4ODNA

Structure of slyd from thermus thermophilus in complex with s2-plus peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 32
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odnA00
1FAPA 4DROA 1FKJA 2RURA 5HW8A 1QPLA 4U85A 4ODNA 1T11A 3OOBA 1FKDA 2FKEA 1YW5A 2ZQUA 4DRMA 2K8IA 4DRHA 4DRPA 1Q6UA 3JYMA 3LUOA 5B8IC 3TDBA 3WH0A 1P5QA 1W26A 3TC5A 3O5GA 1FKRA 1BKFA 1HXVA 2RQSA 3UI6A 2ZR6A 4LAXA 1EYMA 3UI4A 2OFNA 1U79A 3O5LA 2PBCA 1C9HA 1QPFA 1ZCNA 2DG9A 2MNTA 3B7XA 3RFWA 3UF8A 1L1PA 5I98A 2XP3A 4G50A 1M5YA 1JNSA 1Q6IA 2IF4A 2L2SA 4C02B 4ODKA 4MSPA 4W9OA 2KR7A 2XP6A 4QT2A 2PPOA 4DZ3A 2RUDA 5HW7A 4U86A 3KAFA 5DITA 1D6OA 3KAIA 2FAPA 5HWBA 3CGNA 1FKGA 2Y78A 5HKGA 2UZ5A 5J6EA 1Q1CA 2ZQVA 1ZK6A 2MF9A 4FN2A 3PRBA 2N87A 4ODOA 1J4HA 3JYJA 1JNTA 2XP4A 3O5KA 4IQ2A 4ODQA 4IQCA 3UQBA 4TX0A 2ZQTA 4QIBA 2F21A 1FKLA 2PV2A 3O5PA 4TW6A 1Y0OA 1F8AB 2LJ4A 2ZQSA 2KE0A 3O5FA 5HT1A 4JYSA 4LAWA 4FAPA 4JFKA 5HW6A 2LKNA 1NSGA 5HWCA 3NRKA 5DIVA 4ITZA 3UI5A 3IKGA 1R9HA 4U84A 1FKTA 3O5EA 2XP9A 3NI6A 1FJDA 4MGVA 2MLXA 3I6CA 3IHZA 1KT0A 3PRDA 2ZR5A 2KO7A 3KZ7A 4TW7A 1B6CA 1N1AA 4DT4A 4GIVA 1FKIA 1PBKA 2PPNA 2MLYA 2XP5A 1D7HA 2RUCA 4O2TA 2DG4A 3NTPA 2M2AA 3O5OA 4DRJA 4IPXA 3O5IA 3KAGA 4JFLA 4W9QA 2AWGA 4GGQA 1J4IA 2M1IA 4NNRA 4W9PA 2M08A 1D7JA 3H9RB 3O5RA 5HTGA 5D75A 3TCZA 1TCOC 3VAWA 2PPPA 5GPGA 3RGCA 2VCDA 1Q6HA 1EQ3A 2KGJA 4ODRA 1ROTA 4TNSA 3O5JA 3PA7A 5DIUA 1FKKA 3MDYB 4LAYA 2PV1A 2RUQA 1NMWA 3UQIA 4DRNA 1JVWA 2KFWA 2LPVA 1YATA 4DH0A 3O5MA 1FKFA 3CGMA 3KADA 3O5QA 2DG3A 4DIPA 5BXJA 3KACA 3EY6A 2ITKA 4ODMA 4TYOA 4JFMA 2MLZA 4ODPA 2XPBA 1BL4A 2RSEA 4QT3A 4BF8A 2D9FA 5HUAA 4TW8A 4JFJA 3FAPA 1NMVA 3KCEA 2LGOA 4JFIA 1QZ2A 1FD9A 2ZR4A 3GPKA 1FKHA 1A7XA 4G2PA 2XP7A 4R0XA 3KABA 4ODLA 1J6YA 3O5DA 4J4OA 2XP8A 1FKSA 1KT1A 4LAVA 3IKDA 3UQAA 1FKBA 2XPAA 3IK8A 4DZ2A 4DRIA 4DRQA 1F40A 2JZVA 1ROUA 2F4EA 2KI3A 4N19A 3JXVA 1D7IA 3ODKA 4J4NA 2F2DA 2VN1A 4DRKA 1PINA 1J4RA 3KAHA 2PV3A 2MPHA 2Q5AA
chains in the Genus database with same CATH superfamily
4U85A 4ODNA 1T11A 4WK9A 1FKDA 4DRHA 2ZQUA 4DRPA 3B9DA 2A3CA 1LG2A 4ZPWR 3TC5A 4DWSA 3ARVA 4L72B 1BKFA 4NZCA 1HKJA 4LAXA 4HBOA 4MNMA 3ARSA 2MNTA 3RFWA 4ZPVR 2IF4A 4MSPA 2KR7A 1LL4A 2XP6A 1FFQA 2AOSA 2EULA 5DITA 4Q22A 5DEZA 1GOIA 1FKGA 2Y78A 1ZBCA 2WM0A 5HBFA 3WD1A 3PRBA 3JYJA 3O5KA 3WL0A 3UQBA 4TX0A 3OA5A 2DSUA 2F21A 1F8AB 2KE0A 4JYSA 1X6NA 1KFWA 5DIVA 2PI6A 3O5EA 3NI6A 1FJDA 4MGVA 2IUZA 2A3BA 2ZR5A 1NWTA 1W1TA 2MLYA 3NTPA 4P8UA 4IPXA 3O5IA 3KAGA 4LGXA 2G8ZA 1EHNA 4NNRA 3GTYX 5GPRA 3H9RB 1EDQA 3TCZA 4WKAA 1X6LA 1JCHB 5DIUA 5DF0A 3MDYB 4LAYA 2PV1A 2RUQA 2B5UB 2LPVA 4XAKA 1FKFA 3O5QA 2F23A 4JFMA 4KR0B 2P4VA 3ARZA 3FAPA 2LGOA 3GPKA 1NWRA 1FKHA 4Z2JA 3BXWA 1NWSA 2WLZA 2XPAA 4DZ2A 2F4EA 3B8SA 2MPHA 1W1YA 4Q7NA 3O5RA 4DWSD 2RURA 3OOBA 2FKEA 4IT4A 3CHDA 3O5GA 3WD2A 3B9AA 3UI6A 1GPFA 1HKKA 1GUVA 2DSZA 2PBCA 1QPFA 2DG9A 1UR9A 3B7XA 5I98A 1ZBVA 3WD0A 1JNSA 4DROA 3AROA 4W9OA 4QT2A 5GQBA 1K9TA 2RUDA 3CGNA 4R5EA 5J6EA 3QOKA 1ZK6A 4KQZA 1ZBWA 4FN2A 2XP4A 2ZQTA 4QIBA 3O5PA 4HARA 4TW6A 1Y0OA 1E44A 2DT3A 3G6LA 3PR9A 1W1PA 3I6CA 3IHZA 1KT0A 5DO2A 2KO7A 1B6CA 1N1AA 4NSBA 4W5UA 4GIVA 1PBKA 2PPNA 1E6ZA 2XP5A 2DG4A 3ARYA 4DRJA 4JFLA 1RD6A 4W9QA 2ETNA 2YBUA 5D75A 4P8VA 2PPPA 1XRVA 1SYTA 3PRAA 2KGJA 1SR0A 4TNSA 3PA7A 2O92A 3CHEA 1FFRA 4DRNA 3UQIA 1JVWA 3KADA 1NH6A 2ITKA 1LG1A 4ODPA 2XPBA 1E15A 3EIPA 1NMVA 4JFIA 1QZ2A 1LL6A 2XP7A 3O5DA 4LAVA 4L3NA 4Z2LA 4IT6A 1FKBA 2JZVA 3ODKA 2VN1A 2DT0A 2DSVA 2QF8A 4TYOA 5HW8A 3FY1A 1QPLA 1F40A 4DRMA 1Q6UA 3JYMA 3W4RA 3LUOA 5B8IC 3WH0A 2RQSA 3CHCA 1WB0A 3UI4A 2OFNA 1ZCNA 4ZPTR 1HKIA 3UF8A 4WIWA 1M5YA 4C02B 4DZ3A 3RM4A 5HW7A 3KAFA 3KAIA 2FAPA 4MNJA 4WKFA 3WQWA 5HKGA 2UZ5A 1ZBKA 1Q1CA 2ZQVA 2MF9A 3ARTA 2N87A 4ODOA 3WKZA 4IQ2A 3ALFA 3CH9A 1FKLA 2PV2A 2LJ4A 3O5FA 5HT1A 4LAWA 4JFKA 5HWCA 1W9UA 3UI5A 3IKGA 1E6RA 4U84A 1FKTA 3BMBA 3WD3A 2MLXA 1W9PA 1FKIA 3WIJA 1GRJA 2RUCA 2M2AA 1LJYA 1ZU8A 4Z2IA 3ARWA 1W9VA 4HBEA 1ZB5A 1J4IA 2M1IA 4W9PA 1E6PA 2PN0A 1HJVA 1TCOC 1CTNA 3RGCA 4Z2GA 1Q6HA 4ODRA 3O5JA 1FKKA 1NMWA 1YATA 5BXJA 4DIPA 2DG3A 3EY6A 2DPEA 1BL4A 2RSEA 4QT3A 4QZVB 2O9OA 4ML4A 1UR8A 3ARXA 4P8WA 4BF8A 5HUAA 1JNEA 1E6NA 3KCEA 1EIBA 1XHGA 1FD9A 1A7XA 3ARRA 2DSWA 3KABA 4R0XA 1HJWA 1FKSA 3RM9A 1KT1A 1W1VA 3IKDA 3IK8A 2KI3A 2WK2A 4N19A 1OGBA 3JXVA 4AY1A 2F2DA 4DRKA 1PINA 2PV3A 4WJXA 1FAPA 1FKJA 1YW5A 4URIA 2K8IA 2YBTA 3ARPA 3TDBA 1P5QA 1W26A 1LQ0A 2FDMA 1HXVA 2ESCA 2ZR6A 1EYMA 4S3JA 3O5LA 1U79A 4Z2KA 1C9HA 2A3AA 2XP3A 4G50A 3ARQA 1E9LA 1Q6IA 2L2SA 4ODKA 4MNKA 5JH8A 2PPOA 3GU0A 4U86A 1D6OA 5HWBA 2G41A 4ZS6A 4WKHA 4P8XA 3AS3A 4MNLA 1D2KA 3WL1A 1J4HA 3AQUA 1JNTA 2DT2A 4ODQA 4IQCA 1H0GA 2ZQSA 5HW6A 3AS1A 4FAPA 4UDMA 2LKNA 1NSGA 4DWSB 3NRKA 4ITZA 1R9HA 1O6IA 1ITXA 2XP9A 2OLHA 1JNDA 3PRDA 4TW7A 3KZ7A 4DT4A 3ARUA 3RMEA 1D7HA 4O2TA 1TFVA 1VF8A 3O5OA 2WLYA 1OGGA 1OWQA 2AWGA 3B9EA 4GGQA 2M08A 3CHFA 1D7JA 1WAWA 5HTGA 3VAWA 5GPGA 4DWSC 2VCDA 1EQ3A 1ROTA 1L1PA 1FKRA 1ZL1A 2KFWA 4DH0A 3O5MA 3CGMA 3AS0A 3KACA 4ODMA 1LL7A 2MLZA 4PTMA 2DT1A 2D9FA 3FXYA 4MPKA 4TW8A 4JFJA 3WD4A 2A3EA 4MTVA 2ZR4A 4MAVA 3CZ8A 4S3KA 3WQVA 4G2PA 2B31A 4Z2HA 4ODLA 1HJXA 1IX5A 1J6YA 4J4OA 2XP8A 1HKMA 3UQAA 3RM8A 3G6MA 4DRIA 1H0IA 4DRQA 1ROUA 3AS2A 1NWUA 1D7IA 4J4NA 3ALGA 1WNOA 1J4RA 3KAHA 2Q5AA
chains in the Genus database with same CATH topology
4U85A 4ODNA 1T11A 4WK9A 1FKDA 4DRHA 2ZQUA 4DRPA 3B9DA 2A3CA 1LG2A 4ZPWR 3TC5A 4DWSA 3ARVA 4L72B 1BKFA 4NZCA 1HKJA 4LAXA 4HBOA 4MNMA 3ARSA 2MNTA 3RFWA 4ZPVR 2IF4A 4MSPA 2KR7A 1LL4A 2XP6A 1FFQA 2AOSA 5DITA 4Q22A 5DEZA 1GOIA 1FKGA 2Y78A 1ZBCA 2WM0A 5HBFA 3WD1A 3PRBA 3JYJA 3O5KA 3WL0A 3UQBA 4TX0A 3OA5A 2DSUA 2F21A 1F8AB 2KE0A 4JYSA 1X6NA 1KFWA 5DIVA 2PI6A 3O5EA 3NI6A 1FJDA 4MGVA 2IUZA 2A3BA 2ZR5A 1NWTA 1W1TA 2MLYA 3NTPA 4P8UA 4IPXA 3O5IA 3KAGA 4LGXA 2G8ZA 1EHNA 4NNRA 5GPRA 3H9RB 1EDQA 3TCZA 4WKAA 1X6LA 5DIUA 5DF0A 3MDYB 4LAYA 2PV1A 2RUQA 2LPVA 4XAKA 1FKFA 3O5QA 4JFMA 4KR0B 3ARZA 3FAPA 2LGOA 3GPKA 1NWRA 1FKHA 4Z2JA 3BXWA 1NWSA 2WLZA 2XPAA 4DZ2A 2F4EA 3B8SA 2MPHA 1W1YA 4Q7NA 3O5RA 4DWSD 2RURA 3OOBA 2FKEA 4IT4A 3CHDA 3O5GA 3WD2A 3B9AA 3UI6A 1GPFA 1HKKA 1GUVA 2DSZA 2PBCA 1QPFA 2DG9A 1UR9A 3B7XA 5I98A 1ZBVA 3WD0A 1JNSA 4DROA 3AROA 4W9OA 4QT2A 5GQBA 1K9TA 2RUDA 3CGNA 4R5EA 5J6EA 3QOKA 1ZK6A 4KQZA 1ZBWA 4FN2A 2XP4A 2ZQTA 4QIBA 3O5PA 4HARA 4TW6A 1Y0OA 2DT3A 3G6LA 3PR9A 1W1PA 3I6CA 3IHZA 1KT0A 5DO2A 2KO7A 1B6CA 1N1AA 4NSBA 4W5UA 4GIVA 1PBKA 2PPNA 1E6ZA 2XP5A 2DG4A 3ARYA 4DRJA 4JFLA 1RD6A 4W9QA 2YBUA 5D75A 4P8VA 2PPPA 1XRVA 1SYTA 3PRAA 2KGJA 1SR0A 4TNSA 3PA7A 2O92A 3CHEA 1FFRA 4DRNA 3UQIA 1JVWA 3KADA 1NH6A 2ITKA 1LG1A 4ODPA 2XPBA 1E15A 1NMVA 4JFIA 1QZ2A 1LL6A 2XP7A 3O5DA 4LAVA 4L3NA 4Z2LA 4IT6A 1FKBA 2JZVA 3ODKA 2VN1A 2DT0A 2DSVA 2QF8A 4TYOA 5HW8A 3FY1A 1QPLA 1F40A 4DRMA 1Q6UA 3JYMA 3W4RA 3LUOA 5B8IC 3WH0A 2RQSA 3CHCA 1WB0A 3UI4A 2OFNA 1ZCNA 4ZPTR 1HKIA 3UF8A 4WIWA 1M5YA 4C02B 4DZ3A 3RM4A 5HW7A 3KAFA 3KAIA 2FAPA 4MNJA 4WKFA 3WQWA 5HKGA 2UZ5A 1ZBKA 1Q1CA 2ZQVA 2MF9A 3ARTA 2N87A 4ODOA 3WKZA 4IQ2A 3ALFA 3CH9A 1FKLA 2PV2A 2LJ4A 3O5FA 5HT1A 4LAWA 4JFKA 5HWCA 1W9UA 3UI5A 3IKGA 1E6RA 4U84A 1FKTA 3WD3A 2MLXA 1W9PA 1FKIA 3WIJA 2RUCA 2M2AA 1LJYA 1ZU8A 4Z2IA 3ARWA 1W9VA 4HBEA 1ZB5A 1J4IA 2M1IA 4W9PA 1E6PA 1HJVA 1TCOC 1CTNA 3RGCA 4Z2GA 1Q6HA 4ODRA 3O5JA 1FKKA 1NMWA 1YATA 5BXJA 4DIPA 2DG3A 3EY6A 2DPEA 1BL4A 2RSEA 4QT3A 4QZVB 2O9OA 4ML4A 1UR8A 3ARXA 4P8WA 4BF8A 5HUAA 1JNEA 1E6NA 3KCEA 1EIBA 1XHGA 1FD9A 1A7XA 3ARRA 2DSWA 3KABA 4R0XA 1HJWA 1FKSA 3RM9A 1KT1A 1W1VA 3IKDA 3IK8A 2KI3A 2WK2A 4N19A 1OGBA 3JXVA 4AY1A 2F2DA 4DRKA 1PINA 2PV3A 4WJXA 1FAPA 1FKJA 1YW5A 4URIA 2K8IA 2YBTA 3ARPA 3TDBA 1P5QA 1W26A 1LQ0A 2FDMA 1HXVA 2ESCA 2ZR6A 1EYMA 4S3JA 3O5LA 1U79A 4Z2KA 1C9HA 2A3AA 2XP3A 4G50A 3ARQA 1E9LA 1Q6IA 2L2SA 4ODKA 4MNKA 5JH8A 2PPOA 4U86A 1D6OA 5HWBA 2G41A 4ZS6A 4WKHA 4P8XA 3AS3A 4MNLA 1D2KA 3WL1A 1J4HA 3AQUA 1JNTA 2DT2A 4ODQA 4IQCA 1H0GA 2ZQSA 5HW6A 3AS1A 4FAPA 2LKNA 1NSGA 4DWSB 3NRKA 4ITZA 1R9HA 1O6IA 1ITXA 2XP9A 2OLHA 1JNDA 3PRDA 4TW7A 3KZ7A 4DT4A 3ARUA 3RMEA 1D7HA 4O2TA 1TFVA 1VF8A 3O5OA 2WLYA 1OGGA 1OWQA 2AWGA 3B9EA 4GGQA 2M08A 3CHFA 1D7JA 1WAWA 5HTGA 3VAWA 5GPGA 4DWSC 2VCDA 1EQ3A 1ROTA 1L1PA 1FKRA 1ZL1A 2KFWA 4DH0A 3O5MA 3CGMA 3AS0A 3KACA 4ODMA 1LL7A 2MLZA 4PTMA 2DT1A 2D9FA 3FXYA 4MPKA 4TW8A 4JFJA 3WD4A 2A3EA 4MTVA 2ZR4A 4MAVA 3CZ8A 4S3KA 3WQVA 4G2PA 2B31A 4Z2HA 4ODLA 1HJXA 1IX5A 1J6YA 4J4OA 2XP8A 1HKMA 3UQAA 3RM8A 3G6MA 4DRIA 1H0IA 4DRQA 1ROUA 3AS2A 1NWUA 1D7IA 4J4NA 3ALGA 1WNOA 1J4RA 3KAHA 2Q5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAP A;  4DRO A;  1FKJ A;  2RUR A;  5HW8 A;  1QPL A;  4U85 A;  4ODN A;  1T11 A;  3OOB A;  1FKD A;  2FKE A;  1YW5 A;  2ZQU A;  4DRM A;  2K8I A;  4DRH A;  4DRP A;  1Q6U A;  3JYM A;  3LUO A;  5B8I C;  3TDB A;  3WH0 A;  1P5Q A;  1W26 A;  3TC5 A;  3O5G A;  1FKR A;  1BKF A;  1HXV A;  2RQS A;  3UI6 A;  2ZR6 A;  4LAX A;  1EYM A;  3UI4 A;  2OFN A;  1U79 A;  3O5L A;  2PBC A;  1C9H A;  1QPF A;  1ZCN A;  2DG9 A;  2MNT A;  3B7X A;  3RFW A;  3UF8 A;  1L1P A;  5I98 A;  2XP3 A;  4G50 A;  1M5Y A;  1JNS A;  1Q6I A;  2IF4 A;  2L2S A;  4C02 B;  4ODK A;  4MSP A;  4W9O A;  2KR7 A;  2XP6 A;  4QT2 A;  2PPO A;  4DZ3 A;  2RUD A;  5HW7 A;  4U86 A;  3KAF A;  5DIT A;  1D6O A;  3KAI A;  2FAP A;  5HWB A;  3CGN A;  1FKG A;  2Y78 A;  5HKG A;  2UZ5 A;  5J6E A;  1Q1C A;  2ZQV A;  1ZK6 A;  2MF9 A;  4FN2 A;  3PRB A;  2N87 A;  4ODO A;  1J4H A;  3JYJ A;  1JNT A;  2XP4 A;  3O5K A;  4IQ2 A;  4ODQ A;  4IQC A;  3UQB A;  4TX0 A;  2ZQT A;  4QIB A;  2F21 A;  1FKL A;  2PV2 A;  3O5P A;  4TW6 A;  1Y0O A;  1F8A B;  2LJ4 A;  2ZQS A;  2KE0 A;  3O5F A;  5HT1 A;  4JYS A;  4LAW A;  4FAP A;  4JFK A;  5HW6 A;  2LKN A;  1NSG A;  5HWC A;  3NRK A;  5DIV A;  4ITZ A;  3UI5 A;  3IKG A;  1R9H A;  4U84 A;  1FKT A;  3O5E A;  2XP9 A;  3NI6 A;  1FJD A;  4MGV A;  2MLX A;  3I6C A;  3IHZ A;  1KT0 A;  3PRD A;  2ZR5 A;  2KO7 A;  3KZ7 A;  4TW7 A;  1B6C A;  1N1A A;  4DT4 A;  4GIV A;  1FKI A;  1PBK A;  2PPN A;  2MLY A;  2XP5 A;  1D7H A;  2RUC A;  4O2T A;  2DG4 A;  3NTP A;  2M2A A;  3O5O A;  4DRJ A;  4IPX A;  3O5I A;  3KAG A;  4JFL A;  4W9Q A;  2AWG A;  4GGQ A;  1J4I A;  2M1I A;  4NNR A;  4W9P A;  2M08 A;  1D7J A;  3H9R B;  3O5R A;  5HTG A;  5D75 A;  3TCZ A;  1TCO C;  3VAW A;  2PPP A;  5GPG A;  3RGC A;  2VCD A;  1Q6H A;  1EQ3 A;  2KGJ A;  4ODR A;  1ROT A;  4TNS A;  3O5J A;  3PA7 A;  5DIU A;  1FKK A;  3MDY B;  4LAY A;  2PV1 A;  2RUQ A;  1NMW A;  3UQI A;  4DRN A;  1JVW A;  2KFW A;  2LPV A;  1YAT A;  4DH0 A;  3O5M A;  1FKF A;  3CGM A;  3KAD A;  3O5Q A;  2DG3 A;  4DIP A;  5BXJ A;  3KAC A;  3EY6 A;  2ITK A;  4ODM A;  4TYO A;  4JFM A;  2MLZ A;  4ODP A;  2XPB A;  1BL4 A;  2RSE A;  4QT3 A;  4BF8 A;  2D9F A;  5HUA A;  4TW8 A;  4JFJ A;  3FAP A;  1NMV A;  3KCE A;  2LGO A;  4JFI A;  1QZ2 A;  1FD9 A;  2ZR4 A;  3GPK A;  1FKH A;  1A7X A;  4G2P A;  2XP7 A;  4R0X A;  3KAB A;  4ODL A;  1J6Y A;  3O5D A;  4J4O A;  2XP8 A;  1FKS A;  1KT1 A;  4LAV A;  3IKD A;  3UQA A;  1FKB A;  2XPA A;  3IK8 A;  4DZ2 A;  4DRI A;  4DRQ A;  1F40 A;  2JZV A;  1ROU A;  2F4E A;  2KI3 A;  4N19 A;  3JXV A;  1D7I A;  3ODK A;  4J4N A;  2F2D A;  2VN1 A;  4DRK A;  1PIN A;  1J4R A;  3KAH A;  2PV3 A;  2MPH A;  2Q5A A; 
#chains in the Genus database with same CATH topology
 4U85 A;  4ODN A;  1T11 A;  4WK9 A;  1FKD A;  4DRH A;  2ZQU A;  4DRP A;  3B9D A;  2A3C A;  1LG2 A;  4ZPW R;  3TC5 A;  4DWS A;  3ARV A;  4L72 B;  1BKF A;  4NZC A;  1HKJ A;  4LAX A;  4HBO A;  4MNM A;  3ARS A;  2MNT A;  3RFW A;  4ZPV R;  2IF4 A;  4MSP A;  2KR7 A;  1LL4 A;  2XP6 A;  1FFQ A;  2AOS A;  2EUL A;  5DIT A;  4Q22 A;  5DEZ A;  1GOI A;  1FKG A;  2Y78 A;  1ZBC A;  2WM0 A;  5HBF A;  3WD1 A;  3PRB A;  3JYJ A;  3O5K A;  3WL0 A;  3UQB A;  4TX0 A;  3OA5 A;  2DSU A;  2F21 A;  1F8A B;  2KE0 A;  4JYS A;  1X6N A;  1KFW A;  5DIV A;  2PI6 A;  3O5E A;  3NI6 A;  1FJD A;  4MGV A;  2IUZ A;  2A3B A;  2ZR5 A;  1NWT A;  1W1T A;  2MLY A;  3NTP A;  4P8U A;  4IPX A;  3O5I A;  3KAG A;  4LGX A;  2G8Z A;  1EHN A;  4NNR A;  3GTY X;  5GPR A;  3H9R B;  1EDQ A;  3TCZ A;  4WKA A;  1X6L A;  1JCH B;  5DIU A;  5DF0 A;  3MDY B;  4LAY A;  2PV1 A;  2RUQ A;  2B5U B;  2LPV A;  4XAK A;  1FKF A;  3O5Q A;  2F23 A;  4JFM A;  4KR0 B;  2P4V A;  3ARZ A;  3FAP A;  2LGO A;  3GPK A;  1NWR A;  1FKH A;  4Z2J A;  3BXW A;  1NWS A;  2WLZ A;  2XPA A;  4DZ2 A;  2F4E A;  3B8S A;  2MPH A;  1W1Y A;  4Q7N A;  3O5R A;  4DWS D;  2RUR A;  3OOB A;  2FKE A;  4IT4 A;  3CHD A;  3O5G A;  3WD2 A;  3B9A A;  3UI6 A;  1GPF A;  1HKK A;  1GUV A;  2DSZ A;  2PBC A;  1QPF A;  2DG9 A;  1UR9 A;  3B7X A;  5I98 A;  1ZBV A;  3WD0 A;  1JNS A;  4DRO A;  3ARO A;  4W9O A;  4QT2 A;  5GQB A;  1K9T A;  2RUD A;  3CGN A;  4R5E A;  5J6E A;  3QOK A;  1ZK6 A;  4KQZ A;  1ZBW A;  4FN2 A;  2XP4 A;  2ZQT A;  4QIB A;  3O5P A;  4HAR A;  4TW6 A;  1Y0O A;  1E44 A;  2DT3 A;  3G6L A;  3PR9 A;  1W1P A;  3I6C A;  3IHZ A;  1KT0 A;  5DO2 A;  2KO7 A;  1B6C A;  1N1A A;  4NSB A;  4W5U A;  4GIV A;  1PBK A;  2PPN A;  1E6Z A;  2XP5 A;  2DG4 A;  3ARY A;  4DRJ A;  4JFL A;  1RD6 A;  4W9Q A;  2ETN A;  2YBU A;  5D75 A;  4P8V A;  2PPP A;  1XRV A;  1SYT A;  3PRA A;  2KGJ A;  1SR0 A;  4TNS A;  3PA7 A;  2O92 A;  3CHE A;  1FFR A;  4DRN A;  3UQI A;  1JVW A;  3KAD A;  1NH6 A;  2ITK A;  1LG1 A;  4ODP A;  2XPB A;  1E15 A;  3EIP A;  1NMV A;  4JFI A;  1QZ2 A;  1LL6 A;  2XP7 A;  3O5D A;  4LAV A;  4L3N A;  4Z2L A;  4IT6 A;  1FKB A;  2JZV A;  3ODK A;  2VN1 A;  2DT0 A;  2DSV A;  2QF8 A;  4TYO A;  5HW8 A;  3FY1 A;  1QPL A;  1F40 A;  4DRM A;  1Q6U A;  3JYM A;  3W4R A;  3LUO A;  5B8I C;  3WH0 A;  2RQS A;  3CHC A;  1WB0 A;  3UI4 A;  2OFN A;  1ZCN A;  4ZPT R;  1HKI A;  3UF8 A;  4WIW A;  1M5Y A;  4C02 B;  4DZ3 A;  3RM4 A;  5HW7 A;  3KAF A;  3KAI A;  2FAP A;  4MNJ A;  4WKF A;  3WQW A;  5HKG A;  2UZ5 A;  1ZBK A;  1Q1C A;  2ZQV A;  2MF9 A;  3ART A;  2N87 A;  4ODO A;  3WKZ A;  4IQ2 A;  3ALF A;  3CH9 A;  1FKL A;  2PV2 A;  2LJ4 A;  3O5F A;  5HT1 A;  4LAW A;  4JFK A;  5HWC A;  1W9U A;  3UI5 A;  3IKG A;  1E6R A;  4U84 A;  1FKT A;  3BMB A;  3WD3 A;  2MLX A;  1W9P A;  1FKI A;  3WIJ A;  1GRJ A;  2RUC A;  2M2A A;  1LJY A;  1ZU8 A;  4Z2I A;  3ARW A;  1W9V A;  4HBE A;  1ZB5 A;  1J4I A;  2M1I A;  4W9P A;  1E6P A;  2PN0 A;  1HJV A;  1TCO C;  1CTN A;  3RGC A;  4Z2G A;  1Q6H A;  4ODR A;  3O5J A;  1FKK A;  1NMW A;  1YAT A;  5BXJ A;  4DIP A;  2DG3 A;  3EY6 A;  2DPE A;  1BL4 A;  2RSE A;  4QT3 A;  4QZV B;  2O9O A;  4ML4 A;  1UR8 A;  3ARX A;  4P8W A;  4BF8 A;  5HUA A;  1JNE A;  1E6N A;  3KCE A;  1EIB A;  1XHG A;  1FD9 A;  1A7X A;  3ARR A;  2DSW A;  3KAB A;  4R0X A;  1HJW A;  1FKS A;  3RM9 A;  1KT1 A;  1W1V A;  3IKD A;  3IK8 A;  2KI3 A;  2WK2 A;  4N19 A;  1OGB A;  3JXV A;  4AY1 A;  2F2D A;  4DRK A;  1PIN A;  2PV3 A;  4WJX A;  1FAP A;  1FKJ A;  1YW5 A;  4URI A;  2K8I A;  2YBT A;  3ARP A;  3TDB A;  1P5Q A;  1W26 A;  1LQ0 A;  2FDM A;  1HXV A;  2ESC A;  2ZR6 A;  1EYM A;  4S3J A;  3O5L A;  1U79 A;  4Z2K A;  1C9H A;  2A3A A;  2XP3 A;  4G50 A;  3ARQ A;  1E9L A;  1Q6I A;  2L2S A;  4ODK A;  4MNK A;  5JH8 A;  2PPO A;  3GU0 A;  4U86 A;  1D6O A;  5HWB A;  2G41 A;  4ZS6 A;  4WKH A;  4P8X A;  3AS3 A;  4MNL A;  1D2K A;  3WL1 A;  1J4H A;  3AQU A;  1JNT A;  2DT2 A;  4ODQ A;  4IQC A;  1H0G A;  2ZQS A;  5HW6 A;  3AS1 A;  4FAP A;  4UDM A;  2LKN A;  1NSG A;  4DWS B;  3NRK A;  4ITZ A;  1R9H A;  1O6I A;  1ITX A;  2XP9 A;  2OLH A;  1JND A;  3PRD A;  4TW7 A;  3KZ7 A;  4DT4 A;  3ARU A;  3RME A;  1D7H A;  4O2T A;  1TFV A;  1VF8 A;  3O5O A;  2WLY A;  1OGG A;  1OWQ A;  2AWG A;  3B9E A;  4GGQ A;  2M08 A;  3CHF A;  1D7J A;  1WAW A;  5HTG A;  3VAW A;  5GPG A;  4DWS C;  2VCD A;  1EQ3 A;  1ROT A;  1L1P A;  1FKR A;  1ZL1 A;  2KFW A;  4DH0 A;  3O5M A;  3CGM A;  3AS0 A;  3KAC A;  4ODM A;  1LL7 A;  2MLZ A;  4PTM A;  2DT1 A;  2D9F A;  3FXY A;  4MPK A;  4TW8 A;  4JFJ A;  3WD4 A;  2A3E A;  4MTV A;  2ZR4 A;  4MAV A;  3CZ8 A;  4S3K A;  3WQV A;  4G2P A;  2B31 A;  4Z2H A;  4ODL A;  1HJX A;  1IX5 A;  1J6Y A;  4J4O A;  2XP8 A;  1HKM A;  3UQA A;  3RM8 A;  3G6M A;  4DRI A;  1H0I A;  4DRQ A;  1ROU A;  3AS2 A;  1NWU A;  1D7I A;  4J4N A;  3ALG A;  1WNO A;  1J4R A;  3KAH A;  2Q5A A; 
#chains in the Genus database with same CATH homology
 4U85 A;  4ODN A;  1T11 A;  4WK9 A;  1FKD A;  4DRH A;  2ZQU A;  4DRP A;  3B9D A;  2A3C A;  1LG2 A;  4ZPW R;  3TC5 A;  4DWS A;  3ARV A;  4L72 B;  1BKF A;  4NZC A;  1HKJ A;  4LAX A;  4HBO A;  4MNM A;  3ARS A;  2MNT A;  3RFW A;  4ZPV R;  2IF4 A;  4MSP A;  2KR7 A;  1LL4 A;  2XP6 A;  1FFQ A;  2AOS A;  5DIT A;  4Q22 A;  5DEZ A;  1GOI A;  1FKG A;  2Y78 A;  1ZBC A;  2WM0 A;  5HBF A;  3WD1 A;  3PRB A;  3JYJ A;  3O5K A;  3WL0 A;  3UQB A;  4TX0 A;  3OA5 A;  2DSU A;  2F21 A;  1F8A B;  2KE0 A;  4JYS A;  1X6N A;  1KFW A;  5DIV A;  2PI6 A;  3O5E A;  3NI6 A;  1FJD A;  4MGV A;  2IUZ A;  2A3B A;  2ZR5 A;  1NWT A;  1W1T A;  2MLY A;  3NTP A;  4P8U A;  4IPX A;  3O5I A;  3KAG A;  4LGX A;  2G8Z A;  1EHN A;  4NNR A;  5GPR A;  3H9R B;  1EDQ A;  3TCZ A;  4WKA A;  1X6L A;  5DIU A;  5DF0 A;  3MDY B;  4LAY A;  2PV1 A;  2RUQ A;  2LPV A;  4XAK A;  1FKF A;  3O5Q A;  4JFM A;  4KR0 B;  3ARZ A;  3FAP A;  2LGO A;  3GPK A;  1NWR A;  1FKH A;  4Z2J A;  3BXW A;  1NWS A;  2WLZ A;  2XPA A;  4DZ2 A;  2F4E A;  3B8S A;  2MPH A;  1W1Y A;  4Q7N A;  3O5R A;  4DWS D;  2RUR A;  3OOB A;  2FKE A;  4IT4 A;  3CHD A;  3O5G A;  3WD2 A;  3B9A A;  3UI6 A;  1GPF A;  1HKK A;  1GUV A;  2DSZ A;  2PBC A;  1QPF A;  2DG9 A;  1UR9 A;  3B7X A;  5I98 A;  1ZBV A;  3WD0 A;  1JNS A;  4DRO A;  3ARO A;  4W9O A;  4QT2 A;  5GQB A;  1K9T A;  2RUD A;  3CGN A;  4R5E A;  5J6E A;  3QOK A;  1ZK6 A;  4KQZ A;  1ZBW A;  4FN2 A;  2XP4 A;  2ZQT A;  4QIB A;  3O5P A;  4HAR A;  4TW6 A;  1Y0O A;  2DT3 A;  3G6L A;  3PR9 A;  1W1P A;  3I6C A;  3IHZ A;  1KT0 A;  5DO2 A;  2KO7 A;  1B6C A;  1N1A A;  4NSB A;  4W5U A;  4GIV A;  1PBK A;  2PPN A;  1E6Z A;  2XP5 A;  2DG4 A;  3ARY A;  4DRJ A;  4JFL A;  1RD6 A;  4W9Q A;  2YBU A;  5D75 A;  4P8V A;  2PPP A;  1XRV A;  1SYT A;  3PRA A;  2KGJ A;  1SR0 A;  4TNS A;  3PA7 A;  2O92 A;  3CHE A;  1FFR A;  4DRN A;  3UQI A;  1JVW A;  3KAD A;  1NH6 A;  2ITK A;  1LG1 A;  4ODP A;  2XPB A;  1E15 A;  1NMV A;  4JFI A;  1QZ2 A;  1LL6 A;  2XP7 A;  3O5D A;  4LAV A;  4L3N A;  4Z2L A;  4IT6 A;  1FKB A;  2JZV A;  3ODK A;  2VN1 A;  2DT0 A;  2DSV A;  2QF8 A;  4TYO A;  5HW8 A;  3FY1 A;  1QPL A;  1F40 A;  4DRM A;  1Q6U A;  3JYM A;  3W4R A;  3LUO A;  5B8I C;  3WH0 A;  2RQS A;  3CHC A;  1WB0 A;  3UI4 A;  2OFN A;  1ZCN A;  4ZPT R;  1HKI A;  3UF8 A;  4WIW A;  1M5Y A;  4C02 B;  4DZ3 A;  3RM4 A;  5HW7 A;  3KAF A;  3KAI A;  2FAP A;  4MNJ A;  4WKF A;  3WQW A;  5HKG A;  2UZ5 A;  1ZBK A;  1Q1C A;  2ZQV A;  2MF9 A;  3ART A;  2N87 A;  4ODO A;  3WKZ A;  4IQ2 A;  3ALF A;  3CH9 A;  1FKL A;  2PV2 A;  2LJ4 A;  3O5F A;  5HT1 A;  4LAW A;  4JFK A;  5HWC A;  1W9U A;  3UI5 A;  3IKG A;  1E6R A;  4U84 A;  1FKT A;  3WD3 A;  2MLX A;  1W9P A;  1FKI A;  3WIJ A;  2RUC A;  2M2A A;  1LJY A;  1ZU8 A;  4Z2I A;  3ARW A;  1W9V A;  4HBE A;  1ZB5 A;  1J4I A;  2M1I A;  4W9P A;  1E6P A;  1HJV A;  1TCO C;  1CTN A;  3RGC A;  4Z2G A;  1Q6H A;  4ODR A;  3O5J A;  1FKK A;  1NMW A;  1YAT A;  5BXJ A;  4DIP A;  2DG3 A;  3EY6 A;  2DPE A;  1BL4 A;  2RSE A;  4QT3 A;  4QZV B;  2O9O A;  4ML4 A;  1UR8 A;  3ARX A;  4P8W A;  4BF8 A;  5HUA A;  1JNE A;  1E6N A;  3KCE A;  1EIB A;  1XHG A;  1FD9 A;  1A7X A;  3ARR A;  2DSW A;  3KAB A;  4R0X A;  1HJW A;  1FKS A;  3RM9 A;  1KT1 A;  1W1V A;  3IKD A;  3IK8 A;  2KI3 A;  2WK2 A;  4N19 A;  1OGB A;  3JXV A;  4AY1 A;  2F2D A;  4DRK A;  1PIN A;  2PV3 A;  4WJX A;  1FAP A;  1FKJ A;  1YW5 A;  4URI A;  2K8I A;  2YBT A;  3ARP A;  3TDB A;  1P5Q A;  1W26 A;  1LQ0 A;  2FDM A;  1HXV A;  2ESC A;  2ZR6 A;  1EYM A;  4S3J A;  3O5L A;  1U79 A;  4Z2K A;  1C9H A;  2A3A A;  2XP3 A;  4G50 A;  3ARQ A;  1E9L A;  1Q6I A;  2L2S A;  4ODK A;  4MNK A;  5JH8 A;  2PPO A;  4U86 A;  1D6O A;  5HWB A;  2G41 A;  4ZS6 A;  4WKH A;  4P8X A;  3AS3 A;  4MNL A;  1D2K A;  3WL1 A;  1J4H A;  3AQU A;  1JNT A;  2DT2 A;  4ODQ A;  4IQC A;  1H0G A;  2ZQS A;  5HW6 A;  3AS1 A;  4FAP A;  2LKN A;  1NSG A;  4DWS B;  3NRK A;  4ITZ A;  1R9H A;  1O6I A;  1ITX A;  2XP9 A;  2OLH A;  1JND A;  3PRD A;  4TW7 A;  3KZ7 A;  4DT4 A;  3ARU A;  3RME A;  1D7H A;  4O2T A;  1TFV A;  1VF8 A;  3O5O A;  2WLY A;  1OGG A;  1OWQ A;  2AWG A;  3B9E A;  4GGQ A;  2M08 A;  3CHF A;  1D7J A;  1WAW A;  5HTG A;  3VAW A;  5GPG A;  4DWS C;  2VCD A;  1EQ3 A;  1ROT A;  1L1P A;  1FKR A;  1ZL1 A;  2KFW A;  4DH0 A;  3O5M A;  3CGM A;  3AS0 A;  3KAC A;  4ODM A;  1LL7 A;  2MLZ A;  4PTM A;  2DT1 A;  2D9F A;  3FXY A;  4MPK A;  4TW8 A;  4JFJ A;  3WD4 A;  2A3E A;  4MTV A;  2ZR4 A;  4MAV A;  3CZ8 A;  4S3K A;  3WQV A;  4G2P A;  2B31 A;  4Z2H A;  4ODL A;  1HJX A;  1IX5 A;  1J6Y A;  4J4O A;  2XP8 A;  1HKM A;  3UQA A;  3RM8 A;  3G6M A;  4DRI A;  1H0I A;  4DRQ A;  1ROU A;  3AS2 A;  1NWU A;  1D7I A;  4J4N A;  3ALG A;  1WNO A;  1J4R A;  3KAH A;  2Q5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...