNTA 4KQZA 1ZU8A 4XAKA 4W9PA 4JYSA 4IQ2A 1H0IA 2KI3A 4ODMA 1BKFA 1ZBCA 1JNTA 1HJVA 1JNDA 3FXYA 2RQSA 3H9RB 4ZPWR 1D2KA 3ODKA 3KAHA 3WL1A 1WAWA 3UI4A 2Y78A 3O5KA 1HJXA 4LAVA 4WKHA 4O2TA 2F2DA 2VN1A 1LL7A 1QPFA 3O5LA 2A3AA 4LAXA 3ARYA 2ZQUA 1E6RA 3B9DA 4L3NA 4TNSA 4Z2IA 1CTNA 2XP4A 3KAIA 3NRKA 2O92A 3BXWA 5DEZA 4DRJA 4FAPA 1JNSA 3O5MA 3B7XA 4QT3A 3OA5A 1FKSA 2ZR6A 4KR0B 3AQUA 1EQ3A 2IUZA 3CZ8A 3UI5A 1E6NA 4DIPA 4TW8A 1D6OA 4U85A 4DROA 4JFMA 5GPRA 1Q6IA 2PV3A 4URIA 2YBTA 1ITXA 1NSGA 1HKKA 1FKIA 1ZB5A 4ODOA 4DRIA 2MLYA 2XP7A 5HW8A 1HKIA 5HBFA 2ZR5A 1SYTA 4GGQA 4MNLA 2OFNA 1P5QA 2N87A 3IKDA 3AS3A 1HKJA 4WJXA 4DT4A 3AS2A 5DIVA 4JFIA 1FKGA 1J6YA 2WK2A 3CHDA 1L1PA 2M2AA 1EHNA 1FKDA 1HKMA 2A3EA 1LQ0A 4MGVA 4MPKA 3LUOA 4Q22A 3PA7A 5B8IC 3G6MA 1OWQA 1SR0A 1R9HA 1U79A 4DZ3A 3WD4A 1NWTA 2MLZA 1XHGA 4HBOA 2VCDA 1D7JA 3CHFA 3RM9A 2RSEA 3O5RA 5J6EA 4TW6A 1YATA 2MPHA 4ZS6A 1J4IA 3VAWA 1ROUA 4DWSC 1ZBKA 2AOSA 1KFWA 5DF0A 1T11A 1NWRA 3TDBA 1W1TA 1QPLA 4P8XA 4IT6A 4LGXA 3WQVA 3PRBA 4BF8A 2DG9A 4ODKA 2G41A 1FKRA 1E15A 2DSWA 4DRNA 4Z2HA 1EYMA 1FKKA 3TC5A 1UR8A 3B9AA 1Q6UA 3KAGA 3WL0A 5HT1A 2XPBA 3RM8A 5D75A 4DRHA 4WIWA 3AS0A 2PV1A 2L2SA 2FKEA 3KACA 3ARQA 4W9QA 2F4EA 3PRDA 5HTGA 2QF8A 1FFRA 3PRAA 2XP3A 2ZR4A 4PTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0X A;  1Q6I A;  2KO7 A;  2LJ4 A;  2PV3 A;  3O5D A;  2PPO A;  4FN2 A;  4IQC A;  4W9O A;  4DRI A;  1NSG A;  1FKI A;  4ODO A;  1M5Y A;  3FAP A;  2MLY A;  2XP7 A;  1FJD A;  4U86 A;  3O5F A;  5HW8 A;  3UQB A;  1NMW A;  1FKT A;  2XP6 A;  2ZR5 A;  3RGC A;  2RUC A;  4GGQ A;  3GPK A;  3UI6 A;  2OFN A;  1P5Q A;  1PBK A;  2N87 A;  2PPP A;  3JYM A;  4LAY A;  4ODL A;  2F21 A;  3UQI A;  2RUQ A;  3IKD A;  3O5Q A;  1F40 A;  1D7H A;  3NI6 A;  4ODP A;  1C9H A;  1FKJ A;  3JYJ A;  2UZ5 A;  4DRM A;  2KGJ A;  1QZ2 A;  3O5P A;  3JXV A;  1HXV A;  4DT4 A;  2XP8 A;  5DIV A;  4JFI A;  1FKG A;  3TCZ A;  1FKB A;  3CGN A;  1J6Y A;  1JVW A;  2KE0 A;  1PIN A;  3IK8 A;  3KAB A;  4N19 A;  1L1P A;  2M2A A;  4DRQ A;  3NTP A;  2K8I A;  5I98 A;  4QIB A;  1FKD A;  1ZCN A;  4MGV A;  1BL4 A;  5HW7 A;  3KCE A;  3LUO A;  3IKG A;  4J4O A;  2PPN A;  3OOB A;  2DG3 A;  3PA7 A;  1NMV A;  2XPA A;  2ZQV A;  3O5G A;  4G50 A;  2ZQS A;  4TW7 A;  5B8I C;  2M1I A;  4NNR A;  4JFL A;  1R9H A;  1KT1 A;  2PV2 A;  3I6C A;  4J4N A;  4ODR A;  2ZQT A;  1J4H A;  3CGM A;  1U79 A;  4JFJ A;  4DH0 A;  2RUR A;  4ODQ A;  4DRK A;  4U84 A;  4DZ3 A;  4JFK A;  2MLZ A;  3KAD A;  2M08 A;  3O5J A;  2XP5 A;  2MF9 A;  1F8A B;  2KR7 A;  2MNT A;  2VCD A;  1D7J A;  4W9P A;  4JYS A;  2IF4 A;  4IQ2 A;  4ODM A;  1YW5 A;  2KI3 A;  3KAF A;  4DZ2 A;  1FKF A;  4GIV A;  1BKF A;  2RSE A;  3O5R A;  5J6E A;  1D7I A;  2MLX A;  1JNT A;  4C02 B;  3O5I A;  2Q5A A;  2PBC A;  1FAP A;  2ITK A;  3WH0 A;  4TW6 A;  1TCO C;  1YAT A;  2MPH A;  3IHZ A;  2RQS A;  2LPV A;  3H9R B;  1J4I A;  4TYO A;  5HW6 A;  3ODK A;  1ROU A;  1J4R A;  3VAW A;  3KAH A;  3UI4 A;  4QT2 A;  3MDY B;  3EY6 A;  2Y78 A;  5BXJ A;  1T11 A;  3O5K A;  2FAP A;  2D9F A;  5DIT A;  2LKN A;  3TDB A;  4LAV A;  1QPL A;  3O5E A;  4TX0 A;  4O2T A;  2F2D A;  4MSP A;  1ZK6 A;  2VN1 A;  4LAW A;  3UQA A;  1QPF A;  4LAX A;  3O5L A;  4ODN A;  5HWB A;  2ZQU A;  2DG4 A;  3PRB A;  5HKG A;  4BF8 A;  3UF8 A;  2DG9 A;  2KFW A;  4ODK A;  4DRP A;  1FKR A;  4TNS A;  4DRN A;  1EYM A;  1FKK A;  5GPG A;  4G2P A;  3O5O A;  1W26 A;  3RFW A;  3TC5 A;  1ROT A;  2XP9 A;  1Q6U A;  3KAG A;  4IPX A;  5HT1 A;  2XP4 A;  3KAI A;  3NRK A;  1FKL A;  2XPB A;  5D75 A;  4ITZ A;  4DRH A;  5DIU A;  4DRJ A;  1Y0O A;  2JZV A;  2PV1 A;  3KZ7 A;  4FAP A;  5HUA A;  1JNS A;  3O5M A;  2L2S A;  3B7X A;  1FKH A;  1FD9 A;  2FKE A;  1FKS A;  2ZR6 A;  3KAC A;  4QT3 A;  4W9Q A;  1Q1C A;  1EQ3 A;  1A7X A;  1B6C A;  2F4E A;  3PRD A;  5HTG A;  3UI5 A;  1N1A A;  4DIP A;  1Q6H A;  2AWG A;  2LGO A;  5HWC A;  4TW8 A;  2XP3 A;  1D6O A;  1KT0 A;  2ZR4 A;  4U85 A;  4DRO A;  4JFM A;  2RUD A; 
#chains in the Genus database with same CATH topology
 4R0X A;  2PPO A;  3CHE A;  4W9O A;  4P8V A;  3ART A;  1FJD A;  2B5U B;  4U86 A;  2XP6 A;  1FKT A;  2DSV A;  2PPP A;  4LAY A;  4ODL A;  4ODP A;  1FKJ A;  1UR9 A;  2UZ5 A;  3BMB A;  3W4R A;  1QZ2 A;  4DRM A;  4DWS D;  4Z2G A;  3CH9 A;  3IK8 A;  4DRQ A;  2K8I A;  3CHC A;  5HW7 A;  3IKG A;  2PPN A;  1OGG A;  3O5G A;  4Z2L A;  4DWS B;  1LG2 A;  3ARX A;  2M1I A;  3QOK A;  3WD0 A;  4JFL A;  1KT1 A;  4ODR A;  4JFJ A;  4U84 A;  1GUV A;  3FY1 A;  2XP5 A;  2G8Z A;  3KAF A;  1FKF A;  4GIV A;  4W5U A;  2MLX A;  1H0G A;  4C02 B;  3O5I A;  2DT2 A;  2Q5A A;  1FAP A;  2O9O A;  1TCO C;  1GRJ A;  2WM0 A;  3WD3 A;  3G6L A;  1J4R A;  4QT2 A;  3MDY B;  3EY6 A;  5BXJ A;  2FAP A;  1E6P A;  3RM4 A;  4HAR A;  1LL6 A;  1OGB A;  4WKA A;  1ZK6 A;  3WD2 A;  3UQA A;  2DSU A;  4ODN A;  5HWB A;  1LL4 A;  2B31 A;  5HKG A;  3B9E A;  4S3J A;  2KFW A;  3UF8 A;  4DWS A;  3ARO A;  1WB0 A;  1W26 A;  3O5O A;  1ROT A;  2XP9 A;  3WIJ A;  1EDQ A;  2DT0 A;  2WLZ A;  1FKL A;  4AY1 A;  2A3C A;  2DT1 A;  5DIU A;  4MTV A;  4MNJ A;  4Z2K A;  2JZV A;  3KZ7 A;  1FD9 A;  2WLY A;  1Q6H A;  1KT0 A;  2RUD A;  2KO7 A;  1NWS A;  1ZBV A;  1M5Y A;  3ARU A;  3O5F A;  3UQB A;  1NMW A;  3RGC A;  2RUC A;  1FFQ A;  1K9T A;  1PBK A;  4MNK A;  4NSB A;  1E9L A;  3O5Q A;  1D7H A;  1O6I A;  1C9H A;  3JYJ A;  3ARV A;  1JNE A;  2P4V A;  3JXV A;  1HXV A;  4UDM A;  4Z2J A;  2XP8 A;  1X6L A;  3CGN A;  4Q7N A;  4WK9 A;  3GU0 A;  3KAB A;  1W9V A;  4N19 A;  4MAV A;  1HJW A;  1XRV A;  5I98 A;  4QIB A;  1ZCN A;  1BL4 A;  3OOB A;  2DG3 A;  1X6N A;  4TW7 A;  4G50 A;  2ZQS A;  4NNR A;  2PV2 A;  3I6C A;  4J4N A;  4QZV B;  1J4H A;  3CGM A;  1IX5 A;  2RUR A;  4ODQ A;  4DRK A;  1GOI A;  1ZBW A;  1RD6 A;  1W1Y A;  2PN0 A;  3B8S A;  4JFK A;  3KAD A;  2M08 A;  2MF9 A;  2IF4 A;  1YW5 A;  4DZ2 A;  4R5E A;  1D7I A;  4P8U A;  2PBC A;  2ITK A;  3WH0 A;  1E6Z A;  3IHZ A;  3ALG A;  2LPV A;  4TYO A;  5HW6 A;  2OLH A;  2YBU A;  3ARZ A;  2D9F A;  5DIT A;  1LJY A;  2LKN A;  3O5E A;  4TX0 A;  4MSP A;  2A3B A;  4LAW A;  4ML4 A;  3WD1 A;  4NZC A;  2DG4 A;  4ZPT R;  1E44 A;  1W1V A;  4DRP A;  4WKF A;  1GPF A;  2PI6 A;  4G2P A;  3RFW A;  5DO2 A;  4IPX A;  4ZPV R;  2DSZ A;  1VF8 A;  3AS1 A;  4ITZ A;  2DT3 A;  1Y0O A;  1NWU A;  5HUA A;  1FKH A;  4IT4 A;  3ARR A;  1Q1C A;  1A7X A;  1B6C A;  1N1A A;  2EUL A;  2AWG A;  2LGO A;  5HWC A;  1WNO A;  5GPG A;  2LJ4 A;  3O5D A;  4FN2 A;  4IQC A;  1ZL1 A;  3FAP A;  1TFV A;  4L72 B;  3GPK A;  2DPE A;  1W9P A;  3UI6 A;  3JYM A;  1F40 A;  2F21 A;  4MNM A;  2RUQ A;  3UQI A;  1EIB A;  1W9U A;  3NI6 A;  3RME A;  2KGJ A;  3O5P A;  3TCZ A;  1FKB A;  1JVW A;  1PIN A;  2KE0 A;  3PR9 A;  3ARP A;  3NTP A;  2FDM A;  4P8W A;  1W1P A;  3KCE A;  3ARS A;  4J4O A;  1LG1 A;  1NMV A;  2XPA A;  2ZQV A;  1NH6 A;  2ETN A;  4S3K A;  3ARW A;  2ZQT A;  3ALF A;  3WKZ A;  3WQW A;  2ESC A;  5JH8 A;  4DH0 A;  5GQB A;  3O5J A;  4HBE A;  1F8A B;  2KR7 A;  2MNT A;  4KQZ A;  1ZU8 A;  4XAK A;  4W9P A;  4JYS A;  4IQ2 A;  1H0I A;  2KI3 A;  4ODM A;  1BKF A;  1ZBC A;  1JNT A;  1HJV A;  1JND A;  3FXY A;  3H9R B;  2RQS A;  4ZPW R;  1D2K A;  3ODK A;  3KAH A;  3WL1 A;  1WAW A;  3UI4 A;  2Y78 A;  3O5K A;  1HJX A;  4LAV A;  4WKH A;  4O2T A;  2F2D A;  2VN1 A;  1LL7 A;  1QPF A;  3O5L A;  2A3A A;  4LAX A;  3ARY A;  2ZQU A;  1E6R A;  3B9D A;  4L3N A;  4TNS A;  4Z2I A;  1CTN A;  2XP4 A;  3KAI A;  3NRK A;  2O92 A;  3BXW A;  5DEZ A;  4DRJ A;  4FAP A;  1JNS A;  3O5M A;  3B7X A;  4QT3 A;  3OA5 A;  1FKS A;  2ZR6 A;  4KR0 B;  3AQU A;  1EQ3 A;  2IUZ A;  3CZ8 A;  3UI5 A;  1E6N A;  4DIP A;  4TW8 A;  1D6O A;  4U85 A;  4DRO A;  4JFM A;  5GPR A;  1Q6I A;  2PV3 A;  4URI A;  2YBT A;  1ITX A;  1NSG A;  1HKK A;  1FKI A;  1ZB5 A;  4ODO A;  4DRI A;  2MLY A;  2XP7 A;  5HW8 A;  1HKI A;  5HBF A;  2ZR5 A;  1SYT A;  4GGQ A;  4MNL A;  2OFN A;  1P5Q A;  2N87 A;  3IKD A;  3AS3 A;  1HKJ A;  4WJX A;  4DT4 A;  3AS2 A;  5DIV A;  4JFI A;  1FKG A;  1J6Y A;  2WK2 A;  3CHD A;  1L1P A;  2M2A A;  1EHN A;  1FKD A;  1HKM A;  2A3E A;  1LQ0 A;  4MGV A;  4MPK A;  3LUO A;  4Q22 A;  3PA7 A;  2F23 A;  5B8I C;  3G6M A;  1OWQ A;  1SR0 A;  1R9H A;  1U79 A;  4DZ3 A;  3WD4 A;  1NWT A;  2MLZ A;  1XHG A;  4HBO A;  2VCD A;  1D7J A;  3CHF A;  3GTY X;  3RM9 A;  2RSE A;  3O5R A;  5J6E A;  4TW6 A;  1YAT A;  2MPH A;  4ZS6 A;  1J4I A;  1JCH B;  3VAW A;  1ROU A;  4DWS C;  1ZBK A;  2AOS A;  1KFW A;  5DF0 A;  1T11 A;  1NWR A;  3TDB A;  1W1T A;  1QPL A;  4P8X A;  4IT6 A;  4LGX A;  3WQV A;  3PRB A;  4BF8 A;  2DG9 A;  4ODK A;  2G41 A;  1FKR A;  1E15 A;  2DSW A;  4DRN A;  4Z2H A;  1EYM A;  1FKK A;  3TC5 A;  1UR8 A;  3B9A A;  1Q6U A;  3KAG A;  3WL0 A;  5HT1 A;  2XPB A;  3RM8 A;  5D75 A;  4DRH A;  4WIW A;  3AS0 A;  2PV1 A;  3EIP A;  2L2S A;  2FKE A;  3KAC A;  3ARQ A;  4W9Q A;  2F4E A;  3PRD A;  5HTG A;  2QF8 A;  1FFR A;  3PRA A;  2XP3 A;  2ZR4 A;  4PTM A; 
#chains in the Genus database with same CATH homology
 4R0X A;  2PPO A;  3CHE A;  4W9O A;  4P8V A;  3ART A;  1FJD A;  4U86 A;  2XP6 A;  1FKT A;  2DSV A;  2PPP A;  4LAY A;  4ODL A;  4ODP A;  1FKJ A;  1UR9 A;  2UZ5 A;  3W4R A;  4DRM A;  1QZ2 A;  4DWS D;  4Z2G A;  3CH9 A;  3IK8 A;  4DRQ A;  2K8I A;  3CHC A;  5HW7 A;  3IKG A;  2PPN A;  1OGG A;  3O5G A;  4Z2L A;  4DWS B;  1LG2 A;  3ARX A;  2M1I A;  3QOK A;  3WD0 A;  4JFL A;  1KT1 A;  4ODR A;  4JFJ A;  4U84 A;  1GUV A;  3FY1 A;  2XP5 A;  2G8Z A;  3KAF A;  1FKF A;  4GIV A;  4W5U A;  2MLX A;  1H0G A;  4C02 B;  3O5I A;  2DT2 A;  2Q5A A;  1FAP A;  2O9O A;  1TCO C;  2WM0 A;  3WD3 A;  3G6L A;  1J4R A;  4QT2 A;  3MDY B;  3EY6 A;  5BXJ A;  2FAP A;  1E6P A;  3RM4 A;  4HAR A;  1LL6 A;  1OGB A;  4WKA A;  1ZK6 A;  3WD2 A;  3UQA A;  2DSU A;  4ODN A;  5HWB A;  1LL4 A;  2B31 A;  5HKG A;  3B9E A;  4S3J A;  2KFW A;  3UF8 A;  4DWS A;  3ARO A;  1WB0 A;  1W26 A;  3O5O A;  1ROT A;  2XP9 A;  3WIJ A;  1EDQ A;  2DT0 A;  2WLZ A;  1FKL A;  4AY1 A;  2A3C A;  2DT1 A;  5DIU A;  4MTV A;  4MNJ A;  4Z2K A;  2JZV A;  3KZ7 A;  1FD9 A;  2WLY A;  1Q6H A;  1KT0 A;  2RUD A;  2KO7 A;  1NWS A;  1ZBV A;  1M5Y A;  3ARU A;  3O5F A;  3UQB A;  1NMW A;  3RGC A;  2RUC A;  1FFQ A;  1K9T A;  1PBK A;  4MNK A;  4NSB A;  1E9L A;  3O5Q A;  1D7H A;  1O6I A;  1C9H A;  3JYJ A;  3ARV A;  1JNE A;  3JXV A;  1HXV A;  4Z2J A;  2XP8 A;  1X6L A;  3CGN A;  4Q7N A;  4WK9 A;  3KAB A;  1W9V A;  4N19 A;  4MAV A;  1HJW A;  1XRV A;  5I98 A;  4QIB A;  1ZCN A;  1BL4 A;  3OOB A;  2DG3 A;  1X6N A;  4TW7 A;  4G50 A;  2ZQS A;  4NNR A;  2PV2 A;  3I6C A;  4J4N A;  4QZV B;  1J4H A;  3CGM A;  1IX5 A;  2RUR A;  4ODQ A;  4DRK A;  1GOI A;  1ZBW A;  1RD6 A;  1W1Y A;  4JFK A;  3B8S A;  3KAD A;  2M08 A;  2MF9 A;  2IF4 A;  1YW5 A;  4DZ2 A;  4R5E A;  1D7I A;  4P8U A;  2PBC A;  2ITK A;  3WH0 A;  1E6Z A;  3IHZ A;  3ALG A;  2LPV A;  4TYO A;  5HW6 A;  2OLH A;  2YBU A;  3ARZ A;  2D9F A;  5DIT A;  1LJY A;  2LKN A;  3O5E A;  4TX0 A;  4MSP A;  2A3B A;  4LAW A;  4ML4 A;  3WD1 A;  4NZC A;  2DG4 A;  4ZPT R;  1W1V A;  4DRP A;  4WKF A;  1GPF A;  2PI6 A;  4G2P A;  3RFW A;  5DO2 A;  4IPX A;  4ZPV R;  2DSZ A;  1VF8 A;  3AS1 A;  4ITZ A;  2DT3 A;  1Y0O A;  1NWU A;  5HUA A;  1FKH A;  4IT4 A;  3ARR A;  1Q1C A;  1A7X A;  1B6C A;  1N1A A;  2AWG A;  2LGO A;  5HWC A;  1WNO A;  5GPG A;  2LJ4 A;  3O5D A;  4FN2 A;  4IQC A;  1ZL1 A;  3FAP A;  1TFV A;  4L72 B;  3GPK A;  2DPE A;  1W9P A;  3UI6 A;  3JYM A;  1F40 A;  2F21 A;  4MNM A;  2RUQ A;  3UQI A;  1EIB A;  1W9U A;  3NI6 A;  3RME A;  2KGJ A;  3O5P A;  3TCZ A;  1FKB A;  1JVW A;  1PIN A;  2KE0 A;  3PR9 A;  3ARP A;  3NTP A;  2FDM A;  4P8W A;  1W1P A;  3KCE A;  3ARS A;  4J4O A;  1LG1 A;  1NMV A;  2XPA A;  2ZQV A;  1NH6 A;  4S3K A;  3ARW A;  2ZQT A;  3ALF A;  3WKZ A;  3WQW A;  2ESC A;  5JH8 A;  4DH0 A;  5GQB A;  3O5J A;  4HBE A;  1F8A B;  2KR7 A;  2MNT A;  4KQZ A;  1ZU8 A;  4XAK A;  4W9P A;  4JYS A;  4IQ2 A;  1H0I A;  2KI3 A;  4ODM A;  1BKF A;  1ZBC A;  1JNT A;  1HJV A;  1JND A;  3FXY A;  2RQS A;  3H9R B;  4ZPW R;  1D2K A;  3ODK A;  3KAH A;  3WL1 A;  1WAW A;  3UI4 A;  2Y78 A;  3O5K A;  1HJX A;  4LAV A;  4WKH A;  4O2T A;  2F2D A;  2VN1 A;  1LL7 A;  1QPF A;  3O5L A;  2A3A A;  4LAX A;  3ARY A;  2ZQU A;  1E6R A;  3B9D A;  4L3N A;  4TNS A;  4Z2I A;  1CTN A;  2XP4 A;  3KAI A;  3NRK A;  2O92 A;  3BXW A;  5DEZ A;  4DRJ A;  4FAP A;  1JNS A;  3O5M A;  3B7X A;  4QT3 A;  3OA5 A;  1FKS A;  2ZR6 A;  4KR0 B;  3AQU A;  1EQ3 A;  2IUZ A;  3CZ8 A;  3UI5 A;  1E6N A;  4DIP A;  4TW8 A;  1D6O A;  4U85 A;  4DRO A;  4JFM A;  5GPR A;  1Q6I A;  2PV3 A;  4URI A;  2YBT A;  1ITX A;  1NSG A;  1HKK A;  1FKI A;  1ZB5 A;  4ODO A;  4DRI A;  2MLY A;  2XP7 A;  5HW8 A;  1HKI A;  5HBF A;  2ZR5 A;  1SYT A;  4GGQ A;  4MNL A;  2OFN A;  1P5Q A;  2N87 A;  3IKD A;  3AS3 A;  1HKJ A;  4WJX A;  4DT4 A;  3AS2 A;  5DIV A;  4JFI A;  1FKG A;  1J6Y A;  2WK2 A;  3CHD A;  1L1P A;  2M2A A;  1EHN A;  1FKD A;  1HKM A;  2A3E A;  1LQ0 A;  4MGV A;  4MPK A;  3LUO A;  4Q22 A;  3PA7 A;  5B8I C;  3G6M A;  1OWQ A;  1SR0 A;  1R9H A;  1U79 A;  4DZ3 A;  3WD4 A;  1NWT A;  2MLZ A;  1XHG A;  4HBO A;  2VCD A;  1D7J A;  3CHF A;  3RM9 A;  2RSE A;  3O5R A;  5J6E A;  4TW6 A;  1YAT A;  2MPH A;  4ZS6 A;  1J4I A;  3VAW A;  1ROU A;  4DWS C;  1ZBK A;  2AOS A;  1KFW A;  5DF0 A;  1T11 A;  1NWR A;  3TDB A;  1W1T A;  1QPL A;  4P8X A;  4IT6 A;  4LGX A;  3WQV A;  3PRB A;  4BF8 A;  2DG9 A;  4ODK A;  2G41 A;  1FKR A;  1E15 A;  2DSW A;  4DRN A;  4Z2H A;  1EYM A;  1FKK A;  3TC5 A;  1UR8 A;  3B9A A;  1Q6U A;  3KAG A;  3WL0 A;  5HT1 A;  2XPB A;  3RM8 A;  5D75 A;  4DRH A;  4WIW A;  3AS0 A;  2PV1 A;  2L2S A;  2FKE A;  3KAC A;  3ARQ A;  4W9Q A;  2F4E A;  3PRD A;  5HTG A;  2QF8 A;  1FFR A;  3PRA A;  2XP3 A;  2ZR4 A;  4PTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...