4ODNA

Structure of slyd from thermus thermophilus in complex with s2-plus peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
total genus 32
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odnA00
4R0XA 4DRIA 1D6OA 4QIBA 1P5QA 1JNTA 5B8IC 3IKDA 4JYSA 4TW8A 1FKKA 2XP4A 3H9RB 2PV1A 4IQCA 5GPGA 1Q6UA 1R9HA 4ODLA 4DRHA 1F40A 3I6CA 4W9QA 1JNSA 5HKGA 2RSEA 2LPVA 2XP9A 3UI4A 2N87A 3JYMA 4TW6A 1TCOC 3O5FA 1Y0OA 1YW5A 2Q5AA 3O5LA 3O5QA 3MDYB 2ZQUA 4DROA 1FAPA 2UZ5A 1FKHA 5J6EA 2JZVA 2RURA 4DRPA 3NRKA 5HWBA 4JFIA 1J6YA 2MLYA 3VAWA 4DZ2A 3UQAA 3PRBA 4BF8A 2PPNA 4DZ3A 1FKFA 4MGVA 1FKDA 2OFNA 1FKGA 1A7XA 2DG3A 3UI5A 1FD9A 1FKTA 4GGQA 4JFKA 3O5JA 4LAVA 2FKEA 1ROUA 1FKLA 4ODMA 4DIPA 4ODQA 2MLZA 5D75A 2MF9A 2KR7A 2XP7A 3KADA 2XPBA 4JFJA 1JVWA 3KABA 2F4EA 1ROTA 2L2SA 2PV2A 1Q6IA 2LGOA 2ZR5A 2ZQTA 1FKIA 2M08A 2PV3A 4DRNA 2MLXA 4C02B 3UQBA 4DT4A 3IKGA 3KACA 2ITKA 5HUAA 1FJDA 1FKBA 1NMVA 3O5GA 3CGNA 4IQ2A 1FKJA 3GPKA 1C9HA 1L1PA 3IHZA 3WH0A 4ITZA 4TNSA 2ZR6A 2RUDA 4G2PA 1M5YA 1D7HA 4G50A 5DIVA 2KE0A 2XP8A 3O5RA 2PBCA 1FKSA 1BL4A 1NMWA 1T11A 2KFWA 1U79A 3O5PA 1YATA 1D7IA 5DIUA 3UI6A 1HXVA 4ODRA 3KAGA 3OOBA 2DG4A 4JFMA 3KZ7A 3UQIA 2DG9A 2RUCA 3O5MA 3O5KA 3O5IA 3IK8A 1KT0A 3FAPA 3UF8A 4O2TA 1D7JA 1J4HA 3KAFA 2M1IA 2MNTA 3LUOA 1B6CA 5DITA 1J4RA 2XP5A 1W26A 3JYJA 5I98A 3NI6A 1EQ3A 2AWGA 4W9OA 3CGMA 4LAXA 4ODNA 2VCDA 5HT1A 2KO7A 5HTGA 1F8AB 2Y78A 2PPPA 2KI3A 3KAIA 4JFLA 5HW6A 1QZ2A 4DRJA 4QT2A 2F21A 3PA7A 4J4OA 2XPAA 3TCZA 1NSGA 4W9PA 2LJ4A 4DRKA 2RUQA 4J4NA 1N1AA 2XP6A 4ODKA 4LAWA 4FAPA 1QPLA 2PPOA 4IPXA 4U85A 1Q1CA 2D9FA 1BKFA 3PRDA 2FAPA 2RQSA 1ZK6A 2XP3A 3TDBA 5HW8A 1FKRA 4DH0A 4TX0A 2VN1A 2LKNA 4N19A 4ODPA 2K8IA 4TW7A 4TYOA 3NTPA 1PBKA 4U86A 3TC5A 5BXJA 1QPFA 1KT1A 2ZQVA 1EYMA 5HW7A 3O5DA 1PINA 3O5OA 2F2DA 2M2AA 3KCEA 2MPHA 4ODOA 2ZQSA 2KGJA 4NNRA 4QT3A 1J4IA 3RFWA 4DRMA 3RGCA 4DRQA 2ZR4A 3ODKA 3EY6A 4LAYA 4FN2A 1ZCNA 4GIVA 3B7XA 1Q6HA 2IF4A 5HWCA 4MSPA 4U84A 3JXVA 3KAHA 3O5EA
chains in the Genus database with same CATH superfamily
4Z2LA 4UDMA 4QIBA 1P5QA 3WQVA 4JYSA 4KQZA 5I98A 4IQCA 4S3KA 4DRHA 1Q6UA 1R9HA 5HKGA 2RSEA 3UI4A 2WLYA 4LGXA 4P8XA 1YW5A 1EIBA 1E6PA 4DRPA 2DSUA 5HWBA 4JFIA 1J6YA 1CTNA 1LG1A 1ZL1A 2DSZA 3PRBA 4MGVA 1W1YA 1FKGA 2DG3A 3WL1A 2FKEA 4HARA 1FKLA 4ODQA 2O92A 2MF9A 3AS2A 3CZ8A 3KADA 1NH6A 2DT2A 2XPBA 4JFJA 4QZVB 4MNLA 3KABA 1ROTA 2PV2A 1Q6IA 1FKIA 2M08A 4WKHA 4DT4A 3IKGA 3GTYX 2ITKA 1FKBA 1NMVA 1K9TA 3WH0A 2ZR6A 2RUDA 2WK2A 4G2PA 3G6MA 4ZPVR 2KE0A 1FKSA 3ARXA 1YATA 1D7IA 1HXVA 4ODRA 3OOBA 2RUCA 3O5IA 4IT4A 1D7JA 5HBFA 2XP5A 3JYJA 5HT1A 3CHEA 2Y78A 3PR9A 4L3NA 1E6RA 3ARTA 1OGBA 2XPAA 3AS0A 3TCZA 2RUQA 2G8ZA 1ZB5A 4U85A 3ARYA 4HBOA 1BKFA 1ZK6A 4DH0A 2VN1A 4KR0B 2K8IA 4URIA 3CHFA 4XAKA 1QPFA 1KT1A 3O5DA 3ARSA 4Q7NA 3ALFA 4ODOA 2ZQSA 2KGJA 4NNRA 4QT3A 3RFWA 4DRMA 3EY6A 4FN2A 1ZCNA 4MSPA 3B8SA 1E15A 3KAHA 4ZS6A 2DSWA 5GPGA 3ARWA 1W1VA 3I6CA 4W9QA 1JNSA 3W4RA 2XP9A 1NWTA 2N87A 1NWUA 1TCOC 2Q5AA 3O5LA 3O5QA 1XRVA 2RURA 3ARZA 3NRKA 4DZ2A 4BF8A 2PPNA 2A3CA 5JH8A 4R5EA 1FKDA 1W1PA 1HKMA 4GGQA 5GQBA 3O5JA 4LAVA 1ROUA 4MPKA 4DIPA 5D75A 1HKIA 2XP7A 2IUZA 4HBEA 3AS3A 1HKKA 2ZQTA 2PV3A 1NWSA 2A3EA 1TFVA 2WLZA 2ETNA 5HUAA 3ARQA 1SYTA 3CH9A 4Z2IA 1LL6A 3WL0A 4IQ2A 1FKJA 1UR9A 1M5YA 2PBCA 1BL4A 1NMWA 1JNDA 3O5PA 1U79A 1X6NA 5DIUA 1HKJA 3KAGA 3KZ7A 3IK8A 1KT0A 3UF8A 1E6ZA 2MNTA 2PI6A 3G6LA 1J4RA 2AWGA 3CGMA 2VCDA 2KO7A 5HTGA 3CHCA 1F8AB 2PPPA 3KAIA 4JFLA 1QZ2A 3WD1A 4DRJA 3RM8A 2DT0A 4J4OA 3WQWA 1JCHB 4J4NA 1N1AA 2XP6A 4FAPA 2DPEA 2PPOA 4IPXA 3PRDA 4Q22A 1SR0A 1FKRA 2OLHA 4P8WA 4TYOA 3TC5A 4WK9A 2ZQVA 3O5OA 2PN0A 3KCEA 2O9OA 1J4IA 4MTVA 4ZPWR 2ZR4A 3B7XA 1Q6HA 2IF4A 3O5EA 3WIJA 4DRIA 1D6OA 4DWSC 4Z2KA 3CHDA 1FKKA 2QF8A 4MNKA 1GPFA 4TW6A 4ML4A 3O5FA 1Y0OA 3WD3A 4DROA 1E44A 1JNEA 1XHGA 2UZ5A 1FKHA 3AS1A 3BMBA 5J6EA 2MLYA 1GUVA 3VAWA 4DZ3A 2DT1A 1A7XA 1GRJA 1FD9A 3AROA 2P4VA 2YBTA 4WIWA 2MLZA 3ARRA 3B9AA 1JVWA 2F4EA 1HJWA 2LGOA 1WAWA 2MLXA 3UQBA 1E6NA 2AOSA 3FY1A 3KACA 2DSVA 1FJDA 3O5GA 3CGNA 3EIPA 1W1TA 1C9HA 3GPKA 1L1PA 2FDMA 4ITZA 1EDQA 4G50A 5DIVA 3ARPA 2XP8A 3O5RA 1NWRA 1W9PA 4JFMA 2DG4A 2DG9A 1X6LA 3O5KA 3FAPA 4MAVA 1J4HA 3KAFA 2M1IA 2B5UB 1B6CA 3ARUA 3LUOA 4MNJA 1W26A 1EQ3A 5HW6A 4MNMA 4QT2A 3B9EA 1OWQA 4W9PA 2A3BA 4DRKA 4NSBA 4LAWA 1QPLA 4DWSD 5DO2A 2FAPA 2RQSA 5HW8A 2XP3A 3TDBA 2LKNA 4TW7A 3NTPA 1HJXA 1ZBKA 5BXJA 3B9DA 1EYMA 1FFQA 1ITXA 2A3AA 1RD6A 1WB0A 2M2AA 2MPHA 1W9UA 3RGCA 3ODKA 3ARVA 3WD4A 4GIVA 1IX5A 3JXVA 3UQIA 2YBUA 4R0XA 1GOIA 1LG2A 1JNTA 4WKFA 1LL4A 3IKDA 4TW8A 2XP4A 3H9RB 2PV1A 4DWSB 1ZBCA 4ODLA 1F40A 3QOKA 2LPVA 3RM4A 3JYMA 4Z2JA 4IT6A 3MDYB 2ZQUA 1FAPA 3WKZA 2JZVA 1OGGA 3UQAA 3RMEA 1FKFA 2OFNA 2B31A 3UI5A 4JFKA 1FKTA 1ZBWA 4P8UA 4ODMA 2KR7A 1W9VA 2L2SA 3PRAA 2ZR5A 3ALGA 4DRNA 4C02B 4Z2HA 1ZBVA 1H0GA 1D2KA 3GU0A 3IHZA 4TNSA 1WNOA 1D7HA 1FFRA 2WM0A 1O6IA 1T11A 2KFWA 3UI6A 1HJVA 5DEZA 3O5MA 2ESCA 4O2TA 2G41A 3RM9A 5DF0A 5DITA 3AQUA 3BXWA 3NI6A 1LQ0A 4W9OA 4LAXA 4ODNA 2DT3A 4S3JA 3FXYA 1LJYA 2KI3A 3OA5A 2F21A 3PA7A 4WJXA 1NSGA 1H0IA 4L72B 4PTMA 4DWSA 2LJ4A 5B8IC 4ODKA 4ZPTR 1E9LA 1Q1CA 2D9FA 2EULA 1LL7A 4TX0A 4WKAA 4N19A 4ODPA 1ZU8A 1PBKA 4U86A 4W5UA 4NZCA 5HW7A 1PINA 2F2DA 4AY1A 1EHNA 3WD2A 1KFWA 2F23A 5GPRA 4DRQA 4LAYA 1VF8A 3WD0A 4P8VA 5HWCA 4Z2GA 4U84A 1UR8A
chains in the Genus database with same CATH topology
4Z2LA 4QIBA 1P5QA 3WQVA 4JYSA 4KQZA 5I98A 4IQCA 4S3KA 4DRHA 1Q6UA 1R9HA 5HKGA 2RSEA 3UI4A 2WLYA 4LGXA 4P8XA 1YW5A 1EIBA 1E6PA 4DRPA 2DSUA 5HWBA 4JFIA 1J6YA 1CTNA 1LG1A 1ZL1A 2DSZA 3PRBA 4MGVA 1W1YA 1FKGA 2DG3A 3WL1A 2FKEA 4HARA 1FKLA 4ODQA 2O92A 2MF9A 3AS2A 3CZ8A 3KADA 1NH6A 2DT2A 2XPBA 4JFJA 4QZVB 4MNLA 3KABA 1ROTA 2PV2A 1Q6IA 1FKIA 2M08A 4WKHA 4DT4A 3IKGA 2ITKA 1FKBA 1NMVA 1K9TA 3WH0A 2ZR6A 2RUDA 2WK2A 4G2PA 3G6MA 4ZPVR 2KE0A 1FKSA 3ARXA 1YATA 1D7IA 1HXVA 4ODRA 3OOBA 2RUCA 3O5IA 4IT4A 1D7JA 5HBFA 2XP5A 3JYJA 5HT1A 3CHEA 2Y78A 3PR9A 4L3NA 1E6RA 3ARTA 1OGBA 2XPAA 3AS0A 3TCZA 2RUQA 2G8ZA 1ZB5A 4U85A 3ARYA 4HBOA 1BKFA 1ZK6A 4DH0A 2VN1A 4KR0B 2K8IA 4URIA 3CHFA 4XAKA 1QPFA 1KT1A 3O5DA 3ARSA 4Q7NA 3ALFA 4ODOA 2ZQSA 2KGJA 4NNRA 4QT3A 3RFWA 4DRMA 3EY6A 4FN2A 1ZCNA 4MSPA 3B8SA 1E15A 3KAHA 4ZS6A 2DSWA 5GPGA 3ARWA 1W1VA 3I6CA 4W9QA 1JNSA 3W4RA 2XP9A 1NWTA 2N87A 1NWUA 1TCOC 2Q5AA 3O5LA 3O5QA 1XRVA 2RURA 3ARZA 3NRKA 4DZ2A 4BF8A 2PPNA 2A3CA 5JH8A 4R5EA 1FKDA 1W1PA 1HKMA 4GGQA 5GQBA 3O5JA 4LAVA 1ROUA 4MPKA 4DIPA 5D75A 1HKIA 2XP7A 2IUZA 4HBEA 3AS3A 1HKKA 2ZQTA 2PV3A 1NWSA 2A3EA 1TFVA 2WLZA 5HUAA 3ARQA 1SYTA 3CH9A 4Z2IA 1LL6A 3WL0A 4IQ2A 1FKJA 1UR9A 1M5YA 2PBCA 1BL4A 1NMWA 1JNDA 3O5PA 1U79A 1X6NA 5DIUA 1HKJA 3KAGA 3KZ7A 3IK8A 1KT0A 3UF8A 1E6ZA 2MNTA 2PI6A 3G6LA 1J4RA 2AWGA 3CGMA 2VCDA 2KO7A 5HTGA 3CHCA 1F8AB 2PPPA 3KAIA 4JFLA 1QZ2A 3WD1A 4DRJA 3RM8A 2DT0A 4J4OA 3WQWA 4J4NA 1N1AA 2XP6A 4FAPA 2DPEA 2PPOA 4IPXA 3PRDA 4Q22A 1SR0A 1FKRA 2OLHA 4P8WA 4TYOA 3TC5A 4WK9A 2ZQVA 3O5OA 3KCEA 2O9OA 1J4IA 4MTVA 4ZPWR 2ZR4A 3B7XA 1Q6HA 2IF4A 3O5EA 3WIJA 4DRIA 1D6OA 4DWSC 4Z2KA 3CHDA 1FKKA 2QF8A 4MNKA 1GPFA 4TW6A 4ML4A 3O5FA 1Y0OA 3WD3A 4DROA 1JNEA 1XHGA 2UZ5A 1FKHA 3AS1A 5J6EA 2MLYA 1GUVA 3VAWA 4DZ3A 2DT1A 1A7XA 1FD9A 3AROA 2YBTA 4WIWA 2MLZA 3ARRA 3B9AA 1JVWA 2F4EA 1HJWA 2LGOA 1WAWA 2MLXA 3UQBA 1E6NA 2AOSA 3FY1A 3KACA 2DSVA 1FJDA 3O5GA 3CGNA 3GPKA 1W1TA 1C9HA 1L1PA 2FDMA 4ITZA 1EDQA 4G50A 5DIVA 3ARPA 2XP8A 3O5RA 1NWRA 1W9PA 4JFMA 2DG4A 2DG9A 1X6LA 3O5KA 3FAPA 4MAVA 1J4HA 3KAFA 2M1IA 3LUOA 1B6CA 3ARUA 4MNJA 1W26A 1EQ3A 5HW6A 4MNMA 4QT2A 3B9EA 1OWQA 4W9PA 2A3BA 4DRKA 4NSBA 4LAWA 1QPLA 4DWSD 5DO2A 2FAPA 2RQSA 5HW8A 2XP3A 3TDBA 2LKNA 4TW7A 3NTPA 1HJXA 1ZBKA 5BXJA 3B9DA 1EYMA 1FFQA 1ITXA 2A3AA 1RD6A 1WB0A 2M2AA 2MPHA 1W9UA 3RGCA 3ODKA 3ARVA 3WD4A 4GIVA 1IX5A 3JXVA 3UQIA 2YBUA 4R0XA 1GOIA 1LG2A 1JNTA 4WKFA 1LL4A 3IKDA 4TW8A 2XP4A 3H9RB 2PV1A 4DWSB 1ZBCA 4ODLA 1F40A 3QOKA 2LPVA 3RM4A 3JYMA 4Z2JA 4IT6A 3MDYB 2ZQUA 1FAPA 3WKZA 2JZVA 1OGGA 3UQAA 3RMEA 1FKFA 2OFNA 2B31A 3UI5A 4JFKA 1FKTA 1ZBWA 4P8UA 4ODMA 2KR7A 1W9VA 2L2SA 3PRAA 2ZR5A 3ALGA 4DRNA 4C02B 4Z2HA 1ZBVA 1H0GA 1D2KA 3IHZA 4TNSA 1WNOA 1D7HA 1FFRA 2WM0A 1O6IA 1T11A 2KFWA 3UI6A 1HJVA 5DEZA 3O5MA 2ESCA 4O2TA 2G41A 3RM9A 5DF0A 5DITA 3AQUA 3BXWA 3NI6A 1LQ0A 4W9OA 4LAXA 4ODNA 2DT3A 4S3JA 3FXYA 1LJYA 2KI3A 3OA5A 2F21A 3PA7A 4WJXA 1NSGA 1H0IA 4L72B 4PTMA 4DWSA 2LJ4A 5B8IC 4ODKA 4ZPTR 1E9LA 1Q1CA 2D9FA 1LL7A 4TX0A 4WKAA 4N19A 4ODPA 1ZU8A 1PBKA 4U86A 4W5UA 4NZCA 5HW7A 1PINA 2F2DA 4AY1A 1EHNA 3WD2A 1KFWA 5GPRA 4DRQA 4LAYA 1VF8A 3WD0A 4P8VA 5HWCA 4Z2GA 4U84A 1UR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0X A;  4DRI A;  1D6O A;  4QIB A;  1P5Q A;  1JNT A;  5B8I C;  3IKD A;  4JYS A;  4TW8 A;  1FKK A;  2XP4 A;  3H9R B;  2PV1 A;  4IQC A;  5GPG A;  1Q6U A;  1R9H A;  4ODL A;  4DRH A;  1F40 A;  3I6C A;  4W9Q A;  1JNS A;  5HKG A;  2RSE A;  2LPV A;  2XP9 A;  3UI4 A;  2N87 A;  3JYM A;  4TW6 A;  1TCO C;  3O5F A;  1Y0O A;  1YW5 A;  2Q5A A;  3O5L A;  3O5Q A;  3MDY B;  2ZQU A;  4DRO A;  1FAP A;  2UZ5 A;  1FKH A;  5J6E A;  2JZV A;  2RUR A;  4DRP A;  3NRK A;  5HWB A;  4JFI A;  1J6Y A;  2MLY A;  3VAW A;  4DZ2 A;  3UQA A;  3PRB A;  4BF8 A;  2PPN A;  4DZ3 A;  1FKF A;  4MGV A;  1FKD A;  2OFN A;  1FKG A;  1A7X A;  2DG3 A;  3UI5 A;  1FD9 A;  1FKT A;  4GGQ A;  4JFK A;  3O5J A;  4LAV A;  2FKE A;  1ROU A;  1FKL A;  4ODM A;  4DIP A;  4ODQ A;  2MLZ A;  5D75 A;  2MF9 A;  2KR7 A;  2XP7 A;  3KAD A;  2XPB A;  4JFJ A;  1JVW A;  3KAB A;  2F4E A;  1ROT A;  2L2S A;  2PV2 A;  1Q6I A;  2LGO A;  2ZR5 A;  2ZQT A;  1FKI A;  2M08 A;  2PV3 A;  4DRN A;  2MLX A;  4C02 B;  3UQB A;  4DT4 A;  3IKG A;  3KAC A;  2ITK A;  5HUA A;  1FJD A;  1FKB A;  1NMV A;  3O5G A;  3CGN A;  4IQ2 A;  1FKJ A;  3GPK A;  1C9H A;  1L1P A;  3IHZ A;  3WH0 A;  4ITZ A;  4TNS A;  2ZR6 A;  2RUD A;  4G2P A;  1M5Y A;  1D7H A;  4G50 A;  5DIV A;  2KE0 A;  2XP8 A;  3O5R A;  2PBC A;  1FKS A;  1BL4 A;  1NMW A;  1T11 A;  2KFW A;  1U79 A;  3O5P A;  1YAT A;  1D7I A;  5DIU A;  3UI6 A;  1HXV A;  4ODR A;  3KAG A;  3OOB A;  2DG4 A;  4JFM A;  3KZ7 A;  3UQI A;  2DG9 A;  2RUC A;  3O5M A;  3O5K A;  3O5I A;  3IK8 A;  1KT0 A;  3FAP A;  3UF8 A;  4O2T A;  1D7J A;  1J4H A;  3KAF A;  2M1I A;  2MNT A;  3LUO A;  1B6C A;  5DIT A;  1J4R A;  2XP5 A;  1W26 A;  3JYJ A;  5I98 A;  3NI6 A;  1EQ3 A;  2AWG A;  4W9O A;  3CGM A;  4LAX A;  4ODN A;  2VCD A;  5HT1 A;  2KO7 A;  5HTG A;  1F8A B;  2Y78 A;  2PPP A;  2KI3 A;  3KAI A;  4JFL A;  5HW6 A;  1QZ2 A;  4DRJ A;  4QT2 A;  2F21 A;  3PA7 A;  4J4O A;  2XPA A;  3TCZ A;  1NSG A;  4W9P A;  2LJ4 A;  4DRK A;  2RUQ A;  4J4N A;  1N1A A;  2XP6 A;  4ODK A;  4LAW A;  4FAP A;  1QPL A;  2PPO A;  4IPX A;  4U85 A;  1Q1C A;  2D9F A;  1BKF A;  3PRD A;  2FAP A;  2RQS A;  1ZK6 A;  2XP3 A;  3TDB A;  5HW8 A;  1FKR A;  4DH0 A;  4TX0 A;  2VN1 A;  2LKN A;  4N19 A;  4ODP A;  2K8I A;  4TW7 A;  4TYO A;  3NTP A;  1PBK A;  4U86 A;  3TC5 A;  5BXJ A;  1QPF A;  1KT1 A;  2ZQV A;  1EYM A;  5HW7 A;  3O5D A;  1PIN A;  3O5O A;  2F2D A;  2M2A A;  3KCE A;  2MPH A;  4ODO A;  2ZQS A;  2KGJ A;  4NNR A;  4QT3 A;  1J4I A;  3RFW A;  4DRM A;  3RGC A;  4DRQ A;  2ZR4 A;  3ODK A;  3EY6 A;  4LAY A;  4FN2 A;  1ZCN A;  4GIV A;  3B7X A;  1Q6H A;  2IF4 A;  5HWC A;  4MSP A;  4U84 A;  3JXV A;  3KAH A;  3O5E A; 
#chains in the Genus database with same CATH topology
 4Z2L A;  4UDM A;  4QIB A;  1P5Q A;  3WQV A;  4JYS A;  4KQZ A;  5I98 A;  4IQC A;  4S3K A;  4DRH A;  1Q6U A;  1R9H A;  5HKG A;  2RSE A;  3UI4 A;  2WLY A;  4LGX A;  4P8X A;  1YW5 A;  1EIB A;  1E6P A;  4DRP A;  2DSU A;  5HWB A;  4JFI A;  1J6Y A;  1CTN A;  1LG1 A;  1ZL1 A;  2DSZ A;  3PRB A;  4MGV A;  1W1Y A;  1FKG A;  2DG3 A;  3WL1 A;  2FKE A;  4HAR A;  1FKL A;  4ODQ A;  2O92 A;  2MF9 A;  3AS2 A;  3CZ8 A;  3KAD A;  1NH6 A;  2DT2 A;  2XPB A;  4JFJ A;  4QZV B;  4MNL A;  3KAB A;  1ROT A;  2PV2 A;  1Q6I A;  1FKI A;  2M08 A;  4WKH A;  4DT4 A;  3IKG A;  3GTY X;  2ITK A;  1FKB A;  1NMV A;  1K9T A;  3WH0 A;  2ZR6 A;  2RUD A;  2WK2 A;  4G2P A;  3G6M A;  4ZPV R;  2KE0 A;  1FKS A;  3ARX A;  1YAT A;  1D7I A;  1HXV A;  4ODR A;  3OOB A;  2RUC A;  3O5I A;  4IT4 A;  1D7J A;  5HBF A;  2XP5 A;  3JYJ A;  5HT1 A;  3CHE A;  2Y78 A;  3PR9 A;  4L3N A;  1E6R A;  3ART A;  1OGB A;  2XPA A;  3AS0 A;  3TCZ A;  2RUQ A;  2G8Z A;  1ZB5 A;  4U85 A;  3ARY A;  4HBO A;  1BKF A;  1ZK6 A;  4DH0 A;  2VN1 A;  4KR0 B;  2K8I A;  4URI A;  3CHF A;  4XAK A;  1QPF A;  1KT1 A;  3O5D A;  3ARS A;  4Q7N A;  3ALF A;  4ODO A;  2ZQS A;  2KGJ A;  4NNR A;  4QT3 A;  3RFW A;  4DRM A;  3EY6 A;  4FN2 A;  1ZCN A;  4MSP A;  3B8S A;  1E15 A;  3KAH A;  4ZS6 A;  2DSW A;  5GPG A;  3ARW A;  1W1V A;  3I6C A;  4W9Q A;  1JNS A;  3W4R A;  2XP9 A;  1NWT A;  2N87 A;  1NWU A;  1TCO C;  2Q5A A;  3O5L A;  3O5Q A;  1XRV A;  2RUR A;  3ARZ A;  3NRK A;  4DZ2 A;  4BF8 A;  2PPN A;  2A3C A;  5JH8 A;  4R5E A;  1FKD A;  1W1P A;  1HKM A;  4GGQ A;  5GQB A;  3O5J A;  4LAV A;  1ROU A;  4MPK A;  4DIP A;  5D75 A;  1HKI A;  2XP7 A;  2IUZ A;  4HBE A;  3AS3 A;  1HKK A;  2ZQT A;  2PV3 A;  1NWS A;  2A3E A;  1TFV A;  2WLZ A;  2ETN A;  5HUA A;  3ARQ A;  1SYT A;  3CH9 A;  4Z2I A;  1LL6 A;  3WL0 A;  4IQ2 A;  1FKJ A;  1UR9 A;  1M5Y A;  2PBC A;  1BL4 A;  1NMW A;  1JND A;  3O5P A;  1U79 A;  1X6N A;  5DIU A;  1HKJ A;  3KAG A;  3KZ7 A;  3IK8 A;  1KT0 A;  3UF8 A;  1E6Z A;  2MNT A;  2PI6 A;  3G6L A;  1J4R A;  2AWG A;  3CGM A;  2VCD A;  2KO7 A;  5HTG A;  3CHC A;  1F8A B;  2PPP A;  3KAI A;  4JFL A;  1QZ2 A;  3WD1 A;  4DRJ A;  3RM8 A;  2DT0 A;  4J4O A;  3WQW A;  1JCH B;  4J4N A;  1N1A A;  2XP6 A;  4FAP A;  2DPE A;  2PPO A;  4IPX A;  3PRD A;  4Q22 A;  1SR0 A;  1FKR A;  2OLH A;  4P8W A;  4TYO A;  3TC5 A;  4WK9 A;  2ZQV A;  3O5O A;  2PN0 A;  3KCE A;  2O9O A;  1J4I A;  4MTV A;  4ZPW R;  2ZR4 A;  3B7X A;  1Q6H A;  2IF4 A;  3O5E A;  3WIJ A;  4DRI A;  1D6O A;  4DWS C;  4Z2K A;  3CHD A;  1FKK A;  2QF8 A;  4MNK A;  1GPF A;  4TW6 A;  4ML4 A;  3O5F A;  1Y0O A;  3WD3 A;  4DRO A;  1E44 A;  1JNE A;  1XHG A;  2UZ5 A;  1FKH A;  3AS1 A;  3BMB A;  5J6E A;  2MLY A;  1GUV A;  3VAW A;  4DZ3 A;  2DT1 A;  1A7X A;  1GRJ A;  1FD9 A;  3ARO A;  2P4V A;  2YBT A;  4WIW A;  2MLZ A;  3ARR A;  3B9A A;  1JVW A;  2F4E A;  1HJW A;  2LGO A;  1WAW A;  2MLX A;  3UQB A;  1E6N A;  2AOS A;  3FY1 A;  3KAC A;  2DSV A;  1FJD A;  3O5G A;  3CGN A;  3EIP A;  1W1T A;  1C9H A;  3GPK A;  1L1P A;  2FDM A;  4ITZ A;  1EDQ A;  4G50 A;  5DIV A;  3ARP A;  2XP8 A;  3O5R A;  1NWR A;  1W9P A;  4JFM A;  2DG4 A;  2DG9 A;  1X6L A;  3O5K A;  3FAP A;  4MAV A;  1J4H A;  3KAF A;  2M1I A;  2B5U B;  1B6C A;  3ARU A;  3LUO A;  4MNJ A;  1W26 A;  1EQ3 A;  5HW6 A;  4MNM A;  4QT2 A;  3B9E A;  1OWQ A;  4W9P A;  2A3B A;  4DRK A;  4NSB A;  4LAW A;  1QPL A;  4DWS D;  5DO2 A;  2FAP A;  2RQS A;  5HW8 A;  2XP3 A;  3TDB A;  2LKN A;  4TW7 A;  3NTP A;  1HJX A;  1ZBK A;  5BXJ A;  3B9D A;  1EYM A;  1FFQ A;  1ITX A;  2A3A A;  1RD6 A;  1WB0 A;  2M2A A;  2MPH A;  1W9U A;  3RGC A;  3ODK A;  3ARV A;  3WD4 A;  4GIV A;  1IX5 A;  3JXV A;  3UQI A;  2YBU A;  4R0X A;  1GOI A;  1LG2 A;  1JNT A;  4WKF A;  1LL4 A;  3IKD A;  4TW8 A;  2XP4 A;  3H9R B;  2PV1 A;  4DWS B;  1ZBC A;  4ODL A;  1F40 A;  3QOK A;  2LPV A;  3RM4 A;  3JYM A;  4Z2J A;  4IT6 A;  3MDY B;  2ZQU A;  1FAP A;  3WKZ A;  2JZV A;  1OGG A;  3UQA A;  3RME A;  1FKF A;  2OFN A;  2B31 A;  3UI5 A;  4JFK A;  1FKT A;  1ZBW A;  4P8U A;  4ODM A;  2KR7 A;  1W9V A;  2L2S A;  3PRA A;  2ZR5 A;  3ALG A;  4DRN A;  4C02 B;  4Z2H A;  1ZBV A;  1H0G A;  1D2K A;  3GU0 A;  3IHZ A;  4TNS A;  1WNO A;  1D7H A;  1FFR A;  2WM0 A;  1O6I A;  1T11 A;  2KFW A;  3UI6 A;  1HJV A;  5DEZ A;  3O5M A;  2ESC A;  4O2T A;  2G41 A;  3RM9 A;  5DF0 A;  5DIT A;  3AQU A;  3BXW A;  3NI6 A;  1LQ0 A;  4W9O A;  4LAX A;  4ODN A;  2DT3 A;  4S3J A;  3FXY A;  1LJY A;  2KI3 A;  3OA5 A;  2F21 A;  3PA7 A;  4WJX A;  1NSG A;  1H0I A;  4L72 B;  4PTM A;  4DWS A;  2LJ4 A;  5B8I C;  4ODK A;  4ZPT R;  1E9L A;  1Q1C A;  2D9F A;  2EUL A;  1LL7 A;  4TX0 A;  4WKA A;  4N19 A;  4ODP A;  1ZU8 A;  1PBK A;  4U86 A;  4W5U A;  4NZC A;  5HW7 A;  1PIN A;  2F2D A;  4AY1 A;  1EHN A;  3WD2 A;  1KFW A;  2F23 A;  5GPR A;  4DRQ A;  4LAY A;  1VF8 A;  3WD0 A;  4P8V A;  5HWC A;  4Z2G A;  4U84 A;  1UR8 A; 
#chains in the Genus database with same CATH homology
 4Z2L A;  4QIB A;  1P5Q A;  3WQV A;  4JYS A;  4KQZ A;  5I98 A;  4IQC A;  4S3K A;  4DRH A;  1Q6U A;  1R9H A;  5HKG A;  2RSE A;  3UI4 A;  2WLY A;  4LGX A;  4P8X A;  1YW5 A;  1EIB A;  1E6P A;  4DRP A;  2DSU A;  5HWB A;  4JFI A;  1J6Y A;  1CTN A;  1LG1 A;  1ZL1 A;  2DSZ A;  3PRB A;  4MGV A;  1W1Y A;  1FKG A;  2DG3 A;  3WL1 A;  2FKE A;  4HAR A;  1FKL A;  4ODQ A;  2O92 A;  2MF9 A;  3AS2 A;  3CZ8 A;  3KAD A;  1NH6 A;  2DT2 A;  2XPB A;  4JFJ A;  4QZV B;  4MNL A;  3KAB A;  1ROT A;  2PV2 A;  1Q6I A;  1FKI A;  2M08 A;  4WKH A;  4DT4 A;  3IKG A;  2ITK A;  1FKB A;  1NMV A;  1K9T A;  3WH0 A;  2ZR6 A;  2RUD A;  2WK2 A;  4G2P A;  3G6M A;  4ZPV R;  2KE0 A;  1FKS A;  3ARX A;  1YAT A;  1D7I A;  1HXV A;  4ODR A;  3OOB A;  2RUC A;  3O5I A;  4IT4 A;  1D7J A;  5HBF A;  2XP5 A;  3JYJ A;  5HT1 A;  3CHE A;  2Y78 A;  3PR9 A;  4L3N A;  1E6R A;  3ART A;  1OGB A;  2XPA A;  3AS0 A;  3TCZ A;  2RUQ A;  2G8Z A;  1ZB5 A;  4U85 A;  3ARY A;  4HBO A;  1BKF A;  1ZK6 A;  4DH0 A;  2VN1 A;  4KR0 B;  2K8I A;  4URI A;  3CHF A;  4XAK A;  1QPF A;  1KT1 A;  3O5D A;  3ARS A;  4Q7N A;  3ALF A;  4ODO A;  2ZQS A;  2KGJ A;  4NNR A;  4QT3 A;  3RFW A;  4DRM A;  3EY6 A;  4FN2 A;  1ZCN A;  4MSP A;  3B8S A;  1E15 A;  3KAH A;  4ZS6 A;  2DSW A;  5GPG A;  3ARW A;  1W1V A;  3I6C A;  4W9Q A;  1JNS A;  3W4R A;  2XP9 A;  1NWT A;  2N87 A;  1NWU A;  1TCO C;  2Q5A A;  3O5L A;  3O5Q A;  1XRV A;  2RUR A;  3ARZ A;  3NRK A;  4DZ2 A;  4BF8 A;  2PPN A;  2A3C A;  5JH8 A;  4R5E A;  1FKD A;  1W1P A;  1HKM A;  4GGQ A;  5GQB A;  3O5J A;  4LAV A;  1ROU A;  4MPK A;  4DIP A;  5D75 A;  1HKI A;  2XP7 A;  2IUZ A;  4HBE A;  3AS3 A;  1HKK A;  2ZQT A;  2PV3 A;  1NWS A;  2A3E A;  1TFV A;  2WLZ A;  5HUA A;  3ARQ A;  1SYT A;  3CH9 A;  4Z2I A;  1LL6 A;  3WL0 A;  4IQ2 A;  1FKJ A;  1UR9 A;  1M5Y A;  2PBC A;  1BL4 A;  1NMW A;  1JND A;  3O5P A;  1U79 A;  1X6N A;  5DIU A;  1HKJ A;  3KAG A;  3KZ7 A;  3IK8 A;  1KT0 A;  3UF8 A;  1E6Z A;  2MNT A;  2PI6 A;  3G6L A;  1J4R A;  2AWG A;  3CGM A;  2VCD A;  2KO7 A;  5HTG A;  3CHC A;  1F8A B;  2PPP A;  3KAI A;  4JFL A;  1QZ2 A;  3WD1 A;  4DRJ A;  3RM8 A;  2DT0 A;  4J4O A;  3WQW A;  4J4N A;  1N1A A;  2XP6 A;  4FAP A;  2DPE A;  2PPO A;  4IPX A;  3PRD A;  4Q22 A;  1SR0 A;  1FKR A;  2OLH A;  4P8W A;  4TYO A;  3TC5 A;  4WK9 A;  2ZQV A;  3O5O A;  3KCE A;  2O9O A;  1J4I A;  4MTV A;  4ZPW R;  2ZR4 A;  3B7X A;  1Q6H A;  2IF4 A;  3O5E A;  3WIJ A;  4DRI A;  1D6O A;  4DWS C;  4Z2K A;  3CHD A;  1FKK A;  2QF8 A;  4MNK A;  1GPF A;  4TW6 A;  4ML4 A;  3O5F A;  1Y0O A;  3WD3 A;  4DRO A;  1JNE A;  1XHG A;  2UZ5 A;  1FKH A;  3AS1 A;  5J6E A;  2MLY A;  1GUV A;  3VAW A;  4DZ3 A;  2DT1 A;  1A7X A;  1FD9 A;  3ARO A;  2YBT A;  4WIW A;  2MLZ A;  3ARR A;  3B9A A;  1JVW A;  2F4E A;  1HJW A;  2LGO A;  1WAW A;  2MLX A;  3UQB A;  1E6N A;  2AOS A;  3FY1 A;  3KAC A;  2DSV A;  1FJD A;  3O5G A;  3CGN A;  3GPK A;  1W1T A;  1C9H A;  1L1P A;  2FDM A;  4ITZ A;  1EDQ A;  4G50 A;  5DIV A;  3ARP A;  2XP8 A;  3O5R A;  1NWR A;  1W9P A;  4JFM A;  2DG4 A;  2DG9 A;  1X6L A;  3O5K A;  3FAP A;  4MAV A;  1J4H A;  3KAF A;  2M1I A;  3LUO A;  1B6C A;  3ARU A;  4MNJ A;  1W26 A;  1EQ3 A;  5HW6 A;  4MNM A;  4QT2 A;  3B9E A;  1OWQ A;  4W9P A;  2A3B A;  4DRK A;  4NSB A;  4LAW A;  1QPL A;  4DWS D;  5DO2 A;  2FAP A;  2RQS A;  5HW8 A;  2XP3 A;  3TDB A;  2LKN A;  4TW7 A;  3NTP A;  1HJX A;  1ZBK A;  5BXJ A;  3B9D A;  1EYM A;  1FFQ A;  1ITX A;  2A3A A;  1RD6 A;  1WB0 A;  2M2A A;  2MPH A;  1W9U A;  3RGC A;  3ODK A;  3ARV A;  3WD4 A;  4GIV A;  1IX5 A;  3JXV A;  3UQI A;  2YBU A;  4R0X A;  1GOI A;  1LG2 A;  1JNT A;  4WKF A;  1LL4 A;  3IKD A;  4TW8 A;  2XP4 A;  3H9R B;  2PV1 A;  4DWS B;  1ZBC A;  4ODL A;  1F40 A;  3QOK A;  2LPV A;  3RM4 A;  3JYM A;  4Z2J A;  4IT6 A;  3MDY B;  2ZQU A;  1FAP A;  3WKZ A;  2JZV A;  1OGG A;  3UQA A;  3RME A;  1FKF A;  2OFN A;  2B31 A;  3UI5 A;  4JFK A;  1FKT A;  1ZBW A;  4P8U A;  4ODM A;  2KR7 A;  1W9V A;  2L2S A;  3PRA A;  2ZR5 A;  3ALG A;  4DRN A;  4C02 B;  4Z2H A;  1ZBV A;  1H0G A;  1D2K A;  3IHZ A;  4TNS A;  1WNO A;  1D7H A;  1FFR A;  2WM0 A;  1O6I A;  1T11 A;  2KFW A;  3UI6 A;  1HJV A;  5DEZ A;  3O5M A;  2ESC A;  4O2T A;  2G41 A;  3RM9 A;  5DF0 A;  5DIT A;  3AQU A;  3BXW A;  3NI6 A;  1LQ0 A;  4W9O A;  4LAX A;  4ODN A;  2DT3 A;  4S3J A;  3FXY A;  1LJY A;  2KI3 A;  3OA5 A;  2F21 A;  3PA7 A;  4WJX A;  1NSG A;  1H0I A;  4L72 B;  4PTM A;  4DWS A;  2LJ4 A;  5B8I C;  4ODK A;  4ZPT R;  1E9L A;  1Q1C A;  2D9F A;  1LL7 A;  4TX0 A;  4WKA A;  4N19 A;  4ODP A;  1ZU8 A;  1PBK A;  4U86 A;  4W5U A;  4NZC A;  5HW7 A;  1PIN A;  2F2D A;  4AY1 A;  1EHN A;  3WD2 A;  1KFW A;  5GPR A;  4DRQ A;  4LAY A;  1VF8 A;  3WD0 A;  4P8V A;  5HWC A;  4Z2G A;  4U84 A;  1UR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...