4ODQA

Structure of slyd delta-if from thermus thermophilus in complex with s3 peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
106
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 24
structure length 106
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odqA00
2XPAA 5HW6A 3JXVA 1BKFA 4DRKA 3RGCA 4DZ2A 4IQ2A 1JNSA 1ROTA 4MSPA 1JNTA 2ZQUA 2RQSA 4GIVA 2XPBA 1NMWA 2MLZA 4MGVA 1HXVA 4W9PA 3IK8A 4NNRA 2PV3A 4QT3A 3UF8A 1R9HA 3OOBA 1YATA 3KCEA 3TDBA 4DIPA 3GPKA 4IQCA 5J6EA 3KAGA 1FKJA 3NRKA 4G2PA 4FN2A 2AWGA 2VN1A 1EQ3A 2MLYA 4ODQA 3NTPA 1FKRA 1J4IA 1P5QA 3PRBA 4TW6A 5DIUA 3B7XA 4W9QA 1Q6UA 2LGOA 5DITA 4N19A 2UZ5A 3KAIA 3RFWA 4DRPA 5HWCA 1TCOC 4W9OA 1ZK6A 5HWBA 5HT1A 2KE0A 3FAPA 1KT0A 2Q5AA 2LKNA 3MDYB 4ITZA 3UI6A 5HTGA 1NMVA 2KGJA 2LJ4A 2JZVA 1EYMA 1Q6HA 3O5PA 3O5KA 3PRDA 4DRJA 3CGMA 4DT4A 4DH0A 2M1IA 4ODNA 3O5MA 2PBCA 2PV1A 1ZCNA 2M2AA 3LUOA 4JFJA 1KT1A 3O5RA 2F4EA 2OFNA 4BF8A 2KO7A 1PBKA 4ODRA 5I98A 3UQAA 2K8IA 1W26A 2N87A 2XP3A 1D7HA 3O5OA 2MPHA 2PPNA 4TW7A 1YW5A 4JFLA 3O5FA 3EY6A 1C9HA 3UQBA 1FKDA 4ODLA 2RUDA 4ODPA 4DZ3A 1T11A 2F21A 4DRQA 3KADA 3O5QA 4JYSA 2XP7A 4G50A 1FAPA 5BXJA 2MNTA 4DRHA 1J4RA 3IHZA 4J4OA 4DRMA 1U79A 2DG4A 2ZR6A 4ODOA 3VAWA 1FKLA 1FKKA 2RURA 3IKGA 4LAVA 4LAXA 1QPFA 3IKDA 4QT2A 3UI4A 1Q1CA 1FKTA 2PPPA 2ZQSA 2FAPA 2ZQVA 4J4NA 4C02B 5HKGA 2KR7A 4O2TA 1D6OA 2M08A 4ODKA 1B6CA 1JVWA 3O5IA 5B8IC 4IPXA 4GGQA 1FKGA 1D7JA 4FAPA 1FKFA 2RUCA 1FKBA 2DG3A 3TC5A 4TYOA 5HUAA 3O5LA 5HW8A 3O5JA 1FKIA 3JYMA 3O5EA 3O5DA 2XP5A 3CGNA 3KAHA 3O5GA 1A7XA 2XP4A 4TX0A 2LPVA 2F2DA 2RUQA 2IF4A 1QZ2A 2MLXA 2PPOA 2VCDA 4LAYA 1FJDA 3KZ7A 2ZQTA 1NSGA 1F8AB 2RSEA 4TW8A 2KFWA 4QIBA 2ZR5A 5D75A 3KABA 3TCZA 3UQIA 4ODMA 2MF9A 1Q6IA 1PINA 2D9FA 1FKHA 2FKEA 2PV2A 4U84A 2ITKA 1D7IA 1FKSA 2ZR4A 1BL4A 1F40A 1J6YA 3UI5A 5GPGA 2L2SA 3JYJA 1J4HA 1QPLA 4DROA 4JFMA 4JFKA 3I6CA 1Y0OA 5DIVA 3WH0A 1FD9A 2XP9A 4U85A 3KACA 1L1PA 3PA7A 2DG9A 1M5YA 1N1AA 2Y78A 4JFIA 5HW7A 3KAFA 4R0XA 3ODKA 1ROUA 2KI3A 2XP6A 4U86A 2XP8A 4DRNA 4TNSA 3NI6A 4LAWA 3H9RB 4DRIA
chains in the Genus database with same CATH superfamily
3JXVA 3ARWA 3RGCA 3WD3A 1W1TA 4W9PA 3CH9A 1OGBA 1LL7A 1HKMA 2PN0A 3KCEA 4DIPA 3GPKA 4IQCA 3WIJA 1SYTA 3NRKA 2DT0A 4FN2A 2VN1A 4DWSD 4Z2IA 3NTPA 4URIA 1P5QA 3PRBA 1Q6UA 2UZ5A 3KAIA 5HWCA 2KE0A 3MDYB 1SR0A 5HTGA 1KFWA 1D2KA 1LQ0A 3PRAA 2JZVA 1Q6HA 4DT4A 5DO2A 1IX5A 2M1IA 2PV1A 1KT1A 4BF8A 4ODRA 1RD6A 1W26A 1OWQA 2XP3A 2MPHA 3UQBA 4ODLA 3WD2A 1WNOA 2RUDA 4WJXA 2A3EA 4DRHA 1FFQA 3RM9A 1FKLA 3IKGA 4LAVA 3UI4A 3IKDA 3B9DA 4S3JA 1Q1CA 2ZQVA 4Z2LA 1CTNA 2DSUA 3CHDA 1ITXA 1H0GA 1E44A 1B6CA 1JVWA 3O5IA 3ARRA 4MPKA 2DPEA 5HUAA 3O5EA 3O5GA 4Q22A 3KAHA 2LPVA 2F2DA 2IF4A 2VCDA 3UQIA 4ODMA 1PINA 1FKHA 1ZBKA 1NWUA 1D7IA 1EHNA 1UR8A 2B5UB 1OGGA 4NZCA 5GPGA 3ALGA 3JYJA 2ESCA 3CZ8A 4R5EA 3WH0A 3AS0A 2QF8A 3G6MA 3FY1A 3ARZA 4R0XA 4IT6A 2XP6A 3G6LA 2XP8A 2EULA 4ZPTR 5HW6A 4MNLA 1HKJA 4MSPA 2ZQUA 4GIVA 2RQSA 3WL0A 1TFVA 1HXVA 4NNRA 3UF8A 2OLHA 1FFRA 1R9HA 1E6NA 4G2PA 2MLYA 1J4IA 1W1VA 4TW6A 4W9QA 4DWSA 3FXYA 4DRPA 5GPRA 1VF8A 4Q7NA 2B31A 3AS1A 4ZPVR 3UI6A 4Z2JA 4MNKA 4P8WA 1EYMA 3O5KA 4DRJA 4DH0A 2PBCA 3O5RA 1GUVA 2F4EA 2OFNA 4L3NA 1NH6A 5I98A 3UQAA 1D7HA 1W9PA 2DT1A 1E6PA 1YW5A 3ARUA 3O5FA 1C9HA 1FKDA 4DZ3A 2YBTA 1T11A 4MAVA 2F21A 1W1PA 1UR9A 4ZPWR 4G50A 1FAPA 5BXJA 2MNTA 4J4OA 4DRMA 2ZR6A 2DG4A 4ODOA 3VAWA 4W5UA 4LAXA 5HBFA 1LL4A 1FKTA 4ML4A 4C02B 1W9UA 3CHFA 1ZBCA 5B8IC 1FKGA 4FAPA 1FKFA 3GTYX 3TC5A 4TYOA 3O5JA 3JYMA 1O6IA 1XRVA 3CGNA 3OA5A 2RUQA 2WLZA 3KZ7A 2ZQTA 1NWTA 3AROA 3EIPA 3KABA 2FKEA 4U84A 1X6NA 3B9AA 1LG1A 1FKSA 1BL4A 3AS2A 1F40A 1J6YA 1GOIA 3ARQA 1J4HA 4DROA 3I6CA 4DWSB 1L1PA 4Z2KA 1ZBWA 4JFIA 2KI3A 4U86A 4DRNA 3NI6A 3QOKA 4DRIA 1ZBVA 2XPAA 4DRKA 1BKFA 3PR9A 4DZ2A 4IQ2A 1JNSA 4KQZA 1JNTA 3B8SA 1NMWA 3AQUA 3GU0A 4WKFA 2PV3A 4QT3A 1HKIA 1W1YA 3OOBA 1YATA 2O9OA 3TDBA 4NSBA 1W9VA 3KAGA 1FKJA 4UDMA 4ODQA 1GRJA 3RMEA 3B7XA 1EIBA 4IT4A 2LGOA 5DITA 1TCOC 4PTMA 1ZK6A 1X6LA 4ITZA 2Q5AA 2LKNA 3WQVA 2DSZA 1E6RA 1NMVA 2KGJA 2LJ4A 3O5PA 4ODNA 3O5MA 2N87A 5DF0A 4TW7A 2PPNA 4WK9A 3O5QA 4JYSA 4WIWA 1HKKA 3IHZA 1U79A 4AY1A 1FKKA 4L72B 1QPFA 4QT2A 2ZQSA 3ARSA 2FAPA 3ALFA 4J4NA 2DSWA 2KR7A 4O2TA 2M08A 1JNDA 1NWSA 1ZL1A 2YBUA 1E15A 1FKBA 3WKZA 1FKIA 4P8XA 1EDQA 3O5DA 2XP5A 4TX0A 1LL6A 4S3KA 4HARA 2MLXA 2PPOA 4LAYA 3ARVA 5D75A 2DT2A 3TCZA 4QIBA 1HJXA 2MF9A 1Q6IA 2ITKA 5GQBA 2ZR4A 3WD0A 4MNJA 3UI5A 3CHEA 2L2SA 3BXWA 1QPLA 1K9TA 3WQWA 2A3BA 2DSVA 3KACA 1N1AA 4WKHA 2P4VA 5HW7A 3ODKA 1ROUA 4TNSA 4LAWA 2WM0A 4Z2GA 4WKAA 1E6ZA 1H0IA 2A3AA 1ROTA 1E9LA 2XPBA 2MLZA 4MGVA 3IK8A 2WK2A 4HBOA 3RM4A 5J6EA 1WAWA 2WLYA 2AWGA 3ARYA 1EQ3A 2G8ZA 1FKRA 5DIUA 4N19A 3RFWA 4W9OA 4KR0B 5HWBA 5HT1A 3FAPA 1KT0A 3ARXA 1HJVA 3PRDA 1WB0A 3CGMA 1ZCNA 2M2AA 3LUOA 4JFJA 1NWRA 3B9EA 3AS3A 2KO7A 1PBKA 2K8IA 3CHCA 1ZU8A 2DT3A 3O5OA 4JFLA 5JH8A 3EY6A 4ODPA 3ARPA 4DRQA 1LJYA 3KADA 2PI6A 2XP7A 1GPFA 2AOSA 1J4RA 4P8UA 1JNEA 2RURA 3WD1A 4QZVB 2PPPA 2A3CA 4DWSC 4ZS6A 4MTVA 2FDMA 2ETNA 5HKGA 1D6OA 4ODKA 4Z2HA 4IPXA 3BMBA 4GGQA 1D7JA 2RUCA 2DG3A 4P8VA 3O5LA 5HW8A 1LG2A 1JCHB 1A7XA 2XP4A 1QZ2A 3W4RA 2O92A 1FJDA 1ZB5A 1NSGA 1F8AB 2RSEA 4TW8A 2KFWA 4MNMA 2ZR5A 5DEZA 2PV2A 2D9FA 4LGXA 3WD4A 2IUZA 2F23A 4HBEA 4JFMA 4JFKA 1HJWA 1Y0OA 5DIVA 2G41A 4XAKA 1FD9A 2XP9A 4U85A 3PA7A 3WL1A 2DG9A 1M5YA 2Y78A 1XHGA 3KAFA 3ARTA 3H9RB 3RM8A
chains in the Genus database with same CATH topology
3JXVA 3ARWA 3RGCA 3WD3A 1W1TA 4W9PA 3CH9A 1OGBA 1LL7A 1HKMA 3KCEA 4DIPA 3GPKA 4IQCA 3WIJA 1SYTA 3NRKA 2DT0A 4FN2A 2VN1A 4DWSD 4Z2IA 3NTPA 4URIA 1P5QA 3PRBA 1Q6UA 2UZ5A 3KAIA 5HWCA 2KE0A 3MDYB 1SR0A 5HTGA 1KFWA 1D2KA 1LQ0A 3PRAA 2JZVA 1Q6HA 4DT4A 5DO2A 1IX5A 2M1IA 2PV1A 1KT1A 4BF8A 4ODRA 1RD6A 1W26A 1OWQA 2XP3A 2MPHA 3UQBA 4ODLA 3WD2A 1WNOA 2RUDA 4WJXA 2A3EA 4DRHA 1FFQA 3RM9A 1FKLA 3IKGA 4LAVA 3UI4A 3IKDA 3B9DA 4S3JA 1Q1CA 2ZQVA 4Z2LA 1CTNA 2DSUA 3CHDA 1ITXA 1H0GA 1B6CA 1JVWA 3O5IA 3ARRA 4MPKA 2DPEA 5HUAA 3O5EA 3O5GA 4Q22A 3KAHA 2LPVA 2F2DA 2IF4A 2VCDA 3UQIA 4ODMA 1PINA 1FKHA 1ZBKA 1NWUA 1D7IA 1EHNA 1UR8A 1OGGA 4NZCA 5GPGA 3ALGA 3JYJA 2ESCA 3CZ8A 4R5EA 3WH0A 3AS0A 2QF8A 3G6MA 3FY1A 3ARZA 4R0XA 4IT6A 2XP6A 3G6LA 2XP8A 4ZPTR 5HW6A 4MNLA 1HKJA 4MSPA 2ZQUA 4GIVA 2RQSA 3WL0A 1TFVA 1HXVA 4NNRA 3UF8A 2OLHA 1FFRA 1R9HA 1E6NA 4G2PA 2MLYA 1J4IA 1W1VA 4TW6A 4W9QA 4DWSA 3FXYA 4DRPA 5GPRA 1VF8A 4Q7NA 2B31A 3AS1A 4ZPVR 3UI6A 4Z2JA 4MNKA 4P8WA 1EYMA 3O5KA 4DRJA 4DH0A 2PBCA 3O5RA 1GUVA 2F4EA 2OFNA 4L3NA 1NH6A 5I98A 3UQAA 1D7HA 1W9PA 2DT1A 1E6PA 1YW5A 3ARUA 3O5FA 1C9HA 1FKDA 4DZ3A 2YBTA 1T11A 4MAVA 2F21A 1W1PA 1UR9A 4ZPWR 4G50A 1FAPA 5BXJA 2MNTA 4J4OA 4DRMA 2ZR6A 2DG4A 4ODOA 3VAWA 4W5UA 4LAXA 5HBFA 1LL4A 1FKTA 4ML4A 4C02B 1W9UA 3CHFA 1ZBCA 5B8IC 1FKGA 4FAPA 1FKFA 3TC5A 4TYOA 3O5JA 3JYMA 1O6IA 1XRVA 3CGNA 3OA5A 2RUQA 2WLZA 3KZ7A 2ZQTA 1NWTA 3AROA 3KABA 2FKEA 4U84A 1X6NA 3B9AA 1LG1A 1FKSA 1BL4A 3AS2A 1F40A 1J6YA 1GOIA 3ARQA 1J4HA 4DROA 3I6CA 4DWSB 1L1PA 4Z2KA 1ZBWA 4JFIA 2KI3A 4U86A 4DRNA 3NI6A 3QOKA 4DRIA 1ZBVA 2XPAA 4DRKA 1BKFA 3PR9A 4DZ2A 4IQ2A 1JNSA 4KQZA 1JNTA 3B8SA 1NMWA 3AQUA 4WKFA 2PV3A 4QT3A 1HKIA 1W1YA 3OOBA 1YATA 2O9OA 3TDBA 4NSBA 1W9VA 3KAGA 1FKJA 4ODQA 3RMEA 3B7XA 1EIBA 4IT4A 2LGOA 5DITA 1TCOC 4PTMA 1ZK6A 1X6LA 4ITZA 2Q5AA 2LKNA 3WQVA 2DSZA 1E6RA 1NMVA 2KGJA 2LJ4A 3O5PA 4ODNA 3O5MA 2N87A 5DF0A 4TW7A 2PPNA 4WK9A 3O5QA 4JYSA 4WIWA 1HKKA 3IHZA 1U79A 4AY1A 1FKKA 4L72B 1QPFA 4QT2A 2ZQSA 3ARSA 2FAPA 3ALFA 4J4NA 2DSWA 2KR7A 4O2TA 2M08A 1JNDA 1NWSA 1ZL1A 2YBUA 1E15A 1FKBA 3WKZA 1FKIA 4P8XA 3O5DA 1EDQA 2XP5A 4TX0A 1LL6A 4S3KA 4HARA 2MLXA 2PPOA 4LAYA 3ARVA 5D75A 2DT2A 3TCZA 4QIBA 1HJXA 2MF9A 1Q6IA 2ITKA 5GQBA 2ZR4A 3WD0A 4MNJA 3UI5A 3CHEA 2L2SA 3BXWA 1QPLA 1K9TA 3WQWA 2A3BA 2DSVA 3KACA 1N1AA 4WKHA 5HW7A 3ODKA 1ROUA 4TNSA 4LAWA 2WM0A 4Z2GA 4WKAA 1E6ZA 1H0IA 2A3AA 1ROTA 1E9LA 2XPBA 2MLZA 4MGVA 3IK8A 2WK2A 4HBOA 3RM4A 5J6EA 1WAWA 2WLYA 2AWGA 3ARYA 1EQ3A 2G8ZA 1FKRA 5DIUA 4N19A 3RFWA 4W9OA 4KR0B 5HWBA 5HT1A 3FAPA 1KT0A 3ARXA 1HJVA 3PRDA 1WB0A 3CGMA 1ZCNA 2M2AA 3LUOA 4JFJA 1NWRA 3B9EA 3AS3A 2KO7A 1PBKA 2K8IA 3CHCA 1ZU8A 2DT3A 3O5OA 4JFLA 5JH8A 3EY6A 4ODPA 3ARPA 4DRQA 1LJYA 3KADA 2PI6A 2XP7A 1GPFA 2AOSA 1J4RA 4P8UA 1JNEA 2RURA 3WD1A 4QZVB 2PPPA 2A3CA 4DWSC 4ZS6A 4MTVA 2FDMA 5HKGA 1D6OA 4ODKA 4Z2HA 4IPXA 4GGQA 1D7JA 2RUCA 2DG3A 4P8VA 3O5LA 5HW8A 1LG2A 1A7XA 2XP4A 1QZ2A 3W4RA 2O92A 1FJDA 1ZB5A 1NSGA 1F8AB 2RSEA 4TW8A 2KFWA 4MNMA 2ZR5A 5DEZA 2PV2A 2D9FA 4LGXA 3WD4A 2IUZA 4HBEA 4JFMA 4JFKA 1HJWA 1Y0OA 5DIVA 2G41A 4XAKA 1FD9A 2XP9A 4U85A 3PA7A 3WL1A 2DG9A 1M5YA 2Y78A 1XHGA 3KAFA 3ARTA 3H9RB 3RM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPA A;  5HW6 A;  3JXV A;  1BKF A;  4DRK A;  3RGC A;  4DZ2 A;  4IQ2 A;  1JNS A;  1ROT A;  4MSP A;  1JNT A;  2ZQU A;  2RQS A;  4GIV A;  2XPB A;  1NMW A;  2MLZ A;  4MGV A;  1HXV A;  4W9P A;  3IK8 A;  4NNR A;  2PV3 A;  4QT3 A;  3UF8 A;  1R9H A;  3OOB A;  1YAT A;  3KCE A;  3TDB A;  4DIP A;  3GPK A;  4IQC A;  5J6E A;  3KAG A;  1FKJ A;  3NRK A;  4G2P A;  4FN2 A;  2AWG A;  2VN1 A;  1EQ3 A;  2MLY A;  4ODQ A;  3NTP A;  1FKR A;  1J4I A;  1P5Q A;  3PRB A;  4TW6 A;  5DIU A;  3B7X A;  4W9Q A;  1Q6U A;  2LGO A;  5DIT A;  4N19 A;  2UZ5 A;  3KAI A;  3RFW A;  4DRP A;  5HWC A;  1TCO C;  4W9O A;  1ZK6 A;  5HWB A;  5HT1 A;  2KE0 A;  3FAP A;  1KT0 A;  2Q5A A;  2LKN A;  3MDY B;  4ITZ A;  3UI6 A;  5HTG A;  1NMV A;  2KGJ A;  2LJ4 A;  2JZV A;  1EYM A;  1Q6H A;  3O5P A;  3O5K A;  3PRD A;  4DRJ A;  3CGM A;  4DT4 A;  4DH0 A;  2M1I A;  4ODN A;  3O5M A;  2PBC A;  2PV1 A;  1ZCN A;  2M2A A;  3LUO A;  4JFJ A;  1KT1 A;  3O5R A;  2F4E A;  2OFN A;  4BF8 A;  2KO7 A;  1PBK A;  4ODR A;  5I98 A;  3UQA A;  2K8I A;  1W26 A;  2N87 A;  2XP3 A;  1D7H A;  3O5O A;  2MPH A;  2PPN A;  4TW7 A;  1YW5 A;  4JFL A;  3O5F A;  3EY6 A;  1C9H A;  3UQB A;  1FKD A;  4ODL A;  2RUD A;  4ODP A;  4DZ3 A;  1T11 A;  2F21 A;  4DRQ A;  3KAD A;  3O5Q A;  4JYS A;  2XP7 A;  4G50 A;  1FAP A;  5BXJ A;  2MNT A;  4DRH A;  1J4R A;  3IHZ A;  4J4O A;  4DRM A;  1U79 A;  2DG4 A;  2ZR6 A;  4ODO A;  3VAW A;  1FKL A;  1FKK A;  2RUR A;  3IKG A;  4LAV A;  4LAX A;  1QPF A;  3IKD A;  4QT2 A;  3UI4 A;  1Q1C A;  1FKT A;  2PPP A;  2ZQS A;  2FAP A;  2ZQV A;  4J4N A;  4C02 B;  5HKG A;  2KR7 A;  4O2T A;  1D6O A;  2M08 A;  4ODK A;  1B6C A;  1JVW A;  3O5I A;  5B8I C;  4IPX A;  4GGQ A;  1FKG A;  1D7J A;  4FAP A;  1FKF A;  2RUC A;  1FKB A;  2DG3 A;  3TC5 A;  4TYO A;  5HUA A;  3O5L A;  5HW8 A;  3O5J A;  1FKI A;  3JYM A;  3O5E A;  3O5D A;  2XP5 A;  3CGN A;  3KAH A;  3O5G A;  1A7X A;  2XP4 A;  4TX0 A;  2LPV A;  2F2D A;  2RUQ A;  2IF4 A;  1QZ2 A;  2MLX A;  2PPO A;  2VCD A;  4LAY A;  1FJD A;  3KZ7 A;  2ZQT A;  1NSG A;  1F8A B;  2RSE A;  4TW8 A;  2KFW A;  4QIB A;  2ZR5 A;  5D75 A;  3KAB A;  3TCZ A;  3UQI A;  4ODM A;  2MF9 A;  1Q6I A;  1PIN A;  2D9F A;  1FKH A;  2FKE A;  2PV2 A;  4U84 A;  2ITK A;  1D7I A;  1FKS A;  2ZR4 A;  1BL4 A;  1F40 A;  1J6Y A;  3UI5 A;  5GPG A;  2L2S A;  3JYJ A;  1J4H A;  1QPL A;  4DRO A;  4JFM A;  4JFK A;  3I6C A;  1Y0O A;  5DIV A;  3WH0 A;  1FD9 A;  2XP9 A;  4U85 A;  3KAC A;  1L1P A;  3PA7 A;  2DG9 A;  1M5Y A;  1N1A A;  2Y78 A;  4JFI A;  5HW7 A;  3KAF A;  4R0X A;  3ODK A;  1ROU A;  2KI3 A;  2XP6 A;  4U86 A;  2XP8 A;  4DRN A;  4TNS A;  3NI6 A;  4LAW A;  3H9R B;  4DRI A; 
#chains in the Genus database with same CATH topology
 3JXV A;  3ARW A;  3RGC A;  3WD3 A;  1W1T A;  4W9P A;  3CH9 A;  1OGB A;  1LL7 A;  1HKM A;  2PN0 A;  3KCE A;  4DIP A;  3GPK A;  4IQC A;  3WIJ A;  1SYT A;  3NRK A;  2DT0 A;  4FN2 A;  2VN1 A;  4DWS D;  4Z2I A;  3NTP A;  4URI A;  1P5Q A;  3PRB A;  1Q6U A;  2UZ5 A;  3KAI A;  5HWC A;  2KE0 A;  3MDY B;  1SR0 A;  5HTG A;  1KFW A;  1D2K A;  1LQ0 A;  3PRA A;  2JZV A;  1Q6H A;  4DT4 A;  5DO2 A;  1IX5 A;  2M1I A;  2PV1 A;  1KT1 A;  4BF8 A;  4ODR A;  1RD6 A;  1W26 A;  1OWQ A;  2XP3 A;  2MPH A;  3UQB A;  4ODL A;  3WD2 A;  1WNO A;  2RUD A;  4WJX A;  2A3E A;  4DRH A;  1FFQ A;  3RM9 A;  1FKL A;  3IKG A;  4LAV A;  3UI4 A;  3IKD A;  3B9D A;  4S3J A;  1Q1C A;  2ZQV A;  4Z2L A;  1CTN A;  2DSU A;  3CHD A;  1ITX A;  1H0G A;  1E44 A;  1B6C A;  1JVW A;  3O5I A;  3ARR A;  4MPK A;  2DPE A;  5HUA A;  3O5E A;  3O5G A;  4Q22 A;  3KAH A;  2LPV A;  2F2D A;  2IF4 A;  2VCD A;  3UQI A;  4ODM A;  1PIN A;  1FKH A;  1ZBK A;  1NWU A;  1D7I A;  1EHN A;  1UR8 A;  2B5U B;  1OGG A;  4NZC A;  5GPG A;  3ALG A;  3JYJ A;  2ESC A;  3CZ8 A;  4R5E A;  3WH0 A;  3AS0 A;  2QF8 A;  3G6M A;  3FY1 A;  3ARZ A;  4R0X A;  4IT6 A;  2XP6 A;  3G6L A;  2XP8 A;  2EUL A;  4ZPT R;  5HW6 A;  4MNL A;  1HKJ A;  4MSP A;  2ZQU A;  4GIV A;  2RQS A;  3WL0 A;  1TFV A;  1HXV A;  4NNR A;  3UF8 A;  2OLH A;  1FFR A;  1R9H A;  1E6N A;  4G2P A;  2MLY A;  1J4I A;  1W1V A;  4TW6 A;  4W9Q A;  4DWS A;  3FXY A;  4DRP A;  5GPR A;  1VF8 A;  4Q7N A;  2B31 A;  3AS1 A;  4ZPV R;  3UI6 A;  4Z2J A;  4MNK A;  4P8W A;  1EYM A;  3O5K A;  4DRJ A;  4DH0 A;  2PBC A;  3O5R A;  1GUV A;  2F4E A;  2OFN A;  4L3N A;  1NH6 A;  5I98 A;  3UQA A;  1D7H A;  1W9P A;  2DT1 A;  1E6P A;  1YW5 A;  3ARU A;  3O5F A;  1C9H A;  1FKD A;  4DZ3 A;  2YBT A;  1T11 A;  4MAV A;  2F21 A;  1W1P A;  1UR9 A;  4ZPW R;  4G50 A;  1FAP A;  5BXJ A;  2MNT A;  4J4O A;  4DRM A;  2ZR6 A;  2DG4 A;  4ODO A;  3VAW A;  4W5U A;  4LAX A;  5HBF A;  1LL4 A;  1FKT A;  4ML4 A;  4C02 B;  1W9U A;  3CHF A;  1ZBC A;  5B8I C;  1FKG A;  4FAP A;  1FKF A;  3GTY X;  3TC5 A;  4TYO A;  3O5J A;  3JYM A;  1O6I A;  1XRV A;  3CGN A;  3OA5 A;  2RUQ A;  2WLZ A;  3KZ7 A;  2ZQT A;  1NWT A;  3ARO A;  3EIP A;  3KAB A;  2FKE A;  4U84 A;  1X6N A;  3B9A A;  1LG1 A;  1FKS A;  1BL4 A;  3AS2 A;  1F40 A;  1J6Y A;  1GOI A;  3ARQ A;  1J4H A;  4DRO A;  3I6C A;  4DWS B;  1L1P A;  4Z2K A;  1ZBW A;  4JFI A;  2KI3 A;  4U86 A;  4DRN A;  3NI6 A;  3QOK A;  4DRI A;  1ZBV A;  2XPA A;  4DRK A;  1BKF A;  3PR9 A;  4DZ2 A;  4IQ2 A;  1JNS A;  4KQZ A;  1JNT A;  3B8S A;  1NMW A;  3AQU A;  3GU0 A;  4WKF A;  2PV3 A;  4QT3 A;  1HKI A;  1W1Y A;  3OOB A;  1YAT A;  2O9O A;  3TDB A;  4NSB A;  1W9V A;  3KAG A;  1FKJ A;  4UDM A;  4ODQ A;  1GRJ A;  3RME A;  3B7X A;  1EIB A;  4IT4 A;  2LGO A;  5DIT A;  1TCO C;  4PTM A;  1ZK6 A;  1X6L A;  4ITZ A;  2Q5A A;  2LKN A;  3WQV A;  2DSZ A;  1E6R A;  1NMV A;  2KGJ A;  2LJ4 A;  3O5P A;  4ODN A;  3O5M A;  2N87 A;  5DF0 A;  4TW7 A;  2PPN A;  4WK9 A;  3O5Q A;  4JYS A;  4WIW A;  1HKK A;  3IHZ A;  1U79 A;  4AY1 A;  1FKK A;  4L72 B;  1QPF A;  4QT2 A;  2ZQS A;  3ARS A;  2FAP A;  3ALF A;  4J4N A;  2DSW A;  2KR7 A;  4O2T A;  2M08 A;  1JND A;  1NWS A;  1ZL1 A;  2YBU A;  1E15 A;  1FKB A;  3WKZ A;  1FKI A;  4P8X A;  1EDQ A;  3O5D A;  2XP5 A;  4TX0 A;  1LL6 A;  4S3K A;  4HAR A;  2MLX A;  2PPO A;  4LAY A;  3ARV A;  5D75 A;  2DT2 A;  3TCZ A;  4QIB A;  1HJX A;  2MF9 A;  1Q6I A;  2ITK A;  5GQB A;  2ZR4 A;  3WD0 A;  4MNJ A;  3UI5 A;  3CHE A;  2L2S A;  3BXW A;  1QPL A;  1K9T A;  3WQW A;  2A3B A;  2DSV A;  3KAC A;  1N1A A;  4WKH A;  2P4V A;  5HW7 A;  3ODK A;  1ROU A;  4TNS A;  4LAW A;  2WM0 A;  4Z2G A;  4WKA A;  1E6Z A;  1H0I A;  2A3A A;  1ROT A;  1E9L A;  2XPB A;  2MLZ A;  4MGV A;  3IK8 A;  2WK2 A;  4HBO A;  3RM4 A;  5J6E A;  1WAW A;  2WLY A;  2AWG A;  3ARY A;  1EQ3 A;  2G8Z A;  1FKR A;  5DIU A;  4N19 A;  3RFW A;  4W9O A;  4KR0 B;  5HWB A;  5HT1 A;  3FAP A;  1KT0 A;  3ARX A;  1HJV A;  3PRD A;  1WB0 A;  3CGM A;  1ZCN A;  2M2A A;  3LUO A;  4JFJ A;  1NWR A;  3B9E A;  3AS3 A;  2KO7 A;  1PBK A;  2K8I A;  3CHC A;  1ZU8 A;  2DT3 A;  3O5O A;  4JFL A;  5JH8 A;  3EY6 A;  4ODP A;  3ARP A;  4DRQ A;  1LJY A;  3KAD A;  2PI6 A;  2XP7 A;  1GPF A;  2AOS A;  1J4R A;  4P8U A;  1JNE A;  2RUR A;  3WD1 A;  4QZV B;  2PPP A;  2A3C A;  4DWS C;  4ZS6 A;  4MTV A;  2FDM A;  2ETN A;  5HKG A;  1D6O A;  4ODK A;  4Z2H A;  4IPX A;  3BMB A;  4GGQ A;  1D7J A;  2RUC A;  2DG3 A;  4P8V A;  3O5L A;  5HW8 A;  1LG2 A;  1JCH B;  1A7X A;  2XP4 A;  1QZ2 A;  3W4R A;  2O92 A;  1FJD A;  1ZB5 A;  1NSG A;  1F8A B;  2RSE A;  4TW8 A;  2KFW A;  4MNM A;  2ZR5 A;  5DEZ A;  2PV2 A;  2D9F A;  4LGX A;  3WD4 A;  2IUZ A;  2F23 A;  4HBE A;  4JFM A;  4JFK A;  1HJW A;  1Y0O A;  5DIV A;  2G41 A;  4XAK A;  1FD9 A;  2XP9 A;  4U85 A;  3PA7 A;  3WL1 A;  2DG9 A;  1M5Y A;  2Y78 A;  1XHG A;  3KAF A;  3ART A;  3H9R B;  3RM8 A; 
#chains in the Genus database with same CATH homology
 3JXV A;  3ARW A;  3RGC A;  3WD3 A;  1W1T A;  4W9P A;  3CH9 A;  1OGB A;  1LL7 A;  1HKM A;  3KCE A;  4DIP A;  3GPK A;  4IQC A;  3WIJ A;  1SYT A;  3NRK A;  2DT0 A;  4FN2 A;  2VN1 A;  4DWS D;  4Z2I A;  3NTP A;  4URI A;  1P5Q A;  3PRB A;  1Q6U A;  2UZ5 A;  3KAI A;  5HWC A;  2KE0 A;  3MDY B;  1SR0 A;  5HTG A;  1KFW A;  1D2K A;  1LQ0 A;  3PRA A;  2JZV A;  1Q6H A;  4DT4 A;  5DO2 A;  1IX5 A;  2M1I A;  2PV1 A;  1KT1 A;  4BF8 A;  4ODR A;  1RD6 A;  1W26 A;  1OWQ A;  2XP3 A;  2MPH A;  3UQB A;  4ODL A;  3WD2 A;  1WNO A;  2RUD A;  4WJX A;  2A3E A;  4DRH A;  1FFQ A;  3RM9 A;  1FKL A;  3IKG A;  4LAV A;  3UI4 A;  3IKD A;  3B9D A;  4S3J A;  1Q1C A;  2ZQV A;  4Z2L A;  1CTN A;  2DSU A;  3CHD A;  1ITX A;  1H0G A;  1B6C A;  1JVW A;  3O5I A;  3ARR A;  4MPK A;  2DPE A;  5HUA A;  3O5E A;  3O5G A;  4Q22 A;  3KAH A;  2LPV A;  2F2D A;  2IF4 A;  2VCD A;  3UQI A;  4ODM A;  1PIN A;  1FKH A;  1ZBK A;  1NWU A;  1D7I A;  1EHN A;  1UR8 A;  1OGG A;  4NZC A;  5GPG A;  3ALG A;  3JYJ A;  2ESC A;  3CZ8 A;  4R5E A;  3WH0 A;  3AS0 A;  2QF8 A;  3G6M A;  3FY1 A;  3ARZ A;  4R0X A;  4IT6 A;  2XP6 A;  3G6L A;  2XP8 A;  4ZPT R;  5HW6 A;  4MNL A;  1HKJ A;  4MSP A;  2ZQU A;  4GIV A;  2RQS A;  3WL0 A;  1TFV A;  1HXV A;  4NNR A;  3UF8 A;  2OLH A;  1FFR A;  1R9H A;  1E6N A;  4G2P A;  2MLY A;  1J4I A;  1W1V A;  4TW6 A;  4W9Q A;  4DWS A;  3FXY A;  4DRP A;  5GPR A;  1VF8 A;  4Q7N A;  2B31 A;  3AS1 A;  4ZPV R;  3UI6 A;  4Z2J A;  4MNK A;  4P8W A;  1EYM A;  3O5K A;  4DRJ A;  4DH0 A;  2PBC A;  3O5R A;  1GUV A;  2F4E A;  2OFN A;  4L3N A;  1NH6 A;  5I98 A;  3UQA A;  1D7H A;  1W9P A;  2DT1 A;  1E6P A;  1YW5 A;  3ARU A;  3O5F A;  1C9H A;  1FKD A;  4DZ3 A;  2YBT A;  1T11 A;  4MAV A;  2F21 A;  1W1P A;  1UR9 A;  4ZPW R;  4G50 A;  1FAP A;  5BXJ A;  2MNT A;  4J4O A;  4DRM A;  2ZR6 A;  2DG4 A;  4ODO A;  3VAW A;  4W5U A;  4LAX A;  5HBF A;  1LL4 A;  1FKT A;  4ML4 A;  4C02 B;  1W9U A;  3CHF A;  1ZBC A;  5B8I C;  1FKG A;  4FAP A;  1FKF A;  3TC5 A;  4TYO A;  3O5J A;  3JYM A;  1O6I A;  1XRV A;  3CGN A;  3OA5 A;  2RUQ A;  2WLZ A;  3KZ7 A;  2ZQT A;  1NWT A;  3ARO A;  3KAB A;  2FKE A;  4U84 A;  1X6N A;  3B9A A;  1LG1 A;  1FKS A;  1BL4 A;  3AS2 A;  1F40 A;  1J6Y A;  1GOI A;  3ARQ A;  1J4H A;  4DRO A;  3I6C A;  4DWS B;  1L1P A;  4Z2K A;  1ZBW A;  4JFI A;  2KI3 A;  4U86 A;  4DRN A;  3NI6 A;  3QOK A;  4DRI A;  1ZBV A;  2XPA A;  4DRK A;  1BKF A;  3PR9 A;  4DZ2 A;  4IQ2 A;  1JNS A;  4KQZ A;  1JNT A;  3B8S A;  1NMW A;  3AQU A;  4WKF A;  2PV3 A;  4QT3 A;  1HKI A;  1W1Y A;  3OOB A;  1YAT A;  2O9O A;  3TDB A;  4NSB A;  1W9V A;  3KAG A;  1FKJ A;  4ODQ A;  3RME A;  3B7X A;  1EIB A;  4IT4 A;  2LGO A;  5DIT A;  1TCO C;  4PTM A;  1ZK6 A;  1X6L A;  4ITZ A;  2Q5A A;  2LKN A;  3WQV A;  2DSZ A;  1E6R A;  1NMV A;  2KGJ A;  2LJ4 A;  3O5P A;  4ODN A;  3O5M A;  2N87 A;  5DF0 A;  4TW7 A;  2PPN A;  4WK9 A;  3O5Q A;  4JYS A;  4WIW A;  1HKK A;  3IHZ A;  1U79 A;  4AY1 A;  1FKK A;  4L72 B;  1QPF A;  4QT2 A;  2ZQS A;  3ARS A;  2FAP A;  3ALF A;  4J4N A;  2DSW A;  2KR7 A;  4O2T A;  2M08 A;  1JND A;  1NWS A;  1ZL1 A;  2YBU A;  1E15 A;  1FKB A;  3WKZ A;  1FKI A;  4P8X A;  3O5D A;  1EDQ A;  2XP5 A;  4TX0 A;  1LL6 A;  4S3K A;  4HAR A;  2MLX A;  2PPO A;  4LAY A;  3ARV A;  5D75 A;  2DT2 A;  3TCZ A;  4QIB A;  1HJX A;  2MF9 A;  1Q6I A;  2ITK A;  5GQB A;  2ZR4 A;  3WD0 A;  4MNJ A;  3UI5 A;  3CHE A;  2L2S A;  3BXW A;  1QPL A;  1K9T A;  3WQW A;  2A3B A;  2DSV A;  3KAC A;  1N1A A;  4WKH A;  5HW7 A;  3ODK A;  1ROU A;  4TNS A;  4LAW A;  2WM0 A;  4Z2G A;  4WKA A;  1E6Z A;  1H0I A;  2A3A A;  1ROT A;  1E9L A;  2XPB A;  2MLZ A;  4MGV A;  3IK8 A;  2WK2 A;  4HBO A;  3RM4 A;  5J6E A;  1WAW A;  2WLY A;  2AWG A;  3ARY A;  1EQ3 A;  2G8Z A;  1FKR A;  5DIU A;  4N19 A;  3RFW A;  4W9O A;  4KR0 B;  5HWB A;  5HT1 A;  3FAP A;  1KT0 A;  3ARX A;  1HJV A;  3PRD A;  1WB0 A;  3CGM A;  1ZCN A;  2M2A A;  3LUO A;  4JFJ A;  1NWR A;  3B9E A;  3AS3 A;  2KO7 A;  1PBK A;  2K8I A;  3CHC A;  1ZU8 A;  2DT3 A;  3O5O A;  4JFL A;  5JH8 A;  3EY6 A;  4ODP A;  3ARP A;  4DRQ A;  1LJY A;  3KAD A;  2PI6 A;  2XP7 A;  1GPF A;  2AOS A;  1J4R A;  4P8U A;  1JNE A;  2RUR A;  3WD1 A;  4QZV B;  2PPP A;  2A3C A;  4DWS C;  4ZS6 A;  4MTV A;  2FDM A;  5HKG A;  1D6O A;  4ODK A;  4Z2H A;  4IPX A;  4GGQ A;  1D7J A;  2RUC A;  2DG3 A;  4P8V A;  3O5L A;  5HW8 A;  1LG2 A;  1A7X A;  2XP4 A;  1QZ2 A;  3W4R A;  2O92 A;  1FJD A;  1ZB5 A;  1NSG A;  1F8A B;  2RSE A;  4TW8 A;  2KFW A;  4MNM A;  2ZR5 A;  5DEZ A;  2PV2 A;  2D9F A;  4LGX A;  3WD4 A;  2IUZ A;  4HBE A;  4JFM A;  4JFK A;  1HJW A;  1Y0O A;  5DIV A;  2G41 A;  4XAK A;  1FD9 A;  2XP9 A;  4U85 A;  3PA7 A;  3WL1 A;  2DG9 A;  1M5Y A;  2Y78 A;  1XHG A;  3KAF A;  3ART A;  3H9R B;  3RM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...