4ODQA

Structure of slyd delta-if from thermus thermophilus in complex with s3 peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
106
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
total genus 24
structure length 106
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odqA00
1D7HA 3TDBA 2ZQTA 3KAGA 2D9FA 2RSEA 2MLXA 1J4IA 2F2DA 2OFNA 1ROTA 2RUDA 4W9OA 4TX0A 3UI6A 4DRHA 4MGVA 4U84A 1J4HA 1FD9A 1A7XA 3B7XA 4DRNA 4GIVA 3H9RB 3O5OA 4DROA 1JNTA 3TC5A 3KCEA 1HXVA 2DG9A 2MLZA 2PBCA 4G50A 3O5RA 3KACA 1KT0A 1W26A 4FN2A 4W9PA 2N87A 1FJDA 1D7JA 1D6OA 1PBKA 4DRKA 4DRPA 2XP6A 2IF4A 4TNSA 4J4OA 3TCZA 4DZ2A 2ZQSA 2Q5AA 5HW7A 3KABA 4ODQA 4ODMA 1Q1CA 4GGQA 3O5QA 5DIVA 4W9QA 2MNTA 5D75A 4QIBA 3UI4A 1C9HA 2KFWA 4MSPA 4LAXA 4ODNA 2XPAA 3VAWA 3O5MA 3O5IA 4ODRA 1NSGA 2UZ5A 4IPXA 4DH0A 3UF8A 2F4EA 2M2AA 3PRDA 5GPGA 2PV2A 2RQSA 3ODKA 2LGOA 4FAPA 1JVWA 4TW8A 2XP9A 1FKHA 3IKDA 4TYOA 1FKLA 3KAFA 4LAVA 2XP4A 5I98A 4R0XA 3I6CA 1FAPA 2MLYA 1Q6UA 2XP7A 1P5QA 3RFWA 2ZQVA 5HWBA 2MF9A 3PRBA 1NMVA 1D7IA 4NNRA 1PINA 4ODOA 5B8IC 1Q6IA 1KT1A 1R9HA 1ROUA 2DG3A 1NMWA 2LKNA 3UQAA 4QT2A 1F8AB 1ZK6A 3JYMA 1N1AA 3IKGA 3GPKA 3JXVA 3O5FA 1EQ3A 1QPLA 3KZ7A 1YW5A 1FKTA 2ZR5A 4TW6A 4JFKA 2ZQUA 3FAPA 1T11A 1FKBA 2PPOA 2VN1A 3JYJA 2XP3A 1Y0OA 2FAPA 2PV3A 4DRQA 3UQBA 4LAWA 1FKRA 1EYMA 1FKJA 1QPFA 2LPVA 1Q6HA 4C02B 2PV1A 5HTGA 4JFMA 4U85A 1BKFA 1YATA 4LAYA 2RURA 4G2PA 2K8IA 5HT1A 4BF8A 5HWCA 1F40A 2AWGA 2DG4A 2F21A 3IHZA 3O5JA 2ZR6A 3O5LA 3CGMA 4DRIA 4JFLA 1FKGA 3O5EA 1FKIA 2ZR4A 4DZ3A 3NI6A 2VCDA 3LUOA 4ODPA 1M5YA 5HUAA 3KAIA 3OOBA 2KI3A 1FKSA 3UI5A 2PPNA 4JFJA 1TCOC 3EY6A 3IK8A 3MDYB 1FKFA 4DIPA 1BL4A 2RUQA 3O5KA 5HW8A 2PPPA 1B6CA 1FKKA 4J4NA 3O5DA 5DIUA 5DITA 4DRJA 2FKEA 2MPHA 1J6YA 3PA7A 2KO7A 1ZCNA 2XP5A 4O2TA 2JZVA 2Y78A 4QT3A 2M1IA 2XPBA 2KE0A 3UQIA 1L1PA 2RUCA 3NRKA 1J4RA 2M08A 2XP8A 3KADA 1U79A 4ODKA 5HKGA 1FKDA 2KGJA 2LJ4A 4JFIA 2KR7A 2ITKA 2L2SA 3O5PA 4IQCA 4JYSA 4ODLA 4ITZA 3KAHA 4N19A 4DRMA 4DT4A 4U86A 5HW6A 5J6EA 4IQ2A 3O5GA 4TW7A 5BXJA 3WH0A 1JNSA 3RGCA 3NTPA 3CGNA 1QZ2A
chains in the Genus database with same CATH superfamily
3TDBA 3KAGA 2RUDA 2OFNA 2F2DA 4DWSD 3UI6A 4Z2LA 1J4HA 3CHFA 1OGGA 1GOIA 3H9RB 3B9AA 3O5OA 5DF0A 3BMBA 3TC5A 4P8WA 3GU0A 3CZ8A 4FN2A 4AY1A 1NWTA 1PBKA 4MNMA 2IF4A 4TNSA 4DZ2A 2Q5AA 4ZPVR 3ARPA 5D75A 2WK2A 3RM8A 4IPXA 5DEZA 2F4EA 4HBEA 4P8VA 4TW8A 2XP9A 1FKHA 4Q22A 1WAWA 3KAFA 2YBTA 2XP4A 3BXWA 3RM4A 3FXYA 2MLYA 2ZQVA 3ARTA 3ARYA 2MF9A 1PINA 1R9HA 3CHEA 4QT2A 1F8AB 3JYMA 3GPKA 3JXVA 3G6LA 2ZR5A 4P8UA 4TW6A 1W9PA 2ZQUA 2VN1A 1Y0OA 1FKRA 1FKJA 3W4RA 5HWCA 2K8IA 5GPRA 1FFQA 4HBOA 4LGXA 3WD2A 4WKFA 3O5JA 2ZR6A 1X6LA 3ARWA 1O6IA 2ZR4A 3ARZA 3KAIA 4Z2GA 2KI3A 1LG1A 3UI5A 1HJVA 3IK8A 4DWSB 1LL6A 4J4NA 4NZCA 5DITA 4DRJA 4MNLA 1UR9A 2KO7A 3AS2A 4S3JA 2Y78A 1HKIA 1X6NA 3UQIA 2KE0A 2RUCA 1E9LA 3AS1A 5HKGA 2KGJA 4ODLA 3QOKA 4DT4A 1LJYA 3O5GA 3WKZA 3WH0A 3RGCA 3NTPA 2DPEA 4L72B 1LQ0A 1OWQA 3AS0A 1J4IA 2QF8A 4W9OA 4Q7NA 1W9VA 4GIVA 2F23A 3KCEA 1HXVA 2DG9A 3KACA 2PI6A 4WKHA 1GUVA 4NSBA 4J4OA 4W5UA 2PN0A 2YBUA 5HW7A 3KABA 4ODQA 4Z2JA 2MNTA 3UI4A 2KFWA 4URIA 4ODRA 4DH0A 3PRDA 2IUZA 4S3KA 5GPGA 4QZVB 3WD1A 1FKLA 5I98A 1FAPA 2XP7A 3RFWA 1W1TA 2DG3A 3UQAA 1ZK6A 1N1AA 2DT2A 3O5FA 1FKTA 2G8ZA 1XHGA 4JFKA 1T11A 1FKBA 5HBFA 3OA5A 1SYTA 2PV1A 4JFMA 1BKFA 4LAYA 1OGBA 3CH9A 1UR8A 2AOSA 1JNDA 3WD0A 2EULA 3CGMA 1VF8A 3WL0A 1WNOA 1NWUA 3NI6A 4ODPA 4Z2KA 1FKSA 2PPNA 2A3BA 1HKJA 1FKFA 2A3AA 1E6RA 1RD6A 1W9UA 2ETNA 5DIUA 2MPHA 2O92A 1LG2A 3PA7A 4Z2IA 1ZCNA 1SR0A 2A3CA 2JZVA 3EIPA 1K9TA 2XPBA 3NRKA 1J4RA 2M08A 4ODKA 4Z2HA 1FKDA 2LJ4A 2KR7A 2ITKA 2L2SA 3O5PA 4ITZA 3KAHA 4KQZA 5HW6A 4R5EA 4IQ2A 1JNSA 3PR9A 1W1VA 2D9FA 2RSEA 4TX0A 4ZPWR 1A7XA 3B7XA 2G41A 4DRNA 4DROA 1W1PA 1JNTA 2MLZA 2PBCA 1KT0A 4W9PA 1E44A 1D7JA 4DRKA 3ARSA 4ZPTR 2XP6A 2ZQSA 2DT1A 1HKMA 2FDMA 4DWSC 2ESCA 4P8XA 4WK9A 4MPKA 4QIBA 1C9HA 4ODNA 2XPAA 3AROA 3VAWA 3O5MA 3PRAA 3ARXA 2UZ5A 1EHNA 3WD4A 2M2AA 1LL4A 3IKDA 5JH8A 4LAVA 4R0XA 1D2KA 3B9EA 4MAVA 1Q6UA 1P5QA 4UDMA 5HWBA 3PRBA 1NMVA 1D7IA 4NNRA 4ODOA 5B8IC 1Q6IA 1FFRA 1ROUA 2LKNA 5GQBA 1E6PA 1QPLA 1ZBKA 4KR0B 3AS3A 1NWSA 3FAPA 3JYJA 2XP3A 2FAPA 4LAWA 1EYMA 5HTGA 2LPVA 4L3NA 4U85A 1YATA 1F40A 2RURA 4G2PA 4BF8A 5HT1A 3WD3A 1ZBWA 2AWGA 1HJXA 2O9OA 2DG4A 1KFWA 3ALGA 4DRIA 2B5UB 2WM0A 1FKIA 5HUAA 4MNKA 3OOBA 4WKAA 3WIJA 4PTMA 1ZBCA 2WLZA 3CHCA 4DIPA 3O5KA 2RUQA 1B6CA 1FKKA 1E6NA 1J6YA 1GPFA 3RMEA 4O2TA 4QT3A 2M1IA 3AQUA 2XP8A 1XRVA 4JYSA 1TFVA 3RM9A 4N19A 1ZB5A 4U86A 5J6EA 4IT4A 4TW7A 5BXJA 4MNJA 3CGNA 1D7HA 2ZQTA 2MLXA 4IT6A 4DRHA 1E6ZA 1ROTA 2DSVA 4MGVA 4U84A 1FD9A 2B31A 3GTYX 1W1YA 1ITXA 1CTNA 4G50A 3O5RA 1GRJA 3ARQA 1W26A 2N87A 1FJDA 1D6OA 4DRPA 3TCZA 2DT0A 1HKKA 2P4VA 5DO2A 4ODMA 1Q1CA 4GGQA 1EDQA 3O5QA 5DIVA 4W9QA 4HARA 4MSPA 2DSWA 4LAXA 3O5IA 1WB0A 3ARRA 1H0IA 1NSGA 3UF8A 2PV2A 2RQSA 3ODKA 2LGOA 4FAPA 1JVWA 4TYOA 1HJWA 2A3EA 3I6CA 1NWRA 1ZL1A 2DSZA 1KT1A 1ZU8A 1NMWA 4ML4A 3IKGA 1EQ3A 3KZ7A 1YW5A 1EIBA 4WJXA 2DSUA 2PPOA 4DRQA 2PV3A 3B8SA 1NH6A 3UQBA 1QPFA 4C02B 1Q6HA 2OLHA 3WL1A 2WLYA 2F21A 3WQWA 3IHZA 3ARUA 3WQVA 3ARVA 3ALFA 4ZS6A 3O5LA 4JFLA 1FKGA 3O5EA 1LL7A 4DZ3A 3CHDA 2VCDA 3LUOA 1M5YA 4DWSA 4JFJA 4XAKA 1TCOC 3EY6A 3MDYB 1JNEA 1BL4A 1E15A 5HW8A 2PPPA 3O5DA 3FY1A 2FKEA 2XP5A 1ZBVA 4WIWA 1IX5A 2DT3A 1L1PA 3G6MA 1JCHB 3KADA 1U79A 1H0GA 4JFIA 4IQCA 3B9DA 4DRMA 4MTVA 1QZ2A
chains in the Genus database with same CATH topology
3TDBA 3KAGA 2RUDA 2OFNA 2F2DA 4DWSD 3UI6A 4Z2LA 1J4HA 3CHFA 1OGGA 1GOIA 3H9RB 3B9AA 3O5OA 5DF0A 3TC5A 4P8WA 3CZ8A 4FN2A 4AY1A 1NWTA 1PBKA 4MNMA 2IF4A 4TNSA 4DZ2A 2Q5AA 4ZPVR 3ARPA 5D75A 2WK2A 3RM8A 4IPXA 5DEZA 2F4EA 4HBEA 4P8VA 4TW8A 2XP9A 1FKHA 4Q22A 1WAWA 3KAFA 2YBTA 2XP4A 3BXWA 3RM4A 3FXYA 2MLYA 2ZQVA 3ARTA 3ARYA 2MF9A 1PINA 1R9HA 3CHEA 4QT2A 1F8AB 3JYMA 3GPKA 3JXVA 3G6LA 2ZR5A 4P8UA 4TW6A 1W9PA 2ZQUA 2VN1A 1Y0OA 1FKRA 1FKJA 3W4RA 5HWCA 2K8IA 5GPRA 1FFQA 4HBOA 4LGXA 3WD2A 4WKFA 3O5JA 2ZR6A 1X6LA 3ARWA 1O6IA 2ZR4A 3ARZA 3KAIA 4Z2GA 2KI3A 1LG1A 3UI5A 1HJVA 3IK8A 4DWSB 1LL6A 4J4NA 4NZCA 5DITA 4DRJA 4MNLA 1UR9A 2KO7A 3AS2A 4S3JA 2Y78A 1HKIA 1X6NA 3UQIA 2KE0A 2RUCA 1E9LA 3AS1A 5HKGA 2KGJA 4ODLA 3QOKA 4DT4A 1LJYA 3O5GA 3WKZA 3WH0A 3RGCA 3NTPA 2DPEA 4L72B 1LQ0A 1OWQA 3AS0A 1J4IA 2QF8A 4W9OA 4Q7NA 1W9VA 4GIVA 3KCEA 1HXVA 2DG9A 3KACA 2PI6A 4WKHA 1GUVA 4NSBA 4J4OA 4W5UA 2YBUA 5HW7A 3KABA 4ODQA 4Z2JA 2MNTA 3UI4A 2KFWA 4URIA 4ODRA 4DH0A 3PRDA 2IUZA 4S3KA 5GPGA 4QZVB 3WD1A 1FKLA 5I98A 1FAPA 2XP7A 3RFWA 1W1TA 2DG3A 3UQAA 1ZK6A 1N1AA 2DT2A 3O5FA 1FKTA 2G8ZA 1XHGA 4JFKA 1T11A 1FKBA 5HBFA 3OA5A 1SYTA 2PV1A 4JFMA 1BKFA 4LAYA 1OGBA 3CH9A 1UR8A 2AOSA 1JNDA 3WD0A 3CGMA 1VF8A 3WL0A 1WNOA 1NWUA 3NI6A 4ODPA 4Z2KA 1FKSA 2PPNA 2A3BA 1HKJA 1FKFA 2A3AA 1E6RA 1RD6A 1W9UA 5DIUA 2MPHA 2O92A 1LG2A 3PA7A 4Z2IA 1ZCNA 1SR0A 2A3CA 2JZVA 1K9TA 2XPBA 3NRKA 1J4RA 2M08A 4ODKA 4Z2HA 1FKDA 2LJ4A 2KR7A 2ITKA 2L2SA 3O5PA 4ITZA 3KAHA 4KQZA 5HW6A 4R5EA 4IQ2A 1JNSA 3PR9A 1W1VA 2D9FA 2RSEA 4TX0A 4ZPWR 1A7XA 3B7XA 2G41A 4DRNA 4DROA 1W1PA 1JNTA 2MLZA 2PBCA 1KT0A 4W9PA 1D7JA 4DRKA 3ARSA 4ZPTR 2XP6A 2ZQSA 2DT1A 1HKMA 2FDMA 4DWSC 2ESCA 4P8XA 4WK9A 4MPKA 4QIBA 1C9HA 4ODNA 2XPAA 3AROA 3VAWA 3O5MA 3PRAA 3ARXA 2UZ5A 1EHNA 3WD4A 2M2AA 1LL4A 3IKDA 5JH8A 4LAVA 4R0XA 1D2KA 3B9EA 4MAVA 1Q6UA 1P5QA 5HWBA 3PRBA 1NMVA 1D7IA 4NNRA 4ODOA 5B8IC 1Q6IA 1FFRA 1ROUA 2LKNA 5GQBA 1E6PA 1QPLA 1ZBKA 4KR0B 3AS3A 1NWSA 3FAPA 3JYJA 2XP3A 2FAPA 4LAWA 1EYMA 5HTGA 2LPVA 4L3NA 4U85A 1YATA 1F40A 2RURA 4G2PA 4BF8A 5HT1A 3WD3A 1ZBWA 2AWGA 1HJXA 2O9OA 2DG4A 1KFWA 3ALGA 4DRIA 2WM0A 1FKIA 5HUAA 4MNKA 3OOBA 4WKAA 3WIJA 4PTMA 1ZBCA 2WLZA 3CHCA 4DIPA 3O5KA 2RUQA 1B6CA 1FKKA 1E6NA 1J6YA 1GPFA 3RMEA 4O2TA 4QT3A 2M1IA 3AQUA 2XP8A 1XRVA 4JYSA 1TFVA 3RM9A 4N19A 1ZB5A 4U86A 5J6EA 4IT4A 4TW7A 5BXJA 4MNJA 3CGNA 1D7HA 2ZQTA 2MLXA 4IT6A 4DRHA 1E6ZA 1ROTA 2DSVA 4MGVA 4U84A 1FD9A 2B31A 1W1YA 1ITXA 1CTNA 4G50A 3O5RA 3ARQA 1W26A 2N87A 1FJDA 1D6OA 4DRPA 3TCZA 2DT0A 1HKKA 5DO2A 4ODMA 1Q1CA 4GGQA 1EDQA 3O5QA 5DIVA 4W9QA 4HARA 4MSPA 2DSWA 4LAXA 3O5IA 1WB0A 3ARRA 1H0IA 1NSGA 3UF8A 2PV2A 2RQSA 3ODKA 2LGOA 4FAPA 1JVWA 4TYOA 1HJWA 2A3EA 3I6CA 1NWRA 1ZL1A 2DSZA 1KT1A 1ZU8A 1NMWA 4ML4A 3IKGA 1EQ3A 3KZ7A 1YW5A 1EIBA 4WJXA 2DSUA 2PPOA 4DRQA 2PV3A 3B8SA 1NH6A 3UQBA 1QPFA 4C02B 1Q6HA 2OLHA 3WL1A 2WLYA 2F21A 3WQWA 3IHZA 3ARUA 3WQVA 3ARVA 3ALFA 4ZS6A 3O5LA 4JFLA 1FKGA 3O5EA 1LL7A 4DZ3A 3CHDA 2VCDA 3LUOA 1M5YA 4DWSA 4JFJA 4XAKA 1TCOC 3EY6A 3MDYB 1JNEA 1BL4A 1E15A 5HW8A 2PPPA 3O5DA 3FY1A 2FKEA 2XP5A 1ZBVA 4WIWA 1IX5A 2DT3A 1L1PA 3G6MA 3KADA 1U79A 1H0GA 4JFIA 4IQCA 3B9DA 4DRMA 4MTVA 1QZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7H A;  3TDB A;  2ZQT A;  3KAG A;  2D9F A;  2RSE A;  2MLX A;  1J4I A;  2F2D A;  2OFN A;  1ROT A;  2RUD A;  4W9O A;  4TX0 A;  3UI6 A;  4DRH A;  4MGV A;  4U84 A;  1J4H A;  1FD9 A;  1A7X A;  3B7X A;  4DRN A;  4GIV A;  3H9R B;  3O5O A;  4DRO A;  1JNT A;  3TC5 A;  3KCE A;  1HXV A;  2DG9 A;  2MLZ A;  2PBC A;  4G50 A;  3O5R A;  3KAC A;  1KT0 A;  1W26 A;  4FN2 A;  4W9P A;  2N87 A;  1FJD A;  1D7J A;  1D6O A;  1PBK A;  4DRK A;  4DRP A;  2XP6 A;  2IF4 A;  4TNS A;  4J4O A;  3TCZ A;  4DZ2 A;  2ZQS A;  2Q5A A;  5HW7 A;  3KAB A;  4ODQ A;  4ODM A;  1Q1C A;  4GGQ A;  3O5Q A;  5DIV A;  4W9Q A;  2MNT A;  5D75 A;  4QIB A;  3UI4 A;  1C9H A;  2KFW A;  4MSP A;  4LAX A;  4ODN A;  2XPA A;  3VAW A;  3O5M A;  3O5I A;  4ODR A;  1NSG A;  2UZ5 A;  4IPX A;  4DH0 A;  3UF8 A;  2F4E A;  2M2A A;  3PRD A;  5GPG A;  2PV2 A;  2RQS A;  3ODK A;  2LGO A;  4FAP A;  1JVW A;  4TW8 A;  2XP9 A;  1FKH A;  3IKD A;  4TYO A;  1FKL A;  3KAF A;  4LAV A;  2XP4 A;  5I98 A;  4R0X A;  3I6C A;  1FAP A;  2MLY A;  1Q6U A;  2XP7 A;  1P5Q A;  3RFW A;  2ZQV A;  5HWB A;  2MF9 A;  3PRB A;  1NMV A;  1D7I A;  4NNR A;  1PIN A;  4ODO A;  5B8I C;  1Q6I A;  1KT1 A;  1R9H A;  1ROU A;  2DG3 A;  1NMW A;  2LKN A;  3UQA A;  4QT2 A;  1F8A B;  1ZK6 A;  3JYM A;  1N1A A;  3IKG A;  3GPK A;  3JXV A;  3O5F A;  1EQ3 A;  1QPL A;  3KZ7 A;  1YW5 A;  1FKT A;  2ZR5 A;  4TW6 A;  4JFK A;  2ZQU A;  3FAP A;  1T11 A;  1FKB A;  2PPO A;  2VN1 A;  3JYJ A;  2XP3 A;  1Y0O A;  2FAP A;  2PV3 A;  4DRQ A;  3UQB A;  4LAW A;  1FKR A;  1EYM A;  1FKJ A;  1QPF A;  2LPV A;  1Q6H A;  4C02 B;  2PV1 A;  5HTG A;  4JFM A;  4U85 A;  1BKF A;  1YAT A;  4LAY A;  2RUR A;  4G2P A;  2K8I A;  5HT1 A;  4BF8 A;  5HWC A;  1F40 A;  2AWG A;  2DG4 A;  2F21 A;  3IHZ A;  3O5J A;  2ZR6 A;  3O5L A;  3CGM A;  4DRI A;  4JFL A;  1FKG A;  3O5E A;  1FKI A;  2ZR4 A;  4DZ3 A;  3NI6 A;  2VCD A;  3LUO A;  4ODP A;  1M5Y A;  5HUA A;  3KAI A;  3OOB A;  2KI3 A;  1FKS A;  3UI5 A;  2PPN A;  4JFJ A;  1TCO C;  3EY6 A;  3IK8 A;  3MDY B;  1FKF A;  4DIP A;  1BL4 A;  2RUQ A;  3O5K A;  5HW8 A;  2PPP A;  1B6C A;  1FKK A;  4J4N A;  3O5D A;  5DIU A;  5DIT A;  4DRJ A;  2FKE A;  2MPH A;  1J6Y A;  3PA7 A;  2KO7 A;  1ZCN A;  2XP5 A;  4O2T A;  2JZV A;  2Y78 A;  4QT3 A;  2M1I A;  2XPB A;  2KE0 A;  3UQI A;  1L1P A;  2RUC A;  3NRK A;  1J4R A;  2M08 A;  2XP8 A;  3KAD A;  1U79 A;  4ODK A;  5HKG A;  1FKD A;  2KGJ A;  2LJ4 A;  4JFI A;  2KR7 A;  2ITK A;  2L2S A;  3O5P A;  4IQC A;  4JYS A;  4ODL A;  4ITZ A;  3KAH A;  4N19 A;  4DRM A;  4DT4 A;  4U86 A;  5HW6 A;  5J6E A;  4IQ2 A;  3O5G A;  4TW7 A;  5BXJ A;  3WH0 A;  1JNS A;  3RGC A;  3NTP A;  3CGN A;  1QZ2 A; 
#chains in the Genus database with same CATH topology
 3TDB A;  3KAG A;  2RUD A;  2OFN A;  2F2D A;  4DWS D;  3UI6 A;  4Z2L A;  1J4H A;  3CHF A;  1OGG A;  1GOI A;  3H9R B;  3B9A A;  3O5O A;  5DF0 A;  3BMB A;  3TC5 A;  4P8W A;  3GU0 A;  3CZ8 A;  4FN2 A;  4AY1 A;  1NWT A;  1PBK A;  4MNM A;  2IF4 A;  4TNS A;  4DZ2 A;  2Q5A A;  4ZPV R;  3ARP A;  5D75 A;  2WK2 A;  3RM8 A;  4IPX A;  5DEZ A;  2F4E A;  4HBE A;  4P8V A;  4TW8 A;  2XP9 A;  1FKH A;  4Q22 A;  1WAW A;  3KAF A;  2YBT A;  2XP4 A;  3BXW A;  3RM4 A;  3FXY A;  2MLY A;  2ZQV A;  3ART A;  3ARY A;  2MF9 A;  1PIN A;  1R9H A;  3CHE A;  4QT2 A;  1F8A B;  3JYM A;  3GPK A;  3JXV A;  3G6L A;  2ZR5 A;  4P8U A;  4TW6 A;  1W9P A;  2ZQU A;  2VN1 A;  1Y0O A;  1FKR A;  1FKJ A;  3W4R A;  5HWC A;  2K8I A;  5GPR A;  1FFQ A;  4HBO A;  4LGX A;  3WD2 A;  4WKF A;  3O5J A;  2ZR6 A;  1X6L A;  3ARW A;  1O6I A;  2ZR4 A;  3ARZ A;  3KAI A;  4Z2G A;  2KI3 A;  1LG1 A;  3UI5 A;  1HJV A;  3IK8 A;  4DWS B;  1LL6 A;  4J4N A;  4NZC A;  5DIT A;  4DRJ A;  4MNL A;  1UR9 A;  2KO7 A;  3AS2 A;  4S3J A;  2Y78 A;  1HKI A;  1X6N A;  3UQI A;  2KE0 A;  2RUC A;  1E9L A;  3AS1 A;  5HKG A;  2KGJ A;  4ODL A;  3QOK A;  4DT4 A;  1LJY A;  3O5G A;  3WKZ A;  3WH0 A;  3RGC A;  3NTP A;  2DPE A;  4L72 B;  1LQ0 A;  1OWQ A;  3AS0 A;  1J4I A;  2QF8 A;  4W9O A;  4Q7N A;  1W9V A;  4GIV A;  2F23 A;  3KCE A;  1HXV A;  2DG9 A;  3KAC A;  2PI6 A;  4WKH A;  1GUV A;  4NSB A;  4J4O A;  4W5U A;  2PN0 A;  2YBU A;  5HW7 A;  3KAB A;  4ODQ A;  4Z2J A;  2MNT A;  3UI4 A;  2KFW A;  4URI A;  4ODR A;  4DH0 A;  3PRD A;  2IUZ A;  4S3K A;  5GPG A;  4QZV B;  3WD1 A;  1FKL A;  5I98 A;  1FAP A;  2XP7 A;  3RFW A;  1W1T A;  2DG3 A;  3UQA A;  1ZK6 A;  1N1A A;  2DT2 A;  3O5F A;  1FKT A;  2G8Z A;  1XHG A;  4JFK A;  1T11 A;  1FKB A;  5HBF A;  3OA5 A;  1SYT A;  2PV1 A;  4JFM A;  1BKF A;  4LAY A;  1OGB A;  3CH9 A;  1UR8 A;  2AOS A;  1JND A;  3WD0 A;  2EUL A;  3CGM A;  1VF8 A;  3WL0 A;  1WNO A;  1NWU A;  3NI6 A;  4ODP A;  4Z2K A;  1FKS A;  2PPN A;  2A3B A;  1HKJ A;  1FKF A;  2A3A A;  1E6R A;  1RD6 A;  1W9U A;  2ETN A;  5DIU A;  2MPH A;  2O92 A;  1LG2 A;  3PA7 A;  4Z2I A;  1ZCN A;  1SR0 A;  2A3C A;  2JZV A;  3EIP A;  1K9T A;  2XPB A;  3NRK A;  1J4R A;  2M08 A;  4ODK A;  4Z2H A;  1FKD A;  2LJ4 A;  2KR7 A;  2ITK A;  2L2S A;  3O5P A;  4ITZ A;  3KAH A;  4KQZ A;  5HW6 A;  4R5E A;  4IQ2 A;  1JNS A;  3PR9 A;  1W1V A;  2D9F A;  2RSE A;  4TX0 A;  4ZPW R;  1A7X A;  3B7X A;  2G41 A;  4DRN A;  4DRO A;  1W1P A;  1JNT A;  2MLZ A;  2PBC A;  1KT0 A;  4W9P A;  1E44 A;  1D7J A;  4DRK A;  3ARS A;  4ZPT R;  2XP6 A;  2ZQS A;  2DT1 A;  1HKM A;  2FDM A;  4DWS C;  2ESC A;  4P8X A;  4WK9 A;  4MPK A;  4QIB A;  1C9H A;  4ODN A;  2XPA A;  3ARO A;  3VAW A;  3O5M A;  3PRA A;  3ARX A;  2UZ5 A;  1EHN A;  3WD4 A;  2M2A A;  1LL4 A;  3IKD A;  5JH8 A;  4LAV A;  4R0X A;  1D2K A;  3B9E A;  4MAV A;  1Q6U A;  1P5Q A;  4UDM A;  5HWB A;  3PRB A;  1NMV A;  1D7I A;  4NNR A;  4ODO A;  5B8I C;  1Q6I A;  1FFR A;  1ROU A;  2LKN A;  5GQB A;  1E6P A;  1QPL A;  1ZBK A;  4KR0 B;  3AS3 A;  1NWS A;  3FAP A;  3JYJ A;  2XP3 A;  2FAP A;  4LAW A;  1EYM A;  5HTG A;  2LPV A;  4L3N A;  4U85 A;  1YAT A;  1F40 A;  2RUR A;  4G2P A;  4BF8 A;  5HT1 A;  3WD3 A;  1ZBW A;  2AWG A;  1HJX A;  2O9O A;  2DG4 A;  1KFW A;  3ALG A;  4DRI A;  2B5U B;  2WM0 A;  1FKI A;  5HUA A;  4MNK A;  3OOB A;  4WKA A;  3WIJ A;  4PTM A;  1ZBC A;  2WLZ A;  3CHC A;  4DIP A;  3O5K A;  2RUQ A;  1B6C A;  1FKK A;  1E6N A;  1J6Y A;  1GPF A;  3RME A;  4O2T A;  4QT3 A;  2M1I A;  3AQU A;  2XP8 A;  1XRV A;  4JYS A;  1TFV A;  3RM9 A;  4N19 A;  1ZB5 A;  4U86 A;  5J6E A;  4IT4 A;  4TW7 A;  5BXJ A;  4MNJ A;  3CGN A;  1D7H A;  2ZQT A;  2MLX A;  4IT6 A;  4DRH A;  1E6Z A;  1ROT A;  2DSV A;  4MGV A;  4U84 A;  1FD9 A;  2B31 A;  3GTY X;  1W1Y A;  1ITX A;  1CTN A;  4G50 A;  3O5R A;  1GRJ A;  3ARQ A;  1W26 A;  2N87 A;  1FJD A;  1D6O A;  4DRP A;  3TCZ A;  2DT0 A;  1HKK A;  2P4V A;  5DO2 A;  4ODM A;  1Q1C A;  4GGQ A;  1EDQ A;  3O5Q A;  5DIV A;  4W9Q A;  4HAR A;  4MSP A;  2DSW A;  4LAX A;  3O5I A;  1WB0 A;  3ARR A;  1H0I A;  1NSG A;  3UF8 A;  2PV2 A;  2RQS A;  3ODK A;  2LGO A;  4FAP A;  1JVW A;  4TYO A;  1HJW A;  2A3E A;  3I6C A;  1NWR A;  1ZL1 A;  2DSZ A;  1KT1 A;  1ZU8 A;  1NMW A;  4ML4 A;  3IKG A;  1EQ3 A;  3KZ7 A;  1YW5 A;  1EIB A;  4WJX A;  2DSU A;  2PPO A;  4DRQ A;  2PV3 A;  3B8S A;  1NH6 A;  3UQB A;  1QPF A;  4C02 B;  1Q6H A;  2OLH A;  3WL1 A;  2WLY A;  2F21 A;  3WQW A;  3IHZ A;  3ARU A;  3WQV A;  3ARV A;  3ALF A;  4ZS6 A;  3O5L A;  4JFL A;  1FKG A;  3O5E A;  1LL7 A;  4DZ3 A;  3CHD A;  2VCD A;  3LUO A;  1M5Y A;  4DWS A;  4JFJ A;  4XAK A;  1TCO C;  3EY6 A;  3MDY B;  1JNE A;  1BL4 A;  1E15 A;  5HW8 A;  2PPP A;  3O5D A;  3FY1 A;  2FKE A;  2XP5 A;  1ZBV A;  4WIW A;  1IX5 A;  2DT3 A;  1L1P A;  3G6M A;  1JCH B;  3KAD A;  1U79 A;  1H0G A;  4JFI A;  4IQC A;  3B9D A;  4DRM A;  4MTV A;  1QZ2 A; 
#chains in the Genus database with same CATH homology
 3TDB A;  3KAG A;  2RUD A;  2OFN A;  2F2D A;  4DWS D;  3UI6 A;  4Z2L A;  1J4H A;  3CHF A;  1OGG A;  1GOI A;  3H9R B;  3B9A A;  3O5O A;  5DF0 A;  3TC5 A;  4P8W A;  3CZ8 A;  4FN2 A;  4AY1 A;  1NWT A;  1PBK A;  4MNM A;  2IF4 A;  4TNS A;  4DZ2 A;  2Q5A A;  4ZPV R;  3ARP A;  5D75 A;  2WK2 A;  3RM8 A;  4IPX A;  5DEZ A;  2F4E A;  4HBE A;  4P8V A;  4TW8 A;  2XP9 A;  1FKH A;  4Q22 A;  1WAW A;  3KAF A;  2YBT A;  2XP4 A;  3BXW A;  3RM4 A;  3FXY A;  2MLY A;  2ZQV A;  3ART A;  3ARY A;  2MF9 A;  1PIN A;  1R9H A;  3CHE A;  4QT2 A;  1F8A B;  3JYM A;  3GPK A;  3JXV A;  3G6L A;  2ZR5 A;  4P8U A;  4TW6 A;  1W9P A;  2ZQU A;  2VN1 A;  1Y0O A;  1FKR A;  1FKJ A;  3W4R A;  5HWC A;  2K8I A;  5GPR A;  1FFQ A;  4HBO A;  4LGX A;  3WD2 A;  4WKF A;  3O5J A;  2ZR6 A;  1X6L A;  3ARW A;  1O6I A;  2ZR4 A;  3ARZ A;  3KAI A;  4Z2G A;  2KI3 A;  1LG1 A;  3UI5 A;  1HJV A;  3IK8 A;  4DWS B;  1LL6 A;  4J4N A;  4NZC A;  5DIT A;  4DRJ A;  4MNL A;  1UR9 A;  2KO7 A;  3AS2 A;  4S3J A;  2Y78 A;  1HKI A;  1X6N A;  3UQI A;  2KE0 A;  2RUC A;  1E9L A;  3AS1 A;  5HKG A;  2KGJ A;  4ODL A;  3QOK A;  4DT4 A;  1LJY A;  3O5G A;  3WKZ A;  3WH0 A;  3RGC A;  3NTP A;  2DPE A;  4L72 B;  1LQ0 A;  1OWQ A;  3AS0 A;  1J4I A;  2QF8 A;  4W9O A;  4Q7N A;  1W9V A;  4GIV A;  3KCE A;  1HXV A;  2DG9 A;  3KAC A;  2PI6 A;  4WKH A;  1GUV A;  4NSB A;  4J4O A;  4W5U A;  2YBU A;  5HW7 A;  3KAB A;  4ODQ A;  4Z2J A;  2MNT A;  3UI4 A;  2KFW A;  4URI A;  4ODR A;  4DH0 A;  3PRD A;  2IUZ A;  4S3K A;  5GPG A;  4QZV B;  3WD1 A;  1FKL A;  5I98 A;  1FAP A;  2XP7 A;  3RFW A;  1W1T A;  2DG3 A;  3UQA A;  1ZK6 A;  1N1A A;  2DT2 A;  3O5F A;  1FKT A;  2G8Z A;  1XHG A;  4JFK A;  1T11 A;  1FKB A;  5HBF A;  3OA5 A;  1SYT A;  2PV1 A;  4JFM A;  1BKF A;  4LAY A;  1OGB A;  3CH9 A;  1UR8 A;  2AOS A;  1JND A;  3WD0 A;  3CGM A;  1VF8 A;  3WL0 A;  1WNO A;  1NWU A;  3NI6 A;  4ODP A;  4Z2K A;  1FKS A;  2PPN A;  2A3B A;  1HKJ A;  1FKF A;  2A3A A;  1E6R A;  1RD6 A;  1W9U A;  5DIU A;  2MPH A;  2O92 A;  1LG2 A;  3PA7 A;  4Z2I A;  1ZCN A;  1SR0 A;  2A3C A;  2JZV A;  1K9T A;  2XPB A;  3NRK A;  1J4R A;  2M08 A;  4ODK A;  4Z2H A;  1FKD A;  2LJ4 A;  2KR7 A;  2ITK A;  2L2S A;  3O5P A;  4ITZ A;  3KAH A;  4KQZ A;  5HW6 A;  4R5E A;  4IQ2 A;  1JNS A;  3PR9 A;  1W1V A;  2D9F A;  2RSE A;  4TX0 A;  4ZPW R;  1A7X A;  3B7X A;  2G41 A;  4DRN A;  4DRO A;  1W1P A;  1JNT A;  2MLZ A;  2PBC A;  1KT0 A;  4W9P A;  1D7J A;  4DRK A;  3ARS A;  4ZPT R;  2XP6 A;  2ZQS A;  2DT1 A;  1HKM A;  2FDM A;  4DWS C;  2ESC A;  4P8X A;  4WK9 A;  4MPK A;  4QIB A;  1C9H A;  4ODN A;  2XPA A;  3ARO A;  3VAW A;  3O5M A;  3PRA A;  3ARX A;  2UZ5 A;  1EHN A;  3WD4 A;  2M2A A;  1LL4 A;  3IKD A;  5JH8 A;  4LAV A;  4R0X A;  1D2K A;  3B9E A;  4MAV A;  1Q6U A;  1P5Q A;  5HWB A;  3PRB A;  1NMV A;  1D7I A;  4NNR A;  4ODO A;  5B8I C;  1Q6I A;  1FFR A;  1ROU A;  2LKN A;  5GQB A;  1E6P A;  1QPL A;  1ZBK A;  4KR0 B;  3AS3 A;  1NWS A;  3FAP A;  3JYJ A;  2XP3 A;  2FAP A;  4LAW A;  1EYM A;  5HTG A;  2LPV A;  4L3N A;  4U85 A;  1YAT A;  1F40 A;  2RUR A;  4G2P A;  4BF8 A;  5HT1 A;  3WD3 A;  1ZBW A;  2AWG A;  1HJX A;  2O9O A;  2DG4 A;  1KFW A;  3ALG A;  4DRI A;  2WM0 A;  1FKI A;  5HUA A;  4MNK A;  3OOB A;  4WKA A;  3WIJ A;  4PTM A;  1ZBC A;  2WLZ A;  3CHC A;  4DIP A;  3O5K A;  2RUQ A;  1B6C A;  1FKK A;  1E6N A;  1J6Y A;  1GPF A;  3RME A;  4O2T A;  4QT3 A;  2M1I A;  3AQU A;  2XP8 A;  1XRV A;  4JYS A;  1TFV A;  3RM9 A;  4N19 A;  1ZB5 A;  4U86 A;  5J6E A;  4IT4 A;  4TW7 A;  5BXJ A;  4MNJ A;  3CGN A;  1D7H A;  2ZQT A;  2MLX A;  4IT6 A;  4DRH A;  1E6Z A;  1ROT A;  2DSV A;  4MGV A;  4U84 A;  1FD9 A;  2B31 A;  1W1Y A;  1ITX A;  1CTN A;  4G50 A;  3O5R A;  3ARQ A;  1W26 A;  2N87 A;  1FJD A;  1D6O A;  4DRP A;  3TCZ A;  2DT0 A;  1HKK A;  5DO2 A;  4ODM A;  1Q1C A;  4GGQ A;  1EDQ A;  3O5Q A;  5DIV A;  4W9Q A;  4HAR A;  4MSP A;  2DSW A;  4LAX A;  3O5I A;  1WB0 A;  3ARR A;  1H0I A;  1NSG A;  3UF8 A;  2PV2 A;  2RQS A;  3ODK A;  2LGO A;  4FAP A;  1JVW A;  4TYO A;  1HJW A;  2A3E A;  3I6C A;  1NWR A;  1ZL1 A;  2DSZ A;  1KT1 A;  1ZU8 A;  1NMW A;  4ML4 A;  3IKG A;  1EQ3 A;  3KZ7 A;  1YW5 A;  1EIB A;  4WJX A;  2DSU A;  2PPO A;  4DRQ A;  2PV3 A;  3B8S A;  1NH6 A;  3UQB A;  1QPF A;  4C02 B;  1Q6H A;  2OLH A;  3WL1 A;  2WLY A;  2F21 A;  3WQW A;  3IHZ A;  3ARU A;  3WQV A;  3ARV A;  3ALF A;  4ZS6 A;  3O5L A;  4JFL A;  1FKG A;  3O5E A;  1LL7 A;  4DZ3 A;  3CHD A;  2VCD A;  3LUO A;  1M5Y A;  4DWS A;  4JFJ A;  4XAK A;  1TCO C;  3EY6 A;  3MDY B;  1JNE A;  1BL4 A;  1E15 A;  5HW8 A;  2PPP A;  3O5D A;  3FY1 A;  2FKE A;  2XP5 A;  1ZBV A;  4WIW A;  1IX5 A;  2DT3 A;  1L1P A;  3G6M A;  3KAD A;  1U79 A;  1H0G A;  4JFI A;  4IQC A;  3B9D A;  4DRM A;  4MTV A;  1QZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...