4ODWB

Unliganded fab structure of lipid a-specific antibody a6
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIVLTQSTSSLSASLGDRVTITCRASQDIRNYLSWYQQRPDGTVKLLIYYTSKLHSGVPSRFSGSGSGTDYSLTITNLEQEDIATYFCQQGKTLPLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A6 Fab (IgG2b kappa) light chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwB01
4ODHL 1UA6L 4GRMB 4JFXB 1Q9LB 4KJPC 4AQ1B 1RJZA 4IDJH 4ZPVA 3RWHB 1HINL 1AY1L 4XCFL 4MXWH 3L5HA 2VLKE 5CP3A 5JW5A 2XT1B 3C6SB 5ALBL 1QFWH 4RISL 2VISA 3LH2L 1S7UB 3K0WA 3ZDXE 1JWUA 4CJ1A 4KDTC 4M7KL 4O58H 2IGFL 5DHVA 3G08B 2V6HA 1LE5A 5E95B 1QO3A 3AXLB 5IIEA 4PB9L 4PJHA 1A3RH 5FO9A 5CCKL 2H2PC 4OV5A 3MLYH 4WDIA 3EGSA 4GT7A 4R9HA 3U9PH 2Y06H 4JO4L 2UZXB 3GI9L 4N1EA 4ENED 5GSVA 4LCWE 1LO3H 1MOEA 3FTGA 4HDIB 1BBJB 1PSKL 3BE1L 1QQDB 4ZODA 3VRJA 1LP9A 4AMKL 4P4KC 4IS6A 2DQEL 3EOTH 3MXVL 2L0DA 1X5ZA 1DANT 3HZYB 4FP8H 1K4DB 5IMMB 1BLNA 2M26A 4G3YL 2NY4B 1IGJA 4OUUA 4ODWA 1WZKA 3QRGL 1Q1JL 1BFSA 2WANA 2NY5H 1I9RH 3TIDB 3P2TA 1UXSB 2FRGP 4ESKA 2AABH 4HHAA 4J7RA 4TTDD 4PJ9B 2LV4A 3MRMB 3I6KA 3SDYH 5C07D 1FDLH 5JQ6L 1XCQA 2X9WA 3MLSL 4HMEA 4XPTL 1OSPL 3P9WB 3L7EB 3SE3A 5IT2L 4JCLA 4NRZB 2V2TA 32C2A 2A6JB 3QUYD 4Y1AE 2QL1A 4M9OA 4D0CA 2YA1A 1VADB 5ISZA 3BDBA 4XMLH 3EZ8A 3GSNB 1QVOA 3V4VL 1LGVA 1C8PA 4JZOA 4MAUL 3FMGH 4ELMB 5JXAL 1CICD 3BP6A 5DQJB 1D3CA 3C9NB 1OP3K 2BVTA 1DANU 1FAIL 3TVMD 4AEEA 4NOFA 2I9LA 1NGXA 3GBMH 4WCYH 1YEHH 2JF1A 3QG7L 3QXDB 2DQDH 2VXUH 4WFGE 5I17B 1IARB 1Y6MR 3L9RB 4U1HB 4MDJB 4YLQT 2GTWA 5E00B 1R3JB 4WHYG 1FC1A 1FE8L 1F00I 2FEEI 4WWID 3P9LB 2B1HH 3CFBB 3DVFA 4NUJB 3LS4H 4HGWB 1L4IA 3T0WA 3LRGA 4YAQB 5H94A 3BRFA 5F6HJ 2F5AL 2UVFA 1FSKB 2CXGA 3QDHA 3SDAA 1U95B 4QT5A 4X8XA 1MVFA 1MCNA 3SDAC 3DPBA 3FB6A 5FUZL 1ZEAL 3QHFH 4JRYD 2APXA 1KN2H 3K80A 5EBLA 4H20H 5SV3A 3RNKB 4O02L 1DBJH 5FUCC 3Q5TA 3VFRB 4OIIL 2Z31B 2CRMA 2P8PB 1J10A 4QRPD 1NC4B 3W5MA 5LXGL 1OAQL 4JKPL 3RWJB 4C54A 2V17L 2Z91A 5KAQG 1MCWW 3VXTB 4MZ3A 5CEXB 4FFVC 3DVGA 3D6GA 4KROC 5KSVB 4Y2DB 4P9HL 5C0FB 4K7PX 2BHYA 4B5EA 3EJJX 2P5WD 3WO4C 1F42A 3I3BA 3QHZL 2P8LB 5LKNA 5E5MA 5F3BB 4JFDA 4U1IA 4CW1A 5GS1B 2NY0C 5CIPB 2PYEA 2X4TA 3CXHK 5I0ZA 3GMRB 4XMKL 3S3SA 4MQXD 2GUOA 3LSOB 1K3IA 5DRWB 3BHBB 3B9AA 1AP2A 4AH2A 4EQ3A 2HTLD 4LSVL 3IU4L 3GNMH 3P0GB 4K9EC 2QSQA 3SKOB 3QNZA 1QLFB 3GMPA 3KNBA 4KC3B 1JPTH 3IXAB 4E0RA 1GGUA 2YUZA 1MPAL 1NANI 2BVYA 5EOTA 4UOW1 2I9TB 4G7YL 3CZFB 4F8TA 5EZLB 3BPNB 1N5YH 2DF3A 3I6GA 4HPYH 5C09B 1LEKB 4GXUM 4QRUA 4WHTA 4YXKH 3NGBC 4HGMA 3VH8A 5BQ7B 4HZLB 2NW3A 3MYJA 4ELME 4LOUD 5MEOA 1QSFA 2ICWB 1FO0H 3L3IB 4J6RH 3V6FB 5JIIA 1GIGH 3ES6A 2IANB 3LDBC 3BRDA 4FXKB 1F11A 1WLHA 3SKJL 5F7UA 4NM4H 1CLYH 2QADD 1N6QL 4D9QE 3DYOA 4XHJD 3O8XA 1HZHL 3HPLB 4GKNB 3V6ZB 4PB0L 3VD5A 5IEKB 1FG2A 1IZKA 3IFNL 3O8XC 5EUKA 3RX5A 1CD1B 1C12A 1WIUA 5IB2B 5JORB 4GQ9H 2VDKL 3BVNA 5J1SC 4EVNA 4L9LC 3O4OC 3O2DH 5D1ZD 4UNUA 4P9HC 4XVUD 5JHLH 1L7IH 4JGMA 1H3UA 1NFDF 1A7RH 1RIUL 1UG9A 4XMPL 4WFFD 3OJMB 1A6PA 1CQYA 4NJ9L 3HS0B 3PV6A 5HYFA 2AV1A 3CZJA 4R90L 2YD3A 1IAOB 5EUOF 2DQGL 5KSAD 4MLIA 1YMMA 5GRJH 4YDKH 3TYFA 3BD5A 4P2YA 4TPRH 3MREB 3X3FH 4FXGB 4ACPA 5F3HB 3NTCL 4OJFH 1FYTA 4Q9RL 3MRFA 2QHRH 3MUGB 2GT9B 3OKEB 2IBGA 1WAAF 2GJ6D 3O4LD 3I9GL 4M8VA 4DCQA 5F96H 4XRCB 3O3BA 3Q48A 4HEME 2Y1VA 1OSZA 3ZKSD 5IFHH 1YQVL 1HXMB 3FZUD 1S9XB 4ZUTA 1KLGA 1T04A 4MJ6A 2DJ4A 4K3DL 3GHEL 2W9DH 3U0PA 5DMGD 4HV8A 4FQXA 3ULSB 1HSBA 1HE7A 2DQHL 5IGXL 4J8RB 3PG2A 1I1FB 1CDCA 1W0YT 5DVLA 2OL3H 2R4RH 3QNYB 2BFVH 4N0UB 5A3IC 5IFJA 5EWIL 4M5YH 1MJ7H 3HNTL 3S35X 5IR1B 3K4ZA 3HUJA 4BFIB 2AXHA 1INDL 3MBEB 5EU3A 4U1JB 3H7BB 3EYFB 2WBJA 4LRIA 5JA8B 1DE4B 5DDHA 3IVKB 5D8JL 3S4SB 2WBJC 4LRIC 3PQYA 5FB8B 4XPBL 3PGCB 1EEYA 2HH0L 1HSAB 4JB9L 3D0LB 3BDXA 3RWFA 2X89A 5GGUA 4HIIB 2N56A 5DJXB 2ARJQ 2N7AA 4KVCH 5K59E 5C09E 1P4LB 4JGJA 2HJLA 4EUPG 3IETB 3AY4A 3NVQA 1QBAA 1YEFL 4NQVB 5T3XL 3AY4C 2A2QT 2EDTA 3DGCR 3PWVA 5FM4A 2PO6A 3R0MA 2IANE 2VDRH 1FFRA 1IL1B 2ID5A 3NCEB 3HRZB 4LARL 3R06B 4ONOA 2VIRA 2PO6C 1S8DA 5EN2B 3RL1B 5ELIA 3CCHA 4PGJA 1FVDB 4LSRH 3MQIA 1MHPL 1XF5A 3D39B 3RL2B 2OXGA 2G2RB 3WD5H 4CVZA 4Z95H 4YBQD 2APTA 2MPAH 1U8QA 2HKFL 2V7NB 1J7VR 4H8WL 2DIAA 3BJLA 2GSGA 5HPMB 4LSQL 4X5WA 2EYTB 1RZKC 3AB0B 3QEQD 2DN7A 4U6HA 4L29B 1OQXA 5F9JB 3SOBL 1FZMA 3OKDA 1J0IA 2KBGA 1S9KC 1EHNA 3SKNA 1U41A 5J12C 3X12A 3SDDB 1EGJL 2NXZB 3I2CH 3OGCA 4DKEL 1FZOB 1BOYA 4OBSA 5DO2D 1HDMA 2MCPH 3RNQA 2OTUB 3TA3A 3FOMA 3U9UA 4Z7OE 4ZDHA 2YEZA 4KZDH 3KPPA 2R2HB 3ARBD 3MV7A 1X5AA 3QUMH 2FYYB 4YBLC 4MB5A 3IF1B 1G7IB 3FONA 3RKDC 3REVB 4QO1A 1GJIA 1OAZL 5C3LD 3LHPH 2FJHB 4LLMA 3THMH 4RGND 5JDJA 3T77A 4DGVH 4F7EA 4NO3A 1SYSB 1H0DA 1A1MA 1FL6B 3MJ6A 4X7SL 5C0AA 5FYJU 2HLAB 4C83B 5AUMB 2DIBA 4OCXL 4XH2B 3K3QA 4WI5A 4K23H 4P2QD 2HN7A 3HC3H 5IMKA 5FKAA 4NQCD 2G9HB 2DJUA 5I1CH 2NR6C 5KZCD 4U6XB 1FIEA 5CEZH 1QRKA 3QAZB 5A2IH 1W72H 2E3VA 3NIFF 4YE4L 1YZZA 5C6PB 5SX4I 2PW1B 3C8HA 4FQPA 4V1DB 4IOFC 4F15C 5DC9B 4R4FL 4LVNB 3ECBB 3CGTA 4H8WC 4ZNCD 1BBDL 3ARXA 3CSYA 3PABA 4KK6D 4KUCF 5GRZA 3GGWB 1QP1A 2C4FT 2JCCF 4KJWD 3DVNB 1FFNB 3CVHL 4MA1B 5GGQH 3EDJA 4BFEA 2EE6A 5BV7L 3WIHH 3T2OA 2R4SH 3Q6FA 4AENB 5E1AA 5T1KD 1FGNL 4XC1L 1JP5A 4ZTPL 4XP4L 1NFIB 5TQ2L 4S1QH 4MD0A 4YHKH 5IQ7H 4KZEH 5GZND 4LNVA 4QHKJ 1L0XA 4IMLA 3N9GH 1RJLA 3RWEA 3SCMB 4M7ZB 4YHMH 4ZFGL 4YEFA 3HZKA 1VFAA 4RWHA 4OLEA 5GGVY 3UTPE 4NQTA 1KIRA 5CZVH 5GGVL 5L2JA 3QJHA 4NUGH 4ODBD 3TBYA 2X1PA 1NJ9A 3FRPG 4WUUD 2EC8A 3HI1A 3I50H 5DR5L 4P5KB 3D39E 4YFLF 4K3HA 3BZEB 2I07A 7CGTA 3V6OE 4LCUA 1AKJD 2A9MH 2DD8L 5T1DL 3MROA 2DI8A 4XBGA 4XPHH 4W4OA 2F19H 3WMSA 1CE6A 1FORH 5EPMB 3UTSB 5CZXC 1ZTXL 4W4OC 5LQBL 4JRXD 2CD0A 1A14L 3RIAK 4KRPD 3OZ9H 4LP5A 4JFQA 4UTBL 3UZVB 2R1XA 2C4FU 3D69B 3LS5H 2UWEA 4RFOL 5J7CC 4FQCH 3TZVA 3B9KD 3EYUH 1L6XA 1JYXA 3TZVC 5F88B 1KF9B 1IM3B 4G6KH 4NFCA 1XR9A 1SM3L 1XGUA 3JBG7 3CVHA 5DURB 4HUUB 1S7RB 4WU7A 2VZVA 2A6IB 5E8DH 1UWGH 5C0CB 2CDGB 3W9DA 4WHYH 4M61A 5MEND 3A67H 3OF6D 1FPTL 2EIZB 1E4JA 2R0WL 3CDGB 5FYKH 3FO9A 4JVPA 4RFNB 3MFFA 4XTRC 3QH3A 3RX7A 3F7QA 3VFSB 2XA8H 4OFKA 5I71B 4PBXA 2RR3A 5HVGB 5DEGB 5F1NB 3U46A 3BZFB 3FRUA 1BIIB 2AXGA 1BQHA 1KOAA 3RVWC 4YQXL 2DQFB 4P5MB 4WI4A 1KJ2H 1X5XA 1DUYA 5E2UL 2CRYA 3SO3C 1IC5L 2VXSH 2ZSWA 1UVQB 4HIHB 1MELA 3KPSD 4LQFL 3KR3L 1E4XL 4V1DE 4LGSB 3OB8A 4CVXB 2O5XL 5B4MC 3VWKA 5KTEL 3RFZC 4PIRF 4GAFB 3BO8A 2X42A 3FN9A 3RGHA 1IGML 1FNSH 3IS0X 3U7WH 2EH7L 2F74B 1JTTA 2EYRB 5BOZG 3K4AA 3VI3E 1KIPA 4G9FA 4JFPA 5EU4B 3L5WB 2BDNH 3U1SL 1U93A 4M62L 4Y16B 2NY1B 1LEGA 4DEPB 1RK1A 3JWOH 2C3VB 3QWOA 4X7TA 3NH7H 3LEXB 1ZE3C 2X4QA 3R8QA 4GRWH 3TO4A 3WLWD 2VE6B 5DJDB 4DZ8A 3QIBD 4U4BA 3DRTB 1PG7W 4HS6A 3TO4C 4K3EH 4LPCA 2DI7A 4MJIB 2HT2C 4WI3A 5B8CA 5K9KA 5B22A 3R4DA 1NANH 3ZTNL 3FFCD 2EXWD 1DN0B 4UDUB 4FABH 1CXFA 3H9ZA 4OAWA 1QFPA 2CO6B 1KIQB 2PCPA 3V5HA 3NZ8B 1QFOA 2HTKD 1Y0LB 2ZUUA 4ODXB 1ZHLB 4U6YA 4AJ0A 4JKWA 4QXWA 4G6FD 3QDAA 4M8QA 3GK8L 4NC1E 3T2NL 5JOPE 2AS5M 1S5HB 3REWB 2VL5A 1R3IL 3BX7C 3KS0H 3QIUB 3CSPA 2B4CL 2D7MA 5E2WL 4HUMB 3CMOL 4X5XA 5FYJD 5MHSE 1C08B 3TH2T 3PWLA 4M6ML 4RGOH 4LIQH 5JA9A 1DQJB 4PJFA 1UB5B 2UYLA 3ARDD 1PX3A 5J13C 4KVNL 1NBQA 5TPWH 2XICA 4P2RA 5L9DH 1DVFB 1JNJA 5I1KH 3IAPA 1JFQH 2B5IC 4K8RL 5C0IA 1E27A 4P2CG 1J8KA 2AK1H 5F9WC 2D0FA 5HDQL 1DFBL 2XV6B 4O2CA 5C0CE 5CD5C 3W39A 3BESR 4AEIL 4PJ8A 4LSUH 3VMNA 5D7IB 2FEDC 2AK4D 3L3JB 5I74C 4L4VD 4WUKL 3UO1H 1VGEL 4PJ8C 1EUUA 4JM2B 2F54B 5EO9A 2DTML 4JAMB 1OGAB 2APVA 3MSPA 3MCLL 4H0IA 1RSFA 3VDBA 3N1QC 5EC2A 4UMGA 1U8KA 5B3JF 3KYKL 5D70H 4NHCH 2AW2A 5EU6A 3T04D 5I1GL 1BZ7B 3DBXA 3IXTB 1V3LA 3TEUA 1G6RL 1I1AD 4IIQA 4JKKA 4OZFB 4NKOA 1AQKH 1GZPA 3AS2A 4DKFH 4BFBD 4IIQC 2FJGA 1Q9KA 4RGMC 1JNHB 3VXMA 3BMWA 5TH2B 1MHEA 4XPFH 3IDUA 4D94A 5F8QC 5SWSA 4P46B 5LCVH 3U7YH 3V4PH 5BVPH 4Q0XH 1U91B 4KQ3L 1YEKH 4OGXH 3PWPD 1DQTA 4MAYC 3S9DB 2MQ0A 3C60C 3OGOE 1T21A 2GCYA 2IPKB 1PKQB 3RIAF 3CFJA 3RKPA 4OCNC 5AYUH 4S2SB 3PDOA 2VXQL 4IOIA 2YSSB 1U36A 5DD1L 4ZXBA 4DW2L 2VZTA 5C0BA 3ULVD 1MNUL 3VFPB 1JTPA 4G9DB 3ZKNC 4ZXBC 2XPGA 1G7PB 3BUYB 5D72L 5B38B 5IMLA 2AEWA 4FNLL 2CJUL 1S9YB 1JUFB 3OKOA 4G7VH 4NO2A 4CMMB 1JI2A 2VC2L 5EULV 2EDXA 1U58B 5T3ZD 1IQDB 1IILE 3P9MB 2J8UF 3KJ4B 3MJ9L 5IF0A 5DJ8B 1DDHA 4U1GC 4LCCA 1OB1B 2P42B 5C8JB 1UQSA 3ZO0A 5LGJA 2PW2B 4EUPH 4LCCC 3EBAA 4PJAB 4I2XB 3B9VA 3ILPB 1G6RA 2AJXH 1A4JA 1MI5A 3OX8B 2W0LA 3UYRL 3MRGB 4YHNA 5D2LB 5GGRB 3UJIH 5D7LD 1GGIL 5HJ3A 4N1CA 1EK3A 3BEWA 1NLDL 4M93B 4ODSL 5HYJB 3O2VL 4N5ED 2X9XA 4NNYB 1PAMA 3FAXA 1ZSDB 3VFWB 2VLJA 1BJ1H 5EBGA 3UTOA 4BH8B 1CVSC 3F7YB 1T80A 1PZUB 4UB0H 4YHZH 1S78C 3O6FB 4HUVB 4Z78A 3O11B 1SEBA 1U92B 2QKIB 2ZNWA 3ROLA 1IKFL 4OGYH 4NO0A 5IK3B 1YNLH 4DTGH 1NCAH 1T4KA 5D7IE 2A9NH 1HHKA 2F54E 1OGAE 2VO5A 4GMSL 1PDKA 5D71H 4RBPK 1T0MA 1NGQH 4EN3A 2HMIC 4ONGL 2B1AL 3OKKA 2CR3A 1LO5B 1P4BL 5E94B 3MV9A 2GSIB 5F6IB 4LU5L 1NL0H 2ILLA 4PRAB 2EXYD 1UXWB 5HYSB 1UM4L 1WCBA 3FT3B 1CD0A 3H2WA 3G6AB 2IQ9L 4Z0XB 3WN5A 1A9EB 4PJCA 3UPCA 3V0AC 4TSBH 1RZIA 25C8H 3NACH 1XGYH 4PRPB 3MJ9A 1ND0A 4OCRL 3QISA 1MFDH 4KI5D 3VGGA 1NAMH 4BSJA 4FFYL 4H0GA 2ARJB 3KPRD 4QF1A 5FV1L 4AT6B 5C6TL 2O5YL 3ZE0E 3NCMA 4APQA 4W81A 3RBSA 2UUDH 1G1YA 5CWSB 4OLVL 1L7TL 1EFXD 4APQC 1KBGL 1A4KB 1PKQE 1OAYH 3ZDZE 3T3PF 3BP5A 5IW6B 2W0KA 2KQMA 1OGTA 5SX4H 5HYQA 1NKOA 4RAVB 4X98A 3QIWC 1SYVB 4KTEH 3BI9X 3G6JA 3QCTH 1JZ5A 1CT8B 2ICWI 5DD5L 3DX7A 5I9QC 4N9GB 2Y7QB 1CBVH 1P9MA 3RIFK 5I1EL 1P9MC 5F89A 5ICXB 1KJMA 3AS1A 1FFPA 3IDJB 3T0BA 3IDIB 1A7QL 4KJYA 4PRIA 1WFNA 1XR8B 4QWWC 4HQQH 5MP6H 1G7JB 4LSPH 4TSCH 4LKXB 1T20B 2QQQA 3T0VA 1F3JA 2HJFB 4R7NB 1F5WA 2AEQH 2X6MA 2AJ3B 4PJAE 4I2XE 1RZFL 5ADPL 1QSVA 3QG6B 1QRNB 3P40A 4RZCB 5JHDD 1F6AB 4FTVA 4KV5E 3H42L 1A9BA 5D2LE 4B53A 3EW3B 3GZKA 1LQSR 3LN5A 5HYJE 5DD3H 1C5BL 2XY2A 3DX9B 2YMXL 2CUMA 2A83A 4NN5B 4TN9A 3CNKA 1MH5A 1U8PB 4PRDA 1V7NH 2VLLB 3BZ4B 1ZHKA 1JBJA 1MY7A 2EEDA 5DGRA 3RTQD 3DHJA 1BIHA 3MRJA 2V2WA 4C56B 2WIIB 4YJZL 5FK9A 2VJXA 2XN9B 4K7PH 3GMLA 2MTPA 1OD9A 5HHVH 2MOVA 1NGZA 4XB8A 4Q97A 1A6AB 2VQ1B 3LEYL 5HXMA 5D7SH 3AREA 4JZJB 2PYFA 2GK0A 1FGVL 3E6FA 1A64A 1XH3B 5FCUL 2D7OA 1MWAL 5I73C 4D0BA 4FRWA 3RZWA 1HI6A 1J8HD 3VXUD 1OWWA 3AAZB 3TNMA 4XCNB 4ALAL 3F58L 3DSNA 3P73B 4FQJH 3GJFH 4L1DA 4P49A 4PRPE 3QFDB 5ESQA 2QQNL 2ZCKH 3S4SG 5KVEL 3PWUB 2V9QA 3D48R 1EEZB 5IW1B 3FB5B 2GJJA 2HVJB 2VXTH 4F58L 3W82A 5AG9A 1OP9A 3U36A 1KC5L 1ORSA 2ZPKL 4OM1H 4GKSB 4G6JL 1KENL 4JHZA 2A73B 2DL2A 2ZCLH 5ISZD 2V2XB 4HPOH 5EU7C 5DJAB 4JLRA 3O45B 2NTFB 5KS9A 2BXYA 4OM0L 5LVEA 2FB4L 1MRCL 3TN0D 1JZ2A 1XGPA 2ZKHH 1KULA 1TTUA 3QBTB 1JGEA 1T7WA 3MA9H 3L5XL 4P48A 2BNRE 4ZPVB 1RVFH 2DQUL 1UKTA 1DCLA 3KWWA 1NEZA 5JW5B 2WWMD 4KDVA 4JDTH 5FXCH 2VISB 4PD4K 3DETC 4UBDD 3RPIA 1X7QA 1HHIB 3U83A 1GC1H 4OSUL 3S8WA 4MQ7B 2EYSB 2CMRL 1MWAA 3GRWA 3S7GA 3TJEL 3JTSA 2YPLA 5J4MA 1R6VA 5I1DA 3C2AL 1QRNE 1MCCA 3MRDA 4PD4J 5D1XC 2WLYA 1MJ8H 4OV5B 4FQIH 1DBBL 4WDIB 4MHHI 3WFDH 3O6ML 1Q9OA 4PV9B 3RHWF 1I8KA 3GKWH 5L6YH 2X41A 1RZJH 2UY6A 4P4KB 3ARFB 3VRJB 1LP9B 5IVNA 3D3VD 4IS6B 1CF8L 3P4MB 2MHAA 2VDLL 1RU9L 2K7PA 3ZMRA 4OUUB 3ZE1E 4GRLA 3ZDYE 1G7LA 5LBSL 1BVLB 4N0RA 4C56E 1NC2B 1UH4A 2Y36H 1MCDA 1I9IL 2V5SA 3S6CA 4IEFB 2XN9E 5DFVC 3RAJH 4NQEA 3O0RH 3UAJC 4HHAB 5KVDH 3LKRB 1SJXA 3S35H 1X5IA 3NCJH 3MGTB 1N8ZA 5FO7A 2GJZA 3HI6H 1XCQB 4N0YL 2H6PA 1LD9B 4G80B 2E7LA 4G5ZL 4JFDD 2PYED 1CLCA 3RIFF 1SBSL 4KFZC 2E7LC 1T22A 4QHMA 3AMLA 4Y5VB 4FN0A 4Z7NF 5E0QA 5IBUB 2AEIT 4UU9A 1FZJB 1T2QL 5HHOD 2P46B 3KPMA 2QSTA 1Q0XH 3WE6A 1O7VA 2HLFC 5GRXG 4D0CB 1GAFH 1ZVHA 2EDNA 4RFEB 4U1KA 1ZS8A 3MRPB 1DL7L 2LAAA 3QCVL 4ZD3H 8FABA 4O4YL 5ID0B 3SE4C 4DOHB 2Y07L 4Z7WF 1KELL 1NMBL 2QSVA 1D5ZB 1S7QA 1U8IB 4JFEB 4QY8A 3EZJB 5HSFA 5DWUL 1QSFD 1GZQA 3IDNB 4LPYA 4L3CA 1OCWH 2EDKA 1QOKA 5F7DA 3UTTD 5DMKA 1RMFH 3LPGA 1U8OA 4J3SA 2IADA 3O8XD 2GTWB 4XNQA 1YY8A 1A22B 2I27N 3D25A 1U6AL 3BXNB 2A6DA 1XFPA 2RB8A 3ZTJG 5DUML 5JPMB 1CTOA 2E6QA 3BYTA 3GSNH 5EO1B 4PJ7B 4U0RC 2W91A 1MAJA 3SDAB 5EZIH 3MLWL 1QA9B 2C1PA 1BEYH 4Z6AT 1GSMA 1YN6B 3QFJA 4M7LH 4K55A 3NFPA 3IJSB 3MRBA 4QHLB 3FO1A 2CIIB 1VFMA 3ULVF 5C0JB 1HQ4A 1XGQA 1K6QL 4TSAH 5J3HC 1ZVSA 1FYTD 3HR5A 1KT2A 1YJDL 1EJOL 4NNPL 3QEHA 1LP9E 2Z91B 5F9OH 4KROB 4DN4L 3SE8H 2RCSH 5E8OB 3EUUA 2DBLH 3T2QA 3JV4A 3MRCA 1PZ5B 2EKSA 4MA7H 5DEZA 4K07A 2BXZA 2PXYB 1T6VN 2NY0B 3IFLH 4WEBH 1ADQL 1AXTH 4FQXD 5E5MB 4D8PA 3MUJA 5A3ID 4U1IB 3EO1A 4CW1B 1A7BA 4OB5H 1BP3B 1T5WB 1FBIH 1NBZA 3GI8L 3UC0H 2GUOB 3IU3B 2ZG1A 1FIGH 1BVKB 3BKML 1CDGA 4LDLB 1GOHA 1A7PH 4OLXH 4NP4L 3X13A 1YPZA 2Z4QA 3HMXL 4ZOBA 3FB8B 3GMPB 4IJ3B 1Q8MA 3PWNA 4KK8D 4LLDA 1A2YA 1I1YB 1YEEL 3SKUD 3PQYD 1DQDH 3ZDXF 1A6VH 5IOPA 4U33A 3PGFH 3W2DH 2X4RB 3I6GB 3NGBB 3QQ9C 5JQHC 3CLEL 3HE6A 3RVTC 2VDML 4P57B 3BPLC 2X89D 2GYSA 1FZKA 3DYMA 2APBA 2Q87A 2GQHA 5MEOB 3LDBB 5I16B 4POUB 3NN8B 2IPUG 3B2VH 2AEPH 4RRPG 5FYLL 3RDTC 3ES6B 4DOHE 3P11H 3LQZA 1AR2A 2F8OA 3PL6A 3WIIH 2P43B 2R8SL 1BFVL 4OZHF 4JFEE 4EIGB 3K1KC 3S37L 1Z9LA 2XZQH 3U4BL 4YHYB 3PL6C 2FZ3A 1EMTH 3FHAA 5DEFB 1T1YA 3V2AR 1A1NA 1GGCL 1XZ0A 1KGCE 3QPQC 1YJDC 2OZ4H 3U79A 4L9LB 1AO7D 1FNHA 2FECI 1F58L 4E42A 5CJQH 3BVNB 4KRLB 3LIZH 4EVNB 5FGBA 5ID1A 5E6IC 3JVGC 5C2UB 3UYOD 4Q6IC 5TQ0H 5JNYA 5I8OL 1JV5B 5IMOA 4PJIA 5FGBC 3NZHL 1IEAA 2FH6A 1ADQA 3F7PC 2VR4A 2NY7L 3IKCA 2A0LC 1E4XI 3PP3K 4FFZL 4K71C 2Z8VC 4GAGL 4OCWH 3QXAA 1J1XH 2K7QA 4PJ7E 3A6CL 2X40A 1YMMB 3TYFB 1AQDB 3MRRA 2VZ1A 5IKCB 3UJJH 2HFGH 2MNUA 2BRRH 1BOGB 5E4EC 3FQTA 4PRNA 2ZSVB 1RUKH 4LCIL 1OARH 2LU4A 5T5FL 4KY1L 2VB5A 2KZ1B 2RGSA 2Y72A 1MCQA 4LVOB 4M6OL 4R4BA 3RZCA 4X7CC 2PR4H 3VFNB 2VKWA 2QQLH 4DCQB 1IQWL 2FBJL 2KDGA 1RUML 3TA3D 3RZCC 4PBWD 1RUPH 4XP5H 1UADC 1OSZB 1EBAA 3MV7D 1E6OH 2WQRA 1JPSH 3TBWA 4BSVB 3ZYIA 4DQOL 4ZS7L 3QNXB 3CFKB 3KXFA 3WUWB 1RV6X 4P23D 2NY6C 1Z6JT 1RIHL 4F7MA 3S97C 1AD9B 5FEBA 1YY9D 4HV8B 1HSBB 4LEOA 3L6FA 1RIVH 3TFKC 1BZ9B 1KEGL 5IV2B 2W9EL 5T3XD 3SN6N 4PUBH 5IFJB 1FCCA 3NBNA 5C0AD 3V7MA 5IB3A 1EA9C 4LSTL 4XCCH 2RIKA 4ODUA 4U6VL 2JJTA 5TE7L 2WBJB 1PY9A 3BEVB 2JJTC 3ARYA 4A6YA 4OZFG 4NRYA 1MFBL 5E2VL 5F7EH 2FATL 3RVUC 1XIWB 1FN4A 2VTFA 3H9SA 4JPVH 3MV11 4PJHF 4XAWH 4JY6A 1AFVH 2JB6A 4NZRL 1MCRA 3WUZA 5BVJA 4I13B 3RWFB 4OLYL 3UDWC 5GGUB 4J3TA 4I0KA 4O9HL 4PJXA 3RGVB 5JR1L 2YUWA 2YPKA 5D93C 3T8XB 4UI2A 2HJLB 1ZAGA 4OD3L 5KANG 4PY7A 5FM5O 1BM3L 4I9WE 1X3DA 1OT2A 5HHXL 2ITDB 1NBVL 3AMKA 5KANI 1T6WA 2DYPA 2PO6B 5IROA 3C6LA 1CXHA 3BN9C 4XT1C 4YGAB 1S8DB 5IROC 1IAMA 5CBAB 3HG1B 3C6LC 3CCHB 3JWDH 3QXTA 5B38G 3NA9L 5E8NA 2YD2A 5CGYC 1YMHA 4L8BA 2LABA 1W0WB 1YYMH 4CVZB 4Z77B 1A6ZB 4OGAC 4GBXA 1U8QB 4CN4A 5DQDH 1AGFA 4OD2A 4ZQKB 3BH8B 4WO4A 1RUAH 5GS0C 2E27L 1N5AB 4BZ2L 3TYGL 2DMKA 4U6HB 5ERWB 1ORQA 3C5SA 1WC7A 5J12B 3LN4A 5F7YC 5CZXD 1RI8A 3BQUB 3LEVL 3BAEH 1U0QA 5T1LB 3BT2H 5MEPB 3N1FC 3N85L 1I3VA 3RU8L 5I30H 1YMME 1V8HA 3MBXL 4PV8B 3L3GB 4Y19A 3E6HA 2E9WA 1X5FA 2ZUSA 4QHNA 4LFHD 4Z7VF 2F58H 2ZCHL 4ZDHB 3ARSA 3KPPB 3TZVD 4P2OB 2ADGA 4XNMB 4LEXH 4Z76A 3EDFA 4MGXA 3UBXA 3FONB 1GPOH 1KTKE 2XTLA 2JIXB 4KKBD 3OJDA 1KG0A 4UDTA 2H32A 5BJTA 1CDIA 1UJ3C 1I3RB 2F15A 4KTDL 5ICZB 4K3JL 4QNPF 3T77B 4F7EB 4OFPA 1QSZA 4NO3B 1EXUA 4MNGB 1H0DB 5D2NA 1A1MB 3BD4A 3DO7B 4I4WB 3C08L 3HNSL 4ODTL 1KCRL 4XWGL 3CK0L 4ZFOB 5JIKA 5FKAB 4QCIA 4S0SD 4PY8I 3V52L 5F7KC 4C4KT 3E1F1 3V5DB 1MQ8A 4F15B 4YNYA 2CR6A 4XP6H 4CJ0A 1NLBH 3D1MC 5DJYB 5KJRH 2IBZY 4O2FA 4R8WL 1C5CL 3NFSH 2ARWA 5FCSH 1OM3L 5HGDB 2FD6L 4H88L 3VWKD 2J5LB 3L5IA 3BSZH 1TJHH 1SY6L 3Q6FB 3F12B 2D4DA 1JGVH 1INQA 2YK1L 4Z0BL 1BX2A 3K2UL 1A7NL 3BMVA 4OBRA 4PLKC 3GMNB 1J12A 1LK2A 4NJAL 4IMLB 3RWEB 1RJLB 5CEYA 3B3IA 4LSSH 4WI7A 3STZB 1KIRB 1VFBB 1K2DA 3QJHB 3HG1E 1DLFH 5CSGA 4IDJL 2F53A 2EC9U 2I07B 4IRSB 5JW4R 5T33H 1UZ6E 3MR9A 4MXWL 4PGCB 4LCUB 2IEPA 4HT1H 4TQEH 4NSKA 2DKMA 4R96A 5DJZA 4XBGB 2AJUH 2YC1A 3KHOA 2NY2B 4M6NH 2AXFA 4EI5B 2E7CA 1TVBA 1J18A 3P4OA 1MVUB 3P0YH 4G8EB 4KUZH 3EYVB 3EAKA 1A3RL 4L3AA 2UWEB 4RAUA 4WNQA 3HMWH 4FZ8H 2EDQA 1PLGH 3MLYL 1TZIA 4R3SA 2ATPB 1FL5A 4PGDA 3WFZA 3DROA 1XR9B 3U9PL 2Y06L 3DXAA 1XGUB 4JR9H 2VUOA 3FKUS 1DQQB 2RJMA 4WU7B 3DURB 3I75A 1LO3L 1SY6A 1NFDA 2GITA 4P2RD 2C3GA 4OV6F 3W9EB 1N64H 2ZG3A 3O3DA 4GXUN 2OR7A 4DVRL 2VDPH 3HAEG 1JMZA 2Y6SD 5I6XB 4YFEA 4S1DC 3N06B 3FO9B 3ZTJH 4HWUA 4EDWH 3QQ4B 5EUOA 5K59F 3E8UH 1R5WB 1ZHBA 3MV8D 3QH3B 1OW0A 4MNGE 4PJ8D 4CN6A 2NY5L 1I9RL 5I8EB 3MRQB 3U46B 2ENSA 4XWOC 2NW2A 2EH8H 2FJFB 2AABL 3SO3B 1DUYB 4FFWD 2R29H 1Q9WA 1WAAA 3QQNA 2VXVH 4MWFA 1B0GB 3SDYL 4RWYL 1FDLL 2LQRA 3RA7H 2C7UB 4XCEA 5EBMA 2LTQC 5EU6D 3O3AA 2IFFH 1BQSA 2Y23A 3MNWB 1CXKA 1JK8A 4TUOB 3VG0H 2HT3C 3KYMB 3QB7C 5TE4H 1NCTA 3KPQB 4I8DA 3V4UH 1FRGH 4WVRA 4XMLL 3U48A 2CSPA 3QP3A 3LQAH 4G9FB 1CFNB 2J6EH 3FMGL 3G5XA 4HFUH 4HJ0C 4JFPB 3WHXA 5LAXB 1N2RB 2EDJA 5DI8B 1RK1B 4K3GA 5TF0A 1EZVY 5I1LA 5IEHA 4UINH 3GBML 3GIVB 4WCYL 1YEHL 1WBXA 2X4QB 3ZHLA 4YHIA 3TO4B 4BKLA 1A1OA 2M8XA 4Z7OF 2CKNA 2DQDL 4XCYA 3ZKND 4ZXBD 2VXUL 4K8RD 1UYWH 1QEWA 5IQ9A 5C0BD 2CLRA 4FA8A 3QUZA 1FAKT 4RQQB 4F3FB 5H35A 3QUZC 5CFHA 4OAWB 3BW9A 4PG9B 5KSUA 2VABA 2NXYD 2PCPB 5EIIB 1A5FH 4XC3H 4HS3A 3VFMA 4UILH 1NCBH 1CFQA 2ICCA 2YKLH 5JO5B 1TPXC 2B1HL 1IEBB 3LS4L 1ZWIB 3I85A 1G84A 2VL5B 2WUCH 4P3CH 4R26H 1U3HC 2UWEE 1YEDA 1ETZA 3WKNA 3QHFL 3MLXH 1KN2L 1MI5D 2UYLB 4H20L 4ZUVA 3V0VA 1CL7I 3QDGD 3VWJD 1DBJL 1TLKA 4WW2A 4I0PA 4YHLH 5J9PA 4MNQA 3MACH 2HFFA 4HAFA 1OQOA 1HH9A 2VLJD 4I0PC 2H9GA 1B2WH 3W39B 4E41B 1S78D 2I5YH 3JV5A 5FO8B 2W60A 3G04A 3L3OB 3OSKA 5C7XH 1B90A 4GW1B 5EO9B 4NZDA 4MS8C 4NO0D 1I8MB 5EC2B 2CDEA 2CDFA 1H8SA 2W07A 2CXKA 1CXEA 3PHOA 1MLBA 3O9WD 5FECA 2HMID 3L7FB 4NQSA 3W0WA 3DBXB 4EN3D 4IIQB 3G5YB 4LF3A 1KB5H 3EKCA 3MV9D 4NKOB 4JFOA 1P5VA 2FJGB 1Q9KB 4H5SA 3GNML 5E99L 3VXMB 3OKNA 2GHWB 1UWEL 2C3HA 5KG9B 4NQXA 2X9YA 2ITCB 1JPTL 2PTVA 4MAYB 4HEPG 5SWSB 6FABH 1NFKA 3C60B 2DQCH 5I19H 5AEAA 5IBTL 1N5YL 4ETQB 2ESVD 2Z93A 3MRKA 4Q74A 4HPYL 4YDVA 4CUCA 5EOQH 3DUSA 3X14B 1A02N 3FJTA 4CADB 4HIEA 3UTZB 4YXKL 5K33A 1F3DH 2ADIA 5DK2A 4G9FE 1IGYA 3PDOB 4C4KO 5BZWB 2VDQH 3HPJB 4NQDA 1U3ZA 2NZIA 1FO0L 1MRDH 4J6RL 5F1KC 4M1CD 4OGZA 1HHHA 3CAFA 2OQJB 2ZOKB 3O3EA 2XPGB 5I8KH 3BPOC 1CLYL 5IMLB 1XGTB 3VXOA 4Y5YB 3IB4A 3AC0A 4FXLA 4OZFH 1UGNA 4X4ZA 1D5MB 3HC0B 5IFAH 2KPNA 2APWA 1HCVA 3FO2A 4UIKH 4PGZA 1HKFA 3O2DL 4PREA 5BOPA 5JHLL 5GSRA 5IF0B 1L7IL 3CC5A 1TENA 3BH9B 1A7RL 5FM8A 2R2EA 4WFHD 1CFVH 3TBSA 5D7JB 1AGCA 4JO3H 1NUDA 1A4JB 2V9RA 5BW7A 4YDKL 5GRJL 5CD3A 4TPRL 5BW7C 5HJ3B 4WW1B 1YN7A 3BEWB 2BNRD 3X3FL 1CQKA 4PR5A 1N3NA 3DJ9A 2AJZA 4NZUH 4TTDC 4OJFL 3OXRA 3KYAA 3BPCA 4WTZA 1VEPA 1KTLB 4X9GA 2EO9A 3V8OA 2X10A 5F96L 2XTJD 2IQAA 1HH6A 4MCZB 2D7PA 4X6FB 1A6WH 5IFHL 3QT2A 3QUYA 1MFCL 4NCDA 3ROLB 1MCPH 3I6LE 2R2BA 4E41E 5F7FA 2XWBB 2W9DL 3D9AH 3QUYC 2ZUQC 1FO0A 2NLJA 5SWQA 2XXMB 1RAMA 3SE9H 5L2KA 3QCUH 1JF1A 2ZP0T 4X6DB 2B20A 5HHMD 4WIQA 3ILQD 3CLFH 4LPUA 4N90E 1CICA 2OL3L 2R4RL 4ZUSA 2BFVL 4M5YL 4UQ3A 3GSOB 1CXLA 5HGAB 1MJ7L 1CICC 1KYOK 3K81A 3TH3T 4HF5H 3QDJB 5ICYB 1VGKA 2R1YA 3TVMC 3GMOA 3ARED 2UZYB 4PJCB 1RZIB 4HKZA 5FHBH 2FWOA 3V5KA 4KJQC 4BJLA 1ND0B 1E4KA 5MI0C 3VXME 3PDDA 3WFBH 3H8NA 3O6LH 2R39A 1E4KC 1KYOJ 3V8CA 3HLAB 1FV1B 2DLIA 4Q9BA 4QF1B 5SWSE 4LGRB 4E5XB 4LHUB 4APQB 3FO0H 4KVCL 4NYLA 3TF7C 3MLVH 5JOFA 1I3GH 4JKMA 1KPVB 3GSUB 2C1OA 4AZ8A 3DRQB 4GUPA 2OSLA 5HYQB 1R24A 3O41A 3QIWB 3VH8G 2XWTA 5C0DA 2EE3A 2VDRL 1EHLL 4UT9H 3MLRL 1G9MH 5I9QB 1JRHH 5E24E 5J11B 3G6JB 3V0WH 4XBPA 5DC0A 3E2HC 3NAAL 4ZS6D 5E9DB 4P5TA 3KYOA 4LPTA 3WD5L 4QRPA 4Z95L 2WZPD 2MPAL 3TGXA 3GSVB 4P5TC 5E08H 3BKYH 1KJMB 1FFPB 1FFOB 3H9HA 4KJYB 3VI4E 4H0HB 1UEMA 3CPLA 3WJJA 4BA8A 2OL3A 1X4XA 4PRIB 4N8CH 4QTHA 2PUQT 3WJJC 3T0DA 3T4AA 1F3JB 5TDPA 2P5WA 2X2YA 2FSEA 2H3NB 4UUJA 3I2CL 4KDWA 5EIVA 4AEFA 4N8VA 4ZAKB 4MA8H 4FTVB 1A9BB 2C26A 4Z18A 2VLRB 3A0OA 2YPLD 4B41A 2MCPL 3TV3H 3RI5K 5HGHA 3OAYK 5F72S 1ERNA 3OXSA 1G7QA 1NCCH 1CK0H 1GGTA 2VQTA 4MQXC 2FX8H 2HTLC 4X0KA 1I3UA 1SQ2N 4NDMA 3LHPL 1RZGB 3THML 3TT1H 1F4HA 1G9NH 3LKSB 4OZGB 1JHKH 4PS4H 4HWZA 5GGTH 1B6UA 1ULVA 2OR9H 5LG1A 3GUTA 1PYWB 2BX5A 4QOKB 3WUWG 2V2WB 4P4RA 5FK9B 2ZUXA 3HFMH 1S9WB 4MMXC 4X6DE 3SJVD 1NGZB 4K23L 3HC3L 1OPGH 4GRLD 2PYFB 5I1CL 1KFAH 5IUSA 4LOUC 5CEZL 3VXSD 1W72L 4I3RH 5MEQA 3LV3A 1CLOH 4NQED 3QDJE 4MCYB 5ETUA 3TNMB 3LRSB 1ED3A 3FQWA 4PJCE 2QADC 4XHJC 3WCYA 3VE0B 1RZ8B 3QUMB 4GKOA 4P3DA 3VGHA 5GIRB 5GGQL 2SEBA 3WIHL 4MD4A 4ORGB 2R4SL 3N0PB 1HHGA 3U36B 5I8CB 5HHNA 1EPFA 2KKQA 4F80A 2CPCA 4OT1H 2R9HC 1F4AA 1EAPA 1Z5LA 2RQ8A 1KTDB 4S1QL 4YHKL 5IQ7L 3IJYB 4KZEL 4GMTH 5C08B 3B5HA 3N9GL 4FG6D 4YHML 2WP3T 5J06A 2HT4D 3M17B 4LLUA 3G6JE 4NUGL 4XNXH 3DV4B 1ZLWH 3I50L 5EU5A 2GJ6A 3O4LA 5E9DE 2IAMA 4LL9A 4F2MA 5ALCH 5INDA 2BOBB 4NRXA 5CILH 3KWWB 2IAMC 2A9ML 4TUKH 3FQXA 4UT6H 1KJVA 4XPHL 2R56H 1J0KA 2F19L 3FZUC 3C2SA 5D7IF 3RPIB 1UCBH 1FORL 4PRIE 4JM2F 4R6UA 3OZ9L 3P77A 1W72A 1YQ2A 1EERB 4ZOAA 4YXHH 3LS5L 5D1XB 1UWXK 5SWZB 5I1DB 5FHAH 4FQCL 4WHDA 2NCMA 3EYUL 3MA7B 5TF1H 3MRDB 2ICEB 1G0DA 4FTVE 1VFOA 2VLRE 1J1PH 2J4WH 4G6KL 1REIA 1R5VA 1Z0NA 4XGZB 3OQ3B 4M02A 2J8UA 1AGBA 3WIHA 4M48H 1I8KB 4ZNEE 5GISH 5EBWA 4CU7A 4GS7C 5E8DL 3QFJD 1UWGL 3EHBD 2FEEL 2X1OA 4L9DA 5KVFH 3NPZB 3SBWA 2NPLX 4U7SA 3F5WB 3O2WH 4F37K 3SBWC 5FYKL 4NGHH 4OZGE 2MHAB 4L1HA 1QTYT 5JDSB 1G7LB 4KWUA 4KMQA 4QOKE 3DSFH 2XA8L 2YXMA 3DIFB 3ZDZF 1MREH 4PJDB 4NNXB 1ONQA 5IVZA 1CL7H 2AAVA 1KJ2L 4YX2H 4U1LA 1NH6A 1BQUA 2VITB 2VXSL 2WAHA 4HXAH 4QXTB 3WFHB 3PP4H 4ZFZA 2H6PB 1EEUA 1I7TA 2WWKT 2X70A 1BFOB 3HZVA 1X4ZA 1T22B 4RNRB 4O2EA 1X6LA 3QA3A 4YBQC 4B0MM 3VW3H 3CD4A 3BIAX 5E8EA 1FNSL 3WE6B 3U7WL 4L8SA 5BXFB 2XACC 4M7JH 1ZS8B 3K7UA 1F97A 4L8SC 2VKXA 4I48A 4G8GB 4U0QB 5IHBA 5FA3B 2BDNL 3QQ9D 3OR7B 3JWOL 1YECH 1WITA 4KV5F 4RSVA 4EDXA 5D2LF 3KJ6L 3HE6D 2MFNA 3LKNA 3NH7L 4J4PA 5C08E 3RI5F 3TBTA 4FQ2H 4K3EL 4L3CB 3WIFB 5JUEH 3QZWA 2G5BA 3DX6B 4FABL 5DMKB 1QSEA 5ITFA 2NX5D 1B0WA 4F9LA 1K8DA 2OJEA 3QPQD 4Z8FH 5DT1H 1YY8B 4X6CB 3D25B 2C4XA 3VMOA 4RGNC 1KJ2A 3NIDF 1IM9A 4X6EA 4U0RB 2R0LH 1P7QB 4HH8A 4WGWB 5AD0B 2WV3A 4WWKD 1VKXB 1O5DT 4MVBD 5SWZE 4RGOL 2FHFA 4LIQL 2C1PB 4U1SA 5F1OB 1KJ3H 1U8HB 4Q9CA 1S7VB 2VUYA 5TPWL 1FVEA 3FT2A 4NPYA 4OQTA 5I1KL 1DR9A 1JFQL 3HZMB 4M1DH 1SMAA 3VCLB 2AK1L 1RK0B 1HQ4B 1I4FB 1XGQB 1YNTA 1QR1A 3MXVH 1D5IH 3BYYA 4PJ5B 3RVVD 3HR5B 5EC1B 3EO9H 5DHYB 3KPNA 3RZCD 2MQ3A 3QEHB 4LSUL 4KK6C 5D7KE 3IDXH 3UO1L 2HFEA 4ODVH 4J1UB 2WUBH 2IFGA 3MRCB 1CGSH 1IVLA 4A2MA 2EKSB 5DJCA 1AE6H 4LLVA 3KXFD 1H3PH 2V5YA 1QPPA 5D70L 2BK8A 5T5NG 4NHCL 5F1IA 5FYLD 4PJDE 4D8PB 2UV3A 1QFWI 2EZ0C 3BN3B 1BQHG 4XPTH 2Q7YA 5GZNC 1NBZB 5DK0A 3T08A 3C8DA 5IT2H 1AQKL 4KGLA 1BECA 4RA3A 5GXBB 2KH2B 4DKFL 4KK5D 4F7TA 3MTRA 4MZ2A 3OB0H 4JJ5B 1YPZB 4BQBA 1UZ8A 5I66A 3PWNB 1AKJA 4G42B 5LCVL 3K8MA 3PGDB 3U7YL 2P44B 3V4PL 5BVPL 4Q0XL 4XI5D 1A2YB 4OGXL 1KCUH 1CN4A 2PKDA 5JXAH 5IOPB 3H9SD 2P7TB 4IDLA 5LGHH 1NGYB 4LCYA 4PTTB 4TNVF 5AYUL 1JNNH 4G8GE 3ROOA 2D03H 3ZT7A 3RDTB 5IB4A 3KHQA 4KRPC 1N0XH 1GRWA 1QACA 3LQZB 1XF3A 3PL6B 3VGFA 4GW5A 3B9KC 3PV7A 3H0TB 5GS2D 4GKZA 2FZ3B 3BN9D 3EFDH 4K9EH 1A1NB 4TULH 5E56A 1XZ0B 4G7VL 2G75A 2CLVA 5E6IB 4Q6IB 4WRLA 5GHWH 4YXLH 1M6OB 5LWYH 4YDJB 1R3KA 4F37F 2F5AH 2P48B 2VZ3A 1E0OB 4X6CE 4M1GH 3AU1A 4GBXD 3ZE1F 4LPVA 3ZDYF 4Q7DA 3WL9A 2JJWA 4WO4D 1OTSD 3RPKA 2AJXL 4X8JA 4PBVC 1BFTA 1G7HA 2DQIH 3GSXA 1B0RA 5E4EB 3UJIL 2MWCA 2WP3O 3KPLB 1QHPA 4NO5A 3I84A 4CMHB 2IMMA 3S36X 4I77H 3O6KH 4UB0L 1FL3A 2ERJB 3EYSH 4Y19D 3HNVH 1SEQL 1U8LB 5IM7B 1PY4A 4PJ5E 4PRHD 2NY6B 4OGYL 4P9HH 1YNLL 4DTGL 5KS9F 1NCAL 5EIQA 1T1XA 5GJSH 2ZJSH 1YC7A 1U8MA 2A9NL 2Q7NA 1XCTA 3MRIA 4PJGF 3NMEA 4LEOB 43C9B 2A74B 5D71L 3VGAC 2HVKA 4NHUB 1NGQL 4XMKH 3RUGB 5F7MC 3GB7A 5IG7A 3BIKA 3TCLB 1NL0L 1AHWA 1I7UA 3OAZH 1GGBH 4ODUB 3QIBA 1AHWC 2V5RA 3MUZ1 4TSBL 3WLWC 4JDVB 25C8L 4DGIH 1XGYL 1R5IA 2LE9A 3QIBC 4POYA 1DUZB 1RHHA 4A6YB 5DRNA 3NCFB 1MFDL 1D5BA 4Y4FA 3VFTB 1K8IA 3AM8A 2IALB 1YPZE 4EUPA 2K1MA 4Y4FC 4JY6B 4KI1A 4R0LA 2JB6B 2HWZH 1FNEB 4U7MA 2P8MA 5BVJB 5CS7A 3KPOB 4R0LC 4WTWA 1CLZH 1JHLL 1NPUA 5D93B 1HXYB 3TPUA 4OD1H 1OTTD 1OAYL 4XAKE 3F62A 3B5TA 5IB5A 3G5ZA 2BVUA 3ARRA 4KAQH 1RZ7H 1JPFB 1Q72H 2X4NB 4DK6A 2DYPB 4PLKD 5DZLA 3C6LB 4KTEL 2WWKO 1CFBA 2JJUA 1QFUH 1I7RA 3RWDA 3QCTL 2BNQA 5FUOH 3QDMA 5A40E 1CBVL 3U2SA 4MJ5B 5E8NB 5J6GB 2A1WH 3PIQB 2FO4A 2Z9TA 5KN5A 3L95A 4J2XA 2GAZB 1CS6A 4X6BA 3G6DH 1TCRB 1AGFB 4JN2A 2P24B 4L3EA 2AK4A 2F53D 1NAMB 4L4VA 4R90H 4HQQL 3U7AA 4Z7WA 5MP6L 4LSPL 4TSCL 1IGTA 2W9LA 1WC7B 2AEQL 5EOCH 1INEH 2YN3A 2FLRT 3LZFH 4D9LL 1CZ8H 3NTCH 1PG7X 1T1ZB 5F71A 3GSRB 4F33A 4Y8DC 4V2BA 3GO1H 4AEHH 5CGMA 2IH3A 3MRLB 5HYIA 5DD3L 1I1AA 4J3OC 3OWEA 3LKOA 4HW6A 4K7FA 1XF2B 1I1AC 2ADGB 1OVZA 3R1GH 1UM6H 4KHTH 1OY3B 4K3DH 4OTXH 1QHOA 1W8OA 1UJ3B 1WIOA 3MO1A 3H3PH 3QPXH 1V7NL 3OJDB 1KG0B 4UDTB 5BJTB 1P7KB 1RZKH 3PWPA 1ZT7A 2EEBA 2XWJB 1EXUB 2CGRH 2QSCH 5EWIH 5LJYH 3SKMB 4K7PY 4TVPE 1IAKB 4K7PL 1LO4L 3FN3A 5HHVL 4Y88A 2BVOB 5D7SL 4C58B 3EDDA 1FYHB 5BS0A 4QCIB 1P2CA 3OKYA 3NIGE 3D87B 3RUGE 2Z35A 5CMAA 1OAXH 2XFXA 3T3ME 3ULVC 2AV7B 1KB9K 4HK3N 4WENB 2RFXA 2AI0H 4FQJL 5CINH 1RUQH 5DFWH 2ZCKL 4O2FB 3STLA 2N1KA 3LCYA 1OL0A 1S3KH 5BRZD 2BY0A 4JCMA 1PQZB 1AJ7L 1KB9J 3MJ8A 1GOFA 1CWVA 2VXTL 3QUXA 5KSBB 1YEFH 1J0JA 4L4TB 1M71A 1SJEA 4LHUG 1KNOB 1BX2B 4PJ7F 4LARH 2AJSH 3FRPA 1AC6A 4HJ0D 4JPKH 3MUHL 2OR8A 5HVHC 3T2PA 1WBYB 4JANA 1E28A 1RFDH 1Z2KA 4OLWH 4KRMB 1PEZA 2ZKHL 4XNUH 2VLKA 3SDCB 4HIJA 4N5EC 3MGOA 3QEUA 3MA9L 5ANMA 5FDWA 2BSSB 1F2QA 2XQBH 2Q8BH 1MQKH 1BGXH 3UTQB 4CNIA 2XZCH 3QUZD 1D5XA 4JDTL 4G8FB 5DQ9A 1EX0A 3QQ3B 4ZYKA 2AXFB 1AH1A 1MCWM 5C9JB 1EUTA 3ARGA 3IYLW 3UMTA 4OZHA 1NQBA 1LMKA 2E7BA 4MDIA 3RJQB 4M6AA 4RAUB 3M45A 4ISVA 4PJBF 1MJ8L 2VNCA 1TZIB 4FQIL 4LCWA 5INCB 3EOYG 4R3SB 3BGFC 3WFDL 1FL5B 1M4KA 3G9AB 3TPKA 3DROB 5IB1A 2YBRB 4GLRI 3DXAB 3WXVL 1A7OH 2EXYC 4QRRB 1DEEA 1AGEB 2VDNH 4U2YA 3GKWL 5D1QD 4F7PA 4QXUH 5L6YL 4YIQA 2YA2A 1RZJL 1NFDB 3DLQR 2GITB 3OKMA 1SJHA 1MLCA 3O3DB 3WNOA 3IFPB 4KI5C 3ZSSA 1RULL 4BSWB 1AXSA 3K74B 4I3SH 4MNQD 2NYYC 1N59A 2Z8RA 1EJ6A 3QO1B 5JOEA 1ZHBB 5ENWB 1KV3A 2IG2H 2Y36L 4N5UA 1NBYA 3EFFA 5L8JB 3RAJL 3O0RL 3WKML 5KVDL 3BWAA 4JEGB 3S35L 5F7NC 3NCJL 4PJIF 2LTQB 3QWQB 1F4YH 3HI6L 3QI9D 2R1WA 2A77H 1UB6A 4Y1AA 2OP4H 5CP7A 3O3AB 1DJSA 4UTAH 3T0EB 3QULA 4LLQA 2YWYA 1R3HA 4LLWB 4YC2C 5DJ0B 4R7DB 3SY0A 4P3WA 3WEXA 1WEJH 1FNGB 4PP2A 1FLRH 4XXDA 4ZPTA 4WFEE 1OWRM 1Q0XL 4ZTPH 3DUUB 5TQ2H 2ZUTA 2AGJH 5KSBE 9CGTA 4MSWA 5IJVA 4L4TE 1H3TA 1AIFB 3RVXD 5EO0B 4ZD3L 3G5XB 2QBWA 5JHDA 1M7IA 2Q20A 4YHIB 5E70A 4PRBA 1A1OB 4NQDD 3RWHA 3OPZH 1OCWL 5EORH 1RZJC 3HKFA 1H5BA 4NIKB 4V2CB 2JKXA 2FR4B 1RMFL 4UIMB 5TJWK 1F3RB 3MZGB 1H5BC 1S7UA 4KUCD 2GFBB 3GMMA 4YHPB 2NNAA 2VABB 4QRQB 2HKHH 2YD9A 4R2GD 3U4EB 15C8H 4HC1A 1K4CB 5I1HH 3TP4A 3MLTB 1TPXB 3VFMB 1UT9A 3RTQA 1NEZG 1N6VA 3AXLA 5KVGH 1CFQB 2ADJA 1L6ZA 4JN1H 1VHPA 3RTQC 4J12A 1ACZA 2R0ZL 3GSNL 4GG6F 2XKSA 2FX7H 3DMMB 1U3HB 2ORBH 4JREC 5EZIL 1KACB 1JN6A 3ELAT 3PNWB 3U0TA 1ETZB 1BEYL 2Z92B 3SPVB 8CGTA 5TE6H 4QRSB 3V0VB 4PJXF 4HDIA 1BBJA 1J8HA 3VXUA 1QQDA 3NCYP 4QRRE 4I0PB 2B0SH 1K4DA 4P0DA 1NFDE 3RWGB 2NY4C 2P5ED 4BELD 3WLBB 5ESAA 1WGOA 3HA0A 4PLNC 4IHOB 5ITBH 3SE8L 4HUXB 2RCSL 4P59L 2DBLL 1UXSA 2VSDA 1MAMH 1DBAH 3SE3C 4PJ9A 5M7QA 4YO0B 2RBLA 3D85B 3WFCH 4PJ9C 4Z7VA 1IC5H 3LQMA 4WEBL 5L2KD 1DQMH 4X9FA 4LQFH 2PF6A 4OB5L 1Z0MA 2NMSA 5JW3H 3W0WB 1FBIL 3L7EA 2O93L 1WAAE 4NRZA 3TN0A 5EZJB 1FIGL 2FLBT 4JO1H 1A7PL 1QBML 4JFOB 3HE7D 2A6JA 5HY9B 2D31B 4OLXL 3TN0C 3OKNB 4MXVF 1A3LH 1VADA 3WNKA 4KJQD 3T0EE 5BMFH 2YZ1A 3GSNA 1QBBA 2D4FA 4JKLA 4K94H 1YEIH 5E5UB 1DQDL 1A6VL 3PGFL 1NUFA 2WWMC 1WBZA 3MRKB 3W2DL 5I1JH 3C9NA 5ACZB 3CUPA 4UBDC 4ORZC 3S96B 1XEDA 2BSTB 2NY3D 3P4NB 4M43H 3BPOB 3P11L 3TJHC 3WIIL 4D9RE 5I17A 2VLME 3O3EB 2XZQL 3L5JA 4WTXA 2MJWA 4GO6B 3AROA 4MDJA 1EMTL 1R3JA 2JCCB 1WFUA 1KPRB 2OZ4L 4HWBH 2J1KA 5K9OB 3P9LA 3LIZL 3CFBA 4NUJA 4HGWA 2LFGA 1MSPA 1YNKH 2EDRA 4P5TD 5TQ0L 4YAQA 3D3VA 4PREB 3F65A 3CC5B 3B2UD 3FQNB 5GS3A 4O5LL 3OR6B 3S98A 3TBSB 1CG9B 1OAKH 1DSFH 2EEAA 1ZGLB 1KSRA 1AGCB 5TFSH 2CUHA 1J1XL 1JE6A 1CGTA 5D96C 3UJJL 2HFGL 2BRRL 2P8PA 4OLZH 1RUKL 4PR5B 1OARL 1N3NB 4HLJA 5C07B 2PETA 3OXRB 2Q76B 4ZO6A 1DFBH 3RWJA 2PR4L 1P1ZA 2QQLL 3ZZ1A 5AAMA 5CEXA 5FYKU 1HH6B 1RUPL 4XP5L 1E6OL 1WCQA 1JPSL 3QUKB 4N0FA 5C0FA 1BD2D 5HHOA 3QUYB 4N9OB 3MCLH 4CN1A 4JG0H 2P8LA 1ZT1A 3ULUE 2E9JA 3CXHJ 4GG8A 1JF1B 1RIVL 5CIPA 4JFHE 3OG4B 1F6FB 3GMRA 1T1WA 1I7ZB 1CICB 4UT7H 4ZUSB 5DRWA 4UQ3B 1HYSD 3TVMB 3L3DA 3C5ZD 4XCCL 2OZ4A 2YHGA 1VDGA 1MCKA 1YEGH 5FGRA 1VGKB 2R1YB 3IKKA 3SKOA 3W0WE 1QLFA 1TVHB 4S1RH 5GRVK 2XZAH 3IXAA 4Y89A 2CIKB 1P4IH 2FWOB 4PYGA 3V5KB 4NQUA 3UTTA 1DN2A 5F7EL 1Q0YH 1NCDH 2BVEA 4JPVL 4XAWL 5C09A 1LEKA 1AFVL 3BPNC 3F7VB 1GH7A 1HEZB 5BQ7A 4QRTB 4HZLA 5L88H 2IANA 1XF4B 4Y8AA 4FXKA 4U6TA 5D72H 4UAOC 2R9HD 3O41B 5IEKA 4LK4A 4JRYB 1NAKH 2DM4A 5JORA 1CD1A 3E2HB 1F45A 1MHCB 1PX4A 4OZIB 3JWDL 4OKVB 4U1NA 2JCCE 1YYML 4QRPB 2BJML 5JMOC 1NCNA 2B2XH 2J8HA 3EJZC 2UY7A 1CE1H 1RUAL 2QTEA 4PGEB 3MODH 3HS0A 2IAMD 3CPLB 4HH9B 1IAOA 1QKZH 2JB5H 3M1BB 1IC4H 1KEMH 5TDPB 4H26B 2P5WB 3BAEL 4FXGA 3M07A 5F3HA 5J1AA 4OCYH 4UUJB 4ZFFA 5K9QG 3BT2L 3T09A 4BZYA 3MUGA 5FA4B 2GT9A 5CEZD 5I30L 3OHXB 2XQYG 4FQXC 4XRCA 5HGHB 2F58L 5DC4B 2DJSA 5C07E 2FHCA 5H2BA 1RHFA 1M7DB 2JE8A 4LEXL 4EOWH 1GPOL 1UH2A 1DBKH 4CU6A 1BWMA 4HX1A 4X0KB 4KHXH 2Y5TB 4W6WB 3SGJA 2CH8A 4HWZB 3MGAA 4LHQB 2AJYH 4KK8C 3STBA 3PE9A 3SGJC 3GUTB 1C16B 3NABH 3IRPX 3VGEA 1P4BH 5DMIH 5IR1A 4NWUH 5FF6B 5IVOA 4BFIA 1JGUH 4U1JA 1J05B 3EYFA 4GLRH 4KKAD 4BQ9A 2VAAB 3IVKA 3S4SA 2LAGB 1IAII 4XP6L 1NLBL 2QADB 4RAHA 4P99A 5KJRL 1YC8A 3N50A 1HSAA 3FQWB 3D0LA 5CSZA 1AO7A 3A6OA 3NFSL 4NKQB 4P3DB 4XPGH 1BF8A 1P4LA 2X4PA 1NCWH 3FQRB 5D1ZB 1PW3A 3MOAH 2BSRA 4ELKA 3IETA 3BSZL 1TJHL 3DECA 1HHGB 1TETH 3KYNB 1JGVL 3T0AA 4WW2F 3PHQA 4KK9C 1XGRA 2VOTA 1IL1A 1A0QL 3HRZA 5DRXA 3R06A 5HDBF 1EAPB 4X7DC 5EN2A 3RL1A 3MLZH 1TDQA 3DV6B 1FVDA 5KSAB 1IT9H 5BCAA 3D39A 4ETYA 3RL2A 4LSSL 5I1EH 1EV2E 4NCC1 3V6OA 3EYOA 4JRYE 1X5KA 4H25B 2V7NA 3GSQB 3CFEB 1ZA6B 4LLUB 3V6OC 4J4PD 5DJ6B 1DLFL 4OZIE 2GJ6B 3O4LB 4F2MB 1TZHB 4QRPE 2R15A 1A6UH 3P4LA 4HT1L 4TQEL 4M4RA 3MCKB 4L29A 5F9JA 3ZE2E 3FQXB 3CSGA 3VA6A 3TA3C 5FYKD 2FGWH 1KCKA 1QSED 1MUJB 4M6NL 4P23A 3MUY1 3JZ7A 1FZOA 1MHHA 4P23C 2WMPA 2E7HA 5EG6C 3LMJH 4OFDA 3P0YL 1YY9C 3DI3B 2P5WE 3C5JA 4KUZL 5F21B 2OTUA 3AS0A 1C5BH 4IRJD 3HMWL 1IM9D 4AIZB 4FZ8L 2R2HA 3BD3A 4JQXA 3TO2B 1PLGL 1WFOA 4UQ2B 2R23A 1G7IA 3PF2A 4I0CC 4DZBA 3REVA 1R5VB 1RJCA 4JR9L 3AS3A 1KPUB 4GS7B 4N0UE 2FJHA 2J8UB 3MNZB 2OJZH 3S36H 5EBWB 3R0NA 3F6LA 1N64L 1SYSA 4RA0C 2EDYA 3UBXG 5C92A 3OJVC 5IVXF 2VDPL 4C83A 1GXEA 1QLRA 1QNZL 4XH2A 5M94B 4IBLT 4Y4KD 4EDWL 4DUWA 3B6SB 1D6EA 4PGBA 2G9HA 3KG5A 1DBMH 3I02A 3AUVA 4HJGB 5FCUH 1C7TA 3WSQH 3GRWH 4GH7B 1EGJA 3KLAA 2EH8L 1UEYA 1ONQB 3ZLQC 2R29L 3D2UD 3F58H 4YGVB 3MJ7A 3RA7L 3VFGH 1J5OL 2EZ0D 3DVNA 1FFNA 2RAMA 1HCFX 3SDXF 4JRWA 3GFUA 1RD6A 4HXBL 1N0LA 3DUHA 3IRZA 2X4SB 1AR1C 3PJSB 5JPNA 3VG0L 2HP4A 1MJUH 5GGSB 1NFIA 4RDQF 5TE4L 5E03A 3V4UL 4DKAA 1FRGL 3QEQB 4LGPB 5B3JE 5HHPB 4WI8A 5ACMA 3LQAL 2JELH 3WNPA 4HFUL 4WFFE 3SCMA 1B4RA 3SCMC 1IKNA 4M7ZC 4W68A 4UINL 1IKNC 2GI7A 3QO0A 3L5XH 3NFNB 3BZEA 4S1SH 1UYWL 2L7UA 1I75A 3WXWH 5BO1H 4OUOA 3ARBB 4I1NB 1L9NA 3QZWB 4NC0B 3UXFA 5ITFB 3ZHKA 2GJ6E 3O4LE 1A8JH 1DLHA 2OJEB 4ZTOH 3BDYH 1A5FL 2CMRH 4XC3L 2DLHA 4KKBC 4RGNB 4FMFA 2R0KH 4UILL 1NCBL 2YKLL 3QSKB 2XI9A 5BV7C 5J89A 4Y4HD 4G6AD 1ZT4B 3FT4A 4X6EB 4LHJB 3KDMB 5IESH 1I8LA 4CVUA 3MNVB 2WUCL 4P3CL 1IM3A 4P2QB 1I8LC 4R26L 5AAWA 4LNRB 4NQCB 3C8KA 3G9VA 3BFOA 1S7RA 1PG7H 4ZUUB 5KZCB 4U1SB 3MLXL 5AG8A 4X9IA 2FECL 1IAIM 1FVEB 1P7HL 4NPYB 5HI3D 1G1CA 2BOCA 2EIZA 2W1NA 4YHLL 1JWMA 2J8UE 2DICA 1QR1B 43CAB 3MACL 2X4OA 3Q5OA 1B2WL 1NDGB 4WI9A 1VA9A 2I5YL 3ZKXC 5C7XL 1SVZA 3LQAC 2VDOH 5E7BA 4POZD 3BZFA 1BIIA 3VWKC 3P3YA 5T1KB 2MKLC 3VFOA 5DRZB 4HKBB 5F1IB 1UVQA 2ZUYA 4HIHA 4TNWF 3TBVB 2EDOA 5JW4Q 4CVXA 1VACB 2BY3A 5DK0B 1KB5L 4N1HB 1X9QA 4TYUA 2AQ3A 4FQHB 4F7TB 4JFFD 4WUUB 2AERT 3OBAA 3FB7B 4M5ZH 1UZ8B 4KKLD 2EYRA 6FABL 2Q1EA 1AKJB 2DQCL 5I19L 1IGCH 3VRLF 5EU4A 4OF5A 2WM0A 1S7XB 4Y4FD 1D7FA 1WZMA 3S88H 4D2NA 4Y16A 5B8CC 1LO0H 5EOQL 1VSCA 2H1PH 2JK5B 4NWTL 1XF1A 3QEQE 4LCYB 4Y16C 4JRXB 4DEPC 2H26A 3LEXA 4KRPB 1GCFA 4R97C 4I5BA 1OLZA 2VE6A 3CMGA 5DJDA 4BZ1L 2VDQL 3INUH 4NZTH 5IB4B 4R4NC 1MRDL 3DRTA 1I9EA 1HOCB 4AIOA 3UTSE 5A16B 1J0HA 3B9KB 3ESUF 5I8KL 1DN0A 4UDUA 3KLDA 3VXRD 2Q6WA 1KIQA 5J1TC 3NZ8A 4JHWH 5IFAL 3V7AE 1MCEA 4ODXA 3DX8B 4QHUB 1KB5B 2BNQD 1N4XH 4UIKL 5F6HI 3X3GH 2E6JA 3QDMD 1FJ1A 2DLTA 2Q86B 5MENB 3FAWA 4LSDA 1S5HA 4CVWA 2YRLA 3HRPA 4RGNE 3QIUA 1CFVL 2X4UB 2YZ8A 2Y6SC 1C08A 2FNBA 3HC4H 7FABH 3MV8A 3QIUC 4MYWB 3WL9B 3ALXA 2J7LA 4L3ED 3IGAB 5HI4C 4X8JB 2XKNB 1C5DB 2VYRE 1DVFA 4LLYB 4P2QE 1CDYA 4NQCE 4JY4B 1D9KD 4I18A 4NT6A 4NZUL 4Q58C 3LKPA 4FFWC 4I18C 4XPAL 3KPSB 3LPWA 4ONHA 2VH5H 1E6JH 3X17A 5D7IA 3L3JA 2XKUA 1A6WL 4Z5RB 3CFCH 4JM2A 2F54A 3GBLA 5JXED 4JAMA 1OGAA 2VSCA 1MCPL 5D6DA 3BP7A 3D9AL 5EZOH 5SX5H 3SE9L 1U8MB 1EVUA 3QCUL 4HULB 3VGAB 5ILTH 1VB9A 1BZ7A 3IXTA 3CLFL 4QGYA 2W0FB 3MRHB 4OZFA 1JGLH 2B4CC 3GB7B 5GGRY 3ZKMC 2DQJH 1X5YA 4HF5L 1JNHA 1Y18A 3QIBB 1ZGLP 4NBXB 5BS0D 2DS4A 5TDOA 3DOSA 5FHBL 1J0ZA 3FOLA 4U3CA 1RHHB 3FFCB 5DRNB 4K8RC 2DKSA 1T03H 4OKDA 4WUUE 3WFBL 4TTGA 4Y7MA 3O6LL 2V7HA 4J3UA 3VXNB 4YZFF 3AGVA 2IPKA 4R0LB 1PKQA 4MJIE 2P8MB 2M2DA 2NXYC 2YSSA 2D9CA 3FO0L 4G6FB 4F7CA 2EECA 1I3GL 1NDMA 4TVPH 3VFPA 4G9DA 1T0PB 1RQ5A 1G7PA 4JRXE 3BUYA 2R8SH 3QUXD 1IAIH 5IB5B 3U30C 5FGSA 1V7MH 1LE9B 1JGDA 1VERA 4JG1H 1S9YA 1JUFA 2P4AB 3HHRB 4UT9L 1G9ML 4CMMA 3ARDB 1I7RB 3V0WL 1ZLVH 3MX0A 3QDGA 1UKQA 3OKLA 3VWJA 1U58A 4WFED 3P9MA 2DBJA 3L3HA 5AZEH 3VWJC 2EIDA 1F90H 2X7LB 2DMBA 4A6YH 4ONFH 5E08L 2FO4B 3NZHH 5KN5B 3D18A 1WT5A 3BKYL 1OB1A 2BVPA 3L95B 1EO5A 2VLKD 4UV4H 4X6BB 2PW2A 1FH5H 3LOWA 4J23A 1WT5C 2DLEA 4JN2B 1T66D 1LO2H 4I2XA 5MENE 2AK4B 4YR6A 3OX8A 4Y5XA 1IBGL 4L4VB 3IDMB 4Z7WB 3MRGA 5D2LA 5GGRA 1IGTB 3ARVA 4Y5XC 1IJ9A 1JI1A 1B88A 4NNYA 4LCIH 4M93C 1ZSDA 4DGYH 1M1SA 4BH8A 4TRPH 3F7YA 3ARGD 4MA8L 5GS2H 3O9WA 3TV3L 3VGBA 1LDSA 1I1AB 3O9WC 1RUMH 3O6FA 4HUVA 1U92A 2QKIA 3MLPA 1NCCL 1CK0L 4JVUA 4EN3C 5IK3A 5I75C 4LCWD 1TJIH 3KPSE 4DQOH 3IDYB 3MV01 3V79C 2GY7B 4WTZG 2FX8L 4YFLI 2G60H 1RIHH 4QYOB 5HTSA 3Q3GA 1A6TB 3RHWK 3TT1L 1G9NL 5GS0H 5C0GA 3C87A 4PS4L 3WN5C 5GGTL 2LU3A 3PWPB 1QBLH 2ESVA 5E94A 1LO5A 1JHTA 2NYYD 3HFML 2D7TH 2D7NA 1JPGB 1TQBC 4OZ4B 4PRAA 1MIMH 1UXWA 5HYSA 4XNYH 2HRPL 3FT3A 1OPGL 1A9EA 5DYOB 1ZVYA 1KFAL 4X5LA 5KOVC 5MERB 1T0NA 4PRPA 3RWIB 2WW8A 2O61B 2P47B 5CMAB 1PD6A 4I3RL 1AI1H 1CLOL 4M1CC 2XFXB 1W8NA 3QJFB 4UV7H 2ARJA 1ZA3B 3FFCE 1TCMA 1EO7A 3H9YA 4Y1AD 3VD3A 5F97E 4X6CF 1NGPH 3MJ8B 4FS0A 2W59A 5I1IH 2CKBB 1OP5H 1Y6NR 5KAQF 1AGDA 2EDFA 1BJ1J 4OT1L 4RAVA 1JPST 3ME0A 5HVHB 4X9BA 4GW4A 4FQLL 3ET9F 4GMTL 1CT8A 4N9GA 2Y7QA 5D7LB 5FYJE 2BNRA 1HQRB 2FIKB 4WFGD 4X4YB 5ICXA 3WHE0 3IDJA 4XNXL 3IDIA 4Z7NE 3MGOB 4GRWF 1EAJA 4DVBA 5ANMB 5FDWB 4QTIH 4KMTH 5ALCL 1U3JA 2Y9RT 1G9NC 3Q1SL 5CILL 5DK3A 1NKRA 1G7JA 4CBPA 4CNIB 4LKXA 1T20A 2XTJC 3K46A 4YDIH 2R56L 4WGVB 4OIBA 3TIEB 2NTSP 5DQ9B 2AJ3A 4ZYKB 2DM7A 3HAEB 1QRNA 1MCJA 3W81A 4G8IB 4OF6A 4L4VE 2IH1B 4Z7WE 4OZHB 4HAGA 2UUDK 3K8LA 4YXHL 5AZ2H 2IWGA 3ILQC 3DX9A 4ISVB 5E2JA 5TF1L 3DYPA 4HMCA 1J1PL 2J4WL 1MCFA 2C9AA 4PLJC 5DUPH 5JZ7D 2WINB 2DQTH 1U8PA 4W6XB 2YN5A 4M48L 2VLLA 3BZ4A 5GISL 3LD8C 3AREC 2AKRB 1RJYA 4HK0B 4HCRH 4KTDH 5KVFL 5D9SB 3ESVF 2WIIA 1OD7A 3O2WL 4HS8H 3KPRB 5GZOD 4NGHL 4PJEF 2NY4D 1N59B 2VQ1A 3PWPE 1EBPA 4NKDA 5DTFB 4JZJA 3BP4A 3DSFL 1EFXB 1XH3A 3ARUA 4JZJC 1MREL 1NBYB 1BHGA 3VG9C 3VFVA 1CL7L 2GTZB 4YX2L 4PJ9D 4XCNA 3BWAB 1LEIB 4JY5H 3P73A 5EH1A 4HXAL 3ULVE 3PP4L 3QFDA 1CD8A 3X11A 4TOYL 2R1WB 4HGKC 1UB6B 5CP7B 2H8PB 3WS6A 4YC2B 4G43A 5IW1A 3FB5A 4LLQB 2HVJA 4ZS6C 5CGTA 3WS6C 3V9FA 4PJGA 2OTWA 3C09C 4LAQH 2BNUA 3HTLX 3VW3L 4ZPTB 5T3ZE 4GKSA 4XXDB 4JPWH 1RJZB 4U2ZA 2A73A 4M7JL 4QHKI 1JMXA 2V2XA 4OCMC 4MSWB 5DJAA 3O45A 3U0WH 2NTFA 1EFQA 1YECL 5FKPA 1JWUB 3TNNA 5JHDB 5E5RB 1M7IB 3RY4A 3LKQA 5DHVB 5D7LE 1LE5B 4D9QD 1ZGLM 4PRBB 3LVEA 3W11D 1QO3B 3TJHD 1CFTA 4FQ2L 5IIEB 3OTTA 4PJHB 5FO9B 1H5BB 1MRFH 5JUEL 1I1RA 3VDAA 1M05A 5JTWA 4KDTA 5DLMH 2PN5A 5ANME 3EGSB 1HHIA 5C9KA 3GMMB 4QEGA 4MQ7A 2EYSA 2NNAB 4Z8FL 5DT1L 3V6BR 1MCLA 3GJFK 2APFA 5GSVB 3RWCA 3RTQB 1B3JA 2YWZA 2ADJB 3S34L 3FTGB 4M3JA 4HFWA 2R0LL 1WUNT 1OP3H 4JREB 5CZKA 3E3QC 1WWWX 3UPRB 1MF2H 4X4ME 2VWEC 1BLNB 3HCVA 3SJVA 1IGJB 4OZHE 3BKJH 1JN6B 4ODWB 5C70A 3NIGF 3RUGF 3U0TB 4PV9A 1KJ3L 4GRLC 3VXSA 3T3MF 2E9BA 4KXZI 2V5TA 4P4KA 1J8HB 3ARFA 3VXUB 4M1DL 2DLFH 4KGJA 1JCKA 3GM8A 2Z31D 4DVRH 3ARFC 3P4MA 3I6KB 1D5IL 1NC4D 1NGWA 4M3KB 1UACH 5A2JH 3EO9L 4KI5E 5ABDE 1BVLA 5ESAB 1NC2A 2ADFH 3IDXL 3KPRE 4ODVL 1QZ1A 4CDGC 2V2TB 2WUBL 4Y2DD 32C2B 1CGSL 2YA0A 1AE6L 3LKRA 1H3PL 4RWYH 1EEQA 3S3PA 3MGTA 4NBYB 4Z7VB 3HB3C 3GEWB 5ISZB 1LD9A 4G80A 5K9JH 1QVOB 1ZMYA 3F7RA 4JZOB 4Z7UF 5D4QA 4WI6A 4MB3A 3BP6B 1F4XH 4Y5VA 3TN0B 1S5IH 4FG6C 1FZJA 2I9LB 1NGXB 1TITA 4Y5VC 2EIEA 2HT4C 3GSWA 4N0CC 4RFEA 1OAUH 3MRPA 5E8PA 1DQLH 3CX2A 1KCUL 1IC7H 3TT3H 4XVSH 5ID0A 3B43A 3ULUH 1WBZB 5LGHL 5C09D 3CUPB 1D5ZA 1QLEH 1U8IA 3MYZA 4JFEA 3RY5A 1JNNL 2Q8AH 2D03L 1HKLH 4OF8A 1N0XL 2YUVA 3IDNA 3DGGA 2IAND 5CJOH 3U6RA 5H94B 5CSBA 5JHDE 1A3QA 3TH4T 2EE2A 4QT5B 5D5MF 3EFDL 4PJHE 4K9EL 4XBEH 4TULL 3FB6B 2VRAA 3V7AG 5EBLB 3BXNA 3QZWG 5GHWL 4YXLL 5DZOA 5LWYL 1MCOH 4Z9KB 5JPMA 1RY7B 3EHBC 3D3VB 5EO1A 3WV0A 4PJ7A 4M1GL 5I2IA 3EJZD 2VN7A 2LVCA 1QA9A 1CR9H 1TTFA 3NPSC 1YN6A 2DQIL 4XVTH 5D96B 4F57L 3DVGB 4L8DA 3IJSA 2ZNXA 4QHLA 5A2LH 3WO4B 2CIIA 2ZG2A 4PLOB 5C0JA 5CAYB 1TVDA 2K3TA 2XOTA 1V05A 4I77L 3O6KL 1J8HE 3VXUE 4JFDB 3EYSL 2PYEB 1P1ZB 2X4TB 4DUXA 3HNVL 1P84K 1KLFA 2X44D 5E8OA 1EH9A 4K2UL 5HDLA 4N0FB 1AP2B 4AH2B 1JZ8A 1PZ5A 5HHOB 4EXPX 5KSBF 3QNZB 5GJSL 1ZT1B 2ZJSL 4NKIH 5EDXA 3KNBB 2PXYA 3VA2C 2P49B 4E0RB 4X80L 4GG8B 4PJBA 1P84J 5EOTB 2PXYC 4W70A 4XVJL 4BUGA 1T5WA 2VN4A 1LDPH 1T1WB 1ITBB 3IU3A 1ES0A 4Z7VE 4FQ1H 1BVKA 5L8LB 3JV0A 5ISZE 4QRUB 3L3DB 2E8ZA 4WHTB 5E99H 1GGBL 4OI9A 3VH8B 3MBED 3HE6C 1UWEH 2BSED 2NW3B 3MYJB 3FB8A 1QSFB 2R69H 4DGIL 5DMJB 1EDQA 4LMQE 1I1YA 1F11B 4IJ3C 3UTTB 3WYRA 1F8TH 1HYRC 5IBTH 2AJVH 1U2CA 2NX5A 3ZL4H 4JQVA 4QNPE 2X4RA 3B9DA 4KQ4H 3O8XB 2HWZL 2WBKA 4JQVC 4P57A 1FG2B 1AC0A 5EUKB 1CLZL 3F8UB 1C12B 3O4OB 5I16A 3NN8A 2DKUA 4OD1L 4W6YB 5I0DA 4X7EC 2WBWB 1YEJL 4UAOB 4WWKA 1NCUA 4KK9D 3BUTA 3LB6D 4JQIH 4KAQL 1O7SA 4WWKC 1RZ7L 1K85A 1Q72L 5DEFA 4YHYC 3TWCH 1HIMH 3PHSA 4MVBC 3D5OF 3PV6B 4HMDA 3UTPD 1QFUL 4L9LA 2AV1B 5FUOL 1JZ6A 3D39D 4U1NB 1JV5A 2A1WL 3HMXA 2D0HA 5FUCE 1FYTB 3MRFB 3G6DL 1Z3GH 3SO5A 2OS7A 3RVVC 2H2SC 3D3VE 4RMSA 3O3BB 5DSCA 4EI6A 2X5PA 2A6KA 4J3XA 2GIYA 1AQDA 1MCBA 4ZUTB 5IKCA 3H7LA 1KLGB 1T04B 1BOGA 2ZSVA 4MJ6B 1INEL 5EOCL 2V5MA 3LZFL 3SDDD 5J1AB 1CZ8L 4NN6C 1Q38A 1I85A 2NXZD 4ZFFB 1FQ9C 3U0PB 2ZWLT 4FQXB 1I85C 1WTLA 3GO1L 3U4AA 2YD5A 4AEHL 3VFNA 1E4WH 2V9TA 4LVOC 5DA0B 5C1MB 5FFLA 4JZNA 2ZUVA 5H2BB 2IC2A 4BSVA 3R1GL 1ZLUH 1MFCH 3QNXA 1UM6L 3CFKA 3WUWA 3HUJB 1CXIA 4JFDE 4KHTL 4KK5C 4OTXL 2PYEE 5EU3B 4HX1B 3QPXL 1AD9A 3H3PL 5DDHB 4HIXH 5HD8D 4GG6A 1RZKL 2Z8WC 5HHOE 1BZ9A 2ED9A 3PQYB 5IV2A 4LP4A 4XI5C 2YS4A 2ENYA 1EEYB 4HSQA 2CGRL 2QSCL 1WQVT 3T0XA 4UNTA 1WWAX 5CUSH 1AXIB 5E2TH 1T7ZA 3BEVA 5GRYA 4HWEH 5ACLA 2WSKA 1OAXL 1XIWA 3WNNA 3WO3B 4V1DD 4O51A 3J8F7 1QSFE 2AI0L 3PWVB 1XIWC 5CINL 2D0GA 1P6FA 1RUQL 2XG5A 5CSZB 4H1LA 1AO7B 3UTTE 2XY1A 3KLHC 1RURH 2VIRB 3RGVA 1WSST 1CTNA 1S3KL 4B7LA 3RGVC 3T8XA 1XF5B 2MKWA 2X4PB 1MFAH 3VD9A 4ELKB 2BSRB 1AR1D 2ICWJ 4M4PA 2X09A 2ITDA 2XRAH 5FOBA 4NM8H 3PHQB 4GBXC 1GHFH 1XGRB 4FZEH 2GSGB 1EHLH 5ESVA 2AJSL 4X5WB 3MLRH 5DRXB 4JPKL 3H3KA 1OTSC 4WO4C 5CBAA 3HG1A 4ZFOL 5A2KH 5H37G 1FZMB 3OKDB 3NAAH 1T5XA 1RFDL 3SCMD 1W0WA 4OLWL 4Z77A 1IGFL 2YD4A 1A6ZA 3EDEA 3SKNB 3EYOB 3X12B 4WHCA 4XNUL 3OGCB 1ZLUK 1W0VA 1HDMB 4ZQKA 1U2HA 3BH8A 5F9DC 2XQBL 2Q8BL 1N5AA 4YDLC 1MQKL 1BGXL 2VR9A 3RNQB 3TA3B 1QR4A 3CVIL 3FOMB 3U9UB 4YBLB 2YEZB 3P0VH 1SVCP 5ERWA 3MV7B 4PRHA 2XZCL 1D6VH 1FYTE 4WY7H 1ZANH 2OX5A 3EYQD 1HK6A 3ULUF 3BQUA 4EBQH 4P23B 4WU5A 5T1LA 5JOPD 3UTSD 4JE4B 3GHBH 5MEPA 4HK3J 1H8OA 1MHHB 3BQUC 4LLMB 4PV8A 3L3GA 1QYGH 3FHQA 5MHSD 4JDZA 3C5JB 5HVFB 3WS3A 5C0RH 5C0AB 4JHAH 4P2OA 1S9VA 4XNMA 5D2NC 2R23B 1YUHA 5GRUH 4P2OC