4ODNA

Structure of slyd from thermus thermophilus in complex with s2-plus peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
total genus 32
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odnA00
1Q6UA 2PPOA 2XP6A 4G2PA 1R9HA 2N87A 4J4NA 1D7IA 4QIBA 5HKGA 3IKGA 1NMWA 4JFJA 2UZ5A 2RUDA 2LGOA 3O5GA 2ITKA 4IQCA 4ODLA 3RGCA 1ROUA 2XPBA 4ODKA 4ODOA 3UF8A 1D7HA 1YW5A 2PV2A 2Y78A 4IPXA 2KGJA 3ODKA 4JFMA 2KFWA 4ODMA 2ZQSA 1FJDA 2MLZA 4C02B 2PBCA 2PV3A 4R0XA 2RURA 2JZVA 2XP3A 3PRDA 4TX0A 1Q6HA 1A7XA 1D6OA 2ZQTA 4LAVA 1FKDA 2XP9A 4TNSA 2RUCA 2KE0A 5HWBA 3MDYB 5HW8A 2ZR5A 4DRMA 2LJ4A 3FAPA 2KI3A 3O5JA 1J4HA 3H9RB 2XPAA 5HW7A 4LAXA 4DIPA 5HWCA 1W26A 3TCZA 1F8AB 4DRPA 1FKRA 2Q5AA 2RSEA 4NNRA 1FKJA 2FKEA 3OOBA 4GIVA 3RFWA 1FKFA 2K8IA 3CGNA 4G50A 3UI4A 1Y0OA 3IK8A 2MPHA 2VN1A 2M1IA 4ITZA 2PV1A 1T11A 1JNTA 1NSGA 4QT2A 4DH0A 1EYMA 4GGQA 3UI5A 1FKTA 4DROA 1QPLA 1JNSA 1KT1A 2PPNA 1M5YA 2RQSA 3O5RA 3TC5A 3B7XA 3WH0A 4DRKA 2F4EA 2M2AA 3NI6A 3IHZA 5HTGA 3O5PA 5DIVA 1PINA 1FKIA 4DZ2A 2DG3A 2OFNA 2IF4A 1L1PA 1BKFA 4LAWA 4DRIA 4N19A 3KAFA 4U86A 4ODNA 2XP8A 4QT3A 3O5QA 1P5QA 5HUAA 1QPFA 2D9FA 2RUQA 1KT0A 2ZQVA 3KCEA 5I98A 1FKGA 1YATA 3CGMA 2XP4A 2AWGA 3O5FA 4TW7A 5DITA 1FKKA 4BF8A 4DRNA 4ODRA 4TW8A 2ZR4A 4DRHA 1JVWA 5J6EA 1FKLA 2DG9A 1ZK6A 3JYMA 3KAGA 3KAHA 5HT1A 3KABA 3UQIA 5BXJA 4DRQA 1F40A 3EY6A 4FAPA 1C9HA 2MF9A 2KR7A 3UQBA 3JXVA 2MNTA 3JYJA 4MSPA 4JFIA 3UQAA 2FAPA 1PBKA 4JYSA 4O2TA 3I6CA 2KO7A 1FKSA 1J4RA 3O5LA 3O5KA 1Q1CA 2DG4A 2M08A 4JFLA 4J4OA 4W9OA 3IKDA 1FD9A 3UI6A 3VAWA 1FKBA 2L2SA 4TW6A 4U84A 2XP5A 4W9QA 3O5DA 1BL4A 3KAIA 3KZ7A 3PRBA 4MGVA 3KADA 1NMVA 5HW6A 1HXVA 1U79A 1FKHA 2F21A 4ODQA 2ZR6A 4DT4A 1TCOC 2VCDA 3NTPA 4FN2A 3GPKA 1Q6IA 4IQ2A 4LAYA 2LKNA 1J6YA 2LPVA 5DIUA 2F2DA 1FAPA 2MLXA 2XP7A 3NRKA 4JFKA 5GPGA 1QZ2A 1B6CA 4ODPA 4U85A 1N1AA 4DRJA 1EQ3A 1ZCNA 3KACA 4W9PA 3TDBA 3O5EA 2ZQUA 4DZ3A 2PPPA 3O5MA 3LUOA 5B8IC 3O5OA 3PA7A 4TYOA 5D75A 1ROTA 1J4IA 2MLYA 1D7JA 3O5IA
chains in the Genus database with same CATH superfamily
1Q6UA 2PPOA 2N87A 1D7IA 4QIBA 5HKGA 3IKGA 2LGOA 1HJXA 3WD2A 1YW5A 3ODKA 1ZBKA 1FJDA 2KFWA 4ODMA 2XP3A 2JZVA 3CHFA 2ZQTA 1D6OA 4TNSA 2KE0A 1CTNA 1RD6A 3QOKA 4DRMA 3WQVA 3FAPA 1J4HA 3H9RB 3ARWA 4KR0B 4DIPA 3TCZA 4DRPA 2Q5AA 1FKJA 2FKEA 3OOBA 2B31A 2O92A 1FKFA 3CGNA 2MPHA 4ITZA 1NWUA 2G8ZA 2PV1A 1OGBA 2RQSA 3O5RA 3B7XA 4Q7NA 2DSWA 3NI6A 3CH9A 1LL7A 1IX5A 3O5PA 4Z2LA 2AOSA 1D2KA 4QZVB 4N19A 3KAFA 2XP8A 3AS3A 5HUAA 1W1YA 1YATA 3ARQA 1W9VA 4DRHA 3ARSA 5J6EA 1FKLA 4ZPVR 3GU0A 3KABA 1ZU8A 4DRQA 1C9HA 4PTMA 3UQBA 1WAWA 3JXVA 4L3NA 3JYJA 4MSPA 5DEZA 1PBKA 3PRAA 4O2TA 3I6CA 1NWSA 1GUVA 5I98A 2M08A 4J4OA 3UI6A 5GQBA 2PN0A 2YBTA 1BL4A 2A3EA 4DT4A 2QF8A 4P8WA 4FN2A 4LAYA 1J6YA 4IQ2A 4WK9A 2P4VA 5JH8A 3NRKA 4JFKA 2XP7A 1W9PA 1WNOA 4DRJA 1JNSA 4ODPA 4U85A 1N1AA 4W9PA 3TDBA 2ZQUA 1EHNA 5D75A 3PA7A 4L72B 4XAKA 1ROTA 2MLYA 1XRVA 3RMEA 1NMWA 1EDQA 2UZ5A 4JFJA 2RUDA 4IQCA 4MTVA 3RGCA 1ITXA 1ROUA 4ODOA 1HKJA 2PV2A 2KGJA 2ZQSA 2MLZA 2DT1A 3B9DA 2RURA 4WIWA 1Q6HA 1A7XA 4LAVA 1NH6A 5HWBA 1ZBCA 5HW8A 2LJ4A 2XPAA 3PR9A 5HW7A 4LAXA 1E9LA 1LG1A 1FFQA 1HKIA 3AROA 4NNRA 1Y0OA 3IK8A 2DPEA 1T11A 4DH0A 4QT2A 2ESCA 1K9TA 2PPNA 1H0GA 3TC5A 1E44A 2DSVA 3IHZA 1FKIA 1UR9A 3WIJA 1E6NA 2OFNA 4DRIA 4U86A 3WQWA 3AS0A 4QT3A 1P5QA 2DT3A 2D9FA 2RUQA 1KT0A 3KCEA 4ML4A 2AWGA 1FKKA 4DRNA 1HJVA 1JCHB 4MPKA 4MNJA 3WD4A 3KAGA 3UQIA 4FAPA 2FAPA 4JYSA 3ARRA 1GRJA 4WKHA 1J4RA 3WD3A 5HWCA 2DG4A 4IT6A 3VAWA 1FKBA 2L2SA 1NMVA 3GTYX 2ZR6A 4MNKA 3GPKA 2G41A 3ALFA 2MLXA 5GPGA 1ZB5A 1EQ3A 1ZCNA 4UDMA 3CZ8A 5B8IC 3AQUA 3O5OA 4J4NA 4WKAA 1R9HA 1X6NA 1HKMA 5DF0A 4MNMA 3UF8A 1XHGA 4ODKA 1D7HA 2DT2A 2WK2A 4IPXA 4Z2HA 1W1VA 5GPRA 1JNDA 2A3BA 1O6IA 4ZPTR 5HTGA 2RUCA 4WKFA 2ZR5A 3B8SA 4IT4A 3WL0A 3O5JA 4W5UA 1OGGA 1W26A 2F23A 1E6RA 3BXWA 4HBOA 4G50A 4URIA 2B5UB 3ARPA 2VN1A 1W9UA 1H0IA 2M1IA 1JNTA 1NSGA 1LG2A 3ARYA 2IUZA 4GGQA 3W4RA 4DROA 1QPLA 4MNLA 5DO2A 3WH0A 4DRKA 2M2AA 1SYTA 4WJXA 3FY1A 2DG3A 4Z2GA 1NWTA 4DWSA 4AY1A 1ZL1A 3OA5A 1LQ0A 1QPFA 2ZQVA 2FDMA 3CHDA 1FKGA 3O5FA 4ODRA 3FXYA 1W1PA 1E6ZA 3EIPA 3ARUA 3ARXA 5BXJA 2O9OA 2KR7A 2MNTA 3UQAA 3CHEA 2KO7A 3O5LA 3ALGA 4JFLA 4S3KA 3IKDA 4R5EA 2XP5A 4W9QA 1NWRA 3O5DA 3KAIA 3RM8A 3PRBA 1OWQA 1KFWA 4NZCA 3WD1A 1U79A 1HXVA 1FKHA 2F21A 1LL4A 4ODQA 1TCOC 1E15A 2VCDA 3NTPA 1Q6IA 1X6LA 3G6LA 4HARA 2LPVA 2F2DA 1FAPA 3AS1A 1UR8A 1B6CA 3KACA 1HJWA 2PPPA 3LUOA 3JYMA 4P8VA 2XP6A 4G2PA 2PI6A 4ZPWR 4S3JA 3G6MA 4Z2JA 3O5GA 4ODLA 2ITKA 3WL1A 4Q22A 2XPBA 3RM9A 2Y78A 4JFMA 1W1TA 4C02B 1VF8A 2PBCA 2PV3A 4KQZA 4R0XA 3ARZA 3PRDA 4TX0A 4ZS6A 1ZBWA 1FKDA 2XP9A 3WD0A 1ZBVA 3MDYB 2DT0A 4NSBA 2KI3A 5HBFA 4HBEA 3WKZA 1F8AB 1FKRA 2RSEA 1GPFA 4GIVA 3RFWA 2K8IA 3UI4A 4Z2KA 3BMBA 2EULA 4DWSC 1EYMA 1SR0A 2DSUA 3UI5A 1FKTA 2WM0A 1KT1A 1M5YA 2DSZA 2F4EA 2WLZA 5DIVA 1EIBA 1PINA 1TFVA 2IF4A 2A3AA 1L1PA 1BKFA 4LAWA 4ODNA 4DWSB 1JNEA 3B9AA 3O5QA 3ARTA 3ARVA 1LL6A 4DWSD 2OLHA 3AS2A 3CGMA 5DITA 2XP4A 4TW7A 1WB0A 4BF8A 4TW8A 2ZR4A 1JVWA 2DG9A 1ZK6A 4P8UA 1LJYA 3KAHA 5HT1A 1F40A 3EY6A 2ETNA 2MF9A 1GOIA 4LGXA 4JFIA 4Z2IA 2WLYA 1FKSA 3O5KA 1Q1CA 4W9OA 1FD9A 4TW6A 3CHCA 4U84A 3KZ7A 4MGVA 2A3CA 3KADA 5HW6A 1HKKA 1FFRA 2LKNA 4MAVA 5DIUA 4DZ2A 3B9EA 1QZ2A 3RM4A 1E6PA 3O5EA 2YBUA 4DZ3A 3O5MA 4P8XA 4TYOA 1J4IA 1D7JA 3O5IA
chains in the Genus database with same CATH topology
1Q6UA 2PPOA 2N87A 1D7IA 4QIBA 5HKGA 3IKGA 2LGOA 1HJXA 3WD2A 1YW5A 3ODKA 1ZBKA 1FJDA 2KFWA 4ODMA 2XP3A 2JZVA 3CHFA 2ZQTA 1D6OA 4TNSA 2KE0A 1CTNA 1RD6A 3QOKA 4DRMA 3WQVA 3FAPA 1J4HA 3H9RB 3ARWA 4KR0B 4DIPA 3TCZA 4DRPA 2Q5AA 1FKJA 2FKEA 3OOBA 2B31A 2O92A 1FKFA 3CGNA 2MPHA 4ITZA 1NWUA 2G8ZA 2PV1A 1OGBA 2RQSA 3O5RA 3B7XA 4Q7NA 2DSWA 3NI6A 3CH9A 1LL7A 1IX5A 3O5PA 4Z2LA 2AOSA 1D2KA 4QZVB 4N19A 3KAFA 2XP8A 3AS3A 5HUAA 1W1YA 1YATA 3ARQA 1W9VA 4DRHA 3ARSA 5J6EA 1FKLA 4ZPVR 3KABA 1ZU8A 4DRQA 1C9HA 4PTMA 3UQBA 1WAWA 3JXVA 4L3NA 3JYJA 4MSPA 5DEZA 1PBKA 3PRAA 4O2TA 3I6CA 1NWSA 1GUVA 5I98A 2M08A 4J4OA 3UI6A 5GQBA 2YBTA 1BL4A 2A3EA 4DT4A 2QF8A 4P8WA 4FN2A 4LAYA 1J6YA 4IQ2A 4WK9A 5JH8A 3NRKA 4JFKA 2XP7A 1W9PA 1WNOA 4DRJA 1JNSA 4ODPA 4U85A 1N1AA 4W9PA 3TDBA 2ZQUA 1EHNA 5D75A 3PA7A 4L72B 4XAKA 1ROTA 2MLYA 1XRVA 3RMEA 1NMWA 1EDQA 2UZ5A 4JFJA 2RUDA 4IQCA 4MTVA 3RGCA 1ITXA 1ROUA 4ODOA 1HKJA 2PV2A 2KGJA 2ZQSA 2MLZA 2DT1A 3B9DA 2RURA 4WIWA 1Q6HA 1A7XA 4LAVA 1NH6A 5HWBA 1ZBCA 5HW8A 2LJ4A 2XPAA 3PR9A 5HW7A 4LAXA 1E9LA 1LG1A 1FFQA 1HKIA 3AROA 4NNRA 1Y0OA 3IK8A 2DPEA 1T11A 4DH0A 4QT2A 2ESCA 1K9TA 2PPNA 1H0GA 3TC5A 2DSVA 3IHZA 1FKIA 1UR9A 3WIJA 1E6NA 2OFNA 4DRIA 4U86A 3WQWA 3AS0A 4QT3A 1P5QA 2DT3A 2D9FA 2RUQA 1KT0A 3KCEA 4ML4A 2AWGA 1FKKA 4DRNA 1HJVA 4MPKA 4MNJA 3WD4A 3KAGA 3UQIA 4FAPA 2FAPA 4JYSA 3ARRA 4WKHA 1J4RA 3WD3A 5HWCA 2DG4A 4IT6A 3VAWA 1FKBA 2L2SA 1NMVA 2ZR6A 4MNKA 3GPKA 2G41A 3ALFA 2MLXA 5GPGA 1ZB5A 1EQ3A 1ZCNA 3CZ8A 5B8IC 3AQUA 3O5OA 4J4NA 4WKAA 1R9HA 1X6NA 1HKMA 5DF0A 4MNMA 3UF8A 1XHGA 4ODKA 1D7HA 2DT2A 2WK2A 4IPXA 4Z2HA 1W1VA 5GPRA 1JNDA 2A3BA 1O6IA 4ZPTR 5HTGA 2RUCA 4WKFA 2ZR5A 3B8SA 4IT4A 3WL0A 3O5JA 4W5UA 1OGGA 1W26A 1E6RA 3BXWA 4HBOA 4G50A 4URIA 3ARPA 2VN1A 1W9UA 1H0IA 2M1IA 1JNTA 1NSGA 1LG2A 3ARYA 2IUZA 4GGQA 3W4RA 4DROA 1QPLA 4MNLA 5DO2A 3WH0A 4DRKA 2M2AA 1SYTA 4WJXA 3FY1A 2DG3A 4Z2GA 1NWTA 4DWSA 4AY1A 1ZL1A 3OA5A 1LQ0A 1QPFA 2ZQVA 2FDMA 3CHDA 1FKGA 3O5FA 4ODRA 3FXYA 1W1PA 1E6ZA 3ARUA 3ARXA 5BXJA 2O9OA 2KR7A 2MNTA 3UQAA 3CHEA 2KO7A 3O5LA 3ALGA 4JFLA 4S3KA 3IKDA 4R5EA 2XP5A 4W9QA 1NWRA 3O5DA 3KAIA 3RM8A 3PRBA 1OWQA 1KFWA 4NZCA 3WD1A 1U79A 1HXVA 1FKHA 2F21A 1LL4A 4ODQA 1TCOC 1E15A 2VCDA 3NTPA 1Q6IA 1X6LA 3G6LA 4HARA 2LPVA 2F2DA 1FAPA 3AS1A 1UR8A 1B6CA 3KACA 1HJWA 2PPPA 3LUOA 3JYMA 4P8VA 2XP6A 4G2PA 2PI6A 4ZPWR 4S3JA 3G6MA 4Z2JA 3O5GA 4ODLA 2ITKA 3WL1A 4Q22A 2XPBA 3RM9A 2Y78A 4JFMA 1W1TA 4C02B 1VF8A 2PBCA 4KQZA 2PV3A 4R0XA 3ARZA 3PRDA 4TX0A 4ZS6A 1ZBWA 1FKDA 2XP9A 3WD0A 1ZBVA 3MDYB 2DT0A 4NSBA 2KI3A 5HBFA 4HBEA 3WKZA 1F8AB 1FKRA 2RSEA 1GPFA 4GIVA 3RFWA 2K8IA 3UI4A 4Z2KA 4DWSC 1EYMA 1SR0A 2DSUA 3UI5A 1FKTA 2WM0A 1KT1A 1M5YA 2DSZA 2F4EA 2WLZA 5DIVA 1EIBA 1PINA 1TFVA 2IF4A 2A3AA 1L1PA 1BKFA 4LAWA 4ODNA 4DWSB 1JNEA 3B9AA 3O5QA 3ARTA 3ARVA 1LL6A 4DWSD 2OLHA 3AS2A 3CGMA 5DITA 2XP4A 4TW7A 1WB0A 4BF8A 4TW8A 2ZR4A 1JVWA 2DG9A 1ZK6A 4P8UA 1LJYA 3KAHA 5HT1A 1F40A 3EY6A 2MF9A 1GOIA 4LGXA 4JFIA 4Z2IA 2WLYA 1FKSA 3O5KA 1Q1CA 4W9OA 1FD9A 4TW6A 3CHCA 4U84A 3KZ7A 4MGVA 2A3CA 3KADA 5HW6A 1HKKA 1FFRA 2LKNA 4MAVA 5DIUA 4DZ2A 3B9EA 1QZ2A 3RM4A 1E6PA 3O5EA 2YBUA 4DZ3A 3O5MA 4P8XA 4TYOA 1J4IA 1D7JA 3O5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6U A;  2PPO A;  2XP6 A;  4G2P A;  1R9H A;  2N87 A;  4J4N A;  1D7I A;  4QIB A;  5HKG A;  3IKG A;  1NMW A;  4JFJ A;  2UZ5 A;  2RUD A;  2LGO A;  3O5G A;  2ITK A;  4IQC A;  4ODL A;  3RGC A;  1ROU A;  2XPB A;  4ODK A;  4ODO A;  3UF8 A;  1D7H A;  1YW5 A;  2PV2 A;  2Y78 A;  4IPX A;  2KGJ A;  3ODK A;  4JFM A;  2KFW A;  4ODM A;  2ZQS A;  1FJD A;  2MLZ A;  4C02 B;  2PBC A;  2PV3 A;  4R0X A;  2RUR A;  2JZV A;  2XP3 A;  3PRD A;  4TX0 A;  1Q6H A;  1A7X A;  1D6O A;  2ZQT A;  4LAV A;  1FKD A;  2XP9 A;  4TNS A;  2RUC A;  2KE0 A;  5HWB A;  3MDY B;  5HW8 A;  2ZR5 A;  4DRM A;  2LJ4 A;  3FAP A;  2KI3 A;  3O5J A;  1J4H A;  3H9R B;  2XPA A;  5HW7 A;  4LAX A;  4DIP A;  5HWC A;  1W26 A;  3TCZ A;  1F8A B;  4DRP A;  1FKR A;  2Q5A A;  2RSE A;  4NNR A;  1FKJ A;  2FKE A;  3OOB A;  4GIV A;  3RFW A;  1FKF A;  2K8I A;  3CGN A;  4G50 A;  3UI4 A;  1Y0O A;  3IK8 A;  2MPH A;  2VN1 A;  2M1I A;  4ITZ A;  2PV1 A;  1T11 A;  1JNT A;  1NSG A;  4QT2 A;  4DH0 A;  1EYM A;  4GGQ A;  3UI5 A;  1FKT A;  4DRO A;  1QPL A;  1JNS A;  1KT1 A;  2PPN A;  1M5Y A;  2RQS A;  3O5R A;  3TC5 A;  3B7X A;  3WH0 A;  4DRK A;  2F4E A;  2M2A A;  3NI6 A;  3IHZ A;  5HTG A;  3O5P A;  5DIV A;  1PIN A;  1FKI A;  4DZ2 A;  2DG3 A;  2OFN A;  2IF4 A;  1L1P A;  1BKF A;  4LAW A;  4DRI A;  4N19 A;  3KAF A;  4U86 A;  4ODN A;  2XP8 A;  4QT3 A;  3O5Q A;  1P5Q A;  5HUA A;  1QPF A;  2D9F A;  2RUQ A;  1KT0 A;  2ZQV A;  3KCE A;  5I98 A;  1FKG A;  1YAT A;  3CGM A;  2XP4 A;  2AWG A;  3O5F A;  4TW7 A;  5DIT A;  1FKK A;  4BF8 A;  4DRN A;  4ODR A;  4TW8 A;  2ZR4 A;  4DRH A;  1JVW A;  5J6E A;  1FKL A;  2DG9 A;  1ZK6 A;  3JYM A;  3KAG A;  3KAH A;  5HT1 A;  3KAB A;  3UQI A;  5BXJ A;  4DRQ A;  1F40 A;  3EY6 A;  4FAP A;  1C9H A;  2MF9 A;  2KR7 A;  3UQB A;  3JXV A;  2MNT A;  3JYJ A;  4MSP A;  4JFI A;  3UQA A;  2FAP A;  1PBK A;  4JYS A;  4O2T A;  3I6C A;  2KO7 A;  1FKS A;  1J4R A;  3O5L A;  3O5K A;  1Q1C A;  2DG4 A;  2M08 A;  4JFL A;  4J4O A;  4W9O A;  3IKD A;  1FD9 A;  3UI6 A;  3VAW A;  1FKB A;  2L2S A;  4TW6 A;  4U84 A;  2XP5 A;  4W9Q A;  3O5D A;  1BL4 A;  3KAI A;  3KZ7 A;  3PRB A;  4MGV A;  3KAD A;  1NMV A;  5HW6 A;  1HXV A;  1U79 A;  1FKH A;  2F21 A;  4ODQ A;  2ZR6 A;  4DT4 A;  1TCO C;  2VCD A;  3NTP A;  4FN2 A;  3GPK A;  1Q6I A;  4IQ2 A;  4LAY A;  2LKN A;  1J6Y A;  2LPV A;  5DIU A;  2F2D A;  1FAP A;  2MLX A;  2XP7 A;  3NRK A;  4JFK A;  5GPG A;  1QZ2 A;  1B6C A;  4ODP A;  4U85 A;  1N1A A;  4DRJ A;  1EQ3 A;  1ZCN A;  3KAC A;  4W9P A;  3TDB A;  3O5E A;  2ZQU A;  4DZ3 A;  2PPP A;  3O5M A;  3LUO A;  5B8I C;  3O5O A;  3PA7 A;  4TYO A;  5D75 A;  1ROT A;  1J4I A;  2MLY A;  1D7J A;  3O5I A; 
#chains in the Genus database with same CATH topology
 1Q6U A;  2PPO A;  2N87 A;  1D7I A;  4QIB A;  5HKG A;  3IKG A;  2LGO A;  1HJX A;  3WD2 A;  1YW5 A;  3ODK A;  1ZBK A;  1FJD A;  2KFW A;  4ODM A;  2XP3 A;  2JZV A;  3CHF A;  2ZQT A;  1D6O A;  4TNS A;  2KE0 A;  1CTN A;  1RD6 A;  3QOK A;  4DRM A;  3WQV A;  3FAP A;  1J4H A;  3H9R B;  3ARW A;  4KR0 B;  4DIP A;  3TCZ A;  4DRP A;  2Q5A A;  1FKJ A;  2FKE A;  3OOB A;  2B31 A;  2O92 A;  1FKF A;  3CGN A;  2MPH A;  4ITZ A;  1NWU A;  2G8Z A;  2PV1 A;  1OGB A;  2RQS A;  3O5R A;  3B7X A;  4Q7N A;  2DSW A;  3NI6 A;  3CH9 A;  1LL7 A;  1IX5 A;  3O5P A;  4Z2L A;  2AOS A;  1D2K A;  4QZV B;  4N19 A;  3KAF A;  2XP8 A;  3AS3 A;  5HUA A;  1W1Y A;  1YAT A;  3ARQ A;  1W9V A;  4DRH A;  3ARS A;  5J6E A;  1FKL A;  4ZPV R;  3GU0 A;  3KAB A;  1ZU8 A;  4DRQ A;  1C9H A;  4PTM A;  3UQB A;  1WAW A;  3JXV A;  4L3N A;  3JYJ A;  4MSP A;  5DEZ A;  1PBK A;  3PRA A;  4O2T A;  3I6C A;  1NWS A;  1GUV A;  5I98 A;  2M08 A;  4J4O A;  3UI6 A;  5GQB A;  2PN0 A;  2YBT A;  1BL4 A;  2A3E A;  4DT4 A;  2QF8 A;  4P8W A;  4FN2 A;  4LAY A;  1J6Y A;  4IQ2 A;  4WK9 A;  2P4V A;  5JH8 A;  3NRK A;  4JFK A;  2XP7 A;  1W9P A;  1WNO A;  4DRJ A;  1JNS A;  4ODP A;  4U85 A;  1N1A A;  4W9P A;  3TDB A;  2ZQU A;  1EHN A;  5D75 A;  3PA7 A;  4L72 B;  4XAK A;  1ROT A;  2MLY A;  1XRV A;  3RME A;  1NMW A;  1EDQ A;  2UZ5 A;  4JFJ A;  2RUD A;  4IQC A;  4MTV A;  3RGC A;  1ITX A;  1ROU A;  4ODO A;  1HKJ A;  2PV2 A;  2KGJ A;  2ZQS A;  2MLZ A;  2DT1 A;  3B9D A;  2RUR A;  4WIW A;  1Q6H A;  1A7X A;  4LAV A;  1NH6 A;  5HWB A;  1ZBC A;  5HW8 A;  2LJ4 A;  2XPA A;  3PR9 A;  5HW7 A;  4LAX A;  1E9L A;  1LG1 A;  1FFQ A;  1HKI A;  3ARO A;  4NNR A;  1Y0O A;  3IK8 A;  2DPE A;  1T11 A;  4DH0 A;  4QT2 A;  2ESC A;  1K9T A;  2PPN A;  1H0G A;  3TC5 A;  1E44 A;  2DSV A;  3IHZ A;  1FKI A;  1UR9 A;  3WIJ A;  1E6N A;  2OFN A;  4DRI A;  4U86 A;  3WQW A;  3AS0 A;  4QT3 A;  1P5Q A;  2DT3 A;  2D9F A;  2RUQ A;  1KT0 A;  3KCE A;  4ML4 A;  2AWG A;  1FKK A;  4DRN A;  1HJV A;  1JCH B;  4MPK A;  4MNJ A;  3WD4 A;  3KAG A;  3UQI A;  4FAP A;  2FAP A;  4JYS A;  3ARR A;  1GRJ A;  4WKH A;  1J4R A;  3WD3 A;  5HWC A;  2DG4 A;  4IT6 A;  3VAW A;  1FKB A;  2L2S A;  1NMV A;  3GTY X;  2ZR6 A;  4MNK A;  3GPK A;  2G41 A;  3ALF A;  2MLX A;  5GPG A;  1ZB5 A;  1EQ3 A;  1ZCN A;  4UDM A;  3CZ8 A;  5B8I C;  3AQU A;  3O5O A;  4J4N A;  4WKA A;  1R9H A;  1X6N A;  1HKM A;  5DF0 A;  4MNM A;  3UF8 A;  1XHG A;  4ODK A;  1D7H A;  2DT2 A;  2WK2 A;  4IPX A;  4Z2H A;  1W1V A;  5GPR A;  1JND A;  2A3B A;  1O6I A;  4ZPT R;  5HTG A;  2RUC A;  4WKF A;  2ZR5 A;  3B8S A;  4IT4 A;  3WL0 A;  3O5J A;  4W5U A;  1OGG A;  1W26 A;  2F23 A;  1E6R A;  3BXW A;  4HBO A;  4G50 A;  4URI A;  2B5U B;  3ARP A;  2VN1 A;  1W9U A;  1H0I A;  2M1I A;  1JNT A;  1NSG A;  1LG2 A;  3ARY A;  2IUZ A;  4GGQ A;  3W4R A;  4DRO A;  1QPL A;  4MNL A;  5DO2 A;  3WH0 A;  4DRK A;  2M2A A;  1SYT A;  4WJX A;  3FY1 A;  2DG3 A;  4Z2G A;  1NWT A;  4DWS A;  4AY1 A;  1ZL1 A;  3OA5 A;  1LQ0 A;  1QPF A;  2ZQV A;  2FDM A;  3CHD A;  1FKG A;  3O5F A;  4ODR A;  3FXY A;  1W1P A;  1E6Z A;  3EIP A;  3ARU A;  3ARX A;  5BXJ A;  2O9O A;  2KR7 A;  2MNT A;  3UQA A;  3CHE A;  2KO7 A;  3O5L A;  3ALG A;  4JFL A;  4S3K A;  3IKD A;  4R5E A;  2XP5 A;  4W9Q A;  1NWR A;  3O5D A;  3KAI A;  3RM8 A;  3PRB A;  1OWQ A;  1KFW A;  4NZC A;  3WD1 A;  1U79 A;  1HXV A;  1FKH A;  2F21 A;  1LL4 A;  4ODQ A;  1TCO C;  1E15 A;  2VCD A;  3NTP A;  1Q6I A;  1X6L A;  3G6L A;  4HAR A;  2LPV A;  2F2D A;  1FAP A;  3AS1 A;  1UR8 A;  1B6C A;  3KAC A;  1HJW A;  2PPP A;  3LUO A;  3JYM A;  4P8V A;  2XP6 A;  4G2P A;  2PI6 A;  4ZPW R;  4S3J A;  3G6M A;  4Z2J A;  3O5G A;  4ODL A;  2ITK A;  3WL1 A;  4Q22 A;  2XPB A;  3RM9 A;  2Y78 A;  4JFM A;  1W1T A;  4C02 B;  1VF8 A;  2PBC A;  2PV3 A;  4KQZ A;  4R0X A;  3ARZ A;  3PRD A;  4TX0 A;  4ZS6 A;  1ZBW A;  1FKD A;  2XP9 A;  3WD0 A;  1ZBV A;  3MDY B;  2DT0 A;  4NSB A;  2KI3 A;  5HBF A;  4HBE A;  3WKZ A;  1F8A B;  1FKR A;  2RSE A;  1GPF A;  4GIV A;  3RFW A;  2K8I A;  3UI4 A;  4Z2K A;  3BMB A;  2EUL A;  4DWS C;  1EYM A;  1SR0 A;  2DSU A;  3UI5 A;  1FKT A;  2WM0 A;  1KT1 A;  1M5Y A;  2DSZ A;  2F4E A;  2WLZ A;  5DIV A;  1EIB A;  1PIN A;  1TFV A;  2IF4 A;  2A3A A;  1L1P A;  1BKF A;  4LAW A;  4ODN A;  4DWS B;  1JNE A;  3B9A A;  3O5Q A;  3ART A;  3ARV A;  1LL6 A;  4DWS D;  2OLH A;  3AS2 A;  3CGM A;  5DIT A;  2XP4 A;  4TW7 A;  1WB0 A;  4BF8 A;  4TW8 A;  2ZR4 A;  1JVW A;  2DG9 A;  1ZK6 A;  4P8U A;  1LJY A;  3KAH A;  5HT1 A;  1F40 A;  3EY6 A;  2ETN A;  2MF9 A;  1GOI A;  4LGX A;  4JFI A;  4Z2I A;  2WLY A;  1FKS A;  3O5K A;  1Q1C A;  4W9O A;  1FD9 A;  4TW6 A;  3CHC A;  4U84 A;  3KZ7 A;  4MGV A;  2A3C A;  3KAD A;  5HW6 A;  1HKK A;  1FFR A;  2LKN A;  4MAV A;  5DIU A;  4DZ2 A;  3B9E A;  1QZ2 A;  3RM4 A;  1E6P A;  3O5E A;  2YBU A;  4DZ3 A;  3O5M A;  4P8X A;  4TYO A;  1J4I A;  1D7J A;  3O5I A; 
#chains in the Genus database with same CATH homology
 1Q6U A;  2PPO A;  2N87 A;  1D7I A;  4QIB A;  5HKG A;  3IKG A;  2LGO A;  1HJX A;  3WD2 A;  1YW5 A;  3ODK A;  1ZBK A;  1FJD A;  2KFW A;  4ODM A;  2XP3 A;  2JZV A;  3CHF A;  2ZQT A;  1D6O A;  4TNS A;  2KE0 A;  1CTN A;  1RD6 A;  3QOK A;  4DRM A;  3WQV A;  3FAP A;  1J4H A;  3H9R B;  3ARW A;  4KR0 B;  4DIP A;  3TCZ A;  4DRP A;  2Q5A A;  1FKJ A;  2FKE A;  3OOB A;  2B31 A;  2O92 A;  1FKF A;  3CGN A;  2MPH A;  4ITZ A;  1NWU A;  2G8Z A;  2PV1 A;  1OGB A;  2RQS A;  3O5R A;  3B7X A;  4Q7N A;  2DSW A;  3NI6 A;  3CH9 A;  1LL7 A;  1IX5 A;  3O5P A;  4Z2L A;  2AOS A;  1D2K A;  4QZV B;  4N19 A;  3KAF A;  2XP8 A;  3AS3 A;  5HUA A;  1W1Y A;  1YAT A;  3ARQ A;  1W9V A;  4DRH A;  3ARS A;  5J6E A;  1FKL A;  4ZPV R;  3KAB A;  1ZU8 A;  4DRQ A;  1C9H A;  4PTM A;  3UQB A;  1WAW A;  3JXV A;  4L3N A;  3JYJ A;  4MSP A;  5DEZ A;  1PBK A;  3PRA A;  4O2T A;  3I6C A;  1NWS A;  1GUV A;  5I98 A;  2M08 A;  4J4O A;  3UI6 A;  5GQB A;  2YBT A;  1BL4 A;  2A3E A;  4DT4 A;  2QF8 A;  4P8W A;  4FN2 A;  4LAY A;  1J6Y A;  4IQ2 A;  4WK9 A;  5JH8 A;  3NRK A;  4JFK A;  2XP7 A;  1W9P A;  1WNO A;  4DRJ A;  1JNS A;  4ODP A;  4U85 A;  1N1A A;  4W9P A;  3TDB A;  2ZQU A;  1EHN A;  5D75 A;  3PA7 A;  4L72 B;  4XAK A;  1ROT A;  2MLY A;  1XRV A;  3RME A;  1NMW A;  1EDQ A;  2UZ5 A;  4JFJ A;  2RUD A;  4IQC A;  4MTV A;  3RGC A;  1ITX A;  1ROU A;  4ODO A;  1HKJ A;  2PV2 A;  2KGJ A;  2ZQS A;  2MLZ A;  2DT1 A;  3B9D A;  2RUR A;  4WIW A;  1Q6H A;  1A7X A;  4LAV A;  1NH6 A;  5HWB A;  1ZBC A;  5HW8 A;  2LJ4 A;  2XPA A;  3PR9 A;  5HW7 A;  4LAX A;  1E9L A;  1LG1 A;  1FFQ A;  1HKI A;  3ARO A;  4NNR A;  1Y0O A;  3IK8 A;  2DPE A;  1T11 A;  4DH0 A;  4QT2 A;  2ESC A;  1K9T A;  2PPN A;  1H0G A;  3TC5 A;  2DSV A;  3IHZ A;  1FKI A;  1UR9 A;  3WIJ A;  1E6N A;  2OFN A;  4DRI A;  4U86 A;  3WQW A;  3AS0 A;  4QT3 A;  1P5Q A;  2DT3 A;  2D9F A;  2RUQ A;  1KT0 A;  3KCE A;  4ML4 A;  2AWG A;  1FKK A;  4DRN A;  1HJV A;  4MPK A;  4MNJ A;  3WD4 A;  3KAG A;  3UQI A;  4FAP A;  2FAP A;  4JYS A;  3ARR A;  4WKH A;  1J4R A;  3WD3 A;  5HWC A;  2DG4 A;  4IT6 A;  3VAW A;  1FKB A;  2L2S A;  1NMV A;  2ZR6 A;  4MNK A;  3GPK A;  2G41 A;  3ALF A;  2MLX A;  5GPG A;  1ZB5 A;  1EQ3 A;  1ZCN A;  3CZ8 A;  5B8I C;  3AQU A;  3O5O A;  4J4N A;  4WKA A;  1R9H A;  1X6N A;  1HKM A;  5DF0 A;  4MNM A;  3UF8 A;  1XHG A;  4ODK A;  1D7H A;  2DT2 A;  2WK2 A;  4IPX A;  4Z2H A;  1W1V A;  5GPR A;  1JND A;  2A3B A;  1O6I A;  4ZPT R;  5HTG A;  2RUC A;  4WKF A;  2ZR5 A;  3B8S A;  4IT4 A;  3WL0 A;  3O5J A;  4W5U A;  1OGG A;  1W26 A;  1E6R A;  3BXW A;  4HBO A;  4G50 A;  4URI A;  3ARP A;  2VN1 A;  1W9U A;  1H0I A;  2M1I A;  1JNT A;  1NSG A;  1LG2 A;  3ARY A;  2IUZ A;  4GGQ A;  3W4R A;  4DRO A;  1QPL A;  4MNL A;  5DO2 A;  3WH0 A;  4DRK A;  2M2A A;  1SYT A;  4WJX A;  3FY1 A;  2DG3 A;  4Z2G A;  1NWT A;  4DWS A;  4AY1 A;  1ZL1 A;  3OA5 A;  1LQ0 A;  1QPF A;  2ZQV A;  2FDM A;  3CHD A;  1FKG A;  3O5F A;  4ODR A;  3FXY A;  1W1P A;  1E6Z A;  3ARU A;  3ARX A;  5BXJ A;  2O9O A;  2KR7 A;  2MNT A;  3UQA A;  3CHE A;  2KO7 A;  3O5L A;  3ALG A;  4JFL A;  4S3K A;  3IKD A;  4R5E A;  2XP5 A;  4W9Q A;  1NWR A;  3O5D A;  3KAI A;  3RM8 A;  3PRB A;  1OWQ A;  1KFW A;  4NZC A;  3WD1 A;  1U79 A;  1HXV A;  1FKH A;  2F21 A;  1LL4 A;  4ODQ A;  1TCO C;  1E15 A;  2VCD A;  3NTP A;  1Q6I A;  1X6L A;  3G6L A;  4HAR A;  2LPV A;  2F2D A;  1FAP A;  3AS1 A;  1UR8 A;  1B6C A;  3KAC A;  1HJW A;  2PPP A;  3LUO A;  3JYM A;  4P8V A;  2XP6 A;  4G2P A;  2PI6 A;  4ZPW R;  4S3J A;  3G6M A;  4Z2J A;  3O5G A;  4ODL A;  2ITK A;  3WL1 A;  4Q22 A;  2XPB A;  3RM9 A;  2Y78 A;  4JFM A;  1W1T A;  4C02 B;  1VF8 A;  2PBC A;  4KQZ A;  2PV3 A;  4R0X A;  3ARZ A;  3PRD A;  4TX0 A;  4ZS6 A;  1ZBW A;  1FKD A;  2XP9 A;  3WD0 A;  1ZBV A;  3MDY B;  2DT0 A;  4NSB A;  2KI3 A;  5HBF A;  4HBE A;  3WKZ A;  1F8A B;  1FKR A;  2RSE A;  1GPF A;  4GIV A;  3RFW A;  2K8I A;  3UI4 A;  4Z2K A;  4DWS C;  1EYM A;  1SR0 A;  2DSU A;  3UI5 A;  1FKT A;  2WM0 A;  1KT1 A;  1M5Y A;  2DSZ A;  2F4E A;  2WLZ A;  5DIV A;  1EIB A;  1PIN A;  1TFV A;  2IF4 A;  2A3A A;  1L1P A;  1BKF A;  4LAW A;  4ODN A;  4DWS B;  1JNE A;  3B9A A;  3O5Q A;  3ART A;  3ARV A;  1LL6 A;  4DWS D;  2OLH A;  3AS2 A;  3CGM A;  5DIT A;  2XP4 A;  4TW7 A;  1WB0 A;  4BF8 A;  4TW8 A;  2ZR4 A;  1JVW A;  2DG9 A;  1ZK6 A;  4P8U A;  1LJY A;  3KAH A;  5HT1 A;  1F40 A;  3EY6 A;  2MF9 A;  1GOI A;  4LGX A;  4JFI A;  4Z2I A;  2WLY A;  1FKS A;  3O5K A;  1Q1C A;  4W9O A;  1FD9 A;  4TW6 A;  3CHC A;  4U84 A;  3KZ7 A;  4MGV A;  2A3C A;  3KAD A;  5HW6 A;  1HKK A;  1FFR A;  2LKN A;  4MAV A;  5DIU A;  4DZ2 A;  3B9E A;  1QZ2 A;  3RM4 A;  1E6P A;  3O5E A;  2YBU A;  4DZ3 A;  3O5M A;  4P8X A;  4TYO A;  1J4I A;  1D7J A;  3O5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...