4ODQA

Structure of slyd delta-if from thermus thermophilus in complex with s3 peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
106
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 24
structure length 106
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odqA00
4JYSA 5B8IC 2RSEA 1F8AB 3O5RA 3O5QA 1Q6HA 5HT1A 1F40A 1EYMA 3NTPA 4O2TA 1M5YA 3VAWA 2IF4A 4U84A 2KR7A 4MSPA 5D75A 3UQAA 4GIVA 3JYJA 2XP9A 1T11A 2LPVA 1KT0A 1BKFA 5DITA 2Y78A 2ZR5A 3OOBA 1FKHA 3UF8A 4DRKA 3KAFA 1Q1CA 3O5PA 2ZR4A 2AWGA 1FKKA 4N19A 1NMVA 3UI5A 4C02B 4DIPA 4MGVA 2N87A 2PPNA 4DRIA 2Q5AA 2MLZA 3UQBA 2XPAA 1Q6IA 3MDYB 1W26A 4LAVA 4QT3A 1Y0OA 4TW8A 5HUAA 2MNTA 2F2DA 4TW7A 1D7JA 2DG4A 2XP8A 3KCEA 5DIUA 1QPFA 4G50A 1FD9A 2F4EA 3O5KA 2PV3A 1D7HA 4J4OA 3B7XA 2F21A 5HKGA 3KAIA 4DRJA 1JNSA 3O5DA 1FKBA 3KAHA 4DRQA 4TYOA 1ROUA 2RUDA 2ZQVA 3FAPA 5J6EA 4NNRA 4ODOA 4DZ2A 5I98A 2RURA 2ZQTA 4JFKA 2XPBA 4BF8A 3O5JA 2VCDA 1L1PA 2JZVA 3PRDA 3JYMA 1B6CA 4DROA 4DRPA 4ODMA 4FAPA 1A7XA 2KFWA 2M2AA 1FJDA 2K8IA 4DRMA 3PRBA 3IK8A 4TNSA 4DRNA 1FKTA 2PBCA 4JFLA 1FKRA 3O5MA 4ODQA 5BXJA 3TC5A 1QPLA 1ZCNA 2FKEA 4QT2A 1FAPA 1ROTA 3IKDA 3WH0A 2MLYA 4W9QA 1J4HA 2M1IA 2KI3A 3O5GA 2FAPA 1YATA 2D9FA 3O5EA 2UZ5A 1FKFA 5HW7A 4G2PA 1TCOC 1PINA 1FKLA 3GPKA 3UI6A 3KACA 4GGQA 4J4NA 4W9OA 2L2SA 3LUOA 4ODRA 2DG9A 3O5FA 3KAGA 4DZ3A 1PBKA 3O5LA 2KE0A 4ODKA 2PPPA 3TCZA 1C9HA 1J4RA 3O5IA 1EQ3A 3O5OA 2ZQUA 1J4IA 4IPXA 2XP3A 1JNTA 2XP6A 3PA7A 4JFJA 2VN1A 3ODKA 3RGCA 4DT4A 3I6CA 2ZR6A 2LKNA 5HTGA 4R0XA 3TDBA 4DH0A 1YW5A 3NRKA 1FKGA 3CGMA 5DIVA 3UI4A 4W9PA 5GPGA 3CGNA 3IHZA 2LJ4A 2RUCA 4ITZA 4IQ2A 4LAYA 5HWBA 2XP7A 3UQIA 3KADA 1NSGA 2OFNA 1JVWA 2ZQSA 1NMWA 2PPOA 3H9RB 2MF9A 4ODNA 3JXVA 1FKDA 4LAWA 4TW6A 1KT1A 2XP4A 3RFWA 4JFMA 1HXVA 2PV1A 3KZ7A 4U85A 1FKJA 2ITKA 1D7IA 2MLXA 4LAXA 2RUQA 4FN2A 4TX0A 5HWCA 1BL4A 2PV2A 2XP5A 1D6OA 4ODLA 1P5QA 1ZK6A 3IKGA 4QIBA 4IQCA 2KGJA 4U86A 1FKSA 2MPHA 1J6YA 4ODPA 1R9HA 2RQSA 5HW8A 4JFIA 1QZ2A 1U79A 3KABA 2KO7A 3EY6A 4DRHA 1FKIA 1Q6UA 5HW6A 3NI6A 1N1AA 2M08A 2DG3A 2LGOA
chains in the Genus database with same CATH superfamily
3WD3A 2WLYA 1EHNA 4O2TA 3VAWA 3ARZA 4U84A 2KR7A 4MSPA 4GIVA 3JYJA 3ARRA 4ZPWR 5HBFA 3OOBA 4Q7NA 3GTYX 1O6IA 4MPKA 2FDMA 1FKKA 4N19A 4ZPTR 2N87A 3ARUA 1IX5A 3UQBA 4P8WA 1Q6IA 4TW8A 4QT3A 2F2DA 1D7JA 2DG4A 1GPFA 1QPFA 1XHGA 4G50A 4WKAA 1D7HA 4J4OA 3KAIA 1JNSA 3O5DA 1FKBA 4DRQA 4TYOA 2RUDA 5J6EA 4Z2KA 3G6LA 2ZQTA 4BF8A 2XPBA 3PRDA 3JYMA 1FJDA 4DRNA 1HKJA 1FKRA 4XAKA 3O5MA 3PRAA 3TC5A 3ARQA 4QT2A 1E6ZA 1J4HA 2KI3A 3O5GA 1H0IA 1ZBVA 4Z2HA 5HW7A 1ZB5A 3UI6A 4GGQA 2DG9A 4MNMA 4S3KA 1LL7A 2KE0A 4ODKA 2PPPA 4WIWA 1C9HA 3O5IA 2ESCA 1EQ3A 3GU0A 4IPXA 3ARVA 5HTGA 4R0XA 5DIVA 2LJ4A 4IQ2A 1NWRA 2XP7A 3UQIA 4MAVA 1JVWA 1HKMA 4MNJA 4ODNA 4JFMA 3KZ7A 2ITKA 1D7IA 3CHCA 2MLXA 5HWCA 2RUQA 5DEZA 3IKGA 2DT1A 4KR0B 1J6YA 4MNKA 1HKKA 4KQZA 4ODPA 2YBTA 4IT4A 2RQSA 1GRJA 2KO7A 4DRHA 1FKIA 5HW6A 1TFVA 3B9AA 4Z2IA 4L72B 1W1TA 1F8AB 1F40A 5HT1A 3RM8A 1M5YA 2IF4A 2PN0A 2XP9A 2LPVA 5DITA 2ZR5A 3UF8A 2QF8A 3WL1A 4AY1A 2ZR4A 1NMVA 3UI5A 4MGVA 1X6NA 3AS2A 2MLZA 3WD0A 3MDYB 4Z2GA 1Y0OA 5HUAA 4ZS6A 3CHDA 2XP8A 5DIUA 2F4EA 2PV3A 4Q22A 1W9VA 3FAPA 2ZQVA 4ODOA 3O5JA 2VCDA 1L1PA 4DRPA 4FAPA 4DROA 4ODMA 4NZCA 3IK8A 1FKTA 2PBCA 4JFLA 4QZVB 4ML4A 5BXJA 1LQ0A 1ZCNA 2FKEA 1OGGA 3IKDA 2MLYA 1LJYA 1FFRA 1LL4A 2D9FA 2A3CA 2UZ5A 1FKFA 3O5EA 4G2PA 1TCOC 1PINA 1FKLA 3ARYA 1JNDA 3AS3A 1NWUA 3CHFA 1E6NA 1JCHB 1H0GA 2B5UB 3TCZA 3FXYA 4DWSB 4IT6A 2XP3A 1JNTA 2VN1A 3ODKA 4DT4A 3I6CA 2DPEA 1X6LA 3UI4A 3CGMA 3ARXA 1W1VA 3CGNA 2RUCA 4LAYA 5JH8A 1NSGA 3ARSA 2ZQSA 1NMWA 2PPOA 4DWSD 1WNOA 5DF0A 4WKFA 3ARWA 4HARA 3W4RA 2PV1A 1FKJA 4TX0A 2XP5A 1ZK6A 1E44A 1FKSA 4MNLA 3ARPA 4P8VA 4HBOA 4PTMA 1LG1A 3AS0A 5DO2A 3B8SA 1KFWA 4JYSA 1OWQA 5B8IC 2DT2A 3O5QA 1Q6HA 1EYMA 3NTPA 2PI6A 1T11A 3B9EA 2Y78A 1FKHA 4DRKA 3KAFA 2AWGA 1W1YA 4DRIA 3CHEA 1W26A 3AROA 2WK2A 2WLZA 4MTVA 1FD9A 5HKGA 3B7XA 2F21A 1W9UA 3RMEA 2DT3A 3RM9A 4NNRA 4DZ2A 3B9DA 2RURA 4JFKA 2JZVA 1SYTA 1B6CA 2O9OA 2KFWA 1NWTA 2M2AA 3WD2A 3PRBA 4TNSA 1OGBA 1W1PA 1GOIA 1NH6A 1FAPA 1ROTA 3WH0A 4W9QA 2M1IA 1HJWA 1WAWA 5GPRA 1HJVA 2AOSA 1W9PA 2B31A 2DSWA 4J4NA 3LUOA 4ODRA 2ETNA 4DZ3A 1LL6A 1ZU8A 1E6PA 2DSVA 3EIPA 4NSBA 3PA7A 2XP6A 4P8UA 4JFJA 4Z2LA 2ZR6A 2LKNA 4DH0A 2P4VA 3AS1A 1FKGA 3IHZA 1SR0A 5HWBA 3OA5A 3PR9A 3KADA 4P8XA 2MF9A 3JXVA 1HJXA 4LAWA 3CZ8A 2XP4A 4TW6A 3RFWA 1UR9A 5GQBA 1ZBKA 4LAXA 4FN2A 1ZL1A 4UDMA 2PV2A 2EULA 1D6OA 1NWSA 1P5QA 3ALGA 4DWSC 4WKHA 4U86A 2DSZA 2MPHA 1R9HA 2G41A 1LG2A 5HW8A 1QZ2A 1U79A 3EY6A 1D2KA 1Q6UA 3WKZA 3NI6A 1N1AA 2M08A 2DG3A 3TDBA 2O92A 2LGOA 2RSEA 3O5RA 3RM4A 5D75A 3UQAA 3FY1A 1KT0A 1BKFA 3G6MA 1Q1CA 1RD6A 3O5PA 4C02B 4DIPA 2A3EA 2PPNA 2Q5AA 3CH9A 2XPAA 4ZPVR 4LAVA 2MNTA 3QOKA 4TW7A 2DSUA 4Z2JA 1WB0A 3ARTA 3KCEA 3O5KA 2WM0A 4DRJA 3KAHA 2A3AA 2G8ZA 1ROUA 4S3JA 5I98A 1GUVA 4L3NA 1A7XA 4HBEA 2K8IA 4DRMA 3WIJA 4ODQA 2F23A 1ZBWA 1QPLA 1HKIA 2A3BA 2FAPA 1ITXA 1YATA 3AQUA 3BXWA 3GPKA 1E6RA 1VF8A 3KACA 4W9OA 2L2SA 3O5FA 3KAGA 4WK9A 1PBKA 3O5LA 2IUZA 1UR8A 2OLHA 3WL0A 4DWSA 1J4RA 3O5OA 2ZQUA 1J4IA 1E15A 3WQVA 3RGCA 3WD4A 1YW5A 3NRKA 1EIBA 4W9PA 5GPGA 4URIA 4W5UA 3WQWA 4ITZA 2OFNA 3ALFA 4R5EA 1K9TA 3H9RB 3BMBA 1XRVA 3WD1A 1EDQA 1FKDA 1KT1A 1HXVA 4U85A 4LGXA 1BL4A 2DT0A 2YBUA 4ODLA 1CTNA 4QIBA 4IQCA 2KGJA 1JNEA 1FFQA 4JFIA 3KABA 4WJXA 1ZBCA 1E9LA
chains in the Genus database with same CATH topology
3WD3A 2WLYA 1EHNA 4O2TA 3VAWA 3ARZA 4U84A 2KR7A 4MSPA 4GIVA 3JYJA 3ARRA 4ZPWR 5HBFA 3OOBA 4Q7NA 1O6IA 4MPKA 2FDMA 1FKKA 4N19A 4ZPTR 2N87A 3ARUA 1IX5A 3UQBA 4P8WA 1Q6IA 4TW8A 4QT3A 2F2DA 1D7JA 2DG4A 1GPFA 1QPFA 1XHGA 4G50A 4WKAA 1D7HA 4J4OA 3KAIA 1JNSA 3O5DA 1FKBA 4DRQA 4TYOA 2RUDA 5J6EA 4Z2KA 3G6LA 2ZQTA 4BF8A 2XPBA 3PRDA 3JYMA 1FJDA 4DRNA 1HKJA 1FKRA 4XAKA 3O5MA 3PRAA 3TC5A 3ARQA 4QT2A 1E6ZA 1J4HA 2KI3A 3O5GA 1H0IA 1ZBVA 4Z2HA 5HW7A 1ZB5A 3UI6A 4GGQA 2DG9A 4MNMA 4S3KA 1LL7A 2KE0A 4ODKA 2PPPA 4WIWA 1C9HA 3O5IA 2ESCA 1EQ3A 4IPXA 3ARVA 5HTGA 4R0XA 5DIVA 2LJ4A 4IQ2A 1NWRA 2XP7A 3UQIA 4MAVA 1JVWA 1HKMA 4MNJA 4ODNA 4JFMA 3KZ7A 2ITKA 1D7IA 3CHCA 2MLXA 5HWCA 2RUQA 5DEZA 3IKGA 2DT1A 4KR0B 1J6YA 4MNKA 1HKKA 4KQZA 4ODPA 2YBTA 4IT4A 2RQSA 2KO7A 4DRHA 1FKIA 5HW6A 1TFVA 3B9AA 4Z2IA 4L72B 1W1TA 1F8AB 1F40A 5HT1A 3RM8A 1M5YA 2IF4A 2XP9A 2LPVA 5DITA 2ZR5A 3UF8A 2QF8A 3WL1A 4AY1A 2ZR4A 1NMVA 3UI5A 4MGVA 1X6NA 3AS2A 2MLZA 3WD0A 3MDYB 4Z2GA 1Y0OA 5HUAA 4ZS6A 3CHDA 2XP8A 5DIUA 2F4EA 2PV3A 4Q22A 1W9VA 3FAPA 2ZQVA 4ODOA 3O5JA 2VCDA 1L1PA 4DRPA 4FAPA 4DROA 4ODMA 4NZCA 3IK8A 1FKTA 2PBCA 4JFLA 4QZVB 4ML4A 5BXJA 1LQ0A 1ZCNA 2FKEA 1OGGA 3IKDA 2MLYA 1LJYA 1FFRA 1LL4A 2D9FA 2A3CA 2UZ5A 1FKFA 3O5EA 4G2PA 1TCOC 1PINA 1FKLA 3ARYA 1JNDA 3AS3A 1NWUA 3CHFA 1E6NA 1H0GA 3TCZA 3FXYA 4DWSB 4IT6A 2XP3A 1JNTA 2VN1A 3ODKA 4DT4A 3I6CA 2DPEA 1X6LA 3UI4A 3CGMA 3ARXA 1W1VA 3CGNA 2RUCA 4LAYA 5JH8A 1NSGA 3ARSA 2ZQSA 1NMWA 2PPOA 4DWSD 1WNOA 5DF0A 4WKFA 3ARWA 4HARA 3W4RA 2PV1A 1FKJA 4TX0A 2XP5A 1ZK6A 1FKSA 4MNLA 3ARPA 4P8VA 4HBOA 4PTMA 1LG1A 3AS0A 5DO2A 3B8SA 1KFWA 4JYSA 1OWQA 5B8IC 2DT2A 3O5QA 1Q6HA 1EYMA 3NTPA 2PI6A 1T11A 3B9EA 2Y78A 1FKHA 4DRKA 3KAFA 2AWGA 1W1YA 4DRIA 3CHEA 1W26A 3AROA 2WK2A 2WLZA 4MTVA 1FD9A 5HKGA 3B7XA 2F21A 1W9UA 3RMEA 2DT3A 3RM9A 4NNRA 4DZ2A 3B9DA 2RURA 4JFKA 2JZVA 1SYTA 1B6CA 2O9OA 2KFWA 1NWTA 2M2AA 3WD2A 3PRBA 4TNSA 1OGBA 1W1PA 1GOIA 1NH6A 1FAPA 1ROTA 3WH0A 4W9QA 2M1IA 1HJWA 1WAWA 5GPRA 1HJVA 2AOSA 1W9PA 2B31A 2DSWA 4J4NA 3LUOA 4ODRA 4DZ3A 1LL6A 1ZU8A 1E6PA 2DSVA 4NSBA 3PA7A 2XP6A 4P8UA 4JFJA 4Z2LA 2ZR6A 2LKNA 4DH0A 3AS1A 1FKGA 3IHZA 1SR0A 5HWBA 3OA5A 3PR9A 3KADA 4P8XA 2MF9A 3JXVA 1HJXA 4LAWA 3CZ8A 2XP4A 4TW6A 3RFWA 1UR9A 5GQBA 1ZBKA 4LAXA 4FN2A 1ZL1A 2PV2A 1D6OA 1NWSA 1P5QA 3ALGA 4DWSC 4WKHA 4U86A 2DSZA 2MPHA 1R9HA 2G41A 1LG2A 5HW8A 1QZ2A 1U79A 3EY6A 1D2KA 1Q6UA 3WKZA 3NI6A 1N1AA 2M08A 2DG3A 3TDBA 2O92A 2LGOA 2RSEA 3O5RA 3RM4A 5D75A 3UQAA 3FY1A 1KT0A 1BKFA 3G6MA 1Q1CA 1RD6A 3O5PA 4C02B 4DIPA 2A3EA 2PPNA 2Q5AA 3CH9A 2XPAA 4ZPVR 4LAVA 2MNTA 3QOKA 4TW7A 2DSUA 4Z2JA 1WB0A 3ARTA 3KCEA 3O5KA 2WM0A 4DRJA 3KAHA 2A3AA 2G8ZA 1ROUA 4S3JA 5I98A 1GUVA 4L3NA 1A7XA 4HBEA 2K8IA 4DRMA 3WIJA 4ODQA 1ZBWA 1QPLA 1HKIA 2A3BA 2FAPA 1ITXA 1YATA 3AQUA 3BXWA 3GPKA 1E6RA 1VF8A 3KACA 4W9OA 2L2SA 3O5FA 3KAGA 4WK9A 1PBKA 3O5LA 2IUZA 1UR8A 2OLHA 3WL0A 4DWSA 1J4RA 3O5OA 2ZQUA 1J4IA 1E15A 3WQVA 3RGCA 3WD4A 1YW5A 3NRKA 1EIBA 4W9PA 5GPGA 4URIA 4W5UA 3WQWA 4ITZA 2OFNA 3ALFA 4R5EA 1K9TA 3H9RB 1XRVA 3WD1A 1EDQA 1FKDA 1KT1A 1HXVA 4U85A 4LGXA 1BL4A 2DT0A 2YBUA 4ODLA 1CTNA 4QIBA 4IQCA 2KGJA 1JNEA 1FFQA 4JFIA 3KABA 4WJXA 1ZBCA 1E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYS A;  5B8I C;  2RSE A;  1F8A B;  3O5R A;  3O5Q A;  1Q6H A;  5HT1 A;  1F40 A;  1EYM A;  3NTP A;  4O2T A;  1M5Y A;  3VAW A;  2IF4 A;  4U84 A;  2KR7 A;  4MSP A;  5D75 A;  3UQA A;  4GIV A;  3JYJ A;  2XP9 A;  1T11 A;  2LPV A;  1KT0 A;  1BKF A;  5DIT A;  2Y78 A;  2ZR5 A;  3OOB A;  1FKH A;  3UF8 A;  4DRK A;  3KAF A;  1Q1C A;  3O5P A;  2ZR4 A;  2AWG A;  1FKK A;  4N19 A;  1NMV A;  3UI5 A;  4C02 B;  4DIP A;  4MGV A;  2N87 A;  2PPN A;  4DRI A;  2Q5A A;  2MLZ A;  3UQB A;  2XPA A;  1Q6I A;  3MDY B;  1W26 A;  4LAV A;  4QT3 A;  1Y0O A;  4TW8 A;  5HUA A;  2MNT A;  2F2D A;  4TW7 A;  1D7J A;  2DG4 A;  2XP8 A;  3KCE A;  5DIU A;  1QPF A;  4G50 A;  1FD9 A;  2F4E A;  3O5K A;  2PV3 A;  1D7H A;  4J4O A;  3B7X A;  2F21 A;  5HKG A;  3KAI A;  4DRJ A;  1JNS A;  3O5D A;  1FKB A;  3KAH A;  4DRQ A;  4TYO A;  1ROU A;  2RUD A;  2ZQV A;  3FAP A;  5J6E A;  4NNR A;  4ODO A;  4DZ2 A;  5I98 A;  2RUR A;  2ZQT A;  4JFK A;  2XPB A;  4BF8 A;  3O5J A;  2VCD A;  1L1P A;  2JZV A;  3PRD A;  3JYM A;  1B6C A;  4DRO A;  4DRP A;  4ODM A;  4FAP A;  1A7X A;  2KFW A;  2M2A A;  1FJD A;  2K8I A;  4DRM A;  3PRB A;  3IK8 A;  4TNS A;  4DRN A;  1FKT A;  2PBC A;  4JFL A;  1FKR A;  3O5M A;  4ODQ A;  5BXJ A;  3TC5 A;  1QPL A;  1ZCN A;  2FKE A;  4QT2 A;  1FAP A;  1ROT A;  3IKD A;  3WH0 A;  2MLY A;  4W9Q A;  1J4H A;  2M1I A;  2KI3 A;  3O5G A;  2FAP A;  1YAT A;  2D9F A;  3O5E A;  2UZ5 A;  1FKF A;  5HW7 A;  4G2P A;  1TCO C;  1PIN A;  1FKL A;  3GPK A;  3UI6 A;  3KAC A;  4GGQ A;  4J4N A;  4W9O A;  2L2S A;  3LUO A;  4ODR A;  2DG9 A;  3O5F A;  3KAG A;  4DZ3 A;  1PBK A;  3O5L A;  2KE0 A;  4ODK A;  2PPP A;  3TCZ A;  1C9H A;  1J4R A;  3O5I A;  1EQ3 A;  3O5O A;  2ZQU A;  1J4I A;  4IPX A;  2XP3 A;  1JNT A;  2XP6 A;  3PA7 A;  4JFJ A;  2VN1 A;  3ODK A;  3RGC A;  4DT4 A;  3I6C A;  2ZR6 A;  2LKN A;  5HTG A;  4R0X A;  3TDB A;  4DH0 A;  1YW5 A;  3NRK A;  1FKG A;  3CGM A;  5DIV A;  3UI4 A;  4W9P A;  5GPG A;  3CGN A;  3IHZ A;  2LJ4 A;  2RUC A;  4ITZ A;  4IQ2 A;  4LAY A;  5HWB A;  2XP7 A;  3UQI A;  3KAD A;  1NSG A;  2OFN A;  1JVW A;  2ZQS A;  1NMW A;  2PPO A;  3H9R B;  2MF9 A;  4ODN A;  3JXV A;  1FKD A;  4LAW A;  4TW6 A;  1KT1 A;  2XP4 A;  3RFW A;  4JFM A;  1HXV A;  2PV1 A;  3KZ7 A;  4U85 A;  1FKJ A;  2ITK A;  1D7I A;  2MLX A;  4LAX A;  2RUQ A;  4FN2 A;  4TX0 A;  5HWC A;  1BL4 A;  2PV2 A;  2XP5 A;  1D6O A;  4ODL A;  1P5Q A;  1ZK6 A;  3IKG A;  4QIB A;  4IQC A;  2KGJ A;  4U86 A;  1FKS A;  2MPH A;  1J6Y A;  4ODP A;  1R9H A;  2RQS A;  5HW8 A;  4JFI A;  1QZ2 A;  1U79 A;  3KAB A;  2KO7 A;  3EY6 A;  4DRH A;  1FKI A;  1Q6U A;  5HW6 A;  3NI6 A;  1N1A A;  2M08 A;  2DG3 A;  2LGO A; 
#chains in the Genus database with same CATH topology
 3WD3 A;  2WLY A;  1EHN A;  4O2T A;  3VAW A;  3ARZ A;  4U84 A;  2KR7 A;  4MSP A;  4GIV A;  3JYJ A;  3ARR A;  4ZPW R;  5HBF A;  3OOB A;  4Q7N A;  3GTY X;  1O6I A;  4MPK A;  2FDM A;  1FKK A;  4N19 A;  4ZPT R;  2N87 A;  3ARU A;  1IX5 A;  3UQB A;  4P8W A;  1Q6I A;  4TW8 A;  4QT3 A;  2F2D A;  1D7J A;  2DG4 A;  1GPF A;  1QPF A;  1XHG A;  4G50 A;  4WKA A;  1D7H A;  4J4O A;  3KAI A;  1JNS A;  3O5D A;  1FKB A;  4DRQ A;  4TYO A;  2RUD A;  5J6E A;  4Z2K A;  3G6L A;  2ZQT A;  4BF8 A;  2XPB A;  3PRD A;  3JYM A;  1FJD A;  4DRN A;  1HKJ A;  1FKR A;  4XAK A;  3O5M A;  3PRA A;  3TC5 A;  3ARQ A;  4QT2 A;  1E6Z A;  1J4H A;  2KI3 A;  3O5G A;  1H0I A;  1ZBV A;  4Z2H A;  5HW7 A;  1ZB5 A;  3UI6 A;  4GGQ A;  2DG9 A;  4MNM A;  4S3K A;  1LL7 A;  2KE0 A;  4ODK A;  2PPP A;  4WIW A;  1C9H A;  3O5I A;  2ESC A;  1EQ3 A;  3GU0 A;  4IPX A;  3ARV A;  5HTG A;  4R0X A;  5DIV A;  2LJ4 A;  4IQ2 A;  1NWR A;  2XP7 A;  3UQI A;  4MAV A;  1JVW A;  1HKM A;  4MNJ A;  4ODN A;  4JFM A;  3KZ7 A;  2ITK A;  1D7I A;  3CHC A;  2MLX A;  5HWC A;  2RUQ A;  5DEZ A;  3IKG A;  2DT1 A;  4KR0 B;  1J6Y A;  4MNK A;  1HKK A;  4KQZ A;  4ODP A;  2YBT A;  4IT4 A;  2RQS A;  1GRJ A;  2KO7 A;  4DRH A;  1FKI A;  5HW6 A;  1TFV A;  3B9A A;  4Z2I A;  4L72 B;  1W1T A;  1F8A B;  1F40 A;  5HT1 A;  3RM8 A;  1M5Y A;  2IF4 A;  2PN0 A;  2XP9 A;  2LPV A;  5DIT A;  2ZR5 A;  3UF8 A;  2QF8 A;  3WL1 A;  4AY1 A;  2ZR4 A;  1NMV A;  3UI5 A;  4MGV A;  1X6N A;  3AS2 A;  2MLZ A;  3WD0 A;  3MDY B;  4Z2G A;  1Y0O A;  5HUA A;  4ZS6 A;  3CHD A;  2XP8 A;  5DIU A;  2F4E A;  2PV3 A;  4Q22 A;  1W9V A;  3FAP A;  2ZQV A;  4ODO A;  3O5J A;  2VCD A;  1L1P A;  4DRP A;  4FAP A;  4DRO A;  4ODM A;  4NZC A;  3IK8 A;  1FKT A;  2PBC A;  4JFL A;  4QZV B;  4ML4 A;  5BXJ A;  1LQ0 A;  1ZCN A;  2FKE A;  1OGG A;  3IKD A;  2MLY A;  1LJY A;  1FFR A;  1LL4 A;  2D9F A;  2A3C A;  2UZ5 A;  1FKF A;  3O5E A;  4G2P A;  1TCO C;  1PIN A;  1FKL A;  3ARY A;  1JND A;  3AS3 A;  1NWU A;  3CHF A;  1E6N A;  1JCH B;  1H0G A;  2B5U B;  3TCZ A;  3FXY A;  4DWS B;  4IT6 A;  2XP3 A;  1JNT A;  2VN1 A;  3ODK A;  4DT4 A;  3I6C A;  2DPE A;  1X6L A;  3UI4 A;  3CGM A;  3ARX A;  1W1V A;  3CGN A;  2RUC A;  4LAY A;  5JH8 A;  1NSG A;  3ARS A;  2ZQS A;  1NMW A;  2PPO A;  4DWS D;  1WNO A;  5DF0 A;  4WKF A;  3ARW A;  4HAR A;  3W4R A;  2PV1 A;  1FKJ A;  4TX0 A;  2XP5 A;  1ZK6 A;  1E44 A;  1FKS A;  4MNL A;  3ARP A;  4P8V A;  4HBO A;  4PTM A;  1LG1 A;  3AS0 A;  5DO2 A;  3B8S A;  1KFW A;  4JYS A;  1OWQ A;  5B8I C;  2DT2 A;  3O5Q A;  1Q6H A;  1EYM A;  3NTP A;  2PI6 A;  1T11 A;  3B9E A;  2Y78 A;  1FKH A;  4DRK A;  3KAF A;  2AWG A;  1W1Y A;  4DRI A;  3CHE A;  1W26 A;  3ARO A;  2WK2 A;  2WLZ A;  4MTV A;  1FD9 A;  5HKG A;  3B7X A;  2F21 A;  1W9U A;  3RME A;  2DT3 A;  3RM9 A;  4NNR A;  4DZ2 A;  3B9D A;  2RUR A;  4JFK A;  2JZV A;  1SYT A;  1B6C A;  2O9O A;  2KFW A;  1NWT A;  2M2A A;  3WD2 A;  3PRB A;  4TNS A;  1OGB A;  1W1P A;  1GOI A;  1NH6 A;  1FAP A;  1ROT A;  3WH0 A;  4W9Q A;  2M1I A;  1HJW A;  1WAW A;  5GPR A;  1HJV A;  2AOS A;  1W9P A;  2B31 A;  2DSW A;  4J4N A;  3LUO A;  4ODR A;  2ETN A;  4DZ3 A;  1LL6 A;  1ZU8 A;  1E6P A;  2DSV A;  3EIP A;  4NSB A;  3PA7 A;  2XP6 A;  4P8U A;  4JFJ A;  4Z2L A;  2ZR6 A;  2LKN A;  4DH0 A;  2P4V A;  3AS1 A;  1FKG A;  3IHZ A;  1SR0 A;  5HWB A;  3OA5 A;  3PR9 A;  3KAD A;  4P8X A;  2MF9 A;  3JXV A;  1HJX A;  4LAW A;  3CZ8 A;  2XP4 A;  4TW6 A;  3RFW A;  1UR9 A;  5GQB A;  1ZBK A;  4LAX A;  4FN2 A;  1ZL1 A;  4UDM A;  2PV2 A;  2EUL A;  1D6O A;  1NWS A;  1P5Q A;  3ALG A;  4DWS C;  4WKH A;  4U86 A;  2DSZ A;  2MPH A;  1R9H A;  2G41 A;  1LG2 A;  5HW8 A;  1QZ2 A;  1U79 A;  3EY6 A;  1D2K A;  1Q6U A;  3WKZ A;  3NI6 A;  1N1A A;  2M08 A;  2DG3 A;  3TDB A;  2O92 A;  2LGO A;  2RSE A;  3O5R A;  3RM4 A;  5D75 A;  3UQA A;  3FY1 A;  1KT0 A;  1BKF A;  3G6M A;  1Q1C A;  1RD6 A;  3O5P A;  4C02 B;  4DIP A;  2A3E A;  2PPN A;  2Q5A A;  3CH9 A;  2XPA A;  4ZPV R;  4LAV A;  2MNT A;  3QOK A;  4TW7 A;  2DSU A;  4Z2J A;  1WB0 A;  3ART A;  3KCE A;  3O5K A;  2WM0 A;  4DRJ A;  3KAH A;  2A3A A;  2G8Z A;  1ROU A;  4S3J A;  5I98 A;  1GUV A;  4L3N A;  1A7X A;  4HBE A;  2K8I A;  4DRM A;  3WIJ A;  4ODQ A;  2F23 A;  1ZBW A;  1QPL A;  1HKI A;  2A3B A;  2FAP A;  1ITX A;  1YAT A;  3AQU A;  3BXW A;  3GPK A;  1E6R A;  1VF8 A;  3KAC A;  4W9O A;  2L2S A;  3O5F A;  3KAG A;  4WK9 A;  1PBK A;  3O5L A;  2IUZ A;  1UR8 A;  2OLH A;  3WL0 A;  4DWS A;  1J4R A;  3O5O A;  2ZQU A;  1J4I A;  1E15 A;  3WQV A;  3RGC A;  3WD4 A;  1YW5 A;  3NRK A;  1EIB A;  4W9P A;  5GPG A;  4URI A;  4W5U A;  3WQW A;  4ITZ A;  2OFN A;  3ALF A;  4R5E A;  1K9T A;  3H9R B;  3BMB A;  1XRV A;  3WD1 A;  1EDQ A;  1FKD A;  1KT1 A;  1HXV A;  4U85 A;  4LGX A;  1BL4 A;  2DT0 A;  2YBU A;  4ODL A;  1CTN A;  4QIB A;  4IQC A;  2KGJ A;  1JNE A;  1FFQ A;  4JFI A;  3KAB A;  4WJX A;  1ZBC A;  1E9L A; 
#chains in the Genus database with same CATH homology
 3WD3 A;  2WLY A;  1EHN A;  4O2T A;  3VAW A;  3ARZ A;  4U84 A;  2KR7 A;  4MSP A;  4GIV A;  3JYJ A;  3ARR A;  4ZPW R;  5HBF A;  3OOB A;  4Q7N A;  1O6I A;  4MPK A;  2FDM A;  1FKK A;  4N19 A;  4ZPT R;  2N87 A;  3ARU A;  1IX5 A;  3UQB A;  4P8W A;  1Q6I A;  4TW8 A;  4QT3 A;  2F2D A;  1D7J A;  2DG4 A;  1GPF A;  1QPF A;  1XHG A;  4G50 A;  4WKA A;  1D7H A;  4J4O A;  3KAI A;  1JNS A;  3O5D A;  1FKB A;  4DRQ A;  4TYO A;  2RUD A;  5J6E A;  4Z2K A;  3G6L A;  2ZQT A;  4BF8 A;  2XPB A;  3PRD A;  3JYM A;  1FJD A;  4DRN A;  1HKJ A;  1FKR A;  4XAK A;  3O5M A;  3PRA A;  3TC5 A;  3ARQ A;  4QT2 A;  1E6Z A;  1J4H A;  2KI3 A;  3O5G A;  1H0I A;  1ZBV A;  4Z2H A;  5HW7 A;  1ZB5 A;  3UI6 A;  4GGQ A;  2DG9 A;  4MNM A;  4S3K A;  1LL7 A;  2KE0 A;  4ODK A;  2PPP A;  4WIW A;  1C9H A;  3O5I A;  2ESC A;  1EQ3 A;  4IPX A;  3ARV A;  5HTG A;  4R0X A;  5DIV A;  2LJ4 A;  4IQ2 A;  1NWR A;  2XP7 A;  3UQI A;  4MAV A;  1JVW A;  1HKM A;  4MNJ A;  4ODN A;  4JFM A;  3KZ7 A;  2ITK A;  1D7I A;  3CHC A;  2MLX A;  5HWC A;  2RUQ A;  5DEZ A;  3IKG A;  2DT1 A;  4KR0 B;  1J6Y A;  4MNK A;  1HKK A;  4KQZ A;  4ODP A;  2YBT A;  4IT4 A;  2RQS A;  2KO7 A;  4DRH A;  1FKI A;  5HW6 A;  1TFV A;  3B9A A;  4Z2I A;  4L72 B;  1W1T A;  1F8A B;  1F40 A;  5HT1 A;  3RM8 A;  1M5Y A;  2IF4 A;  2XP9 A;  2LPV A;  5DIT A;  2ZR5 A;  3UF8 A;  2QF8 A;  3WL1 A;  4AY1 A;  2ZR4 A;  1NMV A;  3UI5 A;  4MGV A;  1X6N A;  3AS2 A;  2MLZ A;  3WD0 A;  3MDY B;  4Z2G A;  1Y0O A;  5HUA A;  4ZS6 A;  3CHD A;  2XP8 A;  5DIU A;  2F4E A;  2PV3 A;  4Q22 A;  1W9V A;  3FAP A;  2ZQV A;  4ODO A;  3O5J A;  2VCD A;  1L1P A;  4DRP A;  4FAP A;  4DRO A;  4ODM A;  4NZC A;  3IK8 A;  1FKT A;  2PBC A;  4JFL A;  4QZV B;  4ML4 A;  5BXJ A;  1LQ0 A;  1ZCN A;  2FKE A;  1OGG A;  3IKD A;  2MLY A;  1LJY A;  1FFR A;  1LL4 A;  2D9F A;  2A3C A;  2UZ5 A;  1FKF A;  3O5E A;  4G2P A;  1TCO C;  1PIN A;  1FKL A;  3ARY A;  1JND A;  3AS3 A;  1NWU A;  3CHF A;  1E6N A;  1H0G A;  3TCZ A;  3FXY A;  4DWS B;  4IT6 A;  2XP3 A;  1JNT A;  2VN1 A;  3ODK A;  4DT4 A;  3I6C A;  2DPE A;  1X6L A;  3UI4 A;  3CGM A;  3ARX A;  1W1V A;  3CGN A;  2RUC A;  4LAY A;  5JH8 A;  1NSG A;  3ARS A;  2ZQS A;  1NMW A;  2PPO A;  4DWS D;  1WNO A;  5DF0 A;  4WKF A;  3ARW A;  4HAR A;  3W4R A;  2PV1 A;  1FKJ A;  4TX0 A;  2XP5 A;  1ZK6 A;  1FKS A;  4MNL A;  3ARP A;  4P8V A;  4HBO A;  4PTM A;  1LG1 A;  3AS0 A;  5DO2 A;  3B8S A;  1KFW A;  4JYS A;  1OWQ A;  5B8I C;  2DT2 A;  3O5Q A;  1Q6H A;  1EYM A;  3NTP A;  2PI6 A;  1T11 A;  3B9E A;  2Y78 A;  1FKH A;  4DRK A;  3KAF A;  2AWG A;  1W1Y A;  4DRI A;  3CHE A;  1W26 A;  3ARO A;  2WK2 A;  2WLZ A;  4MTV A;  1FD9 A;  5HKG A;  3B7X A;  2F21 A;  1W9U A;  3RME A;  2DT3 A;  3RM9 A;  4NNR A;  4DZ2 A;  3B9D A;  2RUR A;  4JFK A;  2JZV A;  1SYT A;  1B6C A;  2O9O A;  2KFW A;  1NWT A;  2M2A A;  3WD2 A;  3PRB A;  4TNS A;  1OGB A;  1W1P A;  1GOI A;  1NH6 A;  1FAP A;  1ROT A;  3WH0 A;  4W9Q A;  2M1I A;  1HJW A;  1WAW A;  5GPR A;  1HJV A;  2AOS A;  1W9P A;  2B31 A;  2DSW A;  4J4N A;  3LUO A;  4ODR A;  4DZ3 A;  1LL6 A;  1ZU8 A;  1E6P A;  2DSV A;  4NSB A;  3PA7 A;  2XP6 A;  4P8U A;  4JFJ A;  4Z2L A;  2ZR6 A;  2LKN A;  4DH0 A;  3AS1 A;  1FKG A;  3IHZ A;  1SR0 A;  5HWB A;  3OA5 A;  3PR9 A;  3KAD A;  4P8X A;  2MF9 A;  3JXV A;  1HJX A;  4LAW A;  3CZ8 A;  2XP4 A;  4TW6 A;  3RFW A;  1UR9 A;  5GQB A;  1ZBK A;  4LAX A;  4FN2 A;  1ZL1 A;  2PV2 A;  1D6O A;  1NWS A;  1P5Q A;  3ALG A;  4DWS C;  4WKH A;  4U86 A;  2DSZ A;  2MPH A;  1R9H A;  2G41 A;  1LG2 A;  5HW8 A;  1QZ2 A;  1U79 A;  3EY6 A;  1D2K A;  1Q6U A;  3WKZ A;  3NI6 A;  1N1A A;  2M08 A;  2DG3 A;  3TDB A;  2O92 A;  2LGO A;  2RSE A;  3O5R A;  3RM4 A;  5D75 A;  3UQA A;  3FY1 A;  1KT0 A;  1BKF A;  3G6M A;  1Q1C A;  1RD6 A;  3O5P A;  4C02 B;  4DIP A;  2A3E A;  2PPN A;  2Q5A A;  3CH9 A;  2XPA A;  4ZPV R;  4LAV A;  2MNT A;  3QOK A;  4TW7 A;  2DSU A;  4Z2J A;  1WB0 A;  3ART A;  3KCE A;  3O5K A;  2WM0 A;  4DRJ A;  3KAH A;  2A3A A;  2G8Z A;  1ROU A;  4S3J A;  5I98 A;  1GUV A;  4L3N A;  1A7X A;  4HBE A;  2K8I A;  4DRM A;  3WIJ A;  4ODQ A;  1ZBW A;  1QPL A;  1HKI A;  2A3B A;  2FAP A;  1ITX A;  1YAT A;  3AQU A;  3BXW A;  3GPK A;  1E6R A;  1VF8 A;  3KAC A;  4W9O A;  2L2S A;  3O5F A;  3KAG A;  4WK9 A;  1PBK A;  3O5L A;  2IUZ A;  1UR8 A;  2OLH A;  3WL0 A;  4DWS A;  1J4R A;  3O5O A;  2ZQU A;  1J4I A;  1E15 A;  3WQV A;  3RGC A;  3WD4 A;  1YW5 A;  3NRK A;  1EIB A;  4W9P A;  5GPG A;  4URI A;  4W5U A;  3WQW A;  4ITZ A;  2OFN A;  3ALF A;  4R5E A;  1K9T A;  3H9R B;  1XRV A;  3WD1 A;  1EDQ A;  1FKD A;  1KT1 A;  1HXV A;  4U85 A;  4LGX A;  1BL4 A;  2DT0 A;  2YBU A;  4ODL A;  1CTN A;  4QIB A;  4IQC A;  2KGJ A;  1JNE A;  1FFQ A;  4JFI A;  3KAB A;  4WJX A;  1ZBC A;  1E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...