4ODTL

Fab structure of lipid a-specific antibody s1-15 in complex with lipid a carbohydrate backbone
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQSTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKVLIYYTSRLRSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S1-15 Fab (IgG2b) heavy chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 61
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtL01
1J1XH 2X42A 2H26A 2YPVL 3BP7A 1OARH 1OGAB 1EA9C 2FECI 4YWGH 2G2RA 1QR4A 3MZTA 3ZE1F 4M7ZB 5E4EC 5BVJB 3KLHD 3STLA 2YHGA 5IKCB 2X4UA 3MX0A 3PDGA 2MWCA 2B5IC 2EH7L 3QQ4A 5TDNB 1W8NA 1RURH 4WGVB 4PRIE 5E99H 3MRLB 5ID1B 4KJQC 5JW5B 1HSAB 2VJXA 1Z9SA 4P5MB 3TLRA 4UT6H 4QXTB 2NY3C 3WJLA 5FB8B 4S0TD 4KKNA 4B50A 3MJ8B 4YBQD 1XAUA 3T2PA 4IIQA 4JDZB 3U4EA 1BOGA 2VDML 5I18L 4P2OD 5B4MD 2H1PH 1CGVA 4S1RL 4HFWA 4FQCL 2IAMD 1ADQA 4RGNB 1MFEL 1SVCP 5KSVB 25C8H 4CADB 3Q6FA 5F7DB 2FDBP 3C08H 2CK0L 2OTWA 1W8OA 4PG2C 2FJGB 2EE3A 3PGCB 4PJBA 4ZXBD 4G5ZL 4P4RB 1JYNA 2MHAA 4NUGL 1QKZL 4NZUL 3EUUA 4DVRH 3GMLA 3RWCB 4S2SB 3I3DA 5FO7B 2NY4C 3I9GL 3MODH 1D5IL 4OGXH 4YXLL 5CZVL 3UDWA 1GOHA 4XWGL 4XP5H 4YXHL 5TDOA 3SKNA 4ODHH 3BZDA 1TNNA 2F5AL 2RFXA 4PV9A 3ZKXB 5D7JD 5J8OA 2I25N 2ESVA 1WF5A 1N6QL 1UZ6E 2PYFA 3V52L 5BS0A 4XC1L 5ANMB 3TIDA 1A6VH 1D5ZA 4JFDA 1S7XB 4BFBD 1HCVA 1KCRH 5DJ2B 5K59F 1I9JL 1JPGA 4JFED 3S37X 2GAZA 3G6AB 2GJJA 5D2NA 2DB8A 3L1OH 3MBEA 4APQA 1C12B 3GHEH 3GGWA 5EH1A 2LV4A 1HHKA 3LKRA 1B4JL 4NC2B 4O9HL 3JWOL 4G42B 2ENYA 3H9ZA 5FCUH 4U05A 4LCYB 2P5EB 3AUVA 3P4MA 2Y06H 3SGKA 5C0DB 3QJHA 2DLHA 2VWEC 4QHLB 1DL7H 1IEBA 1OT2A 2NY5H 4CN1A 2NNAB 2KQNA 1WQVT 5E24E 4GAYA 1FYTA 5DJ6B 3DWTA 1U58B 2AKRA 4ORGA 1JN6B 5DFTA 2WLZA 5FYJH 3QXAA 1FZMA 3MJ9A 4P5TC 5IK3B 4PUBH 4LHUD 1M7DB 5D2LF 1O7VA 4HBQA 4KKBC 3DO7A 5HDBF 2ZPKH 8CGTA 4N0CC 1T1WA 4PJIA 4G9FE 1PG7H 3NACL 3C5ZB 5D9SA 2WBJA 5E9DA 1LK2B 3QZWA 1EO5A 1NGXB 4JAMB 4R7DA 3DVNA 3VG0L 4DN4H 2GJZA 5B22A 1FL3B 2J5LC 5CINH 4CNIA 3H7LA 3K4AA 4YDLB 3LKNB 2UVFA 4AL8L 4Z95L 3S35H 4BH7B 4AEHL 4OCYH 5T5NG 4GXVL 3M8OH 2NY1B 5HGDA 1AD9B 1F02I 1CXIA 1SHMA 3P0VH 5EU3B 3FRUB 2DQFB 5GRWA 1R5VB 1HYSC 1NJ9A 4H1LH 1ITCA 3BEWA 3RIAK 1YQVL 4GXUN 1KB9J 4R4BB 1ZSDB 3G04A 3GO1H 4JFYA 3LKSB 2AP2A 5I16B 1FE8L 4LLDA 4BSWA 2ILLA 3GSVB 3G6JE 5E2TH 3BXNB 2VO5A 2VISB 3H9SB 1B0RB 4HC1L 4IHOA 5KW9L 3GSUB 3LQZB 4XNUL 1SJVA 1BQHB 1JNLL 3QDMA 1CVSC 1KN4H 3EFDH 4TRPL 1DFBH 5JNYA 3H42L 4PJXA 3O2DA 4MNQA 1QSZA 1XCTA 5T1KD 1C5DA 4HWEH 3MGOA 5E08L 3QEQE 1MHHB 2OJEB 5D6DC 5D1XC 5KSAD 3K1KC 1BECA 3UTTE 4YUEH 3NCCB 1FVCB 4HKBA 5AG9A 3JBG7 4OZHA 1FZKA 2GTWB 2FWOB 4UILL 3EOAB 5DGQA 4MYWB 3QXUA 3UPRA 5CD5D 2ICEA 5C0CB 3PDOB 1A9EB 1UFUA 2HJLB 1BPVA 4LF3B 5CP7B 3SHSA 4FQIL 3O8XB 4S1SH 2LABA 1WTGT 2PNDA 1NGPH 2MQ3A 3NFNB 4I5BB 5HHNB 1MCEA 3TPKA 2HVJA 4XPHL 3HE7B 2JJSC 2BNQE 1A0QH 4KI5C 4NUJB 3FQXA 1FFNB 2OL3H 4Z7VF 2BXYA 3BPNC 2PO6C 5F9JA 1T0NA 2VIRB 4YDIH 5GSRB 5EOTB 2R39A 4ONGL 3LMJL 2AQ2A 2IH3B 1IT9H 1XZ0B 2AXGB 5JUEL 5I6XB 5C0BB 1IFHH 3WN5B 2VH5H 5D5MF 5EU5B 3SKJH 4UZGA 3V4VL 2BK8A 1A7BA 4P2RE 3N1PC 4PRHA 2J3SA 1G9MH 4X6FA 3WHXA 5FYKE 3D3VA 4MJ6B 2FR4A 5F3BA 2X1QA 1HYRC 4MQ7B 2X9WA 5D70H 1OD9A 3NZHL 4E41D 4F7MB 2OTUB 1HHHA 3FZUC 4KJWC 3IJYB 4JZJC 4HGKC 3TA3D 3SEPA 1B0GA 3FFCB 1NC4D 3SDYH 1UADC 1DBBH 2EDEA 3DNKA 3EYQC 5I74C 1JTTA 3WEXA 3MYJB 2V6HA 4H0IA 4CKVX 3QR2A 1W72H 3AGVA 1JPTH 3KPSE 4P2QA 5CHNB 3RVTC 2VDPL 4I1NB 2NY6D 4WEUD 5DUBB 4X4MA 3I6KA 3BGFC 4DUVA 1XGUB 5EZLA 4TSBH 3VFTA 4M5ZL 4M61B 4NN5C 1NAML 1F4YL 4G9DB 3NZ8B 5DFVD 1HXMA 1YEDB 1LK3H 2NY2B 1IAMA 5DJXA 2VLRE 4OAWA 1BQLH 2V7HA 3GFUA 1RD6A 1UB5B 2XFXA 4RDQF 1CCZA 4KTYA 3WUWG 3L3DB 4UTBL 2PW2A 4LRIC 5EC1A 2X70B 4O2FB 4XVTH 3I2CL 3HG1D 5FO8B 2QR0A 1JYVA 4PGEA 2ADJA 4OZIB 1YN7A 3FMGL 3KJ4C 3DRQA 1DQML 3RIFF 5D8JH 3MRNA 3T8XB 1RZFL 1WZKA 4RRPG 1OPGL 1K8DA 2FH6A 3QDHA 4YQXH 3WNOA 3RZCD 1P7QA 3KYOB 4OLUH 1IGCL 2V5SA 4XMLL 4QTIH 4XPTL 3WSQL 3REWB 3KVQA 1M05B 4Y4HD 2C3VA 1D5XB 4UIMB 2R8SH 4TULL 2EDLA 4BFIA 2IWGA 4JY5H 2XWJB 1ED3B 4ELMA 1J10A 2GK2A 3IDIA 1L7TH 3IDXL 4HG4J 2VTFA 1RZGA 2J88H 4ISVA 2WINB 4IRSB 4GKNB 4TSAL 4MZ3A 4M7JL 4X5LA 1ZGLM 4R97B 5J6HB 1PZ5A 5MEPB 2OXHA 5DDHA 4OFDA 3TBTA 3MV7B 3F58L 5DA4A 4I18C 2IPUK 3QIUB 3B43A 4G6AD 4HKZA 2R0ZL 2Z93A 5LBSL 2Z35A 4PRBB 3FT3A 5CBAB 2Y1VA 2YC1A 3O2DH 2BFVH 4FS0A 1YPZF 4Z7WE 3TO4B 2FH8A 4NKIH 1R5WA 2IQ9L 3GJFA 2E7BA 1MAMH 3NA9H 3D69A 3BH8B 3VWJC 1EHXA 4XCEA 2YD6A 4KK9C 3RPKA 4LQ1A 4PLKC 4HKXA 4UT9H 2O5YH 3L7FB 2EIZA 3W82A 5I8CB 3F5WA 2CDEB 1KTDB 4PJ5D 5E8NB 2AJZB 1RUQH 4K8RL 4R6UA 5IW1A 5J11C 1WGOA 5I1HL 4PLJC 1JIBA 4LCUB 4OKDA 3R06A 3VFSA 1P84K 1QRND 2V2TA 4UT7H 4AEIH 3O0RH 3V5DB 3W2DH 4QRRD 1KCUL 3TP4A 5T33H 4LLAA 3O2WH 3MRMB 4FP8H 2R0WH 3FN9A 1MOEA 4OBRA 2DD8L 4OIBA 1KT2A 1QO3A 1AY1H 4ZD3L 4UUJA 2HKFH 3JUYA 3SKMA 1XFPA 2V7NB 3KHOA 5GHWH 1S5IH 3BKJH 1I7UB 4PJ7F 4WUUB 5DC9B 2UWEA 1B0WA 3GB7A 4E5XB 5MEOA 4OLXL 3C9NB 3DUSA 3QDJE 2MOVA 2Y36L 1FAIL 5KJRH 2QQNL 4XWOC 4GW4B 2XN9A 4M48L 3B2VH 3TGXA 3C09B 4MB4A 3GHBH 1YJDH 2CIKA 4GG8B 5D7IF 5IJKC 3H0TA 1OAXL 2B4CL 3QCUH 2AGJH 3D39A 2BCKB 2KZWA 3AM8C 2FBOJ 4QO1A 1XF1A 4X7CC 3MLUH 3CLEH 5DHXB 4Z76A 2E7LC 3MROB 5ENWB 2DI9A 15C8H 4K23H 4A2MA 1NPUA 5HHMB 3RWHB 5BV7B 4X4XA 4Z0BH 1ZGLP 3VRIA 4X99B 5SWQB 4XZUA 3N0PB 3KPOB 4ODUB 1EHAA 4PTUA 4DOHB 4MGXA 5JMRA 2BC4B 1LWRA 4K3HA 4F3FA 1XGRB 1NMCC 4GUPA 3STZB 1CZ8H 1A7OH 5JR1L 2ATPB 4UAOB 4HC1A 4X9FA 3UYRL 2YPLA 3HI6L 4Y5VA 5IMOB 2HKHL 4NQED 3BDYH 4UNTA 5J9PB 3RWIA 2XA3A 3VGBA 4OZGE 1PG7X 4JZNB 5T3XH 3ARZA 1IEHA 4XT1C 1NC2B 2VLKE 5MENB 1UEYA 2M8XA 1RK0A 4URTB 3OHXA 3RHWF 5IHUL 1K2DB 2YPVH 4Y4FD 1QSEB 4NCDA 3B9VA 4U1MB 2Z31C 3EJZC 3P77A 5ERWB 3S35X 3HI5L 5T1MA 3CU1A 3MREA 1F6AB 1ZWIA 4LMQI 3GJFK 3RWGB 4C56D 4OM1L 3GUTA 2EH7H 3GMPA 3PWPB 2X4PB 3UJTL 3SDDA 2G75B 4LLMB 3FOLB 3CDGB 4G8FB 5J13C 2AAVA 1FNFA 5IROC 1HHIA 3T65B 2L7UA 5FK9A 4X0KB 1LVEA 4NQTA 2IGFL 3L3HB 5EO1B 1RUPL 5CBEA 4LVOB 2GTZB 3HRZA 1CFSA 2NTSP 5HD8D 2VDMH 5I18H 1EAPA 1BP3B 3QNZB 4S1RH 4LDLB 4TNVF 1AFVL 4FQCH 2WWKO 4OTXL 2R4SL 2PYEB 1MFEH 4JZOA 5BOPA 3QIBB 5HYFA 3ZHDA 2HJKA 2CK0H 3TCLA 5D7LA 2UYLB 4MSWB 5EG6C 4X8XA 5AUMA 3UP1A 4XP1L 2DKSA 2R1YA 1T2QL 1CICB 4WW2A 4G5ZH 3ULVD 4NUGH 2KZ1B 5DRNA 4Y2DC 1BJ1H 1QKZH 4NZUH 3MNVA 2WUBL 5LAXA 5DVKA 1NDMA 3QUZC 4YHYB 5MI0B 1P4BL 1VFMA 3MCG1 3I9GH 3LN4A 3MJ6A 3BRFA 3WKNA 5I76B 3ZKMD 4DN3L 3SCMD 1D5IH 4G7VL 4YXLH 5CZVH 4QNPE 4NWUL 4XWGH 2BJML 1V7ML 4YXHH 4FQJL 2LE9A 4X6EA 2WMPA 1G84A 3GMQB 4LLYA 3RWJB 2R1XB 5EIIA 3AM8A 2F5AH 1CTNA 1U3HA 5HHOD 1T7VA 1N6QH 3V52H 1RK1B 3LKQA 5F8QC 4XC1H 2R0LL 3V8OA 2B0SL 5D71L 3AB0B 4PGBA 2R15A 5F7KC 4M43L 1PEWA 3OZ9L 4JRYE 5CS7A 3MRDB 5DMKA 1I9JH 4O51A 1BGXL 1I1RA 2RBLA 5IHLB 1NSNL 3I6GA 1F11B 1QG3A 5C08D 2PN5A 4HQQL 5EZOL 3G08A 1B4JH 4O9HH 1G7PB 3JWOH 3RWFB 5L6YL 3PGDB 1WWAX 3LY6A 1RHFA 4GG6B 1M7IB 2GSGB 2BMKA 3OAZH 2F54E 4Y1AD 1CGTA 2VDKL 1AXIB 2FL5A 2AV7A 2FBJL 2F53A 2JIXA 4MXQD 4ONHB 1U8QA 2CJUL 4KPHL 3UEZA 5DHVH 2R2BA 4V1DE 3V4UL 3OAYK 5AEAA 1IGML 4H88L 1OTTC 3EYVB 1IAKB 4QGTA 3IGAB 1JMXA 3MRIA 1HH9A 4XBGA 3NACH 2E9IA 3LB6C 3TNMB 2E9WA 1UZ6F 3RNQA 3BYYA 3MCKB 3SKOB 2AW2A 5IROA 5K9JL 5E03A 2Z92B 3VH8G 4AL8H 4Z95H 1CGYA 1TZHB 5DZLA 3D0VA 1QR1A 4HUWA 3ZDYE 4AEHH 3CSPA 3ET9F 3ARGA 4GXVH 2IANE 4M4RA 2DJUA 2O5XL 3W0WD 5DR5L 3OX8B 3P9MB 4QHMA 5GGSY 3B3IB 4OCLC 5JW4Q 5B38A 4G80A 3QXTA 1OGTB 3X12A 1YQVH 4NN7C 1AGDB 4P2OB 3QUXA 1W0VA 5IQ9A 4RWYL 2YWZA 4KDTC 5D72L 5J06A 1FE8H 1FBIL 1XCQA 2IAMB 1J8HE 2W65B 4YK4B 5CWSB 1IQWL 4KMTL 3FO2A 3CU7A 4H8WL 2BSED 4HC1H 4OF5A 4RCAA 5KW9H 2IH1B 4MXVF 4XNUH 1G9NC 2XYCA 3LEXB 1JNLH 5C0FB 4TRPH 3BIAX 3H42H 3PQYE 3IAQA 3CPLA 5GRJL 4ZXBB 2JELL 4M6OL 1X4YA 3VXOA 2DM7A 3TH4T 5L2KD 2Y9RT 1Y6KR 1S7UB 1H9VA 1LEIB 5E08H 4IDJL 3MRBB 3OAYH 3RVVD 3MLSL 1BFTA 4M7ZC 3MV8E 4I2XA 5CSZB 3VWKD 3FOMB 3LRGA 4UILH 3ARXA 3HLAA 3VMOA 1FNAA 3BISA 1LO5B 5T1LA 2CKBL 4J4PD 3PWUB 1T7WA 5CZXD 3KYMB 4S1DD 5D7JB 1AD0B 2PXYA 1AIFB 4FQIH 1QLEL 1AGBA 1E28A 3DXAE 3VCLA 2Q76B 1FJ1B 4NHUB 1BIIB 3RY6C 4XGZB 4PJ9A 3WCYA 4X4YA 4XPHH 4KQ4L 3ZKQD 4PTTA 2A0LD 1ORSB 1S7VB 2CIIA 3E6FB 1EO7A 5D1ZD 4JFEB 1B4RA 5DMGC 2G5BA 5GZNC 1PKQE 5I71B 1UH3A 1HEZB 2DYPD 3CUPB 3HI1A 3G6JF 2VAAB 1BVLB 2CMRL 3G6DL 2HVKB 1ACYH 4NSKB 4ONGH 3LMJH 1EFQA 3WIFA 1CFTA 4FG6C 4WJ5A 3ARED 1RZJC 2YA2A 5JUEH 1ZVSB 3OG6B 4Q97A 4WNQA 2QTEA 3UXFA 2QJDA 5I8KL 3JWNC 3V4VH 2XPGB 3PWVB 1S9XB 4MQXC 1MI5E 3SKUD 1N6UA 3WFBL 4EQ2A 1ZT4B 3A67L 4MNGB 3DYOA 1QVOB 4YDVB 5GRXG 1FSKB 4NZJA 3LD8B 4GKOA 5GS1B 3NZHH 3ZKXC 3SDCD 5FGRA 4G3YL 3UZQA 4OGZA 1P9MA 2LFGA 3DRTA 5CEZD 4L8SA 1XR9B 3G9VA 4JFZL 3W9DB 2DIAA 4JQXC 1WEJL 1G7IA 4LSPL 1TVBB 3CDFA 3JXAA 5IOPA 2DLIA 4Z7UA 4NYLB 3L5WA 5DD6B 1T7ZA 4ODSL 1FV1A 5JOFA 2VDPH 2BVOB 5DK0A 1FL6B 1PD6A 3OR7A 3MA7A 1GC1C 3MJ7A 4HF5L 3EYUL 1J0ZA 5I2IA 4PRDA 4LKCA 3HAEB 4M5ZH 4NQDA 4G43A 4KTEL 1NAMH 4LSQL 1F4YH 4X6CA 4WENB 2QKIA 1KIUA 4JGUA 4XAKE 4GRWB 5IVXA 1EBAA 1OQXA 5L7XL 2IEPA 2HAZA 5FA4A 1U8OB 3G5YB 3WFCL 3BSZL 5DEFB 4HGMA 4B5EA 2KBGA 4DVBB 1GYAA 4UTBH 4HUMB 2QSQA 5HPOA 1OGAA 3KLDA 3C2SA 3I2CH 1I1AD 4PJXE 3FMGH 3HAEG 3F7PC 1KJVA 5IJVB 4LU5L 5F1NB 1DQMH 4PV8B 1FVDB 1AP2B 2FATL 4IMKC 3VFNB 2PKDA 4ZFZA 3O3EB 3O2VL 5KSAB 3UTPE 4GQPH 4K7PL 1RZFH 1L4IA 4TTDC 3H3PL 5TDNA 3C5ZC 1OPGH 3MRLA 2KKQA 5EFIB 5B3JE 1I7ZA 2ARJB 1HSAA 1P4IL 1IGCH 2ZCHL 1FAKT 4XMLH 1U8NA 4XPTH 4QXTA 1G1YA 3IETB 4YDLC 3WSQH 3EO0A 3MOBL 1QSFE 3C6LD 3MUGA 4AMKL 3MJ8A 2P43B 1MRCL 4TULH 4YEFA 2E9JA 2NY1C 4EI6B 1S9WB 3IDXH 4PB9L 3UYOD 4WY7L 5KSVA 3MUJA 1WLHA 4CADA 5KSBB 5F7DA 4P46A 4TSAH 5CJ8A 4M7JH 3VDAA 2XOTA 1YA5A 4KXZH 4PY8I 5DRZB 4M1CC 3PGCA 2YD2A 2EDQA 3F58H 3MR9B 1S8DB 2HT2D 1RHHB 4EI5D 2VWEE 1QRKA 4PJAE 1CL7I 4S2SA 5FO7A 2R0ZH 1CLYL 3SJVD 5LBSH 3B8SA 3OJDB 2CUMA 1WAAE 3H7BA 4YAQA 2EDBA 4HH8A 2BSTB 4PJEA 3B83A 5IB4B 2IQ9H 3SDXA 4LFHD 1MY7A 1JWSA 3V0VB 3PNWA 2J8UF 3WXWL 4X6DE 2QL1A 5ANMA 4XB7A 4E41B 2BVYA 1LE5B 5AD0B 2IJ0C 5IFAL 2JB6B 4K8RH 4OGAD 1T66C 3O8XC 3TA3B 4YHPB 5DJ2A 3S4SB 5I1HH 5T3ZD 5DTFB 4HX1A 4AIOA 4R0LB 1NC4B 3HA0A 1RZ8A 4KK5C 4PJFE 1KCUH 1T1YB 4HZLA 5JZ7D 1MFNA 2B20A 1U92B 4ZFGL 4HK0B 2DD8H 4LAJH 3SGJA 2DQJL 4O02L 3IAPA 4G42A 4N8CL 3VI3E 4ZD3H 1A1MA 1MAKA 4LCYA 2NY6B 2P5EA 4EDXB 4M7KL 5C0DA 5FYJD 4L4VE 3J8F7 4F7CB 2NNAA 3V0AC 3S4SG 1AR1C 1BVZA 5DJ6A 4PJ8D 2RHEA 3G5VA 4L1DA 1G0DA 1LHZA 4F2MB 4OLXH 5I6XC 3RUGF 3MMEA 1VFAB 2EYSB 3TVMA 2Y36H 4HV8A 3BPCB 1I8KA 4U1HA 5M94B 1FAIH 2QQNH 3DJ9A 4MMZC 4M48H 5FM5M 4TUJB 3HG1B 2Q6WB 2EDHA 1OAXH 3HZMB 1LK2A 1TQCC 3MACL 4UDTA 2B4CH 5AWNL 3LSOB 3RL2B 3T77B 1UACL 5HDQL 1J05B 4LPCA 2NTFB 3BW9B 4AK1A 2Z4QB 1P4LB 1QTYT 3QH3B 3RZCB 3VXMA 5GJTL 3ARWA 2QHRL 2DTSA 3MO1B 1TQBB 1MCJA 1AD9A 5HI5D 3V6BR 4HK3J 1HILB 3EHBC 3FRUA 4JPVL 2DQFA 1R5VA 1LD9B 4PP1C 4MNHB 3WFEL 1JGVL 4KC3B 5DJAB 4KI5E 4R4BA 5JPNA 5JR1H 1U95B 4N0UE 4ELME 3UYRH 3GSVA 3HI6H 3BXNA 3QYCA 4GAJL 5TF0A 2VISA 3H9SA 3OXRB 3GSUA 3LQZA 2HKHH 1P69B 4Y5XA 3S36L 3QIWA 2NY2C 2BY3A 5CKGA 5EUOE 4AY0A 3PP4L 3OKNB 4P4KD 1JJUA 2DI8A 3OJ2C 4U7SA 4R96A 3STBA 3CC5A 2XKNB 3O3BB 4PRPA 5IHUH 1MHHA 5JHLL 2OJEA 1XGQA 2E27L 1XH3B 2DJ4A 5IR1A 1A6UL 1ONQB 2QLVB 2QQQA 4Q6IB 1NFDB 3AFLA 3HI5H 3DARA 3BFOA 2FWOA 3R0NA 4U31A 4L8DB 2CKBA 2DWEA 4J6RL 2CSPA 4ZUSB 5C0CA 3PDOA 4OM1H 1A9EA 3O3UN 4ZSOB 2HJLA 3UJTH 1I8MB 3U4AA 3WIIL 4ZYKB 2FECL 3DGCR 3I84A 2XKUA 5E1HB 4CU8A 1UWXK 2VYRE 5F7UA 1F2XK 4I5BA 2IGFH 3HE7A 4NOFA 4PJ5B 1RUPH 1GHFL 4PJHF 4NUJA 4I13B 5F9AC 1QRNB 4YEEA 4CU7A 2ITCB 5BRZA 1AFVH 4QRRB 4Y16D 3ZE2E 4BK4A 5E2UL 4OTXH 4LCIL 2FX9L 2R4SH 1DLHA 5DJCB 4JB9L 2J7LA 4Y0GA 3CAFA 3FB8B 4XP1H 4OZGF 3CLFL 1T2QH 3V5KA 2ZUVA 1NH6A 3ROLB 4UDUA 3LVEA 3FO0L 1NGWA 3QIUC 3WN5A 2WUBH 3GKZA 3LPWA 2HLFC 1P4BH 4DN3H 5FF6B 1NGQL 1G1CA 4G7VH 3VFMA 3WS3A 5J1AB 4NWUH 3DI2B 2BJMH 5DD5L 1N5YL 1V7MH 4CAGA 4FQJH 5D96B 3MTRA 2FHCA 4GAGL 3L3IA 2ESVD 3R8QA 4F57L 5BS0D 3X14B 1PG7W 3IJYA 4JFDD 2P1YA 3GMRA 3FFCA 3O4LE 2R0LH 2B0SH 5D71H 4KQ3L 3ZLQC 3HE6B 3T3ME 4M43H 1UWXH 1KB5B 3OZ9H 3BYTA 4F37K 5FECB 1XIWD 1O0VA 2CGRL 3WUWA 1RUAL 1GSMA 1BGXH 4APQD 1X5AA 1NSNH 1OP9A 3QNXB 3PWJB 5DUBA 4DKFL 1DUZA 2MNUA 2ZP0T 3ULUC 1ZK9A 4Q9QL 4HQQH 4M61A 5EZOH 2X4QB 1RJCA 2MKWA 1K5NB 5L6YH 2R2EB 3JTTB 1X5JA 4BM7A 1OOAA 3BWUC 5HI3C 1MCSA 1FYTD 4RRPA 2VDKH 1UB5A 1T5XB 5E8OB 2FBJH 4NQEB 3L3DA 4O2FA 4CDGC 2CJUH 4KPHH 3ARFA 5FO8A 1JE6A 2FGZA 3BIKB 3V4UH 4OZIA 4QNPF 1UT9A 1F97A 3VJ6B 1JPFB 4WI4A 1IGMH 4H88H 4YPGB 5HJ3A 5KVDL 2WBJD 5E9DD 1K3ZA 4UBDC 1R5IB 3HC0B 4Y4FB 5I17B 4LBEB 5ACLA 1GGIL 2JTDA 2Y72A 1Z9MA 5INCA 2Z8SA 5IG7A 3ALPA 5K9JH 4AEEA 3BMVA 4C56B 3REWA 3MLTA 1VADB 2DTML 1WVZA 1D5XA 1CG9A 2F15A 4H25B 5EIVA 4UIMA 1UEMA 3EDKA 3WJJC 5A40E 4OUUA 4D2NA 1G7HB 5BV7C 2E7CA 5AAMA 2XWJA 2O5XH 2FX8L 4YIQA 3NCFB 2CRMA 5DR5H 1NCAL 4MAYB 1IKNC 3SBWC 3B5TA 2EEAA 4FQ2L 2WINA 4PJDF 4IRSA 2JCCE 4GKNA 4NKMB 1SBBA 4DFHA 4PJCA 4RWYH 5D72H 5J6HA 5E7FA 1JNJA 1FBIH 5MEPA 3VDCA 3D85A 1Q9OA 32C2A 4CUCA 3O4OB 3MV7A 1IQWH 3QDMD 4KMTH 4H8WH 2J6EL 1QUNA 4MNQD 5E00B 1CFQB 4NO5A 3L95A 3BJ91 4MCZB 5TE4L 5GRJH 2JELH 1A6TB 5CBAA 4JFOB 3BO8B 4M6OH 3JV5A 3PP3H 3RX7A 1Q38A 2I9TB 4YR6A 3NIFF 4IDJH 3TO4A 3DTXA 3MNZA 2FHFA 1A3RL 3ISWA 3MLSH 4ZUWB 3QXWA 3BH8A 5MERB 3SCMB 4MD0A 4WU5B 2DKUA 1DQJB 5FGCB 2ENSA 3L7FA 2CKBH 4U3XA 5ETUB 3FKUS 2CDEA 1KTDA 5HHOB 2AJZA 3U6RB 3KYNB 2EXWC 3BI9X 1QLEH 3VI4E 3GSNL 3ZYIA 3ZDYF 3X11B 2ED9A 3L5IA 4JCMA 3EO1B 4KQ4H 3I3EA 5EO9A 4HPYL 3ILPA 4LVOC 2W1NA 4M8VA 1RIHL 1RZKC 3ZT5A 4MHHG 3NGBB 1T20A 2VL5A 2A83B 2BNRA 3O3AA 5GIRB 3DROB 5C08B 3RKDC 2DWDB 3AXLA 3QIBC 5AAWA 2CMRH 3G6DH 4M1GL 5TFSL 3UO1L 1S9KC 5J6GB 3KWWB 1CICC 3REVA 5C0IB 4YGVB 4E5XA 3C9NA 1IKFL 4Y1AB 4JGMA 5IEKB 4N9GB 4J2XA 2IQAB 2EICA 5I8KH 4YHYC 4HAFA 2BVUA 5MI0C 4GW4A 2XY1A 4XRCA 5EU7C 1U93B 4GG8A 4EXPX 4NQSB 5ISZE 4P59L 3U83A 4JCLA 4RISL 1UVQA 3WFBH 1CN4A 4PBWD 1KN2L 3UJIL 2X4SA 3A67H 1IQDA 2MKLC 4JO2L 2VXTL 3OGCA 1T89A 1RU9L 4JO4L 2BCKA 2MFNA 1BD2E 5DK2A 4WVRA 2EC8A 4G3YH 4DK6A 3BKML 3MROA 5ENWA 4F80A 2HTKC 4M6ML 3RWHA 1ERNA 4JFZH 4QRPA 3WJJA 4AIXA 3AB0C 1WEJH 4LSPH 1PGRB 4P2QD 4X99A 5SWQA 3RVUD 4JM2C 3KPOA 4ODUA 4G7YL 3T1FA 4ODSH 1XGRA 3STZA 3QHTC 4YC2B 2GT9B 4HF5H 3EYUH 1HQRB 4KY1L 1C5BL 5T3XD 2B7DT 4RNRB 4KTEH 4HUXB 4LSQH 2GFBB 2OQJA 4FZ8L 2ZSWB 1EO8L 4GT7A 5J9PA 2HP4A 2Y7QA 1C08A 5L7XH 1OAYL 1I4FB 1KPUA 3DMMA 5CKAA 4JZNA 4WI9A 2QHLA 3WFCH 4EOWL 3D18B 3BSZH 1NC2A 2ICCA 3OKLA 4JJHA 4MJ4A 4LAQL 1G7JB 4XP6L 3QXDA 1C8PA 3T09A 3GI8L 2EDJA 2XG5A 1QSEA 4HWUA 4U1MA 4DFIA 3SGDI 1CD1A 1NEZB 4ZOBA 4WDIA 4E9LA 3B9KD 5L2KB 1MHCB 3DO3A 4LU5H 2FATH 1F6AA 3UTSB 1GZPB 3RWGA 1KG0A 2AEPL 1WIPA 3O2VH 4KJPD 4K7PH 1P7QD 3H3PH 5JXAL 3PWPA 2A73B 2X4PA 4RX4A 5JDJA 3VWKB 3KLHC 3FOLA 1P4IH 4ZDHB 2ZCHH 1H3GA 4J3XA 3MOBH 3U48A 3SDAA 1NEZG 4AMKH 2OSLB 1MRCH 3C8KB 5IMKB 5BW7C 5F1SA 3QNZA 5DO2D 3T3PE 2YSSB 4PB9H 3UTQB 4WY7H 4OLEA 1NCBL 3CXHJ 4HGWB 3NBNA 4F9PC 1Q9LB 5GZOD 5D1ZB 2ZNWA 4P2OC 4P2YA 3MLXL 3VGAB 1NANH 2UYLA 5B4MC 4MSWA 4R3SA 4LLVB 1I3RB 2DYPB 2IAMC 1J1PL 1PAMA 5GPRA 1FZJB 8FABB 4YK4C 3JSSA 3EDJA 4WHYH 5E6ID 5INDB 5MHSD 1L0QA 5ADPL 1E6OL 1CLYH 1FNSL 2N7BA 4ZXBC 3AREB 1D5MA 1TCRB 3P9LB 3VXPB 1CDUA 3Q2CA 4PJXF 2N56A 2YMXL 2LVEA 4WV1B 2IBZX 4DUXA 4HFUL 3GMQA 3RWJA 2R1XA 1KCVL 2VLMD 2ZOLB 2P5WE 5IV2B 1OW0C 1MHPL 1P5UA 1CDCA 2E7MA 3WXWH 3WXVL 2AJXL 3EJYC 3FB6B 1CFVL 1RK1A 2W07A 2VUOA 1KIPB 4OZHF 3TZVA 5IMLA 4NN6B 1HHJB 3BN9D 1HQ4B 3E3QC 5D7JC 3SDCB 5CEYB 4HUNB 5IFAH 3PABB 1BWMA 1CWVA 2GHWB 1XF4B 5D1QD 1A2YB 3C8HA 1I8LA 4LCWD 2A6JB 1LP9B 4NC0B 1ZV5A 3K4ZA 4G6FD 4ZFGH 2VB5A 2GKIA 1U8MA 4HUVB 5A16B 2DQJH 4O02H 3RWFA 4N8CH 5I71C 3EDDA 3MRRA 1AO7E 1M7IA 3C6SA 1RPQA 5D4QA 4GRLA 4M7KH 1CDIA 3N1QC 4K2UL 1J0KA 5IT2L 3GMNA 4PJAF 4ONHA 1D6VL 3LHPL 4YHIB 4JRWA 1KACB 2YK1L 2F58L 3MFGB 2K3TA 1IGIL 1SBSL 3VH8A 1JV5B 1WAAF 2COQA 4I9WE 1IAKA 3SE4C 2OYPA 3IGAA 5ICYB 1I1AB 3D39D 2FCBA 1AJ7L 1P6FA 2R23A 2X1PA 2I27N 4X6DF 4OF7A 3MACH 5AWNH 1FSKC 1G9NL 3SKOA 4P9HC 1OF2B 1UACH 5HDQH 5GS1C 4E0RB 2Z92A 4NRZB 3FB5A 2J2ZA 1CBVL 2AJ3B 4UU9B 3RY5A 5GJTH 2QHRH 4WHCA 3V95A 4JJ5A 3V9FA 6FABL 4QHUB 1AGFB 4PJFF 3OX8A 5I66B 3P9MA 4JPVH 3C6LB 3U9UA 1R3KB 3WFEH 1OGTA 4LPYA 3O45B 4OLYL 2YPLD 1AGDA 1CDGA 1JGVH 3FO9A 3VI3F 1NDGB 2GSIB 2F74B 3GIZL 3KXFA 4D9RE 3LN5B 2WZPD 4FTVE 2J6EA 2YXFA 5C07A 2VNCA 5C0AA 5CWSA 5DT1L 3KPQB 3EO9L 4GAJH 2BZDA 3GKWL 2VLLA 1J0YA 1DN0B 2IH1A 4FQ1L 3NOIA 3CSBA 3S36H 2CLVB 3U36A 2X4OA 3PP4H 4ZXBA 1FFPB 4TQEL 3FONA 4DZ8A 4ACPA 1EEQA 4YE4L 4EI5B 2CR3A 2DLTA 3MRBA 5JHLH 2E27H 4X7TB 3SJVB 5GJSL 3WFHA 1EVUA 4ETYA 1A6UH 1I8IB 3F7QA 5FO9B 1X6NA 1GGCL 5GGRB 1D3CA 4J6RH 1RJLB 3SDDD 4Q9BA 3UTTD 1LO5A 2NCMA 4C59B 5KSAC 3PWUA 5E2VL 4MVBD 4HBCL 1Q8MA 3GSNA 3KYMA 1AD0A 3WIIH 4GKSB 1G6RL 4W4OA 3C2AL 4XX1G 4F7TA 5CD5C 2Q76A 1FJ1A 4JQVA 4NHUA 5I30L 3SO3B 2K9UA 2ICWB 4IOFD 4LSVL 1XGYL 5C0RL 1ORSA 3P30L 1S7VA 1GHFH 3IFOB 4NCC2 2LQRA 3E6FA 5F7NC 4W6WB 1WFOA 4NO3A 5L88L 1YQ2A 4EJ1C 5D7KE 1A3LL 5E2UH 5D7LD 4LCIH 4ELMF 2FX9H 1BVLA 4U1NB 1I3VA 2X7LB 4JB9H 2HVKA 4X8JB 3T0XA 2P44B 5SWSE 3CFDB 2D03L 3ALWA 3W11D 2NY0D 3CLFH 3H6JA 4QXWA 5EUOF 3K4DA 5HHVL 1QZ1A 5FGSA 5I8EA 5KS9B 3BJLA 3FO0H 3PV6B 3K3QA 1PDKA 4PJ8B 4I0CC 2ATKB 3TBWA 1S9XA 3SE4A 5C7XL 5I1LB 1MLCB 3RY4A 1F3JB 1NGQH 2W92A 4JKKA 5DD5H 1ZT4A 1N5YH 2DQTL 5HHPB 2R9HD 1U3HD 5JLZA 4GAGH 1EGJA 2F8XC 3LKOB 5CEXB 4F57H 2L4OA 3H2WA 4JHWL 2APBA 1KOAA 1MCHA 2SEBB 1ORQA 4ALAL 1CXLA 1XR9A 4TPRL 3W9DA 3FT4B 2DM3A 1UXWB 4LKXB 1KC5L 2CRZA 4KQ3H 4PYHA 4PB0L 2ZUUA 3ARSA 1U6AL 1VEPA 2GIYA 3AROA 4H1LB 2CGRH 1RUAH 5DD6A 3MLZL 1QEWB 1CXFA 2I9LB 1Q94A 1CGSL 4DKFH 3ZE2F 1VENA 3OKEB 3F7VB 4Q9QH 4WWID 3IDNB 1R0AL 2DLGA 4NT6B 1S7QB 2NY6C 3QUKB 3H3KA 3AMKA 4NQUA 5IHZB 2F53D 4P23A 2JIXD 2VE6B 1U8OA 3G5YA 2HT4D 1R3JB 5BO1L 3ZSTA 4H1LG 4DVBA 5CAYB 3DX9A 5DFVC 1JWUB 1CU4L 2X1XR 2OJZL 1QLRB 4P4KB 4NWTL 1H8SA 4MS8D 4QXUL 2G2RB 4PV8A 5KVDH 3VFNA 4RIRA 4ZUTB 1Q0YL 3GMMB 3O3EA 3HC3L 4X83A 2J8HA 1YDPA 1FG9C 2ZKHL 4BUGA 2BHYA 3BIBX 1MCKA 1QFOA 4BUHA 1GGIH 2X4UB 5H94B 1M1SA 3QEUB 4YZFE 2Q8AL 2UY7A 1JCKA 1Z3GL 4KRNA 1QLFA 3ARGD 3EIFA 3QBTB 2EDTA 3T3MF 4Q9CA 2DTMH 2JJWA 5BZDA 3RZCC 1TQBC 3ARPA 2FX8H 2OL3B 4EI6A 1ES0A 4IIQB 3VA6A 1S9WA 4Y4HC 3U4EB 1BOGB 1NCAH 4XBEL 1IGFL 2XNAA 1RJZB 5FYLE 3GM0A 5E8PB 5F7WC 4HFWB 5KSBA 4FQ2H 5FYJU 1DBAL 4WI5A 5DRZA 5F9OL 4I48B 3OWEA 4Y16B 4U6YA 2OTWB 3RGVD 4PJBB 1OLZA 2J6EH 1OTUD 3IU4L 1BF2A 1RAMA 3ROOB 1UJ3B 1WFTA 1F4HA 1N4XL 2MHAB 4K7PX 3UROR 1U8IB 5CZKA 5TE4H 3BEVA 4XNXL 3GMLB 1MIML 3IRPX 4JPWL 2J12B 4KK6D 1XGTB 4HH9A 3L3KB 1DANU 5C0BE 4MJ2A 5C9JB 3CX2A 5IESL 4G6AC 1SYVA 5I1JL 5KBNC 5IB4A 1A3RH 1T1ZB 3V0VA 4Q6IC 5T1LD 5KVMC 4K8RD 3QRFM 2RFXB 3MV11 2PXYD 2ESVB 4ENED 5BS0B 5BQ7A 3BP5B 3TIDB 4ZQKA 3O41B 2JB6A 2IMMA 3TA3A 4NQCD 4YHPA 3S4SA 2DICA 3GSNH 3OMZA 3EGSB 1UGNA 2HLAB 5DTFA 1W72B 3LRSA 4CDHA 4R0LA 3FFCE 3QDGB 5BMFL 1JPGB 1T1YA 43C9B 4H5SB 4HZAA 4DEPC 2L7JA 4RDQG 4HPYH 1CIUA 1U92A 5D2NB 2K1MA 1XIWB 1RIHH 3AU1B 2JCCF 4APQB 1NCTA 3ZTJH 3DVIA 2VN7A 4XNZB 5IVZB 1JRHI 3GRWL 1N0XL 4M1GH 5DUPL 5TFSH 1MJJB 5ICXB 1IEBB 2W0LA 3UO1H 4GAYB 1FYTB 5GGTL 4DW2L 1IKFH 1QFUL 5JXEA 2AKRB 2FIKA 1VFAA 3BPOB 2EYSA 5CGTA 4WW2F 5IM7B 5JHDA 1S7RB 1FZMB 1EERB 4EUPH 1Z0NA 1DCLA 2VOTA 5JW3L 3TF7C 2X9YA 3BPLB 4D9QD 3QDJD 2A2QT 4P59H 4RISH 3DO7B 1KN2H 3HZMA 1RIVL 5D96C 3UJIH 5T1DL 4JO2H 2VXTH 4PJIB 4QKXB 1ZS8A 1PJ9A 1J88A 1RU9H 3BGMB 5D9SB 4JO4H 2WBJB 3T77A 1J05A 2NTFA 2R29L 3BW9A 3DVNB 2Z4QA 1P4LA 2GJZB 5BXFA 1J5OL 3BKMH 5CLTA 2ZOKB 4CNIB 3CSYA 4M6MH 3VI4F 3RZCA 1PBYA 4HT1L 3MO1A 1KXVC 3SOBL 1II4E 4JHZA 1WBZA 3HZYA 5HGDB 4G7YH 4MNHA 3D2UB 4NKDB 3OKDA 5DJAA 2RGSA 1VGKB 1NJ9B 4CU6A 2NW2A 1HN1A 3BEWB 1U95A 3VFUB 4KY1H 1C5BH 4L3AA 3FCTB 4JFYB 4PJGA 4FZ8H 1EO8H 5GGVY 4XPBL 4KZDL 3IKKA 5IF0A 1WZMA 5FDYA 4IHOB 1OAYH 3OKNA 5AYQA 4EOWH 3QDMB 2XKNA 3ARRA 4MNQB 4LAQH 5DJZB 3ZKSD 4XP6H 3T0EA 3GI8H 4BQ6A 3WFZA 4BH8B 3MGOB 3UC0L 2VLKD 4QRSB 3GZKA 3V7AG 1NFDA 1AH1A 4GBXA 4L8DA 4ZOCA 1BEYL 2WV3A 2AEPH 1FZKB 3CZJA 4NNYB 5C0GB 3H8NA 1LILA 5JXAH 1G6RA 1SY6A 5GXBB 1I8MA 1JZ8A 4HMEA 3ZO0A 4ZYKA 1MH5A 5HHQA 3DX7B 4FQQA 1INEL 3D0LA 4QRUB 4DK3A 2YZ1A 4LVHB 1S7TA 2BVPA 3PWLA 7FABL 4XXCA 2HVJB 1NUGA 3S36X 4LL9A 4QWWD 2ITCA 3PE9A 4NBYB 4P46D 3FQXB 2NX5A 3ARTA 4TOYL 1NCBH 1ZKAA 5HD8C 1IILE 3ULUE 3MLXH 1T0NB 4MQSB 3K1DA 4FABL 3KYKL 1MFCL 1J1PH 3VA2C 2ZUTA 3FFDA 3O4OC 1E4KC 5DMIL 2DRUA 4KV5E 4IEFB 5L0QC 2X89A 1E6OH 3NH7L 4YHML 5ADPH 1FNSH 3OB8A 4P5KB 1I7RB 4WUUE 5FF6A 3ULUL 3ULVC 1JBJA 2YMXH 4Y19E 4HFUH 4X6FB 1MWAL 4J8RA 4HKJA 1NQBA 4UQ2A 1KCVH 3VXNA 3ZKMC 1S78D 3WNMA 4L3CA 3GIVB 3SCMC 2FR4B 1RUML 5F3BB 1MHPH 1MJ7L 3R8BB 5JORB 4K3DL 3WXVH 4F7PB 1WT5C 2AJXH 3QHZL 1RSFA 1CFVH 1ZHKA 2VQTA 1HHHB 1WFUA 2B2XL 5CIPA 1EVTC 4HHAB 1B0GB 3HE6A 1JZ4A 3MOAL 2GK0B 1KB5A 1RULL 2VXQL 1Q1JL 2VZSA 2ZG2A 5HHME 4YNYA 1TETL 1WJ3A 1YMME 4FFYL 3QNXA 3PWJA 3T3PF 4P2QB 3QUYA 2UV3A 2WWKT 2X1WL 3VD3A 2P5ED 3RNKB 2X4QA 1FNEA 2A74B 3I6KB 1F8TL 5EZLB 3NGBC 1Q72L 2K7PA 3MV9A 3CFEB 3V2AR 1RY7B 3UAJD 4D9LL 1A6ZB 3O81A 5E94A 3R4DA 1T5XA 4K2UH 5IT2H 1DUYA 4A6YL 1D6VH 3LHPH 3P11L 2YK1H 2F58H 1DSFL 3TVMD 5JOPE 1IGIH 1SBSH 1HWHB 1F13A 2DBJA 4RAVB 5HBBA 1J18A 4EVNA 5EC1B 1R3HB 2XA8L 2WWMD 1JPFA 2QR0B 4KUZL 4MXQC 4PGEB 3F65A 5MENE 1YN7B 3OBAA 1R5IA 3DRQB 3HC0A 3L6FB 4NM4L 4Y4FA 3D6GA 5I17A 4LBEA 2DMCA 1AJ7H 4K07A 5GGQL 3B9KB 2GUOB 1G9NH 1QFWL 1ZTXH 3P4OA 2XWBB 1MVFA 4C56A 3VXMD 4MDJB 1P7QB 2DM4A 1VADA 3KG5A 3LZFL 5ALBL 1CBVH 4HD9A 2ICWJ 5ITFB 1G7HA 2C3VB 6FABH 3Q0HA 4BFIB 4Y88A 4MWFA 4MAYA 2ICWI 3BP4B 3BQUA 3B2UD 2IAND 4HSQA 3IDIB 3P4LA 1ZAGA 5TGBB 4LPVA 4OLYH 3OGOE 3CDYA 5IW6A 1RZGB 2BRRL 5AYUL 3GIZH 4DKAA 2C1PB 1MCDA 4MCYA 3QIWD 1WWBX 3JV6A 5DT1H 4UTAL 3EO9H 3GKWH 1CF8L 1KLUA 1PZ5B 2EC9T 2PYEE 4HUUA 4LLUB 3AS1A 1CFQA 4FQ1H 4N0RA 3CSGA 4X6CF 4MCZA 2WM0A 4PRPD 1QQDA 4WI2A 3HZVA 4HKZB 4JFOA 4TQEH 1YUHA 3DHJA 4YE4H 5E6IB 2I9TA 4UINL 4OD3L 5E8DL 4OCXL 5GJSH 1JMZA 4NC1C 5MERA 2GI7A 5C0CD 1R5WB 5HDBE 3TV3L 5EU7E 1GGCH 4HXAL 5HSFA 1DQJA 1G0XA 4XCEB 3RVVC 5ESAA 2Q87A 3MV8D 5ETUA 5E2VH 4HKXB 4HBCH 5HHOA 5FCSH 5JW4R 4NQXB 4FQLL 4X9HA 3ARDA 2EIZB 3VWKC 5KAQF 1G6RH 3C2AH 3F5WB 1R6VA 3X11A 3HE7D 5DFWH 3MBXL 5HVWA 2M1KA 5I30H 2V5YA 1EUTA 4J4PC 5IW1B 3EO1A 3R06B 4S1DC 4LSVH 1XGYH 2V2TB 4OCMC 1KIRB 5C0RH 3B6SB 3P30H 5BRZD 4NQVB 1MFAL 2YZ8A 3P40A 5D1QB 5L88H 1XEDA 4LCWB 2D3VA 1A3LH 1J86A 5GIRA 1KT2B 1UG9A 2A0LC 5TQ0L 1D5BA 2JLLA 1MQKL 2DWDA 4G6FB 4UUJB 1B88A 5D1ZC 3QPXL 1DZBA 5EU6A 3VGAC 4W6XB 2HRLA 1J12A 2V5RA 4NJ9L 2D03H 2HYMA 5J6GA 3KWWA 3UBXB 5C0IA 4GG6E 4YGVA 5HHVH 5DHVB 4Y1AA 5GS0L 1ZLUK 3JWDC 5KANI 3VW3L 5MEOB 3AREC 5EZIL 5C7XH 1NBVL 1U93A 4OT1L 4NQSA 3ZYJA 4WV1C 2DQTH 5EOQL 2CIKB 3H0TB 5E56A 1MI5D 1KGCE 2H8PA 4JHWH 4L9DA 4NPYA 3UBXG 2HTLD 5TDPA 4UOJA 4ALAH 1BAFL 3U2SA 1D9KA 4TPRH 1XF3B 3Q3GB 3QA3A 4JFQA 4CRPA 1F3DH 1KC5H 3F6IA 4HK3N 4PB0H 4GSDL 1U6AH 5CIPH 4JDVA 5DJYB 5D7SL 3EAKA 3RTQC 1MNUL 3TESA 4YPJA 3VRIB 3MLZH 1XGPA 1GOGA 5FFLA 1LNUA 4PTUB 1CGSH 3QAZB 1HQRA 2EDDA 4KRMB 4PD4K 3ARBA 4HUXA 5AZEL 1R0AH 3BRGC 2YPLB 5DVLA 1FGVL 2XTJE 4XXDA 3D18A 3ARFD 4IRJA 3U79A 5BO1H 1EFXA 4KKAD 1HOCA 1GAFL 2DL9A 3G5ZB 1ZLUH 3QXVA 1CU4H 5J4MA 2ZUXA 4ZNEE 1NCWL 2OJZH 3MGAA 3OHXB 3NAAL 3I6LD 2UZYB 3RBGA 4WFED 1NEZA 3VGHA 4NWTH 3VXRE 1PFCA 2W60A 4QXUH 3D1MC 3P77B 3ARQA 4CN4A 3UTSA 1GZPA 5T1MB 1Q0YH 3KYAA 4OLWL 3JV4B 5EA0L 3HC3H 3MREB 5T5NF 2BX5A 1I1AC 5JIIA 2ZKHH 4LHJB 1WV7T 2A73A 2YD7A 2GJ6A 4PS4L 4OIAA 2FEEL 3GUTB 3VWKA 3GMPB 2Q8AH 1F4WL 3SDDB 3UTTB 5JIPA 4CVXA 1Z3GH 4ODWB 1FFOB 1T4KB 1WBXA 4IS6A 4ZUVB 1KSRA 5IB1B 2E9BA 1FP5A 2N7AA 3E3QE 5FK9B 5E5RB 3UJJL 2OSLA 4NP4L 1PVHA 3C8KA 4U7MA 2A9NL 3O3DA 4POZD 1G7LA 1MY5A 1QSFD 2Q1EA 3HRZB 4JRXE 4K71B 4XCFL 1CFSB 3WUZA 4F37F 3OKOB 2ARWA 3MUZ1 4IRSD 4QOKA 4UNVA 4XBEH 1IGFH 5KZCD 1EAPB 1RFDL 5IP4A 3UTQA 4ERSL 2O5ZL 3HB3D 5DHYB 1Q9LA 4EZMA 3D85D 1DBAH 4DWHA 1G7QA 3MV7D 4JFEE 4LLVA 1QOKA 2HJKB 5F9OH 3TCLB 4M5YL 2HG5B 5D7LB 4BQ9A 2XWTA 1FZJA 8FABA 3GBLA 5AUMB 1S5HA 4ZS6C 2R1YB 3CZFB 2YS4A 3IU4H 4Q6YA 1N4XH 1E4XL 1I9IL 5FOBB 3MNVB 2NY0B 4XNXH 5LAXB 4JPWH 1MIMH 3LCYA 3VXPA 4PBVC 1NDMB 3TO4D 3EOYG 2HT2C 2CUHA 1MWAA 4XI5D 4EI5C 2ICES 5IESH 4YX2L 2AERT 5I1JH 4OZ4A 5FUOL 2Q7YB 4M62L 5HGGS 1T2JA 5F44A 4X80L 1U3HB 4BJLA 4MNGE 1JF6A 4KKBD 1HHJA 3CFIC 1DN2A 1HQ4A 5DLML 4MX7A 3LKQB 3SDCA 1I3GL 5DF0A 3TBSA 2B1AL 3PUCA 3BP6B 2DIJA 1MRDL 1AHWA 1XF4A 2YR3A 2YA0A 3SO3C 4Z77A 1LP9A 5BMFH 1LDPL 2QEJA 3QI9A 5K33A 4OGAC 5EBWA 2Q7NA 3I6GB 2BNRD 1UKSA 1TJIL 1NAMB 3K74B 4K94L 2Z8VC 2EXYD 4POUB 5DVOA 5J56B 3QQ9C 4HLZG 4A6YA 1HYSD 2NY5C 3GRWH 1N0XH 5DUPH 2BMKB 1CLCA 3CCHA 4ODXB 2AV7B 4F7EA 3O9WA 4L4VD 2JJVA 5GGTH 2F53B 4GRWE 4DW2H 2JIXB 3FAXA 1EIBA 1JV5A 1QFUH 2Y07L 5E4IA 1U8QB 1INDL 3DOSA 3IDJB 4PJ8C 4NDMB 1E27B 2XZZA 1IL1A 2K7QA 3DV6A 2C4FT 5JW3H 4CVZB 3NN8B 1I1AA 5ICYA 2FB4L 1F00I 1KELL 1YYML 1RIVH 4GQ9L 3HNSL 4U2ZA 3BWAA 5T1DH 3MRIB 1HH9B 2BERA 4L3EA 1OF2A 4POYA 4E0RA 5D1XD 3RNQB 2R29H 4C55A 4M6AA 4QRPD 4NRZA 4PP2A 1U0QA 3V8CA 1J5OH 2AEWA 4UU9A 5E0QA 4HT1H 1JGLL 1QBML 2FZ3B 3D0VB 4ZFOL 3SOBH 2KDGA 4HUWB 4OF3A 1AGFA 3A6OA 2JJTA 3ARGB 5C71A 3C6LA 5F93C 3IRZA 5DJ8A 3EZJB 1R3KA 1NDGA 3KGRA 5B38B 4I4WB 5HI5C 4G80B 5DQJB 1CD9B 3X12B 2PUQT 3LN5A 1W0VB 2RCSL 1EEYB 1XCQB 3DMMD 1DN0A 4AG4L 3OAUL 4DGVL 4Z6AT 2CPCA 4TYUA 4BZ2L 4KZDH 3MRQB 3ZHLA 2CLVA 1RQ5A 2PTTA 1PLGL 2VXUL 3CFJA 3RGVB 1NCNA 2WBWB 3CPLB 4Z78B 3VXOB 3UC0H 5FO9A 5GGRA 1BEYH 1MIEL 4I2XB 4QLRA 1SEQL 1IZJA 2EDXA 5D2LA 1YEHL 3GK8L 1YEJL 5T1LB 3ZKNC 4Z7WB 4WEMB 3FN0L 1INEH 1P84J 3SDAD 1T7YA 1NUNB 1X44A 3C60A 5CP3A 1AGBB 4L4TE 3DETD 4E41E 1QHPA 3WJLC 7FABH 4NQCB 3IFOA 5ITBL 5F70A 4IIQC 4M02A 1I1CA 3EYQD 3E2HB 4TOYH 2NYYC 2ZCLL 1X6LA 2R1WA 2PCPA 4FABH 3KYKH 1MFCH 1VEMA 4J7RA 5DMIH 3VXUA 5KS9A 3MGTB 3PV6A 5E5UB 1KIQA 3I75A 1TTUA 4PJ8A 5GGRY 1JP5A 3NH7H 4YHMH 2ATKA 4LLQA 1UM5L 3L9RA 4Y89A 2AJYL 3ULUH 3MLRL 2KL6A 3EKCA 4LARL 4JGJA 3DSNA 2CQVA 5JMOC 1FFRA 3UDWC 2ADIB 1MWAH 3LKOA 3KLSA 4I3RL 5CEXA 1Q9KB 2FGWL 5F89B 5C6PB 3EJJX 3MSPA 3QDJB 1RUMH 4X7EC 3TZVD 1MJ7H 3RWEA 4K3DH 3HG1E 3RFZC 3QHZH 5JPMB 3EYFA 3VE0A 4CBPA 2A6KB 4S0SD 4OLZL 3FT4A 2B2XH 3DRTB 2I26N 4M9PA 4C58B 1ZHBA 3MOAH 1MLBA 1CIDA 1RULH 2VXQH 1NUDA 3SQBA 4H1LA 1Q1JH 1A6AB 4IRZL 5IOPB 1TETH 4FFYH 4Z7UB 4JFPA 1H15B 3OKEA 1FV1B 1A9BA 5JOFB 3F7VA 5D2NC 5DK0B 1F4XL 3RDTA 2YA1A 4EQ3A 3OR7B 4GRLD 3MJ7B 2FIRT 4APQC 5I2IB 1F8TH 1Q72H 3QUKA 4PREB 4XNZC 1BJ1J 1T80A 1SYSB 5IHZA 1NFKA 1KBGL 2VC2L 2WIIA 3P0YL 2QKIB 4D9LH 4XCNB 5IVXB 3SGKC 3L3OA 4V2CB 1R3JA 4Z7VA 3MLVH 4D0BB 1FRGL 3BZEA 5FA4B 4A6YH 3P11H 3T1WA 1DSFH 1JWUA 2N4IA 5D6CA 4GH7B 3EYSL 5IBLD 1QLRA 5I1CL 4P4KA 2IALB 2VAJA 2XA8H 1NBYB 3TT1L 4KMQA 4KUZH 1T22B 4N0FA 1AQKL 4ZUTA 3GMMA 1KJVB 4PLNC 3BPLC 4NM4H 2VLKB 3ORJA 4ZFZB 5D5MA 4QHKJ 5GGQH 5H94A 2R2CA 3RJQB 3QEUA 1QFWH 2VLJE 2YBRB 2WBJC 1NMBL 4HCRL 1U8JA 1I7ZB 1U8NB 3LZFH 4ZSOE 1UM4L 2XV6B 4QHKI 4KK9D 3EO0B 3PXHA 3MUGB 2VZTA 2OL3A 1DVFA 1RJZA 5E8PA 2X4RB 3KXFD 4PJ5E 1ZT1A 2F5BL 3IDMB 5C07D 5C0AD 1NGZB 2BRRH 1OM3L 1QRNE 1JZ6A 5AYUH 4I48A 4Y16A 4P46B 4ZO7A 2ZWLT 4QRRE 1W0YT 5IB2A 1ND0A 4UTAH 3GSQA 3GJEB 4MA7L 4U33A 1CF8H 1LO2L 1UJ3A 3ROOA 3LKPA 5CLWA 1U8IA 5FIEA 2MCPL 1NKRA 4JVWA 2EDKA 2AXFA 4ZTPL 1XGTA 4QXGL 2I07B 3L3KA 1K8IA 4L5FL 5C9JA 3H7BB 4UINH 4OD3H 4YAQB 3OQ3B 5E8DH 4KZEL 1X5GA 2YD8A 4OCXH 5JA8B 3VG9B 4PJEB 1T1ZA 1T5WB 1N26A 1FZOA 1KCSL 4AT6A 3SDXB 5FKAB 3TV3H 2P8MA 1JWSB 4HXAH 2MQ0A 3PNWB 3MUY1 4CJ1A 5CJ5A 1YN6B 1P6AB 3BP5A 1FL5A 3O41A 3SGEH 3F12A 3CVHL 4FQLH 4J1UA 2R56L 3V6OE 2HMID 4JDTL 3EGSA 1K85A 2HLAA 4Y4KA 1W72A 3IS1X 3MBXH 3QDGA 4KU1A 2VSCA 43C9A 4H5SA 4HX1B 4HPOL 5EN2B 4HJGB 5CP3H 2W38A 1RZ8B 3UPAA 1MFAH 2W9EL 1K4DB 1XIWA 4HZLB 3QWOA 3AU1A 2AXJA 1T0PB 5IVZA 5TQ0H 1A1MB 1MQKH 1JK8B 3J7HA 4P3DB 3QPXH 1K9TA 5C09A 1O7SA 1MJJA 5ICXA 2D7MA 4NJ9H 1N64L 3H3BC 4MXVE 3G5VB 5GS0H 3O11A 3VW3H 1Y6NR 5IM7A 1S7RA 4OFPA 3MMEB 4DTGL 3TVMB 4NQEE 5EZIH 3QFJA 1NBVH 4HV8B 1I8KB 4U1HB 5DI8B 4PRAA 4OT1H 5SWZE 1YJDC 2ADFL 5F1IA 5LJYH 3TPUA 3EFFB 5EOQH 4LRNL 4UV4L 3BGMA 3TWCL 5ISZD 3WNPA 4UDTB 4FQXB 3HZKA 5EDXA 5JIHA 1YPZA 2ZOKA 1BAFH 4YHKL 4LP4A 3PHQA 4FFVD 3VXMB 4GSDH 5ABDE 4OJFL 4PIRF 1YY9D 1RUKL 2C1OA 5D7SH 4D8PA 1MNUH 5TQ2L 3D2UA 4NKDA 4S10A 4JM2F 1VGKA 1WCQA 3RVUC 3VFUA 2C26A 3QFDA 2JK5A 1KF9B 3FCTA 5GGUB 1Y0LA 3ZYOA 2BOBA 5JPNB 2QADC 5AZEH 2IANB 4P23D 1FDLL 3QO1B 2A9ML 1EXUB 1FGVH 3TH3T 4GG6F 3DVFA 5H37G 4FQHA 4Y5XB 3QIWB 1QFHA 3MRCB 5LKNA 2LTQB 4LPUA 4MA8L 1X5FA 5DJZA 1GAFH 4R96B 3Q6GL 3UTZA 3CC5B 3V6FA 1LEKB 4BH8A 4ELKA 4PRPB 4QRSA 3NAAH 1KV3A 1XGQB 2CH8A 3ULVE 2WQ8A 4PJ7A 5HYJE 5IR1B 4J3TA 4OLWH 3VXSE 5EA0H 4NNYA 4X98B 5C0GA 2CKBB 2DWEB 4PS4H 3B9KC 5CJQL 1EPFA 4FXLA 3DX7A 1F58L 5FOJA 1F4WH 4JANA 4QRUA 4KJPC 4XP4L 3U0TB 1C7SA 3NIDE 3MV8B 4FXGA 1JYWA 3RIFK 2IADA 3ZE0F 1KLFA 4LPXA 3UJJH 4NP4H 2NXZC 4LK4A 2A9NH 2CLRA 4XCFH 4O5LL 3SY0A 5FM4A 2X6MA 1RFDH 4ERSH 2O5ZH 5BRZB 2ZG1A 3GM8A 1NMAL 3CH8A 1DLHB 1HK6A 5FM5O 5ELIA 1KLGB 4AENB 2V2XB 4M5YH 2RQ8A 2DN7A 5C08E 5GZOC 1PKQB 3V5KB 3CD4A 3RWDB 1E4XH 2R69L 4UDUB 1I9IH 3DYPA 1GOFA 1NGWB 4P5KA 1I7RA 4B0MM 2DLFL 5DD3L 3KPPA 1EAJA 2DLEA 5K9QG 5E6IC 2ZNXA 1FC2D 2WNGA 3VFMB 3WS3B 2OR7A 4YX2H 3DSFL 4KMLB 3GIVA 3L3IB 4JY4A 5FUOH 4U1LB 2OBGA 4M62H 5JORA 4F7PA 3EOTL 3IXTA 4X80H 4OGYL 1MI5B 4R2GD 1T03L 5DMJB 4HHAA 5DLMH 3PDDA 3GMRB 1LO4L 4JLRA 2GK0A 1I3GH 1F90L 1FORL 2B1AH 1IAII 3AY4A 5FYKL 5DZNA 5E4EB 1MRDH 2W0FA 5I1AB 3BN9C 5LXGL 4GS7B 4YHNB 1LDPH 4Z7OE 2B5IB 3WUWB 3O6LL 2Z9TA 2YD5A 2E8ZA 3RNKA 3LPGA 2A74A 1DUZB 1TJIH 3U0WL 4D0DA 3JWOC 4K94H 2ORBL 3IJSB 5FHBL 3CFEA 4MJIA 2LAGB 1UCBL 1FPTL 1KCKA 3W0WE 1A6ZA 1I9EA 5B3NA 4KXZI 2BSSA 4FXKB 1A1OA 4OI9A 1AO7D 4DGIL 5JXED 1Q0XL 5JHDD 2J4WL 1CXEA 1ZHNA 3V79C 1OAZL 4RAVA 5CILL 2Y07H 1R3HA 4HJJL 1INDH 1CGWA 3ARFB 4WO4D 4U4BA 2AK4A 3GSXA 3KPRD 3L6FA 2VDLL 4JKMA 4N1EA 5HJ3B 2FB4H 5IFHL 2VDQL 1KELH 1YYMH 3WLWD 3B9KA 4GQ9H 3HNSH 2GUOA 3GI9L 4NC1E 3Q1SL 4HCRA 5L2KE 2J8UE 3EYOA 2C9AA 3DYMA 2XWBA 4U0RC 1N3NB 5INCB 4J12A 3V6ZB 2Y4SA 4MDJA 5B8CA 5IG7B 3IDGA 4ZO9A 4WW1A 3WBDA 1BJ8A 5ITFA 3MLTB 4FQPA 1RJYB 1JGLH 1QBMH 1CG9B 3LRHA 1T83A 4PRIA 4RMVA 5SX4I 4OUUB 2NXYC 4HLJA 1HINL 4LSDA 3BP4A 4YIQB 3W39A 5TGBA 1KTLB 1QSFB 3QAZC 2A6IB 2C1PA 1RZ7L 1JI1A 4KJYB 5KZCB 2RCSH 4PJCB 4DCQA 3RL1A 1KULA 4LLUA 2X1OA 4KROD 5ID0A 4AG4H 3OAUH 3D85B 1Q9OB 32C2B 4N90D 4Y5VC 4DGVH 4BZ2H 4FTVD 4S11A 5E2JA 3WKML 3IF1A 3DURB 3DX6B 4GRWF 3L95B 4NO5B 1PLGH 2VXUH 3T0ED 3BX7C 2NY7L 1N6VA 3FQRA 5E6IA 2IPKB 3RUGE 1VKXB 1GIGL 3VD4A 4FG6D 2DQEL 2DAVA 4R8WL 4GBXD 4YR6B 3O6KL 4N8PA 1W0WA 1XT5A 3DTXB 3MNZB 1OLLA 4YXKL 3GDBA 4WHYG 4HAGA 3VD5A 5C2BL 1MIEH 4MD0B 4S1QL 3SPVB 2LAAA 1SEQH 3CVHA 4FRWA 3FHAA 1HDMB 1YEHH 1IVLA 3RHWK 1OWWA 3GK8H 1YEJH 2A1WL 4NQXA 5DEGB 4TSCL 4Z0XB 3FN0H 3W5MA 4F9LC 3SDDC 4MVBC 1SEBB 5F7LB 4F33B 4I0PD 4TN9A 1EV2E 1KIRA 3B6SA 4NQVA 5ITBH 5EO9B 5D1QA 2NX5D 3ILPB 3FTGB 5CEZE 4LCWA 4K71C 2HRPL 4IOFC 2J5LB 3O6ML 1T6VN 2VABB 1ZHLA 1T20B 2VL5B 2ZCLH 2BNRB 3KAAA 3O3AB 1KJMB 5KSBF 3AXLB 3U82B 3HS0B 4AH2A 3BD5A 5KTEL 3VRLE 3HNTL 3UBXA 2MPAL 2X89D 5DHVA 5CEZL 5SWSD 4TNVK 4WW2C 3REVB 1GGYA 2YN3A 5DVNA 1YECL 4TVPE 3GSRB 3W11C 1UM5H 3HHRB 1DBJL 3RVXD 5K9KA 4L4VB 4WHTA 2AJYH 4RBPH 3MLRH 1L0XA 4HMCA 3U0PA 1PY4A 4LARH 4XRCB 4YO0A 5C86A 1Y6MR 1UVQB 4I3RH 4F58L 2X4SB 2ZCKL 1IQDB 2FGWH 3OGCB 2WIMA 3NVQA 5DK2B 4TVPL 5BZWA 4DZBA 3HE6D 2R9HC 1U3HC 4JE4B 4HJ0D 1XF3A 3Q3GA 4OLZH 4G9FA 5D1XB 1PX4A 3PL6D 4MA3B 4QRPB 1AE6L 4AQ1B 4LLWA 5BVPL 3V0WL 5DJYA 4AJ0A 4AZ8A 3G9AB 1VESA 3QUYD 4IRZH 3UCRA 4PJHE 5TF1L 3KPLA 4XNQB 3T1FB 3GSWB 3MV9D 1F4XH 1JNHB 2H2SD 2HFEA 2LVCA 35C8L 5EO0A 1OP3K 2D4DA 1P1ZB 2CRIA 2PF6A 2UZIL 2D7PA 2OQJB 1KBGH 2VC2H 3P0YH 4AQOA 2Y7QB 5FKPA 1C08B 3N1GC 1KPRB 3DMMB 1KPUB 1FRGH 3H9YA 5JIKA 3BMWA 3G5ZA 4ZAKD 1B90A 5ALCL 1OTSC 3G6JA 4EIGB 2APVA 3EYSH 3OKLB 5HGHB 5I1CH 3BPNB 2YEZA 2HT4C 3QXDB 4MD5A 3TT1H 4TTGA 2XRAL 1CD1B 1AQKH 3HR6A 4WDIB 4Z7NE 2F9BT 3JV4A 3M1BB 4BSVB 3SJVE 3EOBA 1A3QA 1KG0B 5JQ6L 4MS8C 3UX9B 3QEQA 3U9PL 4F9LA 2X41A 3UTTA 1NMBH 4WCYL 4HCRH 4ODWA 1FFOA 1T4KA 4ZUVA 5IB1A 5C6TL 1A4KB 1UM4H 7CGTA 1BMGA 1DQDL 4MAYD 3S96A 5GQBA 3SDAB 3BQUD 4R7NA 3OKOA 2OLDA 3ARGC 2ERJB 3JTSB 5IB5A 3HCVB 4JZJB 4CMMB 5DHYA 2F5BH 4UOW1 5T3ZE 3MLYL 4QRTB 1OM3H 4KK5D 2BNQA 5IHBA 2HG5A 3OAZK 3QUXC 1OP3H 1B6DA 4R3SB 4UQ3A 5F9WC 3SE8L 1YC8A 3Q5TA 1NGYB 4MA7H 4PGDA 5DMYA 3CZFA 1G7MA 2J1KA 1IC5L 1LO2H 1IAIM 1X5IA 2MCPH 3FQTB 5FOBA 1FNGB 4O2CA 4OQ1A 5T5FL 3GBML 3HMXL 2XZQL 4ZTPH 1FFQA 3RGVC 4QXGH 5T3ZL 1MCQA 1A7QL 1D5MB 3MYZA 5FYJE 3U7AA 1OTUC 4L5FH 1N0LA 4TVSa 4GMSL 4KZEH 2E3VA 1L9NA 1OSZA 3ES6B 4X9BA 1JF1A 1J0IA 2DF3A 2Q7YA 1KCSH 1UJTA 4MB5A 3T0DA 4EN3A 4M03A 2XT1B 1NFDF 4ZO8A 4P2RA 1T04B 2FD6L 3ARDD 4P9ML 3MFFB 5D93B 1VGEL 1SJHA 3TZVB 1S7WB 5IMLB 1GJIA 3CVHH 4K8RC 2D2OA 2R56H 3BP6A 4JDTH 2PXYC 4DUWA 1QD0A 1CLZL 3H9HB 4HPOH 2GITA 5J0BA 3CFBA 5EC2B 4PJ9C 2YRLA 4JFFE 3VGGA 3S3JA 2W9EH 3VFRB 3BZ4A 1NAMA 5DS8B 3OKYA 1U8MB 3FRPG 4PJDE 3N50A 1KTKE 5EU6D 3E2HC 3MRRB 1BVKB 1JHKL 3C6SB 3KPSA 4GRLB 3GEWB 5I15L 4LOUC 3RZWA 4NNXA 4ODXA 4X5WB 5KVEL 5IWLA 3C8DA 3DUUB 1IM3A 1N64H 4JPKL 1OHQA 5L8LB 3GMNB 5DJDB 4M00A 2QSTA 1FN4A 3QDAA 4FA8A 1VFUA 3FQWB 3VH8B 3IDJA 4WGWB 3JVGC 2OZ4L 4NDMA 1E27A 2VLRA 3OR6A 3QEGL 4FZEL 2OI9B 4DTGH 1SJEA 1MJUL 4CVZA 3NN8A 3NIFE 2ADFH 1WCBB 4LRNH 4NZDA 4M8QB 2B4CC 4UV4H 2FSEA 2R23B 4W4NA 3TWCH 4NRYA 1M7XA 1PW3A 1PYWA 1D9KD 3G5XB 3VG0H 5K9OB 5F3HA 1P9MC 3DHMA 3FB5B 5DZOA 4YHKH 3ILQD 2FZ3A 4L8SC 3U7WL 5TE7L 1U3JA 3ZTNL 4JJ5B 1OAKL 1RUKH 5TQ2H 1YEKL 3IXAA 1X3DA 1HXYB 4E42A 3RI5F 1E0OB 3RJDA 3U9UB 3C5SB 4I4WA 5DQJA 3ARBD 5CFHA 4XHQA 4XVSL 3VMPA 3FO9B 1ZA3A 1JFQL 1GGUA 1EEYA 3AMLA 3KXFB 1EHLL 5J11B 1FDLH 4UMGA 5C07B 5C0AB 2A9MH 3MRQA 4IRJD 2VLLB 5A2LH 1EFXD 1I75A 2JCCB 1FIGL 4PR5A 4KUCD 3U36B 3RGVA 2X4OB 4UV7L 3DX8A 4MA8H 4MD4A 4Z78A 2VR4A 5HY9B 3LQAL 4PJBE 3Q6GH 3IFNL 3VRJB 3FONB 1KFAL 4DZ8B 1U3ZA 2XI9A 1KTRL 5ACMA 1MELA 4OZFH 3UTSD 3GNML 5A2FA 1ADQL 3WFHB 3QPQD 2ED8A 2GJ6D 5EOCL 3HNVL 5E70A 4LSSL 3LIZL 1UQSB 5CJQH 5LG1A 4Z7WA 4LPWA 1TENA 3GSNB 1F58H 4TNWF 5ESVA 4XP4H 4F7TB 2ESVE 5LGJB 5CJOL 1A4JB 3S98A 1X5LA 5BS0E 1VFBB 4B7IA 4NQCA 4QOKD 5CMAB 1N8ZB 4JFDE 4JO1L 2D31A 4M7LT 2X2YA 4O5LH 1V8HA 4NO3B 2XY2A 3CVIL 5IB3B 4Q0XL 4WTWA 4C54A 4PGZA 5CD3A 4HEPG 3ZYZA 4RGNC 1NMAH 2AJUL 5D2NE 2I60L 4QWWC 2V2WA 2V9RA 4X7DC 4DKDC 4P46C 3F62A 4C83B 3OXSB 3ULUD 2GYSA 4NNPL 3MGTA 1S9YB 3JVGA 3TO2A 4XPGL 5I8EB 2R69H 4EUPB 3ZTJG 5KG9B 3HUJB 5I8OL 2Y5TA 1HZHL 4WTXA 2DLFH 1FYTE 5DD3H 3TBWB 3ULVF 3FAWA 2ADIA 2ZJSL 3DSFH 1Q9KA 3VG9C 3IAGC 5F89A 5JLZB 3QDJA 4Y19D 3D5OF 5JPMA 3EOTH 5E8EA 2A6KA 2WANA 1ORQB 4OGYH 4WI7A 4PJIE 5FEBA 1S78C 4EUPG 5ISZB 1T03H 3NIDF 1LO4H 5E9DE 2Z31B 1F90H 1FORH 3RA7L 1A64A 5FYKH 2D9QB 1B2WL 1NEUA 3QI9D 3MJ9L 2FLBT 4HLZH 3BRDA 3HFML 4WFFD 1A6AA 5LXGH 2AXHA 1BOYA 1H15A 3O6LH 1Q94B 3KPMB 3WIHL 4G8IB 1YMMD 5J13B 2XKSA 5EBMB 4M3KB 3U0WH 2ORBH 4CL7A 3SGJC 5FHBH 4PREA 3IVKB 1SYSA 3QG7L 2EYRB 1P2CB 1UCBH 4M7LL 4L8CA 5F6HJ 1NANI 1FPTH 1IAOB 2XZCL 4XCNA 1YC7A 3O9WD 1TJHL 4P23B 4D0BA 3LPFA 4DGIH 1J0HA 5DC0A 4G8GD 5CCKL 1Q0XH 1MQ8A 3CFKB 2J4WH 3IFLL 5DJ0A 3DX9B 1OAZH 1NLDL 5CILH 1X5XA 2IALA 4HJJH 1NBYA 3BDBA 3QDME 3QEHA 1T22A 4OZGA 5KN5B 4Y8AA 3TVMC 5IBUB 4MNQE 3LDBB 1CS6A 1J1OL 2VDLH 2VLKA 4UNUA 5IFHH 2EDNA 2VDQH 4L3ED 4RIRB 3TC9A 2WWMC 2P42B 3GI9H 1YDPB 4Y2DB 3DI3B 3Q1SH 1JI2A 2YBRA 3QUZB 3UMTA 4JHAL 4OZHE 3CFCL 4OFVA 3RPIA 1QLFB 3WL9B 2VITA 3N06B 1IZKA 5IBUG 5BZDB 5GRUL 1NCUA 1ETZB 4ZG1A 1I85C 2XQYG 4Z7OF 1HINH 2X4RA 3C5JA 3EW3B 1ES0B 2EXWD 4NIKB 1QPXA 4K3GA 2XNAB 2Z0BA 3QHFL 3IDMA 1GGBL 4KDWA 1NGZA 3N85L 2FJHB 3FN3A 3N1FC 4YHZL 5SX5K 1RZ7H 1UH2A 4KHXL 2HA1A 3U7YL 1MPAL 3B2UC 3GJEA 4J3UA 3PXJA 2APTA 4U6YB 3SN6N 1FC1A 1MCFA 4EEEA 3HPLA 4YDKL 2H3NB 1MVUB 1CYGA 1WC7A 3WKMH 4Y5XC 3QIWC 4W6YB 4FMKA 3K2MC 1JGDB 2NY7H 3BEVB 2I07A 2OTPA 4WI8A 5GS2H 4KFZC 3DV4A 1GIGH 1FO0L 4HH9B 3T0BA 2EKSB 2WBKA 2DQEH 2IBZY 4R8WH 1T5WA 4WHDA 2ITDB 3O6KH 1CGUA 1W2KT 1NBQA 1SYVB 4QEGA 5DURD 5FKAA 3B5GA 4YXKH 2FO4B 5C2BH 4PRHE 4S1QH 2H32A 4RFOL 3FL7A 4FFWD 1X4XA 1YN6A 1HKLL 3D3VE 3S6CA 1K6QL 1L6XA 3NMEA 3TIEA 2A1WH 3MXWL 4R4ND 3C60D 4TSCH 4MDIA 4NBXB 3QISA 3KS0H 4Z8FL 5HYIA 5BQ7B 4ZQKB 3KDMA 2G9HB 4R2GB 5DRXB 4AM0B 4BKLA 4I3GA 3LRSB 4HJGA 5EN2A 5DRWB 1CTOA 1K4DA 3HE7C 1RI8A 5TE6L 1JZ7A 5F1KC 2HRPH 3CMOL 4NZTL 3O6MH 4JRYA 2EH8L 4NO2A 2O61B 4JPIA 1JK8A 5GS0D 3WO3B 4P2QE 4P3DA 5CUSL 5SX5H 3FQUB 4KK8D 4RMSA 4JFXB 4X4ME 3VXUD 5KTEH 3HNTH 1S7SB 2MPAH 2ZG3A 3BHBA 2OZ4A 5CEZH 1A6WL 5T3XE 1AO7B 1DBML 1T6WA 1EEZB 1YECH 2FIKB 1BJMA 2ZSVA 4R26L 1NFIA 3WN5C 5JHDB 2F54A 4BZYA 1DBJH 5DI8A 4BZ1L 5F9DC 3T4YA 3DBXB 2GY7B 3EFFA 4WO4B 2BSRB 5GSVB 1WWCA 4F58H 4GO6B 1BFVL 2ZCKH 4V1DA 3KPRB 4FQXA 1ZS8B 4TVPH 1PX3A 4XHJD 1C16A 1KGCD 3MQIA 4Y8DC 5BXFB 2NZ9D 4K7FB 3CSYB 3SE3C 3ARVA 2HTLC 1I85A 1AE6H 5BVPH 3V0WH 1MCBA 4JKPL 2KUTA 1WBZB 4QGYA 3HZYB 1AGCB 4GS7C 4XCYA 5TF1H 3RDTD 4BA8A 3OF6A 2AI0L 5FUZL 2GW5A 3ZDZF 3OKDB 4KKLC 5TPWL 1LP9F 2Y23A 3WHE0 5GGUA 4RMUA 2AABL 2NW2B 2IANA 35C8H 4B7LA 5IMMA 3QO1A 4JN2B 4PJGB 4LNVA 3VRLF 1EXUA 2UZIH 2HJFB 4B41A 2V5TA 3P0GB 5IF0B 1UZ8B 3MRCA 3UTOA 2XXCB 4KROB 3S7GA 2XTJD 2P8LB 4FTVB 4Y5YA 5ALCH 1J8HA 1LEKA 5KAQG 2DDQL 3MOQA 4QHNB 3T0EB 3ARFC 1DQLL 4KKAC 1DE4B 2XRAH 1WITA 3PQYA 1TZIB 2WSKA 5MHSE 4X98A 4GBXB 3VXRD 2C5DC 5JQ6H 4BYHA 1EJOL 1G6RB 1CVRA 4I8DA 3U9PH 1MH5B 4WCYH 3U0TA 5HHQB 1A8JH 3MV8A 4FQQB 5C6TH 2VLME 3D0LB 1MRFL 4L8BA 5HPMB 1DVFD 4ORZC 4LDOB 3EJYD 1DQDH 1L0YA 1S7TB 12E8L 2BVPB 2H2PD 3PWLB 4WU7A 3VFOB 3MPCA 4FMFA 4Q2ZA 4OV5A 1N2RB 4I0PB 5DK3A 1H3TA 3DXAA 2YWYA 5FDWB 4RAUB 5EBLA 4NBZB 2P8PB 4JRXD 4AYFA 2NX5B 4POZC 3K46A 3MLYH 1KLGA 4AENA 4IRSC 2V2XA 4LCWE 2C7UB 3SE8H 5DQDL 4R97C 3HB3C 4WFHD 1PQZB 4X7SL 1PKQA 3FFDB 1IC5H 1MFBL 1T1XA 5EPMB 3RWDA 1B3JA 4OCRL 3MRHB 5T5FH 3GBMH 4EIZC 3HMXH 2XZQH 5IBTL 2FX7L 5SWSB 1V3LA 5T3ZH 1A7QH 2UWEE 4GMSH 4Z7NF 3QWRA 4LVEA 3X13A 5DD1L 3M17A 3TO4C 2Q3ZA 4U1LA 3B9DA 4J8RB 4HKJB 4UQ2B 3VXNB 4XI5C 3OKMB 5JDSB 1OAQL 4L3CB 4NCC1 2XN9E 4OFYD 1NKOA 2FD6H 3JV0A 1MI5A 3T2QA 4P9MH 1ZHKB 3SE3A 1HH6B 1VGEH 4Y4KD 2H32H 5CIPB 3QDGD 3D39E 5I1AA 4YHNA 3AS0A 4KGLA 3WIHA 1CLZH 3PL6B 3QSKB 1TLKA 1YNKL 4YNYB 1EEUA 4IMLB 4UB0L 1JZ2A 3BKYL 4P49A 4G8EB 3QUYB 1JHTB 3K81A 3IJSA 1K4CA 3FJTA 1FNEB 4HW6A 5C09D 5I1EL 1D6EB 4IOIB 3MV9B 4W81A 1JHKH 4FXKA 1WFNA 2V17L 5I15H 1NLBL 2EXYC 5E94B 2AQ1A 5KVEH 1H3VA 1YMHB 2YPLE 1UB6B 2QSVA 4JPKH 1DUYB 3MNWA 3TJEL 1BLNA 1WISA 3QFJD 5HTSA 3PP3K 4YJZL 3TBYB 1DP0A 2OZ4H 4J23A 5KS9F 5CJBA 4EVNB 1VACA 3QEGH 4FZEH 5DWUL 4ZAKB 1F5WA 4PG2A 1MJUH 4OKVA 2ED7A 5DQ9A 2FYYA 3C09C 3RGHA 3VD9A 4GW1A 1QHOA 2MMXA 1JZ3A 1N3NA 2YUXA 3V6ZA 1T89C 1CFBA 1KJ3L 3P4OB 3D9AL 2BRQA 1A7RL 2FJFA 1RJYA 3MC0A 2V5MA 1MCWW 3U7WH 1A22B 3D2UD 5TE7H 3ZTNH 3AS2A 4XBPB 1OAKH 1QBBA 3P4NA 1YEKH 2Y25A 5H37H 1C7TA 4MWFB 4NJAL 3BQUB 1KTLA 1BQHG 1QSFA 2X4TA 2A6IA 4XVSH 4YGAB 4KJYA 4GKZB 1JFQH 1AXSA 5IW6B 3VFWB 3PIQB 1EHLH 1XMWA 4UAOC 3MRPB 5GISL 4MCYB 5IQ7L 3JV6B 4QCIB 1IGJA 1YYLL 2D7OA 1TMCB 1KLUB 4HUUB 4LCCB 4XH2A 2FNBA 2FHBA 3DURA 1FLRL 3DX6A 4K7PY 5A2IH 1KENL 1FIGH 5D7LE 3BAEL 5FA3A 1FO0A 3DMMC 1IMHC 4UV7H 5JW4M 1QQDB 1JL8A 2IPKA 3HZVB 3LQAH 1VKXA 3IFNH 1YUHB 5ESQA 1U91A 1KFAH 4ONOA 3TBVB 1I7TA 3GNMH 4PJAA 1ADQH 3HR5B 3F8UB 1ACYL 4MMXC 2YRZA 4K55A 3SPVA 3T2OA 5EOCH 3HNVH 1WAAA 3LOWA 1HDMA 4YLQT 3L7EB 4LSSH 3LIZH 4P5TA 5DEGA 1CDHA 1H3PL 5ESAB 4Z0XA 1MHEB 3ESUF 3ARDB 5I19L 1SEBA 4F33A 5CJOH 4X6DA 5M7QA 3N1MC 4U1KB 2GEEA 1TQCB 3SDAC 3FTGA 4L4TD 4JO1H 3V4PL 2ERJC 3MRJB 3CVIH 3DETC 5H8DA 4Q0XH 4XNMA 3OTTA 2VABA 3BH9A 2WUCL 3RIAF 1KJMA 2AJUH 3I02A 2I60H 1D5BB 4PJFA 1ZMYA 1MUJB 3HS0A 1J7VR 2D0HA 3IFPB 1X7QB 5EU6B 4U3HA 2UVEA 2W9LA 5DSCA 4MLSA 3IKCB 4NNPH 4J3SA 1EZVX 4K3JL 3WO4B 4XPGH 4NRXB 3GSRA 4P57B 4PJBF 1V05A 5H2BA 1AKJB 1HI6A 2O26U 4JFHE 5IW3A 4L4VA 1C1EL 5I8OH 1QBLL 4EDWL 4HS6B 1HZHH 4RWHA 1OD7A 4Z7QE 2F53E 1I1YA 2HWZL 3IJHB 2DQUL 4OD1L 3TJHD 1XR8A 4XAWL 5DXWA 5HGBB 2ZJSH 4OF0A 1S9VA 4WFGD 1UYWL 3B8YA 2P46B 2YD1A 2H8PB 1RVFL 4NPYB 5TDPB 2A77L 1BZ7B 5D6DA 5D1XA 5D93C 3U2SB 4TUKL 3TZVC 4MA3A 1D9KB 1ZLSL 4JFQB 3QA3B 1NBZA 3RA7H 2MJWA 1B2WH 3MJ9H 1A21A 3HFMH 4JDVB 1L9MA 4EKXA 1MCIA 4W68A 4XNQA 1I8LC 2EIBA 1XGPB 4LGRB 3GSWA 1LNUB 3WIHH 1JNHA 2H41A 4MJID 4NKOA 1KYOK 1IAIL 4XNYL 1RZIA 3LN9A 1P1ZA 3ARBB 1OSPL 3QG7H 3K7UA 2P7TA 4M7LH 2XZCH 2JJSA 4GRLC 1TITA 2J8OA 5CGYC 1TJHH 1KPRA 4XXDB 5CCKH 4N0UA 4IRJB 3IFLH 5HGHA 1EFXB 1HOCB 1NLDH 1AI1L 2VZ3A 2AK4D