4ODNA

Structure of slyd from thermus thermophilus in complex with s2-plus peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 32
structure length 150
sequence length 150
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odnA00
2M1IA 2VCDA 1FKJA 2RUCA 5I98A 3TDBA 3O5EA 4ODPA 4FAPA 1ZCNA 4DRQA 4DRJA 2MF9A 1U79A 4TW6A 5HWBA 4ODRA 4DRKA 2LGOA 3UQIA 3O5LA 2RQSA 2ZQSA 4ODOA 1Y0OA 1T11A 2Q5AA 1F8AB 2F4EA 2PPOA 1JNTA 2KGJA 3I6CA 4LAVA 1KT1A 4MSPA 1D7IA 3UI4A 3KAGA 2ZR5A 4DRHA 2JZVA 2PPNA 3JYJA 3PA7A 3NI6A 2L2SA 4JFKA 1J4RA 3OOBA 2LKNA 4IPXA 4DRNA 4JFMA 3KAFA 5HWCA 2F2DA 2XP8A 1J6YA 2LPVA 2XP5A 1ROUA 4G50A 3KZ7A 1Q6HA 3RGCA 2DG9A 1QPLA 1HXVA 4W9PA 1D7HA 4W9QA 3KAIA 3NTPA 1FKSA 3CGNA 4ODKA 4DROA 1FJDA 1PBKA 2RUDA 1ROTA 4QIBA 5D75A 1ZK6A 4DZ2A 2OFNA 3B7XA 3KCEA 1M5YA 1J4IA 4DRIA 4DZ3A 3PRDA 3O5PA 3O5KA 4FN2A 1FKGA 2Y78A 4W9OA 5HUAA 1N1AA 1A7XA 2MNTA 1NSGA 2XPAA 2LJ4A 2KO7A 2DG4A 4J4NA 4JFJA 5HW7A 2PPPA 4TYOA 3O5GA 2MPHA 5HW6A 3JYMA 4TX0A 4LAXA 4G2PA 1EYMA 4GIVA 4JFIA 5HTGA 3PRBA 4O2TA 4IQCA 2UZ5A 1KT0A 4TW8A 4DRPA 3KABA 3UQBA 3IKGA 3KACA 4J4OA 3LUOA 1NMWA 2IF4A 3O5RA 1B6CA 1FKFA 1YW5A 2KE0A 3CGMA 2ZQUA 4U86A 1L1PA 2XPBA 1NMVA 2ZQVA 1R9HA 1QPFA 3IHZA 3O5JA 4DIPA 2MLZA 5HKGA 1JNSA 3GPKA 3NRKA 3VAWA 1BL4A 5HW8A 2MLXA 4JYSA 2PV3A 2VN1A 5J6EA 4ODQA 3RFWA 2KR7A 4LAYA 1Q6UA 2K8IA 2PV1A 1W26A 2ZQTA 2ZR6A 2ZR4A 1FKRA 3MDYB 3FAPA 2PV2A 2XP7A 2XP6A 1JVWA 2XP9A 1FKKA 3TCZA 2M08A 1C9HA 4DT4A 2FAPA 3O5OA 3JXVA 3O5MA 1F40A 4MGVA 3EY6A 2RURA 2RUQA 4GGQA 3UF8A 2RSEA 5B8IC 1EQ3A 4JFLA 3ODKA 1J4HA 3IK8A 3IKDA 4QT3A 2FKEA 4ODLA 1P5QA 1Q6IA 1FKBA 1D7JA 1FD9A 1FAPA 1Q1CA 2ITKA 4DH0A 4QT2A 1YATA 1FKLA 4TNSA 5DIUA 3TC5A 4C02B 5DITA 4IQ2A 4ODNA 3O5IA 1FKHA 2AWGA 2F21A 5GPGA 4ODMA 3UI6A 2PBCA 2M2AA 4R0XA 4BF8A 5DIVA 2KFWA 4NNRA 4U84A 3O5DA 4N19A 3H9RB 4TW7A 2D9FA 4DRMA 3O5FA 3UQAA 1FKIA 1FKTA 4ITZA 3UI5A 3O5QA 1BKFA 1D6OA 2KI3A 1QZ2A 4LAWA 2XP4A 1PINA 2MLYA 5BXJA 2XP3A 2DG3A 3KADA 3KAHA 2N87A 1FKDA 5HT1A 3WH0A 4U85A 1TCOC
chains in the Genus database with same CATH superfamily
1FKJA 3TDBA 4ODPA 1ZCNA 3CHFA 3OA5A 3PRAA 2MF9A 5HWBA 2ZQSA 4ZPVR 2B5UB 4ODOA 3WL0A 1E6RA 1T11A 1LL7A 2KGJA 3WD3A 1EDQA 3RM8A 3NI6A 1OWQA 3CZ8A 5HWCA 2XP8A 3ARZA 1ROUA 4G50A 3RGCA 1X6LA 4ML4A 4UDMA 1FKSA 1JNEA 1ROTA 5D75A 1W1YA 4DZ2A 1M5YA 1EIBA 5HUAA 1A7XA 1IX5A 2G8ZA 1KFWA 2DSWA 2DG4A 4J4NA 2DSUA 4MNLA 2PPPA 4TYOA 2MPHA 1E9LA 4TX0A 1SYTA 4JFIA 5HTGA 1E6NA 4ZPWR 4O2TA 4IQCA 1KT0A 3KABA 1VF8A 3IKGA 4AY1A 4J4OA 2A3AA 2IF4A 4Z2GA 1B6CA 1FKFA 4U86A 3CGMA 3O5JA 1R9HA 2MLZA 1BL4A 4HARA 4WKAA 1E15A 4JYSA 4MPKA 1NWUA 1FFQA 4MNKA 3ARTA 2KR7A 4ODQA 4LAYA 2ZQTA 1FKRA 2XP7A 1JVWA 4ZS6A 3TCZA 1C9HA 4DT4A 3O5MA 2DT2A 4GGQA 2RSEA 4JFLA 3ODKA 1LG2A 4MTVA 4Q22A 2DT3A 1K9TA 1D7JA 1Q1CA 2O9OA 1W1VA 2DSVA 5DIUA 4HBEA 1UR9A 5DF0A 3TC5A 1LL6A 3O5IA 2PBCA 1W9PA 4NZCA 4DWSA 4U84A 4N19A 2D9FA 4DRMA 1FKTA 1ZU8A 4ITZA 1BKFA 4LAWA 1CTNA 4DWSC 5BXJA 2DG3A 3KADA 3KAHA 3GU0A 2VCDA 2WLYA 3ARXA 3FXYA 3RM4A 3ALFA 4MNMA 5GQBA 2PPOA 4XAKA 3JYJA 3PA7A 4ZPTR 4HBOA 3WD0A 4DRNA 2F2DA 2XP5A 3ALGA 2DG9A 1QPLA 1OGBA 4W9QA 1FJDA 1PBKA 2RUDA 2OFNA 1J4IA 3O5PA 3O5KA 4FN2A 4S3KA 1ZBCA 2XPAA 5HW7A 3W4RA 2F23A 5HW6A 3JYMA 3RMEA 4LAXA 2WK2A 4G2PA 4GIVA 3ARQA 4DRPA 3CHDA 1NMWA 2XPBA 3IHZA 4DIPA 3ARRA 3B8SA 1E6PA 5HW8A 2VN1A 1Q6UA 4P8VA 3O5OA 1F40A 3UF8A 1LJYA 1H0GA 2YBUA 1EQ3A 2WM0A 3AROA 1J4HA 3WQWA 1HJVA 1WAWA 1FKBA 1FAPA 4QT2A 1YATA 1FKLA 2EULA 1ZBWA 4TNSA 4URIA 3FY1A 1FKHA 2F21A 5GPGA 1O6IA 4WJXA 3O5DA 3H9RB 3UQAA 3O5FA 4PTMA 1FKIA 1EHNA 3UI5A 3O5QA 1D6OA 2XP4A 1PINA 2MLYA 3QOKA 2XP3A 4KR0B 4DWSD 3WH0A 1TCOC 1ZBKA 3WD4A 2M1IA 2RUCA 1JCHB 3O5EA 3B9DA 4DRJA 3AS0A 4ODRA 2LGOA 1W9VA 3O5LA 2RQSA 4DWSB 2Q5AA 1F8AB 2F4EA 1W1PA 3ARSA 4LAVA 3WIJA 4DH0A 1KT1A 1D7IA 3KAGA 2ZR5A 3ARPA 2JZVA 3B9AA 4WK9A 1HKJA 4JFKA 1J4RA 2FDMA 3OOBA 2LKNA 2P4VA 4IPXA 3WL1A 4JFMA 4Z2IA 3KZ7A 4P8XA 2PN0A 3GTYX 2A3BA 1HXVA 4W9PA 3KAIA 3NTPA 3CGNA 4ODKA 4QIBA 1ZK6A 1W1TA 1LL4A 2YBTA 3PRDA 2A3CA 1FKGA 4W9OA 1N1AA 1NSGA 2LJ4A 1XHGA 3BMBA 5GPRA 1E6ZA 1GUVA 1OGGA 1EYMA 3AS2A 3PRBA 3CH9A 4TW8A 3RM9A 4L3NA 4NSBA 3O5RA 1GRJA 1YW5A 2ETNA 1ZBVA 2ZQUA 1L1PA 4L72B 1NMVA 1H0IA 4WIWA 1FFRA 1JNSA 1NWSA 3NRKA 3VAWA 1XRVA 2MLXA 2PV3A 3WKZA 4R5EA 3ARUA 4IT4A 2ZR6A 1W26A 2ZR4A 3MDYB 3FAPA 2PV2A 2XP6A 4KQZA 2A3EA 2FAPA 4W5UA 3EY6A 2RURA 2B31A 2OLHA 5B8IC 1GOIA 1HKIA 4Z2JA 3CHEA 1Q6IA 1FD9A 2ITKA 4Z2HA 4P8WA 5DITA 4ODNA 2AWGA 4BF8A 5DEZA 3PR9A 5DIVA 1E44A 4Z2KA 4MNJA 2KFWA 2IUZA 1ITXA 4WKHA 4TW7A 4Z2LA 3WQVA 4QZVB 1HJWA 2KI3A 1QZ2A 1NH6A 2N87A 2G41A 4U85A 1D2KA 3G6MA 2WLZA 5I98A 4FAPA 1HJXA 4DRQA 3AQUA 1U79A 4TW6A 2AOSA 4DRKA 3UQIA 2QF8A 2ESCA 1Y0OA 4WKFA 1JNTA 3I6CA 4DRHA 4MSPA 3UI4A 2DT1A 2DT0A 2PPNA 1ZL1A 2L2SA 1TFVA 1W9UA 5HBFA 3KAFA 1LG1A 1J6YA 2LPVA 1NWRA 4LGXA 1Q6HA 1D7HA 4DROA 5DO2A 3B7XA 3KCEA 4DRIA 4DZ3A 2DPEA 2DSZA 2O92A 3WD2A 4MAVA 1HKKA 2Y78A 1RD6A 2MNTA 5JH8A 3EIPA 1SR0A 2KO7A 4JFJA 4Q7NA 3O5GA 1LQ0A 3AS3A 2UZ5A 3UQBA 3KACA 3LUOA 2KE0A 2ZQVA 3WD1A 1QPFA 1NWTA 5HKGA 3GPKA 3ARWA 5J6EA 3RFWA 1HKMA 1WB0A 2PV1A 2K8IA 3ARVA 4IT6A 1X6NA 2PI6A 4S3JA 2XP9A 3AS1A 1FKKA 2M08A 3JXVA 1GPFA 4MGVA 2RUQA 3BXWA 3G6LA 3ARYA 3IK8A 3IKDA 4QT3A 2FKEA 4ODLA 1P5QA 4P8UA 1UR8A 4C02B 4IQ2A 3UI6A 4ODMA 2M2AA 1JNDA 4R0XA 1ZB5A 4NNRA 3CHCA 3B9EA 1FKDA 5HT1A 1WNOA
chains in the Genus database with same CATH topology
1FKJA 3TDBA 4ODPA 1ZCNA 3CHFA 3OA5A 3PRAA 2MF9A 5HWBA 2ZQSA 4ZPVR 4ODOA 3WL0A 1E6RA 1T11A 1LL7A 2KGJA 3WD3A 1EDQA 3RM8A 3NI6A 1OWQA 3CZ8A 5HWCA 2XP8A 3ARZA 1ROUA 4G50A 3RGCA 1X6LA 4ML4A 1FKSA 1JNEA 1ROTA 5D75A 1W1YA 4DZ2A 1M5YA 1EIBA 5HUAA 1A7XA 1IX5A 2G8ZA 1KFWA 2DSWA 2DG4A 4J4NA 2DSUA 4MNLA 2PPPA 4TYOA 2MPHA 1E9LA 4TX0A 1SYTA 4JFIA 5HTGA 1E6NA 4ZPWR 4O2TA 4IQCA 1KT0A 3KABA 1VF8A 3IKGA 4AY1A 4J4OA 2A3AA 2IF4A 4Z2GA 1B6CA 1FKFA 4U86A 3CGMA 3O5JA 1R9HA 2MLZA 1BL4A 4HARA 4WKAA 1E15A 4JYSA 4MPKA 1NWUA 1FFQA 4MNKA 3ARTA 2KR7A 4ODQA 4LAYA 2ZQTA 1FKRA 2XP7A 1JVWA 4ZS6A 3TCZA 1C9HA 4DT4A 3O5MA 2DT2A 4GGQA 2RSEA 4JFLA 3ODKA 1LG2A 4MTVA 4Q22A 2DT3A 1K9TA 1D7JA 1Q1CA 2O9OA 1W1VA 2DSVA 5DIUA 4HBEA 1UR9A 5DF0A 3TC5A 1LL6A 3O5IA 2PBCA 1W9PA 4NZCA 4DWSA 4U84A 4N19A 2D9FA 4DRMA 1FKTA 1ZU8A 4ITZA 1BKFA 4LAWA 1CTNA 4DWSC 5BXJA 2DG3A 3KADA 3KAHA 2VCDA 2WLYA 3ARXA 3FXYA 3RM4A 3ALFA 4MNMA 5GQBA 2PPOA 4XAKA 3JYJA 3PA7A 4ZPTR 4HBOA 3WD0A 4DRNA 2F2DA 2XP5A 3ALGA 2DG9A 1QPLA 1OGBA 4W9QA 1FJDA 1PBKA 2RUDA 2OFNA 1J4IA 3O5PA 3O5KA 4FN2A 4S3KA 1ZBCA 2XPAA 5HW7A 3W4RA 5HW6A 3JYMA 3RMEA 4LAXA 2WK2A 4G2PA 4GIVA 3ARQA 4DRPA 3CHDA 1NMWA 2XPBA 3IHZA 4DIPA 3ARRA 3B8SA 1E6PA 5HW8A 2VN1A 1Q6UA 4P8VA 3O5OA 1F40A 3UF8A 1LJYA 1H0GA 2YBUA 1EQ3A 2WM0A 3AROA 1J4HA 3WQWA 1HJVA 1WAWA 1FKBA 1FAPA 4QT2A 1YATA 1FKLA 4TNSA 1ZBWA 4URIA 3FY1A 1FKHA 2F21A 5GPGA 1O6IA 4WJXA 3O5DA 3H9RB 3UQAA 3O5FA 4PTMA 1FKIA 1EHNA 3UI5A 3O5QA 1D6OA 2XP4A 1PINA 2MLYA 3QOKA 2XP3A 4KR0B 4DWSD 3WH0A 1TCOC 1ZBKA 3WD4A 2M1IA 2RUCA 3O5EA 3B9DA 4DRJA 3AS0A 4ODRA 2LGOA 1W9VA 3O5LA 2RQSA 4DWSB 2Q5AA 1F8AB 2F4EA 1W1PA 3ARSA 4LAVA 3WIJA 4DH0A 1KT1A 1D7IA 3KAGA 2ZR5A 3ARPA 2JZVA 3B9AA 4WK9A 1HKJA 4JFKA 1J4RA 2FDMA 3OOBA 2LKNA 4IPXA 3WL1A 4JFMA 4Z2IA 3KZ7A 4P8XA 2A3BA 1HXVA 4W9PA 3KAIA 3NTPA 3CGNA 4ODKA 4QIBA 1ZK6A 1W1TA 1LL4A 2YBTA 3PRDA 2A3CA 1FKGA 4W9OA 1N1AA 1NSGA 2LJ4A 1XHGA 5GPRA 1E6ZA 1GUVA 1OGGA 1EYMA 3AS2A 3PRBA 3CH9A 4TW8A 3RM9A 4L3NA 4NSBA 3O5RA 1YW5A 1ZBVA 2ZQUA 1L1PA 4L72B 1NMVA 1H0IA 4WIWA 1FFRA 1JNSA 1NWSA 3NRKA 3VAWA 1XRVA 2MLXA 2PV3A 3WKZA 4R5EA 3ARUA 4IT4A 2ZR6A 1W26A 2ZR4A 3MDYB 3FAPA 2PV2A 2XP6A 4KQZA 2A3EA 2FAPA 4W5UA 3EY6A 2RURA 2B31A 2OLHA 5B8IC 1GOIA 1HKIA 4Z2JA 3CHEA 1Q6IA 1FD9A 2ITKA 4Z2HA 4P8WA 5DITA 4ODNA 2AWGA 4BF8A 5DEZA 3PR9A 5DIVA 4Z2KA 4MNJA 2KFWA 2IUZA 1ITXA 4WKHA 4TW7A 4Z2LA 3WQVA 4QZVB 1HJWA 2KI3A 1QZ2A 1NH6A 2N87A 2G41A 4U85A 1D2KA 3G6MA 2WLZA 5I98A 4FAPA 1HJXA 4DRQA 3AQUA 1U79A 4TW6A 2AOSA 4DRKA 3UQIA 2QF8A 2ESCA 1Y0OA 4WKFA 1JNTA 3I6CA 4DRHA 4MSPA 3UI4A 2DT1A 2DT0A 2PPNA 1ZL1A 2L2SA 1TFVA 1W9UA 5HBFA 3KAFA 1LG1A 1J6YA 2LPVA 1NWRA 4LGXA 1Q6HA 1D7HA 4DROA 5DO2A 3B7XA 3KCEA 4DRIA 4DZ3A 2DPEA 2DSZA 2O92A 3WD2A 4MAVA 1HKKA 2Y78A 1RD6A 2MNTA 5JH8A 1SR0A 2KO7A 4JFJA 4Q7NA 3O5GA 1LQ0A 3AS3A 2UZ5A 3UQBA 3KACA 3LUOA 2KE0A 2ZQVA 3WD1A 1QPFA 1NWTA 5HKGA 3GPKA 3ARWA 5J6EA 3RFWA 1HKMA 1WB0A 2PV1A 2K8IA 3ARVA 4IT6A 1X6NA 2PI6A 4S3JA 2XP9A 3AS1A 1FKKA 2M08A 3JXVA 1GPFA 4MGVA 2RUQA 3BXWA 3G6LA 3ARYA 3IK8A 3IKDA 4QT3A 2FKEA 4ODLA 1P5QA 4P8UA 1UR8A 4C02B 4IQ2A 3UI6A 4ODMA 2M2AA 1JNDA 4R0XA 1ZB5A 4NNRA 3CHCA 3B9EA 1FKDA 5HT1A 1WNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1I A;  2VCD A;  1FKJ A;  2RUC A;  5I98 A;  3TDB A;  3O5E A;  4ODP A;  4FAP A;  1ZCN A;  4DRQ A;  4DRJ A;  2MF9 A;  1U79 A;  4TW6 A;  5HWB A;  4ODR A;  4DRK A;  2LGO A;  3UQI A;  3O5L A;  2RQS A;  2ZQS A;  4ODO A;  1Y0O A;  1T11 A;  2Q5A A;  1F8A B;  2F4E A;  2PPO A;  1JNT A;  2KGJ A;  3I6C A;  4LAV A;  1KT1 A;  4MSP A;  1D7I A;  3UI4 A;  3KAG A;  2ZR5 A;  4DRH A;  2JZV A;  2PPN A;  3JYJ A;  3PA7 A;  3NI6 A;  2L2S A;  4JFK A;  1J4R A;  3OOB A;  2LKN A;  4IPX A;  4DRN A;  4JFM A;  3KAF A;  5HWC A;  2F2D A;  2XP8 A;  1J6Y A;  2LPV A;  2XP5 A;  1ROU A;  4G50 A;  3KZ7 A;  1Q6H A;  3RGC A;  2DG9 A;  1QPL A;  1HXV A;  4W9P A;  1D7H A;  4W9Q A;  3KAI A;  3NTP A;  1FKS A;  3CGN A;  4ODK A;  4DRO A;  1FJD A;  1PBK A;  2RUD A;  1ROT A;  4QIB A;  5D75 A;  1ZK6 A;  4DZ2 A;  2OFN A;  3B7X A;  3KCE A;  1M5Y A;  1J4I A;  4DRI A;  4DZ3 A;  3PRD A;  3O5P A;  3O5K A;  4FN2 A;  1FKG A;  2Y78 A;  4W9O A;  5HUA A;  1N1A A;  1A7X A;  2MNT A;  1NSG A;  2XPA A;  2LJ4 A;  2KO7 A;  2DG4 A;  4J4N A;  4JFJ A;  5HW7 A;  2PPP A;  4TYO A;  3O5G A;  2MPH A;  5HW6 A;  3JYM A;  4TX0 A;  4LAX A;  4G2P A;  1EYM A;  4GIV A;  4JFI A;  5HTG A;  3PRB A;  4O2T A;  4IQC A;  2UZ5 A;  1KT0 A;  4TW8 A;  4DRP A;  3KAB A;  3UQB A;  3IKG A;  3KAC A;  4J4O A;  3LUO A;  1NMW A;  2IF4 A;  3O5R A;  1B6C A;  1FKF A;  1YW5 A;  2KE0 A;  3CGM A;  2ZQU A;  4U86 A;  1L1P A;  2XPB A;  1NMV A;  2ZQV A;  1R9H A;  1QPF A;  3IHZ A;  3O5J A;  4DIP A;  2MLZ A;  5HKG A;  1JNS A;  3GPK A;  3NRK A;  3VAW A;  1BL4 A;  5HW8 A;  2MLX A;  4JYS A;  2PV3 A;  2VN1 A;  5J6E A;  4ODQ A;  3RFW A;  2KR7 A;  4LAY A;  1Q6U A;  2K8I A;  2PV1 A;  1W26 A;  2ZQT A;  2ZR6 A;  2ZR4 A;  1FKR A;  3MDY B;  3FAP A;  2PV2 A;  2XP7 A;  2XP6 A;  1JVW A;  2XP9 A;  1FKK A;  3TCZ A;  2M08 A;  1C9H A;  4DT4 A;  2FAP A;  3O5O A;  3JXV A;  3O5M A;  1F40 A;  4MGV A;  3EY6 A;  2RUR A;  2RUQ A;  4GGQ A;  3UF8 A;  2RSE A;  5B8I C;  1EQ3 A;  4JFL A;  3ODK A;  1J4H A;  3IK8 A;  3IKD A;  4QT3 A;  2FKE A;  4ODL A;  1P5Q A;  1Q6I A;  1FKB A;  1D7J A;  1FD9 A;  1FAP A;  1Q1C A;  2ITK A;  4DH0 A;  4QT2 A;  1YAT A;  1FKL A;  4TNS A;  5DIU A;  3TC5 A;  4C02 B;  5DIT A;  4IQ2 A;  4ODN A;  3O5I A;  1FKH A;  2AWG A;  2F21 A;  5GPG A;  4ODM A;  3UI6 A;  2PBC A;  2M2A A;  4R0X A;  4BF8 A;  5DIV A;  2KFW A;  4NNR A;  4U84 A;  3O5D A;  4N19 A;  3H9R B;  4TW7 A;  2D9F A;  4DRM A;  3O5F A;  3UQA A;  1FKI A;  1FKT A;  4ITZ A;  3UI5 A;  3O5Q A;  1BKF A;  1D6O A;  2KI3 A;  1QZ2 A;  4LAW A;  2XP4 A;  1PIN A;  2MLY A;  5BXJ A;  2XP3 A;  2DG3 A;  3KAD A;  3KAH A;  2N87 A;  1FKD A;  5HT1 A;  3WH0 A;  4U85 A;  1TCO C; 
#chains in the Genus database with same CATH topology
 1FKJ A;  3TDB A;  4ODP A;  1ZCN A;  3CHF A;  3OA5 A;  3PRA A;  2MF9 A;  5HWB A;  2ZQS A;  4ZPV R;  2B5U B;  4ODO A;  3WL0 A;  1E6R A;  1T11 A;  1LL7 A;  2KGJ A;  3WD3 A;  1EDQ A;  3RM8 A;  3NI6 A;  1OWQ A;  3CZ8 A;  5HWC A;  2XP8 A;  3ARZ A;  1ROU A;  4G50 A;  3RGC A;  1X6L A;  4ML4 A;  4UDM A;  1FKS A;  1JNE A;  1ROT A;  5D75 A;  1W1Y A;  4DZ2 A;  1M5Y A;  1EIB A;  5HUA A;  1A7X A;  1IX5 A;  2G8Z A;  1KFW A;  2DSW A;  2DG4 A;  4J4N A;  2DSU A;  4MNL A;  2PPP A;  4TYO A;  2MPH A;  1E9L A;  4TX0 A;  1SYT A;  4JFI A;  5HTG A;  1E6N A;  4ZPW R;  4O2T A;  4IQC A;  1KT0 A;  3KAB A;  1VF8 A;  3IKG A;  4AY1 A;  4J4O A;  2A3A A;  2IF4 A;  4Z2G A;  1B6C A;  1FKF A;  4U86 A;  3CGM A;  3O5J A;  1R9H A;  2MLZ A;  1BL4 A;  4HAR A;  4WKA A;  1E15 A;  4JYS A;  4MPK A;  1NWU A;  1FFQ A;  4MNK A;  3ART A;  2KR7 A;  4ODQ A;  4LAY A;  2ZQT A;  1FKR A;  2XP7 A;  1JVW A;  4ZS6 A;  3TCZ A;  1C9H A;  4DT4 A;  3O5M A;  2DT2 A;  4GGQ A;  2RSE A;  4JFL A;  3ODK A;  1LG2 A;  4MTV A;  4Q22 A;  2DT3 A;  1K9T A;  1D7J A;  1Q1C A;  2O9O A;  1W1V A;  2DSV A;  5DIU A;  4HBE A;  1UR9 A;  5DF0 A;  3TC5 A;  1LL6 A;  3O5I A;  2PBC A;  1W9P A;  4NZC A;  4DWS A;  4U84 A;  4N19 A;  2D9F A;  4DRM A;  1FKT A;  1ZU8 A;  4ITZ A;  1BKF A;  4LAW A;  1CTN A;  4DWS C;  5BXJ A;  2DG3 A;  3KAD A;  3KAH A;  3GU0 A;  2VCD A;  2WLY A;  3ARX A;  3FXY A;  3RM4 A;  3ALF A;  4MNM A;  5GQB A;  2PPO A;  4XAK A;  3JYJ A;  3PA7 A;  4ZPT R;  4HBO A;  3WD0 A;  4DRN A;  2F2D A;  2XP5 A;  3ALG A;  2DG9 A;  1QPL A;  1OGB A;  4W9Q A;  1FJD A;  1PBK A;  2RUD A;  2OFN A;  1J4I A;  3O5P A;  3O5K A;  4FN2 A;  4S3K A;  1ZBC A;  2XPA A;  5HW7 A;  3W4R A;  2F23 A;  5HW6 A;  3JYM A;  3RME A;  4LAX A;  2WK2 A;  4G2P A;  4GIV A;  3ARQ A;  4DRP A;  3CHD A;  1NMW A;  2XPB A;  3IHZ A;  4DIP A;  3ARR A;  3B8S A;  1E6P A;  5HW8 A;  2VN1 A;  1Q6U A;  4P8V A;  3O5O A;  1F40 A;  3UF8 A;  1LJY A;  1H0G A;  2YBU A;  1EQ3 A;  2WM0 A;  3ARO A;  1J4H A;  3WQW A;  1HJV A;  1WAW A;  1FKB A;  1FAP A;  4QT2 A;  1YAT A;  1FKL A;  2EUL A;  1ZBW A;  4TNS A;  4URI A;  3FY1 A;  1FKH A;  2F21 A;  5GPG A;  1O6I A;  4WJX A;  3O5D A;  3H9R B;  3UQA A;  3O5F A;  4PTM A;  1FKI A;  1EHN A;  3UI5 A;  3O5Q A;  1D6O A;  2XP4 A;  1PIN A;  2MLY A;  3QOK A;  2XP3 A;  4KR0 B;  4DWS D;  3WH0 A;  1TCO C;  1ZBK A;  3WD4 A;  2M1I A;  2RUC A;  1JCH B;  3O5E A;  3B9D A;  4DRJ A;  3AS0 A;  4ODR A;  2LGO A;  1W9V A;  3O5L A;  2RQS A;  4DWS B;  2Q5A A;  1F8A B;  2F4E A;  1W1P A;  3ARS A;  4LAV A;  3WIJ A;  4DH0 A;  1KT1 A;  1D7I A;  3KAG A;  2ZR5 A;  3ARP A;  2JZV A;  3B9A A;  4WK9 A;  1HKJ A;  4JFK A;  1J4R A;  2FDM A;  3OOB A;  2LKN A;  2P4V A;  4IPX A;  3WL1 A;  4JFM A;  4Z2I A;  3KZ7 A;  4P8X A;  2PN0 A;  3GTY X;  2A3B A;  1HXV A;  4W9P A;  3KAI A;  3NTP A;  3CGN A;  4ODK A;  4QIB A;  1ZK6 A;  1W1T A;  1LL4 A;  2YBT A;  3PRD A;  2A3C A;  1FKG A;  4W9O A;  1N1A A;  1NSG A;  2LJ4 A;  1XHG A;  3BMB A;  5GPR A;  1E6Z A;  1GUV A;  1OGG A;  1EYM A;  3AS2 A;  3PRB A;  3CH9 A;  4TW8 A;  3RM9 A;  4L3N A;  4NSB A;  3O5R A;  1GRJ A;  1YW5 A;  2ETN A;  1ZBV A;  2ZQU A;  1L1P A;  4L72 B;  1NMV A;  1H0I A;  4WIW A;  1FFR A;  1JNS A;  1NWS A;  3NRK A;  3VAW A;  1XRV A;  2MLX A;  2PV3 A;  3WKZ A;  4R5E A;  3ARU A;  4IT4 A;  2ZR6 A;  1W26 A;  2ZR4 A;  3MDY B;  3FAP A;  2PV2 A;  2XP6 A;  4KQZ A;  2A3E A;  2FAP A;  4W5U A;  3EY6 A;  2RUR A;  2B31 A;  2OLH A;  5B8I C;  1GOI A;  1HKI A;  4Z2J A;  3CHE A;  1Q6I A;  1FD9 A;  2ITK A;  4Z2H A;  4P8W A;  5DIT A;  4ODN A;  2AWG A;  4BF8 A;  5DEZ A;  3PR9 A;  5DIV A;  1E44 A;  4Z2K A;  4MNJ A;  2KFW A;  2IUZ A;  1ITX A;  4WKH A;  4TW7 A;  4Z2L A;  3WQV A;  4QZV B;  1HJW A;  2KI3 A;  1QZ2 A;  1NH6 A;  2N87 A;  2G41 A;  4U85 A;  1D2K A;  3G6M A;  2WLZ A;  5I98 A;  4FAP A;  1HJX A;  4DRQ A;  3AQU A;  1U79 A;  4TW6 A;  2AOS A;  4DRK A;  3UQI A;  2QF8 A;  2ESC A;  1Y0O A;  4WKF A;  1JNT A;  3I6C A;  4DRH A;  4MSP A;  3UI4 A;  2DT1 A;  2DT0 A;  2PPN A;  1ZL1 A;  2L2S A;  1TFV A;  1W9U A;  5HBF A;  3KAF A;  1LG1 A;  1J6Y A;  2LPV A;  1NWR A;  4LGX A;  1Q6H A;  1D7H A;  4DRO A;  5DO2 A;  3B7X A;  3KCE A;  4DRI A;  4DZ3 A;  2DPE A;  2DSZ A;  2O92 A;  3WD2 A;  4MAV A;  1HKK A;  2Y78 A;  1RD6 A;  2MNT A;  5JH8 A;  3EIP A;  1SR0 A;  2KO7 A;  4JFJ A;  4Q7N A;  3O5G A;  1LQ0 A;  3AS3 A;  2UZ5 A;  3UQB A;  3KAC A;  3LUO A;  2KE0 A;  2ZQV A;  3WD1 A;  1QPF A;  1NWT A;  5HKG A;  3GPK A;  3ARW A;  5J6E A;  3RFW A;  1HKM A;  1WB0 A;  2PV1 A;  2K8I A;  3ARV A;  4IT6 A;  1X6N A;  2PI6 A;  4S3J A;  2XP9 A;  3AS1 A;  1FKK A;  2M08 A;  3JXV A;  1GPF A;  4MGV A;  2RUQ A;  3BXW A;  3G6L A;  3ARY A;  3IK8 A;  3IKD A;  4QT3 A;  2FKE A;  4ODL A;  1P5Q A;  4P8U A;  1UR8 A;  4C02 B;  4IQ2 A;  3UI6 A;  4ODM A;  2M2A A;  1JND A;  4R0X A;  1ZB5 A;  4NNR A;  3CHC A;  3B9E A;  1FKD A;  5HT1 A;  1WNO A; 
#chains in the Genus database with same CATH homology
 1FKJ A;  3TDB A;  4ODP A;  1ZCN A;  3CHF A;  3OA5 A;  3PRA A;  2MF9 A;  5HWB A;  2ZQS A;  4ZPV R;  4ODO A;  3WL0 A;  1E6R A;  1T11 A;  1LL7 A;  2KGJ A;  3WD3 A;  1EDQ A;  3RM8 A;  3NI6 A;  1OWQ A;  3CZ8 A;  5HWC A;  2XP8 A;  3ARZ A;  1ROU A;  4G50 A;  3RGC A;  1X6L A;  4ML4 A;  1FKS A;  1JNE A;  1ROT A;  5D75 A;  1W1Y A;  4DZ2 A;  1M5Y A;  1EIB A;  5HUA A;  1A7X A;  1IX5 A;  2G8Z A;  1KFW A;  2DSW A;  2DG4 A;  4J4N A;  2DSU A;  4MNL A;  2PPP A;  4TYO A;  2MPH A;  1E9L A;  4TX0 A;  1SYT A;  4JFI A;  5HTG A;  1E6N A;  4ZPW R;  4O2T A;  4IQC A;  1KT0 A;  3KAB A;  1VF8 A;  3IKG A;  4AY1 A;  4J4O A;  2A3A A;  2IF4 A;  4Z2G A;  1B6C A;  1FKF A;  4U86 A;  3CGM A;  3O5J A;  1R9H A;  2MLZ A;  1BL4 A;  4HAR A;  4WKA A;  1E15 A;  4JYS A;  4MPK A;  1NWU A;  1FFQ A;  4MNK A;  3ART A;  2KR7 A;  4ODQ A;  4LAY A;  2ZQT A;  1FKR A;  2XP7 A;  1JVW A;  4ZS6 A;  3TCZ A;  1C9H A;  4DT4 A;  3O5M A;  2DT2 A;  4GGQ A;  2RSE A;  4JFL A;  3ODK A;  1LG2 A;  4MTV A;  4Q22 A;  2DT3 A;  1K9T A;  1D7J A;  1Q1C A;  2O9O A;  1W1V A;  2DSV A;  5DIU A;  4HBE A;  1UR9 A;  5DF0 A;  3TC5 A;  1LL6 A;  3O5I A;  2PBC A;  1W9P A;  4NZC A;  4DWS A;  4U84 A;  4N19 A;  2D9F A;  4DRM A;  1FKT A;  1ZU8 A;  4ITZ A;  1BKF A;  4LAW A;  1CTN A;  4DWS C;  5BXJ A;  2DG3 A;  3KAD A;  3KAH A;  2VCD A;  2WLY A;  3ARX A;  3FXY A;  3RM4 A;  3ALF A;  4MNM A;  5GQB A;  2PPO A;  4XAK A;  3JYJ A;  3PA7 A;  4ZPT R;  4HBO A;  3WD0 A;  4DRN A;  2F2D A;  2XP5 A;  3ALG A;  2DG9 A;  1QPL A;  1OGB A;  4W9Q A;  1FJD A;  1PBK A;  2RUD A;  2OFN A;  1J4I A;  3O5P A;  3O5K A;  4FN2 A;  4S3K A;  1ZBC A;  2XPA A;  5HW7 A;  3W4R A;  5HW6 A;  3JYM A;  3RME A;  4LAX A;  2WK2 A;  4G2P A;  4GIV A;  3ARQ A;  4DRP A;  3CHD A;  1NMW A;  2XPB A;  3IHZ A;  4DIP A;  3ARR A;  3B8S A;  1E6P A;  5HW8 A;  2VN1 A;  1Q6U A;  4P8V A;  3O5O A;  1F40 A;  3UF8 A;  1LJY A;  1H0G A;  2YBU A;  1EQ3 A;  2WM0 A;  3ARO A;  1J4H A;  3WQW A;  1HJV A;  1WAW A;  1FKB A;  1FAP A;  4QT2 A;  1YAT A;  1FKL A;  4TNS A;  1ZBW A;  4URI A;  3FY1 A;  1FKH A;  2F21 A;  5GPG A;  1O6I A;  4WJX A;  3O5D A;  3H9R B;  3UQA A;  3O5F A;  4PTM A;  1FKI A;  1EHN A;  3UI5 A;  3O5Q A;  1D6O A;  2XP4 A;  1PIN A;  2MLY A;  3QOK A;  2XP3 A;  4KR0 B;  4DWS D;  3WH0 A;  1TCO C;  1ZBK A;  3WD4 A;  2M1I A;  2RUC A;  3O5E A;  3B9D A;  4DRJ A;  3AS0 A;  4ODR A;  2LGO A;  1W9V A;  3O5L A;  2RQS A;  4DWS B;  2Q5A A;  1F8A B;  2F4E A;  1W1P A;  3ARS A;  4LAV A;  3WIJ A;  4DH0 A;  1KT1 A;  1D7I A;  3KAG A;  2ZR5 A;  3ARP A;  2JZV A;  3B9A A;  4WK9 A;  1HKJ A;  4JFK A;  1J4R A;  2FDM A;  3OOB A;  2LKN A;  4IPX A;  3WL1 A;  4JFM A;  4Z2I A;  3KZ7 A;  4P8X A;  2A3B A;  1HXV A;  4W9P A;  3KAI A;  3NTP A;  3CGN A;  4ODK A;  4QIB A;  1ZK6 A;  1W1T A;  1LL4 A;  2YBT A;  3PRD A;  2A3C A;  1FKG A;  4W9O A;  1N1A A;  1NSG A;  2LJ4 A;  1XHG A;  5GPR A;  1E6Z A;  1GUV A;  1OGG A;  1EYM A;  3AS2 A;  3PRB A;  3CH9 A;  4TW8 A;  3RM9 A;  4L3N A;  4NSB A;  3O5R A;  1YW5 A;  1ZBV A;  2ZQU A;  1L1P A;  4L72 B;  1NMV A;  1H0I A;  4WIW A;  1FFR A;  1JNS A;  1NWS A;  3NRK A;  3VAW A;  1XRV A;  2MLX A;  2PV3 A;  3WKZ A;  4R5E A;  3ARU A;  4IT4 A;  2ZR6 A;  1W26 A;  2ZR4 A;  3MDY B;  3FAP A;  2PV2 A;  2XP6 A;  4KQZ A;  2A3E A;  2FAP A;  4W5U A;  3EY6 A;  2RUR A;  2B31 A;  2OLH A;  5B8I C;  1GOI A;  1HKI A;  4Z2J A;  3CHE A;  1Q6I A;  1FD9 A;  2ITK A;  4Z2H A;  4P8W A;  5DIT A;  4ODN A;  2AWG A;  4BF8 A;  5DEZ A;  3PR9 A;  5DIV A;  4Z2K A;  4MNJ A;  2KFW A;  2IUZ A;  1ITX A;  4WKH A;  4TW7 A;  4Z2L A;  3WQV A;  4QZV B;  1HJW A;  2KI3 A;  1QZ2 A;  1NH6 A;  2N87 A;  2G41 A;  4U85 A;  1D2K A;  3G6M A;  2WLZ A;  5I98 A;  4FAP A;  1HJX A;  4DRQ A;  3AQU A;  1U79 A;  4TW6 A;  2AOS A;  4DRK A;  3UQI A;  2QF8 A;  2ESC A;  1Y0O A;  4WKF A;  1JNT A;  3I6C A;  4DRH A;  4MSP A;  3UI4 A;  2DT1 A;  2DT0 A;  2PPN A;  1ZL1 A;  2L2S A;  1TFV A;  1W9U A;  5HBF A;  3KAF A;  1LG1 A;  1J6Y A;  2LPV A;  1NWR A;  4LGX A;  1Q6H A;  1D7H A;  4DRO A;  5DO2 A;  3B7X A;  3KCE A;  4DRI A;  4DZ3 A;  2DPE A;  2DSZ A;  2O92 A;  3WD2 A;  4MAV A;  1HKK A;  2Y78 A;  1RD6 A;  2MNT A;  5JH8 A;  1SR0 A;  2KO7 A;  4JFJ A;  4Q7N A;  3O5G A;  1LQ0 A;  3AS3 A;  2UZ5 A;  3UQB A;  3KAC A;  3LUO A;  2KE0 A;  2ZQV A;  3WD1 A;  1QPF A;  1NWT A;  5HKG A;  3GPK A;  3ARW A;  5J6E A;  3RFW A;  1HKM A;  1WB0 A;  2PV1 A;  2K8I A;  3ARV A;  4IT6 A;  1X6N A;  2PI6 A;  4S3J A;  2XP9 A;  3AS1 A;  1FKK A;  2M08 A;  3JXV A;  1GPF A;  4MGV A;  2RUQ A;  3BXW A;  3G6L A;  3ARY A;  3IK8 A;  3IKD A;  4QT3 A;  2FKE A;  4ODL A;  1P5Q A;  4P8U A;  1UR8 A;  4C02 B;  4IQ2 A;  3UI6 A;  4ODM A;  2M2A A;  1JND A;  4R0X A;  1ZB5 A;  4NNR A;  3CHC A;  3B9E A;  1FKD A;  5HT1 A;  1WNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...