4ODQA

Structure of slyd delta-if from thermus thermophilus in complex with s3 peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
106
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
total genus 24
structure length 106
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odqA00
5HWBA 4JFMA 2ZR5A 3IKGA 1M5YA 1Y0OA 1TCOC 2KGJA 4O2TA 2FAPA 4ODMA 2ZR6A 3UF8A 5HW8A 2Y78A 4IQ2A 2K8IA 2LPVA 3O5PA 1YATA 1QZ2A 1QPLA 4TW8A 5HW7A 1D7JA 2FKEA 3O5IA 5HWCA 2Q5AA 1NSGA 1Q6HA 3O5FA 2UZ5A 2XPAA 4MSPA 1Q6UA 4W9QA 3UI6A 1ROUA 1BL4A 4TX0A 2RURA 4DRJA 1JVWA 1D7IA 1PBKA 3O5EA 4IQCA 4J4OA 3NRKA 4U85A 4C02B 2ZQTA 1JNTA 4TNSA 1JNSA 2XPBA 3UI4A 4ODRA 1HXVA 1J4IA 3TCZA 2VN1A 4JYSA 2MLXA 4BF8A 1J6YA 3O5OA 4DRNA 1EQ3A 2MPHA 1FKBA 4JFKA 5DITA 3UQBA 4LAVA 1B6CA 2OFNA 5HW6A 1KT1A 2KI3A 1J4HA 1FKFA 4ODNA 3KABA 4GIVA 4DRPA 1Q6IA 4JFLA 3EY6A 1ZK6A 5HTGA 2D9FA 2DG3A 5I98A 1PINA 4TW6A 3CGNA 4JFJA 2XP9A 1Q1CA 2M1IA 3RFWA 2PV2A 3NI6A 4J4NA 2L2SA 4DRQA 4ITZA 1EYMA 2F2DA 2F4EA 2PV3A 4U86A 4DRMA 1FKLA 3UI5A 4DRHA 2KR7A 3O5LA 3KZ7A 2PPOA 2PBCA 3JYMA 3O5QA 1QPFA 5BXJA 4IPXA 4NNRA 1ROTA 1FKJA 3OOBA 1YW5A 4DT4A 4W9OA 2MLZA 2PV1A 2ZQSA 1W26A 1FKRA 2PPNA 2VCDA 4FAPA 2DG4A 2IF4A 3JYJA 3KADA 2MLYA 2F21A 1J4RA 4DZ3A 5HT1A 3IK8A 3O5JA 3TDBA 1FKKA 3FAPA 4R0XA 4QT3A 3O5KA 2XP3A 1FKSA 4LAWA 2XP8A 4LAYA 1L1PA 2ZQUA 1F40A 2RUCA 3IKDA 3JXVA 3PRBA 4DROA 4TW7A 1FKGA 4JFIA 4G50A 4QT2A 1FKDA 3UQIA 4U84A 2KFWA 4FN2A 2XP4A 5DIUA 4G2PA 5GPGA 3MDYB 1FD9A 2N87A 4ODKA 3O5GA 5DIVA 2JZVA 2MF9A 3VAWA 3WH0A 1KT0A 4TYOA 3LUOA 1NMVA 1ZCNA 3GPKA 1A7XA 3KAFA 3O5DA 4GGQA 3UQAA 2M08A 1NMWA 1N1AA 2XP5A 1D6OA 2XP7A 3H9RB 4DIPA 2AWGA 2RQSA 2RSEA 3KACA 1FJDA 4LAXA 1T11A 1R9HA 1P5QA 2LJ4A 3KAIA 3O5RA 4N19A 4DZ2A 2PPPA 2MNTA 4QIBA 4DH0A 3KAGA 4DRKA 2M2AA 3IHZA 3NTPA 4MGVA 2ITKA 3ODKA 1FAPA 5D75A 5J6EA 1D7HA 2RUDA 4ODOA 4ODLA 5B8IC 1FKHA 5HKGA 4W9PA 3B7XA 3PRDA 3CGMA 1F8AB 2KE0A 1BKFA 2DG9A 2XP6A 3KCEA 3TC5A 5HUAA 2LGOA 3I6CA 4ODPA 2RUQA 3RGCA 2LKNA 2ZQVA 1FKTA 2ZR4A 2KO7A 1U79A 3KAHA 4ODQA 3O5MA 3PA7A 1C9HA 4DRIA 1FKIA
chains in the Genus database with same CATH superfamily
4Z2JA 5HWBA 1K9TA 4O2TA 1FJDA 1M5YA 1Y0OA 1TCOC 2WLZA 4ODMA 5HW8A 4PTMA 1D7JA 3FY1A 3AS1A 4IT4A 1UR9A 5DF0A 3WL1A 3RM4A 2ETNA 1ROUA 4NZCA 1BL4A 3PRAA 1GPFA 4TX0A 3O5EA 4L72B 1JNTA 4WK9A 4ODRA 1J4IA 2FDMA 2VN1A 4Q22A 2G41A 4UDMA 1GOIA 4DRNA 4LAVA 2KI3A 4DRPA 3B8SA 3EY6A 2D9FA 4TW6A 3NI6A 4DRMA 2PPOA 1ZBCA 4IPXA 1ROTA 1FKJA 4KQZA 1HKKA 1FKRA 1GUVA 1ITXA 1LG1A 2DG4A 3JYJA 3KADA 4DZ3A 5HT1A 1HJVA 1TFVA 3FAPA 1SR0A 2XP8A 1IX5A 1H0GA 1UR8A 4ZPVR 1F40A 5DEZA 4TW7A 3ARXA 3RM8A 4FN2A 1OGBA 3ARYA 4MNKA 5GPGA 1FD9A 1NMVA 1ZCNA 3O5DA 4Z2GA 3KAFA 3WD1A 1FFQA 1T11A 3KAIA 3O5RA 4DZ2A 2B31A 4N19A 4DRKA 3CHFA 4MGVA 3ODKA 4ODLA 4Q7NA 4L3NA 4HBEA 2F23A 1BKFA 1VF8A 2LGOA 3I6CA 3RGCA 2ZQVA 2KO7A 1U79A 1EIBA 3O5MA 1E9LA 2DSUA 4JFMA 5HW7A 1RD6A 1NWRA 3CH9A 2K8IA 3O5PA 4WIWA 1W1TA 1QZ2A 1QPLA 5HWCA 2FKEA 2YBUA 3O5IA 2UZ5A 4Z2IA 1W1PA 4MSPA 3WIJA 1Q6UA 4W9QA 3UI6A 4DRJA 1D7IA 1PBKA 3WL0A 1EHNA 1D2KA 3BMBA 2ZQTA 4U85A 1JNSA 3B9EA 1W1YA 3ARUA 1J6YA 1FFRA 2MPHA 5DITA 3WD2A 1EQ3A 2AOSA 5HW6A 1WNOA 3AS2A 4ODNA 3KABA 4MNJA 1Q6IA 4AY1A 1NH6A 1XHGA 2O9OA 2PN0A 2DG3A 5GPRA 4JFJA 4DWSA 1W9VA 2M1IA 3RFWA 1E44A 1E6PA 1XRVA 2L2SA 3GTYX 4J4NA 4DRQA 4U86A 1EYMA 3GU0A 2KR7A 3O5LA 3KZ7A 5BXJA 4WKFA 4NNRA 2PI6A 1HKJA 2PV1A 1ZBWA 2IF4A 1LJYA 3IK8A 1EDQA 3RMEA 3ARSA 1HKIA 4LAYA 3PR9A 1L1PA 3JXVA 1OGGA 1FKGA 4Z2LA 3ALFA 3MDYB 3O5GA 2JZVA 1W9PA 1KT0A 2A3AA 4Z2KA 2WLYA 1NMWA 1N1AA 1LL4A 2LJ4A 1CTNA 1LL7A 3KAGA 3WQVA 3ARRA 1D7HA 2RUDA 4W5UA 1FKHA 5HKGA 3CHCA 3WKZA 3CGMA 1SYTA 2DG9A 3AROA 3G6LA 4KR0B 4P8XA 3W4RA 5JH8A 1FKTA 2DSZA 4ODQA 1JNDA 1HJWA 4MNMA 2KGJA 4MPKA 2FAPA 3UF8A 2ZR6A 2Y78A 3FXYA 4IT6A 2LPVA 1YATA 1NSGA 1O6IA 3O5FA 4R5EA 2A3EA 2G8ZA 3AS0A 2RURA 4MAVA 1JVWA 1NWSA 3CZ8A 4TNSA 2WM0A 3ALGA 2A3BA 4HBOA 4JYSA 4BF8A 2DT1A 3O5OA 3ARTA 3UQBA 1J4HA 1FKFA 1JNEA 2ESCA 3WD4A 4GIVA 3ARWA 4QZVB 4JFLA 1W1VA 1ZK6A 5HTGA 1PINA 4MTVA 2XP9A 2QF8A 2PV2A 3CHEA 1HKMA 2DT2A 2F4EA 2PV3A 4ZPTR 1FKLA 3UI5A 4DRHA 3O5QA 1QPFA 2P4VA 1YW5A 2DSWA 4W9OA 2A3CA 1W26A 2PPNA 2VCDA 2MLYA 2F21A 1J4RA 1E6ZA 4ML4A 3G6MA 3O5JA 5DO2A 1WB0A 4R0XA 5HBFA 1FKSA 4LAWA 3ARPA 1HJXA 2ZQUA 2RUCA 3AQUA 3IKDA 1ZBKA 4G50A 1FKDA 3UQIA 4U84A 2XP4A 5DIUA 4G2PA 1X6LA 4ODKA 2N87A 4WKHA 5DIVA 2MF9A 4TYOA 3GPKA 3UQAA 1LG2A 4DWSD 1ZBVA 2DT0A 2XP7A 3H9RB 1D6OA 4DIPA 1NWTA 1R9HA 4QIBA 4DH0A 2DPEA 2B5UB 4WJXA 5D75A 5J6EA 3CHDA 5B8IC 1OWQA 4W9PA 4WKAA 3B7XA 3PRDA 1F8AB 3TC5A 3KCEA 2YBTA 2LKNA 4HARA 2ZR4A 2DSVA 3KAHA 3PA7A 1C9HA 1FKIA 2WK2A 2ZR5A 3IKGA 4IQ2A 1E15A 4DWSC 4LGXA 4TW8A 1JCHB 2Q5AA 1Q6HA 2XPAA 3ARZA 3B9DA 1E6NA 1NWUA 3B9AA 1ZU8A 4J4OA 4IQCA 3WQWA 3EIPA 3NRKA 4C02B 2XPBA 3UI4A 1HXVA 3TCZA 2MLXA 4JFKA 1B6CA 2OFNA 1KT1A 5I98A 3CGNA 4S3JA 1E6RA 1Q1CA 3RM9A 2O92A 1ZL1A 4ITZA 4S3KA 2F2DA 3OA5A 2PBCA 3JYMA 2IUZA 4URIA 5GQBA 4P8UA 3OOBA 1WAWA 4DT4A 2MLZA 3WD0A 2ZQSA 4FAPA 4ZS6A 4XAKA 1ZB5A 3TDBA 1FKKA 3AS3A 4QT3A 3O5KA 1KFWA 2XP3A 1H0IA 4ZPWR 3QOKA 3PRBA 4DROA 4JFIA 1GRJA 2DT3A 4QT2A 3WD3A 2KFWA 3VAWA 3WH0A 3LUOA 1A7XA 4GGQA 1W9UA 4NSBA 2M08A 2XP5A 3ARQA 2AWGA 2RQSA 2RSEA 3KACA 4LAXA 1P5QA 1X6NA 2PPPA 2MNTA 2M2AA 3IHZA 3NTPA 2ITKA 1FAPA 4ODOA 4P8VA 4MNLA 3BXWA 2EULA 1LL6A 2KE0A 3ARVA 5HUAA 2XP6A 4ODPA 2RUQA 1LQ0A 2OLHA 4DWSB 4P8WA 4Z2HA 4DRIA 1FKBA
chains in the Genus database with same CATH topology
4Z2JA 5HWBA 1K9TA 4O2TA 1FJDA 1M5YA 1Y0OA 1TCOC 2WLZA 4ODMA 5HW8A 4PTMA 1D7JA 3FY1A 3AS1A 4IT4A 1UR9A 5DF0A 3WL1A 3RM4A 4NZCA 1ROUA 1BL4A 3PRAA 1GPFA 4TX0A 3O5EA 4L72B 1JNTA 4WK9A 4ODRA 1J4IA 2FDMA 2VN1A 4Q22A 2G41A 4DRNA 1GOIA 4LAVA 2KI3A 4DRPA 3B8SA 3EY6A 2D9FA 4TW6A 3NI6A 4DRMA 2PPOA 1ZBCA 4IPXA 1ROTA 1FKJA 4KQZA 1HKKA 1FKRA 1GUVA 1ITXA 1LG1A 2DG4A 3JYJA 3KADA 4DZ3A 5HT1A 1HJVA 1TFVA 3FAPA 1SR0A 2XP8A 1IX5A 1H0GA 1UR8A 4ZPVR 1F40A 5DEZA 4TW7A 3ARXA 3RM8A 4FN2A 1OGBA 3ARYA 4MNKA 5GPGA 1FD9A 1NMVA 1ZCNA 3O5DA 4Z2GA 3KAFA 3WD1A 1FFQA 1T11A 3KAIA 3O5RA 4DZ2A 2B31A 4N19A 4DRKA 3CHFA 4MGVA 3ODKA 4ODLA 4Q7NA 4L3NA 4HBEA 1BKFA 1VF8A 2LGOA 3I6CA 3RGCA 2ZQVA 2KO7A 1U79A 1EIBA 3O5MA 1E9LA 2DSUA 4JFMA 5HW7A 1RD6A 1NWRA 3CH9A 2K8IA 3O5PA 4WIWA 1W1TA 1QZ2A 1QPLA 5HWCA 2FKEA 2YBUA 3O5IA 2UZ5A 4Z2IA 1W1PA 4MSPA 3WIJA 1Q6UA 4W9QA 3UI6A 4DRJA 1D7IA 1PBKA 3WL0A 1EHNA 1D2KA 4U85A 2ZQTA 1JNSA 3B9EA 1W1YA 3ARUA 1J6YA 1FFRA 2MPHA 5DITA 3WD2A 1EQ3A 2AOSA 5HW6A 1WNOA 3AS2A 4ODNA 3KABA 4MNJA 1Q6IA 4AY1A 1NH6A 1XHGA 2O9OA 2DG3A 5GPRA 4JFJA 4DWSA 1W9VA 2M1IA 3RFWA 4J4NA 1E6PA 1XRVA 2L2SA 4DRQA 4U86A 1EYMA 2KR7A 3O5LA 3KZ7A 5BXJA 4WKFA 4NNRA 2PI6A 1HKJA 2PV1A 1ZBWA 2IF4A 1LJYA 3IK8A 1EDQA 3RMEA 3ARSA 1HKIA 4LAYA 3PR9A 1L1PA 3JXVA 1OGGA 1FKGA 4Z2LA 3ALFA 3MDYB 3O5GA 2JZVA 1W9PA 1KT0A 2A3AA 4Z2KA 2WLYA 1NMWA 1N1AA 1LL4A 2LJ4A 1CTNA 1LL7A 3KAGA 3WQVA 3ARRA 1D7HA 2RUDA 4W5UA 1FKHA 5HKGA 3CHCA 3WKZA 3CGMA 1SYTA 2DG9A 3AROA 3G6LA 4KR0B 4P8XA 3W4RA 5JH8A 1FKTA 2DSZA 4ODQA 1JNDA 1HJWA 4MNMA 2KGJA 4MPKA 2FAPA 3UF8A 2ZR6A 2Y78A 3FXYA 4IT6A 2LPVA 1YATA 1NSGA 1O6IA 3O5FA 4R5EA 2A3EA 2G8ZA 3AS0A 2RURA 4MAVA 1JVWA 1NWSA 3CZ8A 4TNSA 2WM0A 3ALGA 2A3BA 4HBOA 4JYSA 4BF8A 2DT1A 3O5OA 3ARTA 3UQBA 1J4HA 1FKFA 1JNEA 2ESCA 3WD4A 4GIVA 3ARWA 4QZVB 4JFLA 1W1VA 1ZK6A 5HTGA 1PINA 4MTVA 2XP9A 2QF8A 2PV2A 3CHEA 1HKMA 2DT2A 2F4EA 2PV3A 4ZPTR 1FKLA 3UI5A 4DRHA 3O5QA 1QPFA 1YW5A 2DSWA 4W9OA 2A3CA 1W26A 2PPNA 2VCDA 2MLYA 2F21A 1J4RA 1E6ZA 4ML4A 3G6MA 3O5JA 5DO2A 1WB0A 4R0XA 5HBFA 1FKSA 4LAWA 3ARPA 1HJXA 2ZQUA 2RUCA 3AQUA 3IKDA 1ZBKA 4G50A 1FKDA 3UQIA 4U84A 2XP4A 5DIUA 4G2PA 1X6LA 4ODKA 2N87A 4WKHA 5DIVA 2MF9A 4TYOA 3GPKA 3UQAA 1LG2A 4DWSD 1ZBVA 2DT0A 2XP7A 3H9RB 1D6OA 4DIPA 1NWTA 1R9HA 4QIBA 4DH0A 2DPEA 4WJXA 5D75A 5J6EA 3CHDA 5B8IC 1OWQA 4W9PA 4WKAA 3B7XA 3PRDA 1F8AB 3TC5A 3KCEA 2YBTA 2LKNA 4HARA 2ZR4A 2DSVA 3KAHA 3PA7A 1C9HA 1FKIA 2WK2A 2ZR5A 3IKGA 4IQ2A 1E15A 4DWSC 4LGXA 4TW8A 2Q5AA 1Q6HA 2XPAA 3ARZA 3B9DA 1E6NA 1NWUA 3B9AA 1ZU8A 4J4OA 4IQCA 3WQWA 3NRKA 4C02B 2XPBA 3UI4A 1HXVA 3TCZA 2MLXA 4JFKA 1B6CA 2OFNA 1KT1A 5I98A 3CGNA 4S3JA 1E6RA 1Q1CA 3RM9A 2O92A 1ZL1A 4ITZA 4S3KA 2F2DA 3OA5A 2PBCA 3JYMA 2IUZA 4URIA 5GQBA 4P8UA 3OOBA 1WAWA 4DT4A 2MLZA 3WD0A 2ZQSA 4FAPA 4ZS6A 4XAKA 1ZB5A 3TDBA 1FKKA 3AS3A 4QT3A 3O5KA 1KFWA 2XP3A 1H0IA 4ZPWR 3QOKA 3PRBA 4DROA 4JFIA 2DT3A 4QT2A 3WD3A 2KFWA 3VAWA 3WH0A 3LUOA 1A7XA 4GGQA 1W9UA 4NSBA 2M08A 2XP5A 3ARQA 2AWGA 2RQSA 2RSEA 3KACA 4LAXA 1P5QA 1X6NA 2PPPA 2MNTA 2M2AA 3IHZA 3NTPA 2ITKA 1FAPA 4ODOA 4P8VA 4MNLA 3BXWA 1LL6A 2KE0A 3ARVA 5HUAA 2XP6A 4ODPA 2RUQA 1LQ0A 2OLHA 4DWSB 4P8WA 4Z2HA 4DRIA 1FKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWB A;  4JFM A;  2ZR5 A;  3IKG A;  1M5Y A;  1Y0O A;  1TCO C;  2KGJ A;  4O2T A;  2FAP A;  4ODM A;  2ZR6 A;  3UF8 A;  5HW8 A;  2Y78 A;  4IQ2 A;  2K8I A;  2LPV A;  3O5P A;  1YAT A;  1QZ2 A;  1QPL A;  4TW8 A;  5HW7 A;  1D7J A;  2FKE A;  3O5I A;  5HWC A;  2Q5A A;  1NSG A;  1Q6H A;  3O5F A;  2UZ5 A;  2XPA A;  4MSP A;  1Q6U A;  4W9Q A;  3UI6 A;  1ROU A;  1BL4 A;  4TX0 A;  2RUR A;  4DRJ A;  1JVW A;  1D7I A;  1PBK A;  3O5E A;  4IQC A;  4J4O A;  3NRK A;  4U85 A;  4C02 B;  2ZQT A;  1JNT A;  4TNS A;  1JNS A;  2XPB A;  3UI4 A;  4ODR A;  1HXV A;  1J4I A;  3TCZ A;  2VN1 A;  4JYS A;  2MLX A;  4BF8 A;  1J6Y A;  3O5O A;  4DRN A;  1EQ3 A;  2MPH A;  1FKB A;  4JFK A;  5DIT A;  3UQB A;  4LAV A;  1B6C A;  2OFN A;  5HW6 A;  1KT1 A;  2KI3 A;  1J4H A;  1FKF A;  4ODN A;  3KAB A;  4GIV A;  4DRP A;  1Q6I A;  4JFL A;  3EY6 A;  1ZK6 A;  5HTG A;  2D9F A;  2DG3 A;  5I98 A;  1PIN A;  4TW6 A;  3CGN A;  4JFJ A;  2XP9 A;  1Q1C A;  2M1I A;  3RFW A;  2PV2 A;  3NI6 A;  4J4N A;  2L2S A;  4DRQ A;  4ITZ A;  1EYM A;  2F2D A;  2F4E A;  2PV3 A;  4U86 A;  4DRM A;  1FKL A;  3UI5 A;  4DRH A;  2KR7 A;  3O5L A;  3KZ7 A;  2PPO A;  2PBC A;  3JYM A;  3O5Q A;  1QPF A;  5BXJ A;  4IPX A;  4NNR A;  1ROT A;  1FKJ A;  3OOB A;  1YW5 A;  4DT4 A;  4W9O A;  2MLZ A;  2PV1 A;  2ZQS A;  1W26 A;  1FKR A;  2PPN A;  2VCD A;  4FAP A;  2DG4 A;  2IF4 A;  3JYJ A;  3KAD A;  2MLY A;  2F21 A;  1J4R A;  4DZ3 A;  5HT1 A;  3IK8 A;  3O5J A;  3TDB A;  1FKK A;  3FAP A;  4R0X A;  4QT3 A;  3O5K A;  2XP3 A;  1FKS A;  4LAW A;  2XP8 A;  4LAY A;  1L1P A;  2ZQU A;  1F40 A;  2RUC A;  3IKD A;  3JXV A;  3PRB A;  4DRO A;  4TW7 A;  1FKG A;  4JFI A;  4G50 A;  4QT2 A;  1FKD A;  3UQI A;  4U84 A;  2KFW A;  4FN2 A;  2XP4 A;  5DIU A;  4G2P A;  5GPG A;  3MDY B;  1FD9 A;  2N87 A;  4ODK A;  3O5G A;  5DIV A;  2JZV A;  2MF9 A;  3VAW A;  3WH0 A;  1KT0 A;  4TYO A;  3LUO A;  1NMV A;  1ZCN A;  3GPK A;  1A7X A;  3KAF A;  3O5D A;  4GGQ A;  3UQA A;  2M08 A;  1NMW A;  1N1A A;  2XP5 A;  1D6O A;  2XP7 A;  3H9R B;  4DIP A;  2AWG A;  2RQS A;  2RSE A;  3KAC A;  1FJD A;  4LAX A;  1T11 A;  1R9H A;  1P5Q A;  2LJ4 A;  3KAI A;  3O5R A;  4N19 A;  4DZ2 A;  2PPP A;  2MNT A;  4QIB A;  4DH0 A;  3KAG A;  4DRK A;  2M2A A;  3IHZ A;  3NTP A;  4MGV A;  2ITK A;  3ODK A;  1FAP A;  5D75 A;  5J6E A;  1D7H A;  2RUD A;  4ODO A;  4ODL A;  5B8I C;  1FKH A;  5HKG A;  4W9P A;  3B7X A;  3PRD A;  3CGM A;  1F8A B;  2KE0 A;  1BKF A;  2DG9 A;  2XP6 A;  3KCE A;  3TC5 A;  5HUA A;  2LGO A;  3I6C A;  4ODP A;  2RUQ A;  3RGC A;  2LKN A;  2ZQV A;  1FKT A;  2ZR4 A;  2KO7 A;  1U79 A;  3KAH A;  4ODQ A;  3O5M A;  3PA7 A;  1C9H A;  4DRI A;  1FKI A; 
#chains in the Genus database with same CATH topology
 4Z2J A;  5HWB A;  1K9T A;  4O2T A;  1FJD A;  1M5Y A;  1Y0O A;  1TCO C;  2WLZ A;  4ODM A;  5HW8 A;  4PTM A;  1D7J A;  3FY1 A;  3AS1 A;  4IT4 A;  1UR9 A;  5DF0 A;  3WL1 A;  3RM4 A;  2ETN A;  1ROU A;  4NZC A;  1BL4 A;  3PRA A;  1GPF A;  4TX0 A;  3O5E A;  4L72 B;  1JNT A;  4WK9 A;  4ODR A;  1J4I A;  2FDM A;  2VN1 A;  4Q22 A;  2G41 A;  4UDM A;  1GOI A;  4DRN A;  4LAV A;  2KI3 A;  4DRP A;  3B8S A;  3EY6 A;  2D9F A;  4TW6 A;  3NI6 A;  4DRM A;  2PPO A;  1ZBC A;  4IPX A;  1ROT A;  1FKJ A;  4KQZ A;  1HKK A;  1FKR A;  1GUV A;  1ITX A;  1LG1 A;  2DG4 A;  3JYJ A;  3KAD A;  4DZ3 A;  5HT1 A;  1HJV A;  1TFV A;  3FAP A;  1SR0 A;  2XP8 A;  1IX5 A;  1H0G A;  1UR8 A;  4ZPV R;  1F40 A;  5DEZ A;  4TW7 A;  3ARX A;  3RM8 A;  4FN2 A;  1OGB A;  3ARY A;  4MNK A;  5GPG A;  1FD9 A;  1NMV A;  1ZCN A;  3O5D A;  4Z2G A;  3KAF A;  3WD1 A;  1FFQ A;  1T11 A;  3KAI A;  3O5R A;  4DZ2 A;  2B31 A;  4N19 A;  4DRK A;  3CHF A;  4MGV A;  3ODK A;  4ODL A;  4Q7N A;  4L3N A;  4HBE A;  2F23 A;  1BKF A;  1VF8 A;  2LGO A;  3I6C A;  3RGC A;  2ZQV A;  2KO7 A;  1U79 A;  1EIB A;  3O5M A;  1E9L A;  2DSU A;  4JFM A;  5HW7 A;  1RD6 A;  1NWR A;  3CH9 A;  2K8I A;  3O5P A;  4WIW A;  1W1T A;  1QZ2 A;  1QPL A;  5HWC A;  2FKE A;  2YBU A;  3O5I A;  2UZ5 A;  4Z2I A;  1W1P A;  4MSP A;  3WIJ A;  1Q6U A;  4W9Q A;  3UI6 A;  4DRJ A;  1D7I A;  1PBK A;  3WL0 A;  1EHN A;  1D2K A;  3BMB A;  2ZQT A;  4U85 A;  1JNS A;  3B9E A;  1W1Y A;  3ARU A;  1J6Y A;  1FFR A;  2MPH A;  5DIT A;  3WD2 A;  1EQ3 A;  2AOS A;  5HW6 A;  1WNO A;  3AS2 A;  4ODN A;  3KAB A;  4MNJ A;  1Q6I A;  4AY1 A;  1NH6 A;  1XHG A;  2O9O A;  2PN0 A;  2DG3 A;  5GPR A;  4JFJ A;  4DWS A;  1W9V A;  2M1I A;  3RFW A;  1E44 A;  1E6P A;  1XRV A;  2L2S A;  3GTY X;  4J4N A;  4DRQ A;  4U86 A;  1EYM A;  3GU0 A;  2KR7 A;  3O5L A;  3KZ7 A;  5BXJ A;  4WKF A;  4NNR A;  2PI6 A;  1HKJ A;  2PV1 A;  1ZBW A;  2IF4 A;  1LJY A;  3IK8 A;  1EDQ A;  3RME A;  3ARS A;  1HKI A;  4LAY A;  3PR9 A;  1L1P A;  3JXV A;  1OGG A;  1FKG A;  4Z2L A;  3ALF A;  3MDY B;  3O5G A;  2JZV A;  1W9P A;  1KT0 A;  2A3A A;  4Z2K A;  2WLY A;  1NMW A;  1N1A A;  1LL4 A;  2LJ4 A;  1CTN A;  1LL7 A;  3KAG A;  3WQV A;  3ARR A;  1D7H A;  2RUD A;  4W5U A;  1FKH A;  5HKG A;  3CHC A;  3WKZ A;  3CGM A;  1SYT A;  2DG9 A;  3ARO A;  3G6L A;  4KR0 B;  4P8X A;  3W4R A;  5JH8 A;  1FKT A;  2DSZ A;  4ODQ A;  1JND A;  1HJW A;  4MNM A;  2KGJ A;  4MPK A;  2FAP A;  3UF8 A;  2ZR6 A;  2Y78 A;  3FXY A;  4IT6 A;  2LPV A;  1YAT A;  1NSG A;  1O6I A;  3O5F A;  4R5E A;  2A3E A;  2G8Z A;  3AS0 A;  2RUR A;  4MAV A;  1JVW A;  1NWS A;  3CZ8 A;  4TNS A;  2WM0 A;  3ALG A;  2A3B A;  4HBO A;  4JYS A;  4BF8 A;  2DT1 A;  3O5O A;  3ART A;  3UQB A;  1J4H A;  1FKF A;  1JNE A;  2ESC A;  3WD4 A;  4GIV A;  3ARW A;  4QZV B;  4JFL A;  1W1V A;  1ZK6 A;  5HTG A;  1PIN A;  4MTV A;  2XP9 A;  2QF8 A;  2PV2 A;  3CHE A;  1HKM A;  2DT2 A;  2F4E A;  2PV3 A;  4ZPT R;  1FKL A;  3UI5 A;  4DRH A;  3O5Q A;  1QPF A;  2P4V A;  1YW5 A;  2DSW A;  4W9O A;  2A3C A;  1W26 A;  2PPN A;  2VCD A;  2MLY A;  2F21 A;  1J4R A;  1E6Z A;  4ML4 A;  3G6M A;  3O5J A;  5DO2 A;  1WB0 A;  4R0X A;  5HBF A;  1FKS A;  4LAW A;  3ARP A;  1HJX A;  2ZQU A;  2RUC A;  3AQU A;  3IKD A;  1ZBK A;  4G50 A;  1FKD A;  3UQI A;  4U84 A;  2XP4 A;  5DIU A;  4G2P A;  1X6L A;  4ODK A;  2N87 A;  4WKH A;  5DIV A;  2MF9 A;  4TYO A;  3GPK A;  3UQA A;  1LG2 A;  4DWS D;  1ZBV A;  2DT0 A;  2XP7 A;  3H9R B;  1D6O A;  4DIP A;  1NWT A;  1R9H A;  4QIB A;  4DH0 A;  2DPE A;  2B5U B;  4WJX A;  5D75 A;  5J6E A;  3CHD A;  5B8I C;  1OWQ A;  4W9P A;  4WKA A;  3B7X A;  3PRD A;  1F8A B;  3TC5 A;  3KCE A;  2YBT A;  2LKN A;  4HAR A;  2ZR4 A;  2DSV A;  3KAH A;  3PA7 A;  1C9H A;  1FKI A;  2WK2 A;  2ZR5 A;  3IKG A;  4IQ2 A;  1E15 A;  4DWS C;  4LGX A;  4TW8 A;  1JCH B;  2Q5A A;  1Q6H A;  2XPA A;  3ARZ A;  3B9D A;  1E6N A;  1NWU A;  3B9A A;  1ZU8 A;  4J4O A;  4IQC A;  3WQW A;  3EIP A;  3NRK A;  4C02 B;  2XPB A;  3UI4 A;  1HXV A;  3TCZ A;  2MLX A;  4JFK A;  1B6C A;  2OFN A;  1KT1 A;  5I98 A;  3CGN A;  4S3J A;  1E6R A;  1Q1C A;  3RM9 A;  2O92 A;  1ZL1 A;  4ITZ A;  4S3K A;  2F2D A;  3OA5 A;  2PBC A;  3JYM A;  2IUZ A;  4URI A;  5GQB A;  4P8U A;  3OOB A;  1WAW A;  4DT4 A;  2MLZ A;  3WD0 A;  2ZQS A;  4FAP A;  4ZS6 A;  4XAK A;  1ZB5 A;  3TDB A;  1FKK A;  3AS3 A;  4QT3 A;  3O5K A;  1KFW A;  2XP3 A;  1H0I A;  4ZPW R;  3QOK A;  3PRB A;  4DRO A;  4JFI A;  1GRJ A;  2DT3 A;  4QT2 A;  3WD3 A;  2KFW A;  3VAW A;  3WH0 A;  3LUO A;  1A7X A;  4GGQ A;  1W9U A;  4NSB A;  2M08 A;  2XP5 A;  3ARQ A;  2AWG A;  2RQS A;  2RSE A;  3KAC A;  4LAX A;  1P5Q A;  1X6N A;  2PPP A;  2MNT A;  2M2A A;  3IHZ A;  3NTP A;  2ITK A;  1FAP A;  4ODO A;  4P8V A;  4MNL A;  3BXW A;  2EUL A;  1LL6 A;  2KE0 A;  3ARV A;  5HUA A;  2XP6 A;  4ODP A;  2RUQ A;  1LQ0 A;  2OLH A;  4DWS B;  4P8W A;  4Z2H A;  4DRI A;  1FKB A; 
#chains in the Genus database with same CATH homology
 4Z2J A;  5HWB A;  1K9T A;  4O2T A;  1FJD A;  1M5Y A;  1Y0O A;  1TCO C;  2WLZ A;  4ODM A;  5HW8 A;  4PTM A;  1D7J A;  3FY1 A;  3AS1 A;  4IT4 A;  1UR9 A;  5DF0 A;  3WL1 A;  3RM4 A;  4NZC A;  1ROU A;  1BL4 A;  3PRA A;  1GPF A;  4TX0 A;  3O5E A;  4L72 B;  1JNT A;  4WK9 A;  4ODR A;  1J4I A;  2FDM A;  2VN1 A;  4Q22 A;  2G41 A;  4DRN A;  1GOI A;  4LAV A;  2KI3 A;  4DRP A;  3B8S A;  3EY6 A;  2D9F A;  4TW6 A;  3NI6 A;  4DRM A;  2PPO A;  1ZBC A;  4IPX A;  1ROT A;  1FKJ A;  4KQZ A;  1HKK A;  1FKR A;  1GUV A;  1ITX A;  1LG1 A;  2DG4 A;  3JYJ A;  3KAD A;  4DZ3 A;  5HT1 A;  1HJV A;  1TFV A;  3FAP A;  1SR0 A;  2XP8 A;  1IX5 A;  1H0G A;  1UR8 A;  4ZPV R;  1F40 A;  5DEZ A;  4TW7 A;  3ARX A;  3RM8 A;  4FN2 A;  1OGB A;  3ARY A;  4MNK A;  5GPG A;  1FD9 A;  1NMV A;  1ZCN A;  3O5D A;  4Z2G A;  3KAF A;  3WD1 A;  1FFQ A;  1T11 A;  3KAI A;  3O5R A;  4DZ2 A;  2B31 A;  4N19 A;  4DRK A;  3CHF A;  4MGV A;  3ODK A;  4ODL A;  4Q7N A;  4L3N A;  4HBE A;  1BKF A;  1VF8 A;  2LGO A;  3I6C A;  3RGC A;  2ZQV A;  2KO7 A;  1U79 A;  1EIB A;  3O5M A;  1E9L A;  2DSU A;  4JFM A;  5HW7 A;  1RD6 A;  1NWR A;  3CH9 A;  2K8I A;  3O5P A;  4WIW A;  1W1T A;  1QZ2 A;  1QPL A;  5HWC A;  2FKE A;  2YBU A;  3O5I A;  2UZ5 A;  4Z2I A;  1W1P A;  4MSP A;  3WIJ A;  1Q6U A;  4W9Q A;  3UI6 A;  4DRJ A;  1D7I A;  1PBK A;  3WL0 A;  1EHN A;  1D2K A;  4U85 A;  2ZQT A;  1JNS A;  3B9E A;  1W1Y A;  3ARU A;  1J6Y A;  1FFR A;  2MPH A;  5DIT A;  3WD2 A;  1EQ3 A;  2AOS A;  5HW6 A;  1WNO A;  3AS2 A;  4ODN A;  3KAB A;  4MNJ A;  1Q6I A;  4AY1 A;  1NH6 A;  1XHG A;  2O9O A;  2DG3 A;  5GPR A;  4JFJ A;  4DWS A;  1W9V A;  2M1I A;  3RFW A;  4J4N A;  1E6P A;  1XRV A;  2L2S A;  4DRQ A;  4U86 A;  1EYM A;  2KR7 A;  3O5L A;  3KZ7 A;  5BXJ A;  4WKF A;  4NNR A;  2PI6 A;  1HKJ A;  2PV1 A;  1ZBW A;  2IF4 A;  1LJY A;  3IK8 A;  1EDQ A;  3RME A;  3ARS A;  1HKI A;  4LAY A;  3PR9 A;  1L1P A;  3JXV A;  1OGG A;  1FKG A;  4Z2L A;  3ALF A;  3MDY B;  3O5G A;  2JZV A;  1W9P A;  1KT0 A;  2A3A A;  4Z2K A;  2WLY A;  1NMW A;  1N1A A;  1LL4 A;  2LJ4 A;  1CTN A;  1LL7 A;  3KAG A;  3WQV A;  3ARR A;  1D7H A;  2RUD A;  4W5U A;  1FKH A;  5HKG A;  3CHC A;  3WKZ A;  3CGM A;  1SYT A;  2DG9 A;  3ARO A;  3G6L A;  4KR0 B;  4P8X A;  3W4R A;  5JH8 A;  1FKT A;  2DSZ A;  4ODQ A;  1JND A;  1HJW A;  4MNM A;  2KGJ A;  4MPK A;  2FAP A;  3UF8 A;  2ZR6 A;  2Y78 A;  3FXY A;  4IT6 A;  2LPV A;  1YAT A;  1NSG A;  1O6I A;  3O5F A;  4R5E A;  2A3E A;  2G8Z A;  3AS0 A;  2RUR A;  4MAV A;  1JVW A;  1NWS A;  3CZ8 A;  4TNS A;  2WM0 A;  3ALG A;  2A3B A;  4HBO A;  4JYS A;  4BF8 A;  2DT1 A;  3O5O A;  3ART A;  3UQB A;  1J4H A;  1FKF A;  1JNE A;  2ESC A;  3WD4 A;  4GIV A;  3ARW A;  4QZV B;  4JFL A;  1W1V A;  1ZK6 A;  5HTG A;  1PIN A;  4MTV A;  2XP9 A;  2QF8 A;  2PV2 A;  3CHE A;  1HKM A;  2DT2 A;  2F4E A;  2PV3 A;  4ZPT R;  1FKL A;  3UI5 A;  4DRH A;  3O5Q A;  1QPF A;  1YW5 A;  2DSW A;  4W9O A;  2A3C A;  1W26 A;  2PPN A;  2VCD A;  2MLY A;  2F21 A;  1J4R A;  1E6Z A;  4ML4 A;  3G6M A;  3O5J A;  5DO2 A;  1WB0 A;  4R0X A;  5HBF A;  1FKS A;  4LAW A;  3ARP A;  1HJX A;  2ZQU A;  2RUC A;  3AQU A;  3IKD A;  1ZBK A;  4G50 A;  1FKD A;  3UQI A;  4U84 A;  2XP4 A;  5DIU A;  4G2P A;  1X6L A;  4ODK A;  2N87 A;  4WKH A;  5DIV A;  2MF9 A;  4TYO A;  3GPK A;  3UQA A;  1LG2 A;  4DWS D;  1ZBV A;  2DT0 A;  2XP7 A;  3H9R B;  1D6O A;  4DIP A;  1NWT A;  1R9H A;  4QIB A;  4DH0 A;  2DPE A;  4WJX A;  5D75 A;  5J6E A;  3CHD A;  5B8I C;  1OWQ A;  4W9P A;  4WKA A;  3B7X A;  3PRD A;  1F8A B;  3TC5 A;  3KCE A;  2YBT A;  2LKN A;  4HAR A;  2ZR4 A;  2DSV A;  3KAH A;  3PA7 A;  1C9H A;  1FKI A;  2WK2 A;  2ZR5 A;  3IKG A;  4IQ2 A;  1E15 A;  4DWS C;  4LGX A;  4TW8 A;  2Q5A A;  1Q6H A;  2XPA A;  3ARZ A;  3B9D A;  1E6N A;  1NWU A;  3B9A A;  1ZU8 A;  4J4O A;  4IQC A;  3WQW A;  3NRK A;  4C02 B;  2XPB A;  3UI4 A;  1HXV A;  3TCZ A;  2MLX A;  4JFK A;  1B6C A;  2OFN A;  1KT1 A;  5I98 A;  3CGN A;  4S3J A;  1E6R A;  1Q1C A;  3RM9 A;  2O92 A;  1ZL1 A;  4ITZ A;  4S3K A;  2F2D A;  3OA5 A;  2PBC A;  3JYM A;  2IUZ A;  4URI A;  5GQB A;  4P8U A;  3OOB A;  1WAW A;  4DT4 A;  2MLZ A;  3WD0 A;  2ZQS A;  4FAP A;  4ZS6 A;  4XAK A;  1ZB5 A;  3TDB A;  1FKK A;  3AS3 A;  4QT3 A;  3O5K A;  1KFW A;  2XP3 A;  1H0I A;  4ZPW R;  3QOK A;  3PRB A;  4DRO A;  4JFI A;  2DT3 A;  4QT2 A;  3WD3 A;  2KFW A;  3VAW A;  3WH0 A;  3LUO A;  1A7X A;  4GGQ A;  1W9U A;  4NSB A;  2M08 A;  2XP5 A;  3ARQ A;  2AWG A;  2RQS A;  2RSE A;  3KAC A;  4LAX A;  1P5Q A;  1X6N A;  2PPP A;  2MNT A;  2M2A A;  3IHZ A;  3NTP A;  2ITK A;  1FAP A;  4ODO A;  4P8V A;  4MNL A;  3BXW A;  1LL6 A;  2KE0 A;  3ARV A;  5HUA A;  2XP6 A;  4ODP A;  2RUQ A;  1LQ0 A;  2OLH A;  4DWS B;  4P8W A;  4Z2H A;  4DRI A;  1FKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...