4ODWB

Unliganded fab structure of lipid a-specific antibody a6
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIVLTQSTSSLSASLGDRVTITCRASQDIRNYLSWYQQRPDGTVKLLIYYTSKLHSGVPSRFSGSGSGTDYSLTITNLEQEDIATYFCQQGKTLPLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
molecule keywords A6 Fab (IgG2b kappa) light chain
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwB01
4UDUA 1MAKA 2ZCKL 5DRXA 3UTOA 1LK3L 1ZLWK 1WIUA 3QEQA 2WW8A 5BRZB 5IHZA 4MA8L 1OP3H 2IADB 2ADIA 5EOCH 5DFTA 3F58H 2ICEA 2NY0D 1F8TH 2QQQA 3OG4B 3DBXA 4EI5C 1N3NB 4APQA 2D7NA 3TFKD 4XWOD 1FYTA 3RZCA 4N1EA 2YUXA 3G6AB 4P2OB 4NQCD 4C56E 3BPCA 4TRPH 4O2CB 4LNRA 1XCTA 5TDNB 1DQQA 2JJSC 3MJ8B 2GSIB 2EDRA 1JNJA 2OTWA 3F58L 4G8EB 4Y16B 1K6QL 3HMXL 5C0BE 3MLYL 3HZYB 4M7ZC 4C55A 5TF0A 5I9QC 4MQXC 2DTSA 4OLYH 3VG0L 4PGJA 2PCPA 5JOFB 1LK3H 2HJLB 4QWWD 4PRHB 4OAWA 1UB5B 2EECA 4HGMA 4HCRL 3LSOB 1J9CT 4RGMC 3MLWL 2VR9A 3UZVB 1YA5A 2HLFC 4S1SL 4XPGH 3FL7A 2IFFH 3MRRA 5DJDA 1TPXC 1IAII 3WFBL 2ORBL 2EDLA 1RZKC 3GMPB 3KLHD 1NFKA 1P53A 4Y5XA 5I1IL 1C8PA 4P23D 5CZKA 5BQ7A 4Y2OA 5GGSA 4P9HL 2W0FB 1U93A 1RIUL 4QTIH 2KDGA 1A9BB 3CFJB 2EDQA 3HR6A 5CUSH 3EBAA 4GSDH 4ZS7H 3DX8B 1AXIB 2A6IB 4KK5D 1J05A 1DQLH 3BE1L 1QEWB 4QKXB 3V8CA 5SX5H 3AXLA 3CDGB 1DBKH 2V5MA 1OAQH 4LDLB 4WHYH 3I02B 5DWUL 5E24E 3HS0A 3J8F7 3WL9B 4K3DL 5F7HA 2JCCA 3QDJD 4YHNB 1MHPH 3P4OA 1B0WA 4LLMA 1NCCL 4WHTB 4PJ8B 1JPST 4CN4A 1CFQA 5I1LB 3H7BB 4O4YH 1IAIM 4Z7OF 3BYYA 4OIIL 4P2OD 3MUHL 4QWWC 1CFNA 3DXAB 4KTEL 2DLEA 1JBJA 2G5RA 3BKYH 4U1SA 3UJJL 1CFVL 4CVZA 5FDWA 3KYKL 3RVUD 1OL0A 1F4YH 2Y25A 5IV2A 4MJIA 2ZUXA 4AMKL 3KPPA 4XNYL 3IDGB 4WHDA 4PJIE 5EUOB 3GKWL 5HGBB 4N1CA 5J7CC 2A74B 1GZPA 4W70A 3HNTH 3H8NA 4ONHB 3OAUL 8FABB 3RRQA 2FSEA 4G6JH 2GJ6E 1QHOA 3WNPA 2QSVA 4M61A 2UWEB 3TJHC 4OF3A 1KIPB 1S7VB 4PD4J 1RJLB 4ZD3L 2OJZL 4LSRL 3BJLA 1KLUB 5C07B 3MCLL 4QXGL 4L4VB 5F1SA 3PNWA 4H88H 5DQ9A 2A73A 3RL1B 3LIZH 4TN9A 5HHME 3BVNB 4UU9A 3T1WA 3TBWB 3QUYA 3GIZL 1QFHA 3MRFA 4XC3H 1IAOA 4D94A 5JDJA 1GRWA 3OSKA 1EA9C 3STLB 3V9FA 1KCKA 2DICA 1DCLA 2J1KA 4X8JB 3OB0H 3QIUC 4M8VA 3SY0B 5BCAA 2HFGH 5ISZB 2LABA 1X5XA 4HH9B 4CVWA 5D7SH 4OGXH 5BS0D 3I50L 4XCEA 5KW9L 1S9KC 5HHOB 2Z8RA 3KLDA 1EAPA 1FZJA 3O2WH 2GCYA 4J3WA 4Y2DB 1YECL 2BMKA 3O3AA 3SPVA 4S0SD 2L0DA 2RJMA 3QUKA 1S7TB 3IB4A 5EZLA 1TQBC 3NCJL 2FECI 1RZ7L 2D31A 1ED3A 4M02A 1MFCH 1XFPA 3BGMB 1NLBL 4OIBA 2Z92A 4OGYL 1RI8A 1WBXA 3QEQE 4Q9CA 4XBGA 4ZUWA 2GJ6D 3QWOB 3QT2A 5ECJE 2VXQH 5C0EB 2MPAH 3EYFB 3VFPB 5I1KL 1L7IH 5HGAB 4AEHH 1P6FA 4IOIA 3LEVL 4L3CA 5IB2A 1KC5L 1JGUH 4GW5A 1HE7A 3QQ3B 5FYJU 3JV5A 1X44A 3PIQA 4G9FE 4YXLL 4OTXH 5KSVB 1PSKH 1A6WL 4PLOB 4TPRL 1RPQA 2GAZB 3MGTA 1XIWD 3ROLB 4ENED 1CICC 3KXFD 4MB4A 3LKNB 4P3CL 5FGRA 2VDRH 1NQBA 5D2NC 3SKNA 5B3NA 4F7CB 4HGWB 3RY6A 3ZKQD 2P5EA 4ONOA 5C09D 5CWSA 3W81A 5EZIL 3U6RB 2X05A 2XN9A 3E6HA 3IAPA 4YGAB 4KV5E 4JY4A 2NQCA 1MHEB 4NKDA 5LWYL 4WUUD 5SWZA 3VFUB 1X7QA 2H3NA 5FKPA 3D3VA 4JDVB 2X4RB 2VDPH 2FCBA 1QHPA 1R5IA 4PTTA 1FG2A 1CZ8H 4XCYA 1KIRA 5C0JB 5CCKH 3FOLA 3H3BC 3Q6GL 2X1QA 1OAKH 3S96B 1N7MH 3HPLA 5I1GL 4FMFA 3FT4A 2DWEB 3OKOB 2WUBH 3LS5L 4H25B 4IIQA 4OUUB 1N6UA 1NUNB 2XT1B 2YD1A 1DP0A 4KVNL 4WJ5A 4XMKL 5DZLA 5D7LB 4F7MB 4TTGA 2Q86A 5IBUG 3QXUA 5HXMA 2VUOA 2WIIA 1CL7I 4NFDA 3VXSD 1SBBA 3I75B 1BMGA 2AEQH 3WSQL 4LPCA 1J10A 4A6YH 4PRIE 1KJ3H 3Q5YA 2AJ3B 4XRCB 1WFNA 2VDQL 2X4TB 4NM8H 4AM0B 5C1MB 1URLA 3VXNB 4PGEB 1IE5A 2R69L 2CLZA 4PY8J 5CJOH 1FNFA 4FQ2H 4FQLL 4PRNA 1RFDL 3NIDE 4M5ZH 1ZMYA 2YC1B 2AW2A 1HILB 2AEIT 3LZFL 2QADD 3T0EB 4HC1L 1HHGB 4F57H 4JG1L 5IV2B 3JUYA 5IEHB 2PXYC 1JYWA 4PBVC 5J1AA 1F3JA 1A3RL 5INDA 4I4WB 1RURL 4Q0XL 4L3AA 5HYJD 3OJVC 2UVFA 3AREC 3LEYL 5E08L 1LE9B 4PJAB 2XRAL 4GKNB 1PKOA 3D1MC 5ADPL 1JGEB 3HE6C 3WE6B 3B2UD 5FAAA 4KPHH 3O6KL 5DK2B 4Z95H 3ARBD 4ACPA 4MNGB 1AGBB 2BOCB 1SJHA 1ITCA 5D7IB 3TZVB 2J8UA 1ACZA 2VITA 2FX7L 3ILQC 4M62H 4XPFL 1FL6B 1ND0A 2D9CA 4LSQH 3U7YL 2C1PA 3GSOB 3D5OF 4BSWA 3RVTC 3EFDL 1FFOA 3CVHH 2EYTA 1IM9D 1CK0H 3CSYA 1U8HB 3GBMH 4LLWB 3O2VL 1H3GA 2MKLC 4U6XA 1HHHB 2DQIL 3QG6B 3P0GB 1LP9A 2ENYA 4K9EL 3BRDA 3U4BL 2R9HD 4B50A 4PG9B 1VDGA 3D39E 3EOBB 2AJXL 2IAMA 3AU1A 4LLYA 4LLQA 8CGTA 5D2NE 4HIXL 4LASH 5BVJB 3BEWA 3V4PH 1L0XA 4GRMB 5IW1B 3UTSA 1CQKA 1ZHNB 4LLVA 3HE6D 4GW4B 2N1KA 2M26A 2YEZB 1G7MB 4IMLA 2JJTC 4CMMA 5GJSL 5M7QA 3ZE1E 4XXDA 3QUXA 4YFEA 2VZSA 1I1FB 3T77B 3WYRA 1CDJA 3BGMA 2IAMC 5L2KD 2V2WA 2WMPA 4YPJA 1RJZA 2OP4L 1I7TB 1OPGL 2O5ZL 3RWHB 2NXYB 2X2YA 4NBXB 4O02H 5GGTL 5E03A 2HFFB 4ZUTB 3PG2A 4N9OB 1AJ7H 1JIBA 2HVJA 4ELMF 4MD0B 3G5YA 4X6CB 4LDOB 4ESKA 4JM2D 4OM1H 1JGLL 4M1CC 5DEGA 1YNTB 2HT2D 2Y72A 1AI1H 4N0CD 5D93B 1QA9B 3OF6A 4MVBD 2BRRH 2ZCLL 3KXFE 4UB0H 4WO4B 3KR3L 2EO1A 3WXWH 4NQEB 2VDKL 2Y6SD 2D0HA 3C5ZB 4FRWA 1YPZB 3C60C 4PJ5A 4Z0XB 1C5CL 4RWYL 5IBLD 3WIFB 3C8KA 5C9KA 1TZGH 4UV4L 3SE3C 3BT2H 3NIFF 1ZANH 5FUZL 5B22A 3MBEC 4HWZA 3QPQC 2R56L 2F54B 1PG7X 2VTFA 5BV7L 1S9XA 1UVQB 3U1SL 5D93C 1AD0B 2A6KB 4NO2B 1FYTD 3RZCD 3VFOA 3IF1B 5DT1H 4I77L 3ALXA 1QBBA 2DIBA 1DUZA 2H41A 3P4NA 2GY5A 3DNKA 4M3JA 1BX2B 2Z8SA 2XZQH 3QEQD 3WNLA 4DAGH 3EYUL 3NFNB 3DJ9A 4PR5B 1SJEB 4QHMA 4HIJA 4H1LG 4R26H 5SWZB 2F74A 3O41A 1MRCH 2AXFA 4LNRB 5J13B 4ZAKD 2DMBA 4XCYB 4IOFD 2VN4A 1MNUH 1JZ3A 3N85H 4LFHD 1HH6A 2DIAA 2DKMA 1T2QL 5GPRA 4OZGB 1R3JA 1KJ2B 4MJIE 3FQUB 4GBXC 5IW6A 2CDGA 3VFWA 4LVHC 1NCUA 4A2MA 1TNMA 3BQUA 1MJUL 1D5MB 1Z9SA 4R3SB 5GRJH 4XVUC 5FF6A 4FS0A 1S7WB 3OGCA 1AR1D 4OKDA 4BH7A 2GHWB 2BVOB 2D7PA 2HWZL 3WLBA 4P2RE 4LP5A 4IDJL 4HS3A 4YAQB 4M7JH 4G6FD 2WIIB 2ZP0T 3CXDL 5CILL 3MRJB 5F1NB 2R29H 4QRSA 3PHQB 1AGEA 4I2XB 5I8KL 4C54A 2R0LH 2DDQL 2FNBA 3T0WA 4YDIL 1ZWIA 3QHZH 4C58B 1G7PB 1VA9A 5EZJB 4RMWA 2EYRB 3JWDC 2ESVB 4N0UB 5IB1A 5J57B 5J6HA 2ZOKB 2NY6D 2XZCH 2ARJB 5F7UA 4XVTH 3D25B 4IRJA 3RWEA 4Y4KB 1YEFH 4D9QE 4ZFOA 2W9EL 3MOBH 2FB4L 3P3YA 4MNHB 3HAEB 1IC7H 5HDQL 2WBKA 3GMMA 4X80H 3BKCH 1KCRL 1IKNA 4EUPG 2NY6B 5JW4Q 4IRZH 5FA3B 3HMWH 1DQJA 2GSGB 4OAWB 1HK6A 4ONFH 4JFHE 1WQVT 2NY5H 1MHHB 3DETD 4OLWL 1ED3B 1QFWM 1CXEA 3OKKB 1ES0B 4JM2C 3SDXA 2BNUA 1A7OL 4MDJB 3NCYP 2V17L 4JZNA 3QRGH 1XZ0B 5LQBH 5EBMA 1FIEA 1CGSL 2YSSA 1T7VA 3L5HA 4LMQI 3V6ZB 2ADJB 2A83B 3SDDB 3WIHH 2XWBB 3IU4H 4W6WB 4QXTA 5CAYB 5CHNB 6FABH 4OLUH 3H9SD 3MLPA 2NXZD 4MD4A 2J6EH 4XPBL 3FZUC 4A2LA 3CDGA 5C3LD 2R2HA 3V4VH 4PJEA 4IRSA 1FE8L 1E4KA 1XGQA 2AJUL 3U2SB 2CQVA 1QRNB 2CKBH 1I8LA 2MFNA 3PWPA 3UTQB 3IDNB 2BNRB 4HKJB 5GRVK 3MREA 1B9ZA 4H5SB 3WS3A 5JO5A 5JQ6L 4TSBH 2A73B 4Z7QF 2DTML 4YC2B 3S88H 3QUZD 4S2SB 1IAMA 3K1DA 5GGTA 1XAUA 4WU7B 3ALPA 2FLRT 1NGQL 1S9WB 3MLZH 1R5VA 3U36B 5K9JL 4OD1L 1R24A 2FATL 3GJFK 4D9QD 1GJIA 1QFUL 3FFCE 4KY1H 2B39A 5C0BA 3VRJA 3FO2B 4OGZA 1I1AD 3BXNB 5I16A 4BQ6A 3DXAD 4ERSL 3OR7A 1OF2A 2G2RA 3ROOB 4CNIB 4U1LA 4LCCA 2YPVL 1YEKH 4NBZB 2BHUA 4Q9QH 2AKRB 1SY6A 3ARDB 1OM3H 4I48A 3O3AB 5F9WB 5EC2B 4KTDL 4R7DB 5AD0B 2HG5A 1K9TA 1FL5A 1NAMB 2IAND 5H35B 4RX4A 1D5XB 4G6AC 3P77A 4NSKB 1OT2A 4WFHE 5MI0B 3KPNB 2A0LC 4MA7H 3FQTA 3IKCA 4XPAH 5DTFB 5DJXB 3MRDB 3WFCL 1Q9LA 43C9B 1UM6L 5DRXB 4XGZB 5I1AB 2HT4D 1IJ9A 1IGFH 4NJ9H 3D0LB 1QLRA 3MLTB 4PREB 4HUVB 2CDFB 4PJ7F 3KPTA 3RGVB 1CICB 1KJVA 3EYSH 2YBRB 2FL5A 2R15A 1AKJB 5IQ7L 2K7QA 4DKDC 1A7PL 3MLSH 4YDJA 3HZKB 1F13A 1E6OL 5ICZB 5D7KD 4WRLA 2YRZA 1E27B 1DVFD 1EEZB 2HLFD 4S1RL 5JIIA 4C56B 1SJEA 4QHMB 5KN5A 4MJ4A 1FYTE 4R4FL 5C9JB 4J1UB 4AEIL 1KPUA 4FFZH 5GRXG 4GRWE 4KGLA 2D9QB 1R3IL 3CGTA 1YEJH 3TV3H 2DD8H 1DBBH 4P9MH 2FBOJ 4X6DF 1K4DA 5HJ3B 3T2NH 3RNQB 4MJIB 2FECL 3NAAL 3MA7A 1WITA 3U0PA 3S36L 1C7SA 4LSVL 3MXWH 3O0RL 3PWVB 5D1QA 4KK5C 3P2TA 2NY2B 5HHQA 4WNQB 4G8GE 1EFXA 3O8XA 1I1AC 4NQXB 3B3IB 2C4FT 5DUBA 3NCCB 2G60L 3SQBA 4I1NB 5GS3A 2A6IA 2YPLB 5I1JH 4R0LA 2H2SC 4DGYL 4FG6C 5CEXA 1QLFB 3BMWA 3M1BA 2G5BA 4LCIL 3S7GA 4B7LA 4Q2ZB 1GOHA 3JVGA 3FQXB 2EDDA 4YXKH 3TEUA 1WEJH 2PTTA 4KHTL 3V7AG 1WICA 4WGWB 5GGVL 1XH3A 4D0CB 1MCQA 3OAZK 4C4KT 5DZOA 1OTUC 5D70H 5EOCJ 3AFLA 3HAEG 3DV6A 3ORJA 3UBXI 5JNYA 4P48A 4DGVL 5ANMA 1QPPA 3T04D 5I1DB 4NPYB 1INDH 3QUXB 3LQZA 4JGJA 5D7IF 1VFAB 2YC1A 5KS9F 2CXKA 4HF5L 2EH7L 3QP3A 1U8MA 5ENWA 4ETQA 2CUMA 1JHTA 2GSIA 2DRUA 4YDKL 1YMME 3IDGA 3IVKA 3K3QA 2PCPB 5DVOA 3QNYA 3GO1L 2CDEB 3MJ9L 5DRNA 5T3ZH 3D2UB 3NN8A 4O5LH 2XXCB 5D2LA 1IL1A 2R4RH 1QR1A 3SDYH 1MH5A 5E94A 3IKKA 1OSZB 1UM6H 4OZIE 3HC0A 5E8EB 1TFHA 2IFGA 3DETC 3IETA 2N7AA 1LEGB 2F58L 4JFOB 3KLAB 3LQMA 4CAGA 1ZGLB 1M7XA 3VFPA 1Q38A 1QRNE 1U93B 1A1MA 1EGJA 2DQJH 2IMMA 2APTA 3VGAB 1I8KB 2C1PB 3GSOA 4IOIB 4MA3A 4BKLB 1NFIA 5JOEA 1YY9C 3DMMA 3RKDC 3L3HB 1P2CB 2IWGA 4WEBH 3M07A 2DI8A 3V6FB 3V5KA 1F6AB 5MEQA 4K3JL 4WI5A 4OLZL 1GGBH 5IK3A 2X4SB 5DMGC 7FABL 1Z5LA 4O2CA 5TDNA 1IQWH 32C2B 1JFQL 4I0PA 5HD8D 4Q6IA 2YPKB 3MNVA 5F6IC 5C3TA 4IRJD 3PHSA 3OJDA 1P7QB 1QSZA 2ITDA 1TJGH 1TETL 2NY3C 1VACB 2DTMH 4ZO8A 3QYCA 4DKEL 5JQ6H 1C08B 1SYVB 1Q94A 4HW6A 5ERWB 3DURA 2NNAB 5C8JB 4X6BB 2HT3C 1X7QB 1QD0A 1IKFH 4RGOH 3TF7C 1KJMB 2Q8BL 3TNMA 3BGFB 4PRDA 4Y19E 5DMJB 4NDMA 5K9KB 2E6JA 1XIWC 2EE3A 1QZ1A 5GGUA 3ARGA 4HS3B 4E0RB 1J5OH 4UV7H 4BSVA 1N8ZA 1AXSB 4XVSL 3PDOA 4JFQB 5F1NA 2EXWC 4U6VH 3UJIL 3HG1D 5KSAA 1ZA3B 1GZQB 4Y4HD 4NP4H 4YFDB 2X7LA 3FFCD 1P5VA 1WFOA 2NY1C 5KANI 2BSRA 2Q1EA 2E27H 2UV3A 5FHBL 2HJFB 1C5BH 5D7LA 3NCMA 1A7OH 1Q0XL 1PKQB 3KYOB 3NA9L 4L9DA 4LHQB 4MXWH 4XVUD 1FHGA 3DXAE 1XF1A 4OLWH 2YD2A 4ODUB 1PG7H 2FD6H 4ZUVA 3W9EB 4NRZB 3UO1H 3HMWL 2RQ8A 1XF3B 2DQCL 2VE6B 4HMEA 1NBVH 2J7LA 3RDTC 4F8TA 3X12B 3DYMA 1OP3K 1YEDB 3HRPA 2GSGA 3X3FL 4M1DH 1H3VA 5FKPB 1PD6A 1XR9A 4PJHA 3QHTC 5IMLB 1Y6NR 2CGRH 3U6RA 5EULV 1YYMH 3UC0H 1RK1A 2OI9B 5DA4A 1U58B 4QRPD 1YQVL 3UDWA 1A9EA 3MNZB 1NCBH 1D5IL 1X6NA 2A9NH 4FXLA 4KHXH 1NBVL 1OTUD 4WW2A 3IJHA 2QTEA 3PL6B 4LU5L 1V3LA 2FD6L 4ZUUB 2VYRE 2ZSVB 2OCFD 5I2IA 5IBTH 1N0XL 5DVKA 1AO7A 1IBGH 4FZ8H 1FNHA 3PQYB 4MXWL 4BFBD 2YS4A 4LCCC 5HGGS 3OAZH 5L9DH 1NBQA 4HHAB 5CD5C 4JDZB 5T1LA 1JV5B 3UDWC 2XFXA 1FC1A 3ES6A 4NP4L 1BQHG 2W0KA 1G1CA 2VSDA 4IIQC 5HGAA 3GMPA 5L0QB 3DX8A 1BF2A 2OZ4A 3D9AL 3IT8D 3RI5F 3TT1L 4OT1L 1FPTL 5GS0H 5ISZE 4M5YH 1MCEA 3QDGB 4XZUB 3LD8B 1IFHH 2RAMA 5IVOA 4J3TA 1PZUB 1A4KB 1OT1A 3HE6A 3L5WB 3X14A 1DL7H 1XMWA 1NSNL 5EOQL 5MEND 3O41B 4G9FD 5EC1A 5INDB 4LRIC 4PJAF 4OT1H 5JORA 1VFAA 2RCSH 2OTWB 2P42B 3F7YB 3RVTD 1HDMA 2FIKA 4L9LC 1ODAA 2BXYA 4X9IA 2AJYL 1ZHNA 4LLVB 4BJLA 2NY5C 4HIIB 3LMJH 2PR4L 2UVEA 3LEXB 4GH7B 4FABL 4MB5A 5CD5D 1QRKA 4HUKB 1IM9A 5J12B 2ICWB 2VLKA 4FZ8L 2GFBB 3SDCC 5KSUA 4QOKE 5HYIA 4WEBL 2NX5D 3CAFA 2WBJD 3VGHA 5I9QB 1CDCA 1OSPH 4LLDA 4YE4L 1Q9LB 3ZHDA 43C9A 3TO4A 3TZVD 4GAJL 3KR3H 1XZ0A 1KLGB 4WV1B 2IEPA 3MLTA 4PREA 3F7VB 3GNML 1JPGA 4NKMB 4JE4B 4JO1H 3PQYD 4YHZH 3D69B 4U1MB 5LJYH 4HJJH 4OSUL 1PY4A 1A1OB 3ARRA 4EI5B 2JCCB 2O5ZH 5K93A 4L3EB 4NQVA 3KJ4B 4MB3A 3DI2B 2D4FA 4OFPA 4WTZA 4OZHB 1KB9K 5IMOB 3UO1L 5GJSH 3FRPG 5E2VH 3WIIH 3PGCB 4AEEA 3GSWA 2WINA 2E8ZA 5EO0B 4F58H 1P7QA 5FDWB 1EBAA 3NA9H 1G7MA 2XTLA 4ZO9A 4BFIB 4OCSL 1A1NA 3P4NB 3KJ4C 1FN4A 4RA3A 1MCCA 3PP3H 1RZFL 4ZODA 3G5VB 3MJ8A 2DQIH 4XCFL 3EYVA 5EU7E 2XKNA 1G6RL 3OR7B 5T1KA 3SJVD 1CK0L 1O0VA 3QH3A 4K3EL 3QO1A 4UBDC 3EFDH 4RGOL 1AO7D 3WFHB 1YN6A 2P8MB 2QSCL 4NCC1 4NHUA 1GZQA 5DRZB 4GXUN 3K2UH 3MZGB 2HMIC 3GSUA 3QQ4A 3DUUA 4JVPA 4F7MA 4M62L 3HC4H 4JFDD 1BJ1H 4BYHA 3CK0H 1FL6A 4U31A 1T89A 2C9AA 2LV4A 3MV8B 4N9GA 3FQTB 3BZEA 3O6KH 1FAIH 2VC2H 2XY1A 2YWYA 3D3VD 4ODWB 5EFIB 5FUCC 4ENEC 3D48R 4PUBL 1H3WM 1E4XH 4HX1B 4OI8A 5IESH 3FONA 4MJ6A 1T7WA 1A3RH 5IGXH 2D0GA 4KROB 3KPSB 1HHJA 5I6XB 5FXCH 5FYKU 1TNNA 2KH2B 5HYJE 1L4IA 1RK0A 4WI6A 3KVQA 1HXYA 1OF2B 4JRYE 4PJFA 5ICZA 2APWA 1A3QA 5ESVB 3G5XA 5C6TH 1WZ1L 1YEJL 1ZLUH 3SE8H 2R69H 4N5EC 3VXMB 1J8HD 1WUNT 3LSOA 1FL3B 2F58H 4AT6A 4S1RH 2C1OA 3FO1B 4Y4HA 3UBXA 3BD5A 3N9GL 4LSTH 4JFXA 3MNWB 4A6YL 3HG1A 5E70A 5FFLA 3JWOC 3PGDB 2AEQL 1HHKB 5C0CA 3MRLB 4MHHI 5F89B 4L8CA 3MLSL 4EUPA 5DJXA 3QEGH 1U8KA 3UTSE 3MRJA 3MJ9H 4FQHA 5T1LB 2W0FA 3GO1H 3VI3F 4KVNH 3I3EA 2DOCA 1JWUA 1AHWC 3RPIB 4M6OL 3JV0A 3KHOA 1JJUA 3V6ZA 2JJVA 3TBYB 5DUML 3I3DA 4HF5H 2X4QB 2Z91B 4NQEA 2LE9A 2DQHH 2UYLB 5EORH 3U9PL 4F9PA 5JXED 4XPAL 3J7HA 3H3KA 3PWNA 1Q0YH 3O4LB 1SMOA 1ZOXA 5T1KD 4WJ5B 2AQ1A 1VSCA 3L3OA 3MRQB 3KYNB 2MCPH 4U2ZA 4I0PD 2P1YA 3VGGA 1ZSDA 2NY4B 5D70L 4X5XA 1AHWB 3ARTA 5F7NC 3DHMA 5BS0A 3OJDB 2VDLH 4ZFZA 3TWCH 5CD3A 1YY8A 3OJ2C 3TBSA 3L3IA 4V1DA 2A6DA 3V79C 1OLLA 4LCIH 5FA3A 4P3CH 5I73C 4RMQA 2VJXA 3NFNA 2UUDH 2IF7A 3VGFA 3UAJD 1RJCA 5IFJB 5M95B 1Q72H 3BP7A 2Q20A 4QYOA 4OD1H 4YHIA 3U48A 5EU6B 1FZJB 3MLZL 4IDLA 1A6TA 4J2XA 2Y1VA 1MLBB 1NCWH 3CNKA 3MXWL 4WI2A 4KAQH 3OTTA 5MEPB 1QBMH 5MENE 2E7LC 4YLQT 1KXVC 3QFJD 2CSPA 3QO0B 1WIPA 1D6EB 3G04B 4LEOA 4QXTB 2R8SL 1T6VN 3Q2CA 1QA9A 4LKCB 4KK8D 3RGVC 3HI1A 1HXMA 1KCVH 4MAYA 5IMKA 3TIDB 1T5WB 1XF5B 3N50A 5CMAA 4YHLH 5CEXB 4RCAA 1PYWA 3AM8C 3N1GC 1R3IH 4ELME 5D7IA 3TO4D 3TZVA 4DN3H 1CXLA 3SE4A 4LRNL 3FJTA 1I8MA 3LOWA 3CLEL 2H26A 1LEGA 3EFFB 3C6LA 2XZAH 4R4FH 1G9NC 3IDJA 1CL7L 5J6GB 2A9ML 1JN6B 3PP3K 4MJID 3NFPA 1EO7A 3AUVA 1I3RB 4U1IA 1UZ8B 1XF3A 2VE6A 4H8WC 3MRIA 4Z5RB 4LAJH 4MD5B 1DVFC 1T04B 4QLRA 2BVPB 5L2JB 2NY3B 3QRGL 2BNQB 3O6MH 3ECBA 1BPVA 4LLUB 3CX5J 1FC2D 1MPAL 3P0VL 1T6WA 1KB5B 2C3GA 5CP3A 5KW9H 1INQA 3BEWB 5C0BB 1XGPB 3EYSL 2V9RA 3FO2A 4P3DB 4U3HA 2DL2A 5I1LA 2F74B 4HUUB 2X41A 2VISB 4KI5E 5LG1A 4ONFL 4LCUB 4WUKH 2IAMB 4EQ2A 2G2RB 3ROOA 1F97A 32C2A 3S97C 1GIGL 4I0PB 3VFVA 4ZFGL 4QRPE 3X3GH 1IC7L 4KK8C 2OXHA 5GSRA 3O8XD 4JFEB 4QCIB 3T0EC 1CDIA 3ZYOA 4IMLB 1F2QA 4FNLL 1A8JH 2E9WA 2W60B 4MWFB 5F9OL 4I13B 1YEEH 4G6MH 2PXYB 4L9LA 1DR9A 3VXRE 1RHFA 1G7LB 1IGYB 4HHAA 2B4CH 1JE6A 4X6DB 5KTEL 3MCLH 4Q9RL 3KLAA 2VWEE 1S7WA 1IGTB 4DKAA 2CXGA 1YDPA 2NPLX 5K33A 5IMMA 5T1LD 4P57A 4WTXA 1U3HA 4OQTL 4YHOH 3GZKA 5IKCA 3BZEB 4P99A 5BOZG 2ADGB 2Z31C 1DEEB 3FT4B 4ZXBA 1TVBB 2YA0A 4JDTL 4PRHD 4YR6B 1FLTX 4LPTA 2ZSWA 3A6CL 1FZOB 3HA0A 5DEGB 3GJFH 3HNTL 3I84A 3RWCA 3KLHC 3TFKC 2FATH 3SJVB 3H6JA 1VFBB 2MKWA 4AMKH 4UQ2B 2FYYB 4OFDA 3LRGA 4NWTH 1MFNA 4TVPD 4QRPA 5FYJD 5EU3A 2YA1A 3FOMB 3IGAA 3MNVB 4JM2F 4BA8A 1KPUB 1YC7A 1S7SB 3SKOA 3MLXL 3O45B 3G5XB 2FIKB 1M71A 3NFSH 1MNUL 5ID1B 2DLFL 3VFTB 4B41A 1FYTB 3BYTA 3RZCB 1EVTC 1CDYA 5D7JB 3VXME 2PUQT 4AL8H 5JLZB 1FE8H 4YXHL 4O4YL 3VXQB 3ZLQC 1KACB 5C86A 1TENA 1NCCH 3EYUH 1HHGA 3KPMB 5HHMD 3T0AA 2VSCA 1J7VR 1NDMB 2XN9E 2EDBA 1HNGA 1U8JA 1OAQL 4LQFH 1BQUA 1AQDA 3ULUE 1X5IA 5CP3H 2BK8A 2XWBA 5CUSL 2FZ3B 2CDEA 2R56H 1RIUH 4QTIL 2GITA 3VGAC 3B9VA 2LAGB 5FCUL 1JZ6A 1OLZA 3O6FA 4RDQG 5IQ9A 3WFBH 5DUBB 5C71A 2EDOA 3ZDZE 5F8QC 4PP1D 5GGVY 2NY5L 1VFUA 4YBLC 2P5WD 4Y5XC 2W65A 3ARGD 2FRGP 2XFXB 1BVKB 2GT9A 5HY9A 5LAXA 5IFHH 3GM8A 1PJ9A 1S5HA 1WVZA 1ZEAH 4HUVA 2I07A 4JO3L 1N4XL 4BSWB 1I1AA 3OKDA 3FO9A 3MMEB 5IF0B 5GIRB 1QQDA 3D85D 1ZT1B 4OLYL 2Y5EA 2ID5A 4GXUM 2CK2A 5ANMB 5F70A 2XZCL 1WFUA 2CLRA 3V7AE 1OPGH 5E7BA 2FEEL 4P4KD 3TVMA 4JFHD 5IMLA 1V3KA 2O93L 1ZLWH 4YDVB 4PJXA 4GG8A 3VD5A 4I3SL 5EIVA 2R0LL 1ONQA 3LRSB 1WZMA 5BOPA 1LE9A 2R29L 1KN2H 3JZ7A 4URTB 1V3MA 1JZ5A 4HSQA 3CXDH 4HUNB 5CILH 1ZLVH 3F7YA 4KKCC 4XMPH 5EOCL 4CVZB 4Z7VE 3GMMB 3MJ7A 3KYMB 4IDJH 1XGRB 4ODVH 1J0YA 3HFMH 3WNNA 1J1OL 4PRPA 1MJUH 3RWDA 4I18A 4KJYA 4JO2L 2BFVL 1MJ7H 3NACL 4RGNE 4WO4C 3QIWB 4CBPA 2W07A 5E8EA 1AXTL 2X4UB 2BVQB 1FVEA 4RMSA 2GI7A 1SQ2N 3REVA 3BN9D 5E9DE 4HPYH 4D9RD 2OXGA 3MV8A 4XBPA 3MJ6A 3MXVH 1BBDH 1C1EH 2IBZX 4BKLA 3LQAL 4BSVB 4C4KO 4OGAD 4RFOL 5CP7A 3RA7L 4YNYA 5CGYD 4YC2C 2XZQL 5E8NA 1XGQB 5TQ2H 5DD3H 4W4OC 3QXAB 1R5WA 4S0TD 4P2QD 4CU6A 4PTUA 2WLYA 3VD4A 2R2HB 2HT3D 3OV6A 3CSBA 5HHNA 4I77H 1VEOA 4M93C 4Z77B 4ZAKB 4HXBL 2VDNL 3RVXD 5L8LB 3CDFA 2VNCA 5FO7A 1P4BH 1B4RA 2DF3A 1FFNB 1U2HA 3BZFA 4P4KA 3MRMB 3SEPA 1KB5H 4GKSB 3DARA 1GGIH 4M1GH 5JNYB 4S2SA 5HD8C 2H2SD 3CPLB 1YYLL 3VWJB 5L8JB 4PBXA 1IGJA 4XC1L 3WXWL 2UWEE 3D85B 2QQKL 3VXSB 5K59E 4LVOB 4FQLH 3KDMA 5FEBA 1JWMB 5FYJE 1BBJB 3SDCD 3C8DA 1JWUB 2HTKD 5LGJA 4NM8L 3ARGB 1Q1JH 1U92A 2VDQH 4XB8A 4GG6E 3BQUD 3JWOH 2GTWA 4LPVA 2EIEA 5EO9B 2O5XH 5C0GA 3D69A 4PJGF 4U1MA 4ZPTB 4XP6H 5DJ8A 5GRYA 3WIFA 3HUJB 5MEOB 3EYFA 5LCVL 3QPQD 4JDZA 4X7TB 2OZ4L 2BSSA 4HUMB 3K1KC 1J0KA 2ENSA 1MVFA 2OX5A 1N26A 5C09B 5C0FB 1SM3H 4JJHA 2JJWA 5LGHL 1CZ8L 4OQ1A 1S7XA 1KPVB 1NGZB 4OF7A 1C7TA 1NEZG 1BZ9A 1RU9L 5I1DA 3ESVF 3VXQA 4F33B 3O2VH 4QF1B 4RFNC 3GBML 4PJHB 1I3UA 1U8MB 1JMXA 5ENWB 4ETQB 5BVJA 1DSFH 4ODSH 4POYA 1M7IB 3RTQB 4IHOB 3BUYB 3VWKB 4GMTH 1HH6B 2Y07L 1U9KA 4OJFL 4PJCF 1UM4L 3ZDXF 1XF2A 5HVHB 1UACL 1JPFB 4MNGE 5DYOA 4XHQA 3UYOD 2FX7H 4I0KA 4XWGH 1QSFE 3VFSA 1LO2H 4ZXBD 3BZ4A 5E94B 3BPOB 3DPBA 1H5BA 2JF1A 4MXVE 1U3HD 3RL2A 4YAQA 2IPTH 4M9PA 3SDXB 4FTVD 5DD6B 1N64L 4XAWL 4ZFFB 4PGCB 3FAXA 4TVPH 4WW2C 4JPWH 5DHXB 5E08H 5HHQB 4ZO7A 1KC5H 3P9WB 3MBXL 4OF6A 5ILTL 2OJEA 4QO1A 2BDNH 1NL0L 3MRGB 3TPUA 3ARDD 4WNQA 1HQ4B 3S3JA 2I60H 5KANG 5C08A 3E1F1 3D39B 4AYFA 4OCLC 1W72B 1A6UH 5IB5A 2RFXB 4FQ2L 3VXPB 2AK4E 2ERJC 2DI7A 2V9TA 4U1GC 3GMQB 5EOTA 1LO2L 2IAMD 4AQ1B 4PGEA 2ZCHH 5ISZD 4HT1L 4UTAL 5FYKH 2VZ3A 1W2KT 4NQUA 4HS6B 4C59B 2W0LA 4F80A 2Y07H 5I66A 4S1DC 4Z7VB 1NEUA 2X4NB 3HI5H 4CADB 4LRIA 2H9GB 4MNQA 3MRBB 5IR1B 4UILL 4PGDB 2RR3A 1A6VL 3MQIA 2N56A 2WUBL 2VXVL 3L3DB 1MCWM 2DQEH 1IC4H 4NDMB 4EI5D 1L0QA 1N7ML 1R3HB 4P2QA 3Q6GH 1LE5B 1YMHA 1Z0MA 4QY8B 3TO4B 5CCKL 5K9QG 1JMZA 4RAUB 2DQEL 3DYOA 1TVBA 1YPZE 1AO7B 2VDPL 4YR6A 3QI9C 4R0LB 1OOAA 5H35A 4M7KH 2XKSA 4O2EA 4ZSOE 5TDPA 2OZ4H 2NX5B 1S9VB 1AH1A 1ACYH 4F7TA 2F54E 3G08B 3BPLC 1WBYA 5DJZA 5EG6C 5DMGD 3ALWA 1CE6A 1ZHLA 4AH2A 2GKIA 4XT1C 4HT1H 5DJCA 4MMXC 4PJBB 4X6FB 3U36A 1Q1JL 3NOIA 4TUKH 4K2UL 3BXNA 3WHE0 3SQOL 4RGNC 1PSKL 4LLQB 3S3SA 1BJMA 1F5WA 5EC1B 4Q6IB 1U58A 3LEVH 5GGRB 3UAJC 2X4SA 1CFTB 3L5JA 3QB7C 1I1YA 5ILTH 4KXZI 3MROB 4M1GL 4OZGE 3KPOA 4M8QA 4PY7A 1L7IL 1KB5L 2VISA 5EIIA 2D7MA 4PLNC 2AQ2A 5A2KH 1MIEL 4X4ZA 5FUOH 1UJ3A 5JXEA 1U95B 3LKSA 4JPWL 1P4BL 2PYEE 2YZ8A 2VDNH 2Z31B 3RWHA 2R2BB 2FR4A 5IQ9B 5INCA 3R8QA 4XAKD 4BELD 4XCCL 4RNRA 4FP8H 4KRPB 1X5FA 4ZS7L 4LKXB 2NY4C 3ESUF 3QWRD 4NJAH 5D72H 3RA7H 2X1XR 3RPIA 1TZIB 4IJ3C 3O6FD 4UOW1 3RBSA 4RFOH 5D2NB 1MI5E 1RZJH 5I1IH 5LXGL 5CIPH 3I50H 3LHPL 4CVXB 2P5ED 4HPYL 4OGXL 1QSFD 4JFFB 4LEXH 2FGWL 3NACH 5CJQH 2DBLL 1IMHC 2LU4A 1SM3L 2DIJA 5GSVB 4UI2A 3VFOB 3RQ3A 4JRYB 2WINB 3WV0A 4HH8A 3U7AA 3EOAB 1S3KL 2CR3A 5HI4C 4G7VL 1KN2L 3KPSD 2DLHA 2Z4QB 1RUAL 2HMID 4GAGL 4LSRH 5F9DC 2BVYA 3BH9A 2XTJE 1IAKB 3OKEA 5D5MF 3NZ8B 3LKOA 3D18B 4TQEH 4HUXA 3JWOL 3LPFA 4LLDB 2G75A 1ZXQA 5DD6A 5LKNA 3CFCH 3RWIB 2R0KH 3QDMB 1J0ZA 3O9WD 9CGTA 3SBWA 5I75C 3WS6C 1DLHB 2PYFA 2R0ZH 2Z91A 3GKWH 2C4FU 4B7IA 2P8MA 4NKQB 3BP6A 1ZEAL 2QV2A 3FT2A 2VMFA 1FFRA 3FTGB 1NH6A 4K9EC 4R7NB 5DVLA 1E6JH 5FF6B 4LKCA 2QQKH 3GSUB 3QQ4B 2FX9H 5E2UH 1KCUH 3QEHA 1DEDA 4DW2H 4O2FB 3EO0A 3UYRH 3IKCB 4M03A 5IW3A 4KTYA 1GGIL 5A43C 4JZOA 1G9MH 1OAUH 4R2GD 3ABZA 4OIIH 3BISA 4UBDD 5E99H 5E6YA 3TC9A 1QSEE 2Y7QA 3L95B 3W82A 3DO7B 1EPFA 5F96L 5D96B 2NLJA 1T04A 2E7CA 3V5DB 1P7QD 3NPSB 5E6IB 3MYZA 3CPLA 4NZJA 1EO8L 4KUCD 3IVKB 2YA2A 3STZA 5DGQA 3DV4A 3GSVB 3S36X 3BWAA 1G7IA 4K8RC 1A7NH 4Q6YA 4YPGB 3T3PF 1WT5A 1MJ8L 4QXUH 5DHVH 4BSJA 1MY5A 1JNLH 4ZNCD 5J11B 1DDHA 1I9JL 5IVXE 3EHBC 5D96C 3RVUC 2B7DT 3GIVB 4J3VA 5BZWA 1KCUL 4DW2L 1LWRA 4X99A 3SDAC 2MMXA 2DQFA 4NWTL 4JO2H 1TVHB 3EJYC 1QOKA 3HTLX 4EN3C 5I1CH 1T5WA 4HXAL 5F21B 3ILPB 3LKQB 3L3KB 3ES6B 2FEDC 2NX5A 1ZTXH 3RIAK 4M93B 4ODVL 4X4YB 3G6JE 4XAKE 4XP9H 1LVEA 4MAYD 1MREH 3TBWA 4GO6B 3DTXB 2CKNA 1F3RB 2DQDH 4YHOL 4L5FH 5I30L 2H2PD 3LDBB 3QFJA 1A02N 1VFOA 2ZWLT 5HYJB 4MDIB 4IS6A 1OTSC 4GAGH 5DD1L 3UX9B 1WC7B 4GFTB 5D7JC 3VDAA 5DLMH 1FDLL 4Q9RH 4P2OA 1JUFA 4G7VH 4O9HL 4HUUA 5DA0B 1RK0B 4UQ2A 1F02I 4MA8H 4IMKA 4OBSA 4OCYL 1C5DA 1S7UB 1LDPL 1WCBB 3QDJA 1KNOB 3RBGA 4WWKB 5JDSA 3V0WH 5GZNC 4LCUA 3DVGA 3BEVB 5CJQL 3H42H 3LD8C 4HGKC 2FGWH 3PV6A 5GRVL 1Y0LA 4LEXL 5FM5M 1XF4A 4NT6B 3ULUC 3TBVB 4V1DD 5KS9B 1BAFH 1RHHB 2Q7YB 1B0RA 4H20H 1IGTA 1CGTA 1Z3GL 4P23A 2GJZB 3C5JA 5KJRH 1J88A 4ZNEA 1CE1H 2J2ZA 1FNSL 2WWKO 4XX1E 3VXSA 2H2PC 3VRLF 4L4VE 3M45A 4N0YH 4FP8L 1YDPB 5DRNB 1BBJA 3ZE0E 1I7UA 2VOTA 1UWEH 3GSQB 4XP1H 1F6LL 4NQED 4MXVF 3U46A 5E8PA 4R2GC 1KLFA 4GRLB 1CDUA 1GC1C 5A16A 3H9ZA 1YN6B 4KWUA 1OQXA 1T1ZA 1MFAH 3K8LA 3MODH 3QIBB 2CRIA 3I02A 1T2JA 1H15B 1I4FB 1CXIA 4OFYD 4KROC 5JMOC 4AL8L 3O9WB 1KCVL 3B9DA 1TZHA 5I74C 3D6GA 2BC4B 2DLFH 4Y1AB 5HHOE 4WENB 4NQCA 4IRJC 5C0CD 2ZOLA 4YIQB 1QBML 5I18L 3ZKMD 3UYPA 3KPSA 2I24N 4NQSA 2IBZY 1LEIA 5I8CA 3B9AA 5C09A 5C0FA 3EOAA 5KAQG 2FX8H 5EN2A 5KVMC 1INEL 1SY6H 3V0VA 1S7XB 1RZ8B 4MXQD 3CCHB 1G7HB 4FQCH 5I74B 3AROA 4G80B 5ALCL 4WVRA 1YY9D 2HN7A 4F33A 5ID0B 2LAAA 1NCDH 3LKPB 1JHKH 1HDMB 1QSFA 4JKKA 2EDYA 4WY7H 1VCAA 5C0GB 3QNXA 4X9BA 35C8H 1YJDC 4JY6B 4HKBA 4TTDD 4FQXB 4ZOBA 2AEPL 3QWRA 3PGDA 1ZGLP 2X4UA 3ARFC 3RVWD 4F2MB 2GJ6A 3GK8L 5EORL 3QCUL 4HJ0C 1PAMA 3X3GL 4UNVA 2EH8L 4LCWE 5EDXA 3RVVD 2G9HA 4KMTH 3B8YA 4U1GB 5D6DC 1D5ZA 2WP3T 2J6EA 3BRGC 3K2MC 12E8H 2P8PA 1PX3A 1KIQA 2E9IA 3FCTB 4J23A 3P0VH 4PRNB 4X6EB 4Z7UF 2XXMB 4QF1A 1ZLUK 1X5YA 3ZMRA 2OK0H 4YQXH 3IGAB 1MIML 4BK4A 5BS0B 4GG8B 2OQJB 4MCYB 3REWA 2X09A 2ZCHL 5HI4D 5AWNH 1CBVL 3L5IA 1CVSC 2YRPA 3GMRB 5SWQA 5FYLL 3DMMD 3AMLA 4N8VB 2AJZA 4KKCD 4YHLL 5HVGB 1MJJA 5J4MA 4O58L 2EYSB 5F97E 3VWKC 1U36A 5HYSA 4JHWH 1NGWB 3O3EB 3DOSA 2BDNL 2BOBB 4RQQA 4DUWA 3AVEA 4MQTB 5TQ0H 2V2TA 4GBXA 5HVWA 1JWMA 5C0AA 1EEQA 1JPGB 1ND0B 2WUCH 4NKMA 4JPIA 4YBQC 4ZUUA 5IKCB 1XEDA 3ZHLA 1JHLL 3VCLB 1MH5B 4XAWH 4PUBH 2GITB 4ZFOL 5C6PB 3EUUA 1J87A 1XF5A 5CMAB 4ALAL 1JK8B 3PQYA 2VC2L 3PHOB 4EI6A 4WWID 1PDKA 3F8UB 3FB6A 1HOCA 2V6HA 4XWGL 2X4PB 3HI6L 2MJWA 1RJLA 3FRUB 5D9SB 5TDOA 3HUJF 1QYGL 1W0YT 5EOTB 3KHQA 3T0EE 1UM4H 2N7BA 5ACLA 1X6LA 4UAOB 2J3SA 2J12B 1DSFL 4ODSL 4ODHL 2F8XC 3MUGA 5E9DD 3ARZA 1PVHA 3ECBB 4L1DA 2AXJA 1VPOH 1KV3A 1CDBA 3MPCA 2XN9B 3E6HB 1EZVY 4RRPG 5ISZA 5LGHH 2RB8A 4QRTA 3ZE2E 2HFTA 3FQNB 3TZVC 4OCSH 3WJLC 3VXRD 3UJTL 4I3RH 4PJGB 3TO2A 1FSKC 1CG9B 1TCMA 3VH8G 4Y8DC 4F58L 4GOSA 5T5NG 3NGBC 1RZGA 3K80A 5I73B 4XNZC 3W9DA 1F90L 4G8IA 1N2RA 3EJZD 4I18B 3DUUB 4KJYB 2VLRA 1EFXD 1FVCA 5EO9A 1AIFB 1V05A 4X7TA 4PRDB 4MWFA 3C5ZA 3ZTJH 5D1QD 2IQ9L 5JHLH 5DQ9B 1DLFH 4JR9H 4TNVK 1G0XA 2FO1A 1WAAE 1BZ7B 4L4TB 3OWEA 4HLJA 4D9LL 1RZIA 3GJEA 3T4YB 4YHZL 1FNGA 3SE8L 3DVNB 4LOUC 4YIQA 4BFEA 4XC1H 3Q1SH 4PIRF 5FOBA 1LEIB 3T0BA 4NO3B 1YYLH 3RY4A 4NYLA 3IXAA 3FOMA 3INUH 4PJXB 1UENA 5IGXL 4UDTA 3RX7A 4P5TB 5IESL 4LLMB 3W2DH 5C2BH 1XCTB 2VQ1B 3PGCA 2ZJSL 3RDTA 3ROLA 3MOAL 4KGJA 3HB3D 3LMJL 4QRRE 5IBUB 3I6GA 3BZFB 4P4KB 1YEGH 1DVFB 4AENB 5D7JA 4L8SC 5E95B 5GISL 1LO4L 2ZPKH 3HPJA 1KTLA 2N4IA 3QCVL 3MYJB 4WW2F 4U1SB 4APQD 5D7LE 4I5BB 3P40A 5BRZD 2OSLB 3RWFB 4QHUA 4ZG1A 4PV8B 2Y23A 5D6CB 2ZUQB 5T1DH 1BF8A 4RZCB 3K2UL 2Y06H 4G8FB 5EOQH 3HZMB 2VH5L 3FZUD 1A6ZB 3T09A 4HKBB 2BXZA 1CVRA 4R3SA 5I1HL 1YNKL 3ZT6A 4QYOB 4YHIB 3RL2B 5MP6H 3LKOB 3MV9E 3LQAH 3CFJA 5JHDA 1BBDL 1C1EL 2X89D 4M5YL 2I25N 4PB9L 1KB9J 2NTSP 5GS0L 3PDGA 3OR6A 5IB2B 1AXTH 1NC4B 2KBGA 4HFWB 2DQTH 3GMNA 4BM7A 2J5LB 1D6EA 1Z9OA 4L3EE 1MJ7L 3DX9A 3RP1A 3VMOA 3VFNB 2VLRE 5CJ5A 3FT3A 5E2TH 1N6QH 4ZPVA 1J1OH 3D3VE 5TH2A 3HFML 2EE6A 1JUFB 2AGJL 3BZDA 3GKZA 5FO8A 1OGTB 3EAKA 4Y2DD 2R2CA 3OPZH 1UWGL 4ZFOB 5KVGH 5IBTL 3EJZC 5CSGA 4MYWB 2JLLA 5ID1A 5JPMA 4R4ND 2I07B 3ARUA 4NO0B 3VXUB 3DBXB 5E6ID 4I0PC 4Z5RA 4KHXL 4EXPX 5JA8B 1TTUA 3HE6B 3L5WA 4UT9H 4UQ3B 3HE7C 4PJ9C 1KEGL 1YQVH 3QUZA 4UIMA 1CGUA 1BOGB 1G6RA 5ITBL 3JV6B 5DZNA 1IARB 1EHAA 4HJJL 5JQHC 2CGRL 2K3TA 5A3IC 1INQB 2VO5A 5IROC 1ZHKA 2IGFH 4YBQD 4P9HC 1MOEA 1SVZA 1N4XH 3GNMH 2V2XB 3C8HA 5DK0B 2BNRD 2YN3A 5D8JH 5EA0L 5J8OA 5IFHL 3OHXA 4DFHA 1HZHH 2DQCH 5MERB 1Z2KA 1S7VA 1KN4L 1IGIL 2D31B 4YJZL 2XQYG 4U0QB 2MNUA 1TXKA 2EKSB 3RJQB 3DROA 3HC3L 4Y7MA 5HDOA 3RWDB 5T5NF 4HG4K 5DS8B 5D1ZC 1TIUA 4JCLA 4N0UE 3I75A 5IVZA 2J8UB 5F7DB 2ED8A 3T2QA 3DVFA 5C0EA 3H0TA 1RY7B 3VFRA 5JIPA 3WO4B 3NVQA 5F6IB 3DSFH 2AJYH 5DQJB 4EIZC 2NXZC 3DO7A 1HH9B 4TNVF 4NN5C 4YX2H 2RCSL 2AAVA 3P4LA 3WCYA 4MJ5B 4UV7L 1LD9A 1WBZA 5C0CE 2W59A 1HILA 1NSNH 4FTVE 1DL7L 2RFXA 4DOHB 2UY7A 4QGTA 1CD0A 2EO9A 2F53A 1IKFL 2VXTL 5IEHA 1ZSDB 1KBGH 2E9JA 5D6DA 1WGOA 3MV11 3WUZA 3RWGB 4RDQF 1W0WA 2UZYB 4G8EA 3D9AH 3PDDA 2OBGA 3ARFD 3NCEB 4LPYA 2MHAB 1RSFA 2YK1L 4PJGE 3MGOB 2J8HA 4M9OA 1KELH 4XNXH 1NPUA 5KSBF 3SKJL 1YEIH 5I71C 3W39A 5IR1A 3TN0B 5HVFB 1UGNA 1NCNA 3KJ6H 3C60B 3X11B 4FXKA 2ARWA 3GSXB 4OLZH 1AIFA 1FVEB 3EOTL 4GRLC 5IMMB 3CZJA 5AZ2H 4CN6A 1M05A 5FECB 4OQTH 4P23B 4Y5XB 3QH3B 3P73B 1P6AB 4PP2B 4OZHE 2A9NL 4L4TE 4HWBA 4NHUB 4MD0A 5FA4A 1U92B 2J88L 2WNGA 2BHZA 1KIPA 4LCWD 3HR5A 4G6ML 3UC0L 2VLJB 1AGCB 1I1CA 1OVZA 1IGCH 1GGYA 4LL9A 4NRXA 3CIQA 3QJFA 4X4XA 1EERB 5JHDD 3BDYH 4L8DA 4NCC2 3IS1X 4ZFGH 4PJ8A 4WUUB 5I19H 1EMTH 2P49B 4XI5C 4WUKL 2R4RL 2YEZA 5CWSB 1CFNB 3EOYG 3MRMA 4LSUH 4Q97A 4DTGL 4GXVL 5C9JA 2B20A 3SKNB 4K71B 3G6AA 4OD3L 3WS6A 3K4AA 3UZEA 2EZ0D 1UWXK 5D7JD 4GUPB 1N3NA 5GS1C 5FHBH 2EH7H 3NABH 1CT8A 2XYCA 3IFPA 1MJJB 1MQKL 2DKUA 3HNVL 1U0QA 3GSNA 1PX4A 4LSPL 4N0CC 4V2CB 5IFAH 2G75B 1JNNL 3FHAA 5FCSH 1W0VB 3RWIA 3S35H 3GB7A 1KPRA 2BCKB 3UJIH 4I2XE 4J6RH 5CZVL 2CUIA 2P7TA 1IEAA 4JRXB 3CLEH 2BVEA 4JPIB 3RU8H 4EKXA 3VD7A 5CBAA 5GS0C 1HHKA 4KI5D 2Q8BH 2CRZA 4HFUH 4KHTH 1NANH 4PRHA 4YXKL 3GRWL 3OKYA 1FGVL 1U8KB 3LDBC 4RFEA 4HQQL 3VH8B 2R8SH 3EYQD 3KPSE 4OCWH 4YFLF 1TJGL 1RULH 4NFBA 3TLRA 1XCQB 4LNVA 3JXAA 1Q72L 1IQWL 3QA3B 7FABH 1RJYB 3FN3A 1S9WA 3L95A 4LAQL 4ODTL 4N8PA 5H8DA 4KU1A 1U8IB 1MY7A 1HKLH 3MRQA 5EUOE 3DV6B 2GAZA 3MGTB 3K8KA 3MOQA 3UTSD 3VRJB 3NAAH 3U0WH 3BP4B 4NQCE 4C56D 4NC1E 4PV9B 1CYGA 3T2NL 5HHOA 2P43B 3EOBA 1CXFA 1LP9F 2VDLL 1Z0NA 4NNXB 1MI5D 5JR1H 4FXGA 1QFOA 4MNHA 3TV3L 2A6DB 2BY3A 4PJBF 3UTSB 5C0BD 1ORQA 4P4RB 3WFEL 3GIVA 3BD3A 2M1KA 4XP5H 3GGWB 2JJUA 4F3FB 3THMH 1X5AA 3SDDC 4PRBB 2B1HL 4LGPB 1Q0YL 5HI3D 3S4SG 1FZMA 3SCMA 4HWBH 2VITB 4RFNB 2VLKE 1QR1B 3SE9L 3P77B 2HTKC 1KYOJ 4ZTPH 1ES0A 1WBXB 3QXVA 2EKSA 3NIGF 1YC8A 5E8DL 1R3HA 5FGBA 5B4MD 3MRDA 1A7PH 4CJ0A 2DLTA 4O5LL 3G5ZA 4M6OH 2CK0H 5MEPA 3MACH 3L3DA 4NQTA 4IRSD 2QBWA 5ESAB 3IU3B 5LGJB 2E7LA 2UWEA 4DN4H 3C6SB 1IT9L 3TBTA 2A83A 3QEGL 1J05B 4YDKH 3BESR 5IB4A 4Q9BA 4UTBL 3H9SA 3ZDXE 2XOTA 1BOYA 5HPMB 1INDL 4X6EA 3WFCH 4HKZB 1V7ML 1NFDF 2BJML 4HWBL 5C0AD 4KKAD 3T4AB 4WFEE 3TYFB 4UNTA 3EJYD 4KI5F 3WEXB 5E2WL 2L4OA 2F8OA 5TJWK 4KTDH 5C6TL 5JR1L 4M43H 1YMMB 4CMMB 4RMVA 4Q9QL 3CFKB 3MUZ1 2ITCB 3LN9A 1D6VH 2CLRB 2I27N 2A77L 2DM4A 4PJIF 5EUKB 2B0SL 2QHLA 4PJ7E 3QI9A 4HZLB 1EAPB 5I1JL 4LBEB 3MRNA 4G8FA 4ODTH 5KS9E 2Q7YA 4TYUA 4Y1AD 3QDME 3DI3B 4X98A 4FXKB 2GEEA 1QRND 3FFDA 1O7SA 1G7QB 1IC5H 2NY7L 4YDLC 5C7XH 1ZS8A 1NGQH 1FAIL 2UZXB 2FDBP 3ME0A 2ZNWA 5DMIH 3ZT7A 3RNKB 4R8WH 1I9RH 3OXRB 3CK0L 3P9LA 4KRPC 3S88L 3DHJA 3HC4L 4HBQA 5BJTB 1CLOL 2YZ1A 1U95A 2EC9T 4HQQH 1IAIH 4R9HA 1FGVH 4XBGB 4ZUWB 1QNZL 1VGKA 1ZVSB 4CGTA 3NZHH 3PNWB 2BNQE 4RISL 3CUPA 2VLJE 2Z92B 1XGUA 5CBEB 5L88H 1WZLA 4P0DA 1ZA6A 1FZKA 4P5TC 1P1ZA 5DMKB 4BZ2H 3QWOA 4FFZL 1G6RH 4XCFH 1SEQH 5T3ZE 4J6RL 5CZVH 5BMFL 1RZFH 4OLUL 1QFPA 3TNNA 1QTYT 3WIHL 2Y7QB 1AP2B 3RPKA 3S35L 3RWCB 5T33L 1S8DB 5D2NA 3VXUA 5CLTA 1MQKH 5IFAL 3BUTA 5HI5C 4HIJB 5FV1L 4XCEB 3ZKMC 4JFEE 4NPYA 4ZAKA 4NO3A 3SKOB 2V5YA 2COQA 3BH8B 1U3JA 3QPXL 3LN5A 4R6UA 2VAJA 1UKTA 3UPAA 3IXTB 5IVXB 3ZYJA 1XIWB 5EO1B 4KFZC 2FJHB 4P46D 3SGDI 2P24B 4IRZL 3W5NA 1TJIL 1CXHA 2XG4A 1KCRH 5MERA 3BZ4B 1BVLB 4RGNB 4QHLA 4U4BA 4FQXA 1DUYB 3BDYL 5FHAH 4LIQE 4N8VA 2PNDA 3MOBL 2AK1L 2YOCA 5JHDE 3W0WB 3QRFM 4XVTL 4OZ4B 3RNQA 3WKML 1J0IA 4ZUTA 3OGCB 4BH7B 4HBCH 4JFDA 4NC2B 4QRSB 1OM3L 4Z8FL 4HUXB 4GAJH 2DB8A 3HCVA 2DDQH 3DGCR 1EIBA 5DO2C 3V0AC 1E28B 3BIKA 4GS7C 4JM2A 3L6FB 4QRRA 4HEPG 4Z7UA 3F62A 1T21B 3DX9B 1ZHBA 4D0DA 3QNZA 5D71L 1KELL 4XNXL 1LEKB 3GI8L 1FAKT 1VB9A 4MCZB 4HS8L 2GIYA 5KN5B 2WWMC 4X7EC 3I6LE 4ONGL 4G7YL 5L2KA 4NQCB 5E0QA 3RHWK 4XPHH 1IAOB 3HZVB 5BS0E 4TSBL 1AE6H 1V3JA 1LMKA 1FO0B 4OZIB 4XNMA 3LKRB 5D7IE 3AGVA 1S7QB 3ARXA 1EEUA 2VXTH 1R24B 1MHEA 2AJUH 3KWWB 5D6CA 3M17A 4ZSOA 4HH9A 4R26L 1XGTB 2EIZB 1SBSL 3RUGB 3PQYE 4Z7VF 1J8HE 1HCFX 2J6EL 4XPBH 4MSWA 3FQNA 1YMHB 4QY8A 4YBLB 5KSUB 3ZT5A 4L8SB 1NGWA 2QHRH 2WK2A 3O3EA 6FABL 3HRZB 3G5ZB 3OKOA 4W81A 2AKRA 5BZWB 3B5TA 3GSQA 3G6DL 3VGDA 3LH2L 1TCRA 5L9DL 1NAMA 4OM0H 3WE6A 4NN7B 2YMXH 1XGYL 1ZANL 1JZ4A 4LCYB 4UV4H 3FB7B 3N1PC 1Y6MR 1YPZA 3FQWB 2IH1B 1JZ8A 1T0NA 4U2YA 1KN4H 4LU5H 2Y6SC 2WBJA 3LAFA 2IG2L 4YGVA 2B2XH 3C5SA 2PXYD 3JV4A 4HEME 4M1CD 2VLKD 1D5IH 4AM0A 1U8QA 4AIZA 4QEGA 4X80L 1JYVA 2AERT 3OB0K 1UA6H 4JY5H 4NO2A 2J8UF 1TTFA 2YBRA 3B2VL 1BZQK 2ZNXA 4LLAA 3OX8A 4W4OA 3MUGB 5GGTH 1RVFL 1RUQH 4MJ5A 3H9SE 2B1AH 5HYJA 2XA3A 4X4MA 5L7XL 5JOPE 1KEGH 3X3FH 2X44D 4CU7A 4UT9L 2JCCF 1ZLVK 3SOBL 3DVIA 2EDEA 4UUJA 1G1YA 5LBSH 3QIWC 1U8NA 4X6CE 4G9FA 3BGFC 2CKBA 1T22A 4Z78A 1UJ3B 1HIMH 5KVGL 2OTUB 1NUGA 4GRMA 1QSFB 4Z18A 5E6IC 1ZS8B 4C83A 1Q0XH 3RIAF 1P84K 2VB5A 1P9MA 3KPNA 2AJXH 2XZZA 5E2TL 1DBMH 3BWUC 4OKVB 3QWQB 4FQPA 1AQKL 2D4DA 3U4BH 3W39B 1MAJA 4PD4K 2NNAA 4WI4A 1A6ZA 3ILPA 2L7JA 1EAJA 4E42A 5EU4B 4U6VL 2V2WB 4RMRA 2PETA 2BY1A 1OP5K 1UB6B 4M6ML 3QDHA 5DTFA 4MNQE 3PWVA 1FFOB 3N85L 5D1QB 5EIQA 4PB9H 1D5BB 1LO0H 3HPLB 1HSAA 4CRPA 4M61B 4HDIB 1N8ZB 1PEWA 2RBLA 3E6FB 1EFXB 5KVDL 5I1HH 1LD9B 1WBZB 1JGDB 3T3PE 4W6XB 3SGJA 3BAEH 2HH0L 3ZDYE 4FFVC 4HJGA 1YN7A 5GJTL 2VLJA 3UEZA 2BERA 5J3HC 2ZOKA 1Q9WB 1HHIB 4PYGA 5IJVB 3LKNA 1NGPL 3VFGH 5D1QC 5GISH 5IHZB 3NA4A 3L7FA 3MOAH 4WUUA 5SWZD 5A1AA 4OB5L 3DIFB 2XN9D 3LEYH 3RZWA 3PL6C 1GGBL 4Y5VB 5K9QI 3CXHK 3IJSA 5E00A 3S37L 4K3JH 3WKNA 3MYJA 4X0KB 4RWYH 1C5CH 1WSST 5E4EC 4IM8A 3TT3L 3QQ9D 1FNEA 5HYFA 4JG1H 2FBJH 2BSED 4JFXB 3Q1SL 1E4WL 4HC1H 3EYOA 5JHDB 4M5ZL 1OAZH 1AI1L 3P0YH 1DLHA 4TNWK 3BKMH 3TO2B 1QUNA 2DWEA 5EIIB 3PDOB 4JRWA 5C0AB 1S7TA 2V5RA 5D7LD 4Z6AT 1QFWI 2IC2A 5FKAA 3WO4C 2HG5B 2I9TA 3BQUB 2B5IC 3EGSA 3TJEL 5SWSA 1DLFL 1DN0A 1EJOH 1CD8A 2IQ9H 3V8OA 3KNBA 2OP4H 3VMPA 1D5XA 4JANB 2P4AB 4MNGA 3UMTA 2IBBA 2NTFB 2R1WA 4BUGA 2JIXA 3SDYL 2X9YA 2DM3A 5EU6D 4ZUVB 5JPMB 3KPLA 2NXYD 3LS5H 4F37K 3C9NA 3DX6A 1AD0A 5E6ZA 3GSWB 3NTCH 3V4PL 4DEPB 5EZJA 1A14H 5B38G 4UQ3A 1XCQA 3QXDA 4ZS6D 4KXZH 3PWPE 1V8HA 5DFVD 1P2CA 2DMKA 2VQTA 2E3VA 3DUSA 4WHTA 1NBYB 1F11A 4LHUB 1MRDL 3K46A 2PW1B 3BKJL 3X14B 5LWYH 1CTOA 3TPKA 4IRJB 2BCKA 5J12C 5EZIH 5KVEH 2D2OA 5GGVH 2XI9A 5D1ZA 3F6IA 1CR9L 4TVPE 5F9JA 3KGRA 2PYEB 4E41D 1IEBB 4H0HB 3QNXB 2ATPA 5AG9A 3HRZA 3FQUA 4X99B 5IHLB 1CICD 2JCCE 2HJKA 1N2RB 4DGYH 3PXHA 3G04A 1FFPB 5CKAA 2D0FA 3QUYD 5EBMB 3WNKA 5F7MC 2YUVA 1DBJH 3S6CA 4DUVA 2EE9A 4EBQL 2QQLL 3CFDA 3S96A 2XRAH 1UQSB 3H9HA 1JI2A 2HTLC 4LSVH 3G5YB 4X6CA 5CGYC 5B39A 3F7PC 3O3BA 3MLRH 3JV4B 4P2RA 2BHYA 4IS6B 1T7XA 2LVEA 3GM0A 1MFDH 3QIUD 3ARBB 4POZD 2Y5TA 1MVUA 2EEDA 4XNUH 4PJXE 1OGAD 3ETBF 5FM4A 3LZFH 2DD8L 3AB0B 3O2DH 5DJZB 2EDJA 3H3PH 4KZEH 4YUEL 1UCTA 5IW1A 3N1MC 4P5TA 5DJCB 4QT5B 3TIEA 3NCJH 1FGNL 3MV7E 2Z0BA 1GOGA 4LFHG 1B2WH 1H3PL 1HINL 4D8PB 3WSQH 5GQBA 1N5AB 4ELKA 2A38A 4CUCA 4J4PC 2ZG2A 1CD1A 3CVHA 1UZ6F 4PV8A 2PTUA 3MV8E 5TFSL 5E1HB 4DCQA 1DANT 1EK3A 1OCWH 1JRHI 2HFFA 3TN0A 12E8L 1GVIA 5CINL 5GRZA 3GUTA 2NX5E 4MXQC 3LKPA 5ESAA 5EC2A 4X98B 3BPLB 4WV1A 4GKNA 3QCUH 4WO4A 2VLRB 4KDTC 4JFQA 4MA7L 4XC3L 1QO3B 4K7FB 3U9UB 1O5DT 4PJBE 3VXTB 3GJFB 3FB8A 1MCNA 4IOSD 5FM5O 4ZDHA 2DYPD 5DJYA 2HLAA 3WJJC 3CH1A 3NPZB 3P4MB 1T21A 2DQUH 2Z93B 3T4AA 4PP1C 4DWHA 35C8L 1I7ZA 2A6JA 2DI9A 2OJZH 4KQ3H 4ODUA 3BPNC 2Y9RT 3ZSSA 3VFRB 2Q3AA 1YEKL 4FTVA 3UTTD 4YWGH 2PO6D 4Y4FC 3RTQC 1F2XK 1P7HL 5H37H 2VZVA 4NQSB 1FIGH 1NUFA 2VL5B 4ERSH 3W9EA 5ALCH 3OAUH 3JTTB 1K8IB 3CH8A 3AREA 3FB5A 4GRWH 1IC1A 1A4KA 1A6WH 1BFVH 1AY1L 2V7NA 4LIQH 5DJ0A 4DUXA 3EDJA 3QULB 1G7QA 1X5JA 4JRXA 1JGUL 5IEKA 3IJHB 4BUHA 3G9AB 1NC2A 5IHBA 3OHXB 3IDIB 5SX5K 5EWIH 2CKBL 4AENA 2ATKB 3BD4A 4QNPF 4WGVB 4IJ3B 4YHKL 3IS0X 3OJMB 4KQ3L 1IAKA 4AT6B 3OKEB 1JV5A 3CU1A 3V4VL 4NSKA 1MHPL 3WLBB 4MAYB 3TIDA 5IMKB 1NLBH 1LK2B 4OF0A 4X4ME 1BFSA 3EZJB 2ICWI 5DWUH 1FSKB 4JFFE 4KKLD 4R4BA 2VZUA 4Z0BH 4HWNA 4XP1L 1PW3A 2HVJB 3CFBA 2VABB 3PWUA 5IIEB 1CGSH 4L8BB 3ZE2F 4Z7NE 3QIWD 2AK4D 3QA3A 5FV2A 4ODXA 4CDGC 1YECH 4OV6F 1C12B 5DJ2B 5J56B 1QVOB 5KJRL 4PY8I 2BZDA 2OMBA 3EO0B 4F7EA 2ZZUT 1KYOK 2HRLA 2JELH 1OCWL 3O11A 1YPZF 1BAFL 1X5LA 4DZBB 3SDCA 4TSCL 3OQ3B 3TVMB 1EJ6A 1MCDA 2WBJC 5D9SA 3IDNA 3SKUD 5JW4R 3BKCL 5A2LH 2CH8A 1OGTA 2MSPA 1H3PH 1HINH 4HCRH 3MV9A 5HDQH 5MENB 5A2FA 4ZOAA 1MFBL 4AG4L 2W9EH 2OTUA 4R96A 3VG0H 1WAAF 4H26B 4PLKD 1K6QH 3HMXH 1IEBA 4XTRD 5D1XB 4JPKL 4OZHF 4H88L 3H3PL 4KZEL 3VI4F 4MX7A 5DD1H 4OUOA 4DGIH 5CSBA 4HCRA 3QHZL 2I5YL 4X6DA 2ICWA 2VLKB 5I8KH 4XWOC 3PWPD 5D4QA 1GC1L 5CHNA 1WFTA 3D2UA 4XP9L 3P73A 1AGDB 4M7JL 1P7KB 2F19L 1NLDL 4JN2B 1I75A 1ZTXL 2XIDA 4U1HB 4EBQH 1KIUA 1MRFH 4B0MM 5D2LB 3TA3C 5E8OB 5GRWA 5ANME 1CI5A 2LTQB 3T2PA 3KYKH 2WLZA 4P49A 5IJVA 3CLFL 3UJJH 3BMVA 4QRPB 5L2KB 4MA3B 1UYWH 1YMMA 1RV6X 5AYUH 4KTEH 5EO0A 4QXUL 5EFIA 1M71B 1I3GH 4NQDA 4DKFH 5EU7C 4QRQA 3X12A 4P4KC 4PRPD 2QR0B 3QISA 1HH9A 4XZUA 1B6UA 5B8CA 1MCJA 2GK2A 3BKJH 4X6DE 2CO7B 3GMLA 5D5MA 5FK9B 5J6HB 2C26A 4Y19B 3QJHB 1K2DA 1EGJH 1IZKA 1YZZA 4FHBD 5DD0H 4OZGF 1CD1B 4U49A 5F96H 2Y4SA 3S5LA 2VN7A 2AV1B 2GUOB 2XICA 4JRXE 3BI9X 1HI6A 3OAYH 1CGWA 1A14L 1MWAL 3MRKA 3NTCL 1FP5A 2NZIA 3ISWA 4P9HH 2EEBA 3HHRB 3TVMD 3CC5A 1K3ZA 5BJTA 2EZ0C 3OBAA 4NT6A 3HE7B 3PL6A 2BY0A 1B6DA 2EDKA 1WF5A 2F8VA 2ORBH 3RNKA 5IJKC 4M6NL 3B9KD 3I6KA 2ZG1A 4LF3A 1J1PL 3HG1B 4QRUA 3LN4B 1CGXA 4XP4H 4S1SH 3O6FB 3MLUL 3HAEH 5HYSB 4MZ2A 2DJ4A 4KRPD 4OM1L 1I8IB 2FHBA 5IOPB 4O51B 3DVNA 3V6OA 1YNTA 1ZK9A 4WU5B 2R0KL 2R2EA 5DJ6B 3FONB 4R97C 5F1OB 4PP2A 3IFNL 4TOYH 1F4HA 3BKML 1ZT1A 3OX8B 2XY2A 1OAZL 3H7LA 4W4NA 5HPMA 3IXAB 3CSGA 2IPKA 3QFDA 3T65A 4YBHA 4PJEF 3PWLB 2IALA 1TZHB 5HYQA 1NGZA 3QJFB 4PJDE 1F8TL 1Q9WA 1S3KH 1CXKA 1I9IL 4FQJL 2B8OT 1NEZB 2VR4A 4OB5H 4WDIA 5DXWA 2ZCKH 4F9LA 5ACZA 4WU7A 1DUZB 1F6FB 1KG0B 3QUMB 3IDIA 4RZCA 4K9EH 1A7QH 3MA7B 5HPOA 1OARL 3GSNB 1RMFL 3Q5TA 2CRYA 4U1NA 1JZ2A 5GJTH 5JIHA 4GUPA 2LU7A 3LHPH 3MTRA 1BEYH 2HH0H 1UJ3C 1A3LL 1G9NL 2X40A 4LCCB 1GHFL 1OB1A 2D7TH 4I48B 4JKLA 4PJ5D 1LO0L 1A2YA 4Y1AE 3WFHA 3BIKB 4XCCH 1NMAL 1EHNA 3B9KA 3TN0C 3OF6D 2F5BL 2FGZA 4NN5B 4Z95L 2QSQA 3KYNA 4LHJB 1NFDA 4KPHL 3CUPB 4JLRA 4NN6B 5DSCA 5IBLC 3PWNB 5ADPH 4M7LL 5FYJH 3C60D 3AS0A 4N90D 4Q0XH 4OCMC 1LEKA 1H0DB 4JGMA 3T2OA 3WEXA 3L3IB 1D5ZB 5JW3H 1LO3H 4U05A 2VXUL 3QUXD 3WD5H 4HIHB 1EVUA 4PJ7B 3FCTA 4F57L 4H1LB 4MD5A 3KG5A 5LBSL 1HHJB 4JZJB 3MCKA 1RFDH 1C16B 2Z8VC 2GTZA 3AM8A 4K2UH 2VLLB 5E9DB 4MSWB 4WEUD 1RUQL 4N8CH 4NFCA 4EN3B 3U4EA 3B2VH 1U91A 2PW1A 4U33A 3ZHKA 1A5FL 1DQDL 1KXTB 1T22B 2P7TB 3B43A 4KKBC 3RUGE 2FJHA 4WW2B 1OAXL 4ZTOL 3ILQD 1IL1B 5FKAB 5DR5H 3TM6A 5CBAB 1EEYA 1BVLA 4S11A 1LE5A 1F58H 2B2XL 5GHWL 2ATPB 5CIPB 1C08A 1SYVA 3B2UC 4NIKB 3PGFL 2W60A 4M7KL 3GSRB 2W9LA 1JF5A 3V5HA 3HI1B 3C6LD 4GLRH 2YMXL 4HPOH 3QHFL 4I9WD 4HV8A 1ZA6B 3LH2H 2BSTA 5GGUB 5ABDE 4Y4KC 3MO1B 1R3KB 3PP4H 1CN4A 3TCLB 1KTDB 3C9NB 3DX6B 2B5IB 3CFDB 1NANI 1RZKH 2IANB 1GOFA 5F3BB 2BVPA 1IC4L 4P59L 1U8QB 1UADC 4AIZB 4OFKA 1AP2A 3VFNA 4P3WA 4U1IB 2X4PA 1KB5A 1U8IA 3L5XL 3PXJA 3SCMC 5IK3B 3IFLH 1T1YB 4M4RA 3CXHJ 1M1SA 2ICES 1WK0A 2A1WL 4H5SA 1S78D 4MCZA 1NFDE 4U7KA 5HDBE 4L8DB 4K8RH 3QUML 3M8OH 1DQMH 4XH2B 3BDXA 5FYKL 1F4WH 3KS0J 4XPHL 1PQZB 1R0AL 3W11D 4ONGH 4XNQA 2IQAA 4GT7A 4PRBA 3ELAT 1FZMB 3SCMB 4JPVL 4WCYL 5C0RH 2Y36L 3X11A 1ZAGA 1A6UL 2C5DC 3VFSB 4WW1B 5GSRB 3QIWA 4E42B 4YXLH 5IG7B 2HRPL 5FECA 3U0TA 3MJGX 3FFDB 2J8OA 3WJLA 1FN4B 3I2CL 4OKVA 1RK1B 3REVB 4FFYH 4EOWL 3EYOB 4YEEA 1NL0H 3GHBL 5C09E 3QO1B 3SDAA 1AR2A 5GGQH 2NCMA 2VXQL 3QO0A 4JQIH 3K74B 4HBCL 4GRLD 3V4UH 4NWUL 4NZTH 4MAUH 4NRXB 1QVOA 4OLVH 4OGYH 1S7RB 2NW3A 3DRTB 4AJ0A 4N0RA 1RUPH 4PJDA 4PJHE 5C92A 3NIDF 1FORL 1RZ7H 2R23A 1P1ZB 5DMKA 4Z77A 4JRXD 1NGYB 4NGHL 1S7SA 5EBWA 3T4YA 4EIGB 5IMOA 3C5SB 1HHIA 4Q6IC 2ICWJ 1VFMA 1I8KA 3VFTA 1MCLA 3ZTNH 4OJFH 1I1AB 4YHPA 2NW2A 4GMTL 4V1DB 3BW9B 2ZUYA 4YDJB 1G84A 3FRPA 5JW4N 3TNNB 1L9NA 3E8UL 1NKRA 3QDGA 3QSKB 5JPNA 1RU9H 1GAFL 1A6PA 1F42A 3UTZB 3ULVE 5ICYB 3KPQB 4B5EA 5ICXA 4JN1L 3OXSA 4FOMA 3KXFA 5KSBA 4DZ8B 1MCIA 3GRWA 2K9UA 3NH7L 1XIWA 4P5KA 3RX8A 2EC8A 1BJ8A 3FOLB 3V7MA 2FSEB 1H3UA 4Y4HB 1NC2B 1VACA 1A7RL 1TJHL 1DFBH 2PYFB 4QXGH 4NQDE 4NKOA 3MRLA 2D03L 2XV6B 5LCVH 2YN5A 2AK4B 1NUDA 5I8EB 4PS4L 3PWJB 2OMNA 2PO6C 3NZHL 2J8UE 1IGYA 4KJPD 3RUGF 4D0BB 3QG7L 4Z76B 2EE2A 2HKFH 4FQHB 1KLUA 5C07A 1T3FB 4YDLB 4K7PH 5K9KA 1QSEA 2DJSA 2YD5A 2KQMA 5F89A 4QOKD 2WBJB 1F45A 3S4SA 5DRWA 4R8WL 3IDXL 3RHWF 4KVCH 2APVA 3CFBB 3B4NA 1H0DA 1BJ1J 3NFPB 1RJYA 4XCNA 1NAMH 4RGND 2NY7H 3L6FA 4QRRB 1AGCA 1T83C 1UM5L 5DQDL 4Q2ZA 3SJVA 2EXYD 1A1OA 2DN7A 3V6OC 2L7UA 3HE7D 4Q58C 3ZO0A 4MQ7A 4PJFB 4UOW0 3A0OA 1B88A 4QHKJ 1GXEA 3CZFB 3WFDL 2B0SH 3I9GH 1JVKA 2GUOA 4LQ1A 1N59B 4NNYA 2ATKA 3C2AL 3U7WH 2DWDA 1FJ1A 1DBAH 4HXBH 4M48L 4NZUH 5B3JE 5EB9A 1DBKL 3QI9B 4G6KL 1AFVH 2CD0A 3QEUA 2BJMH 2BVQA 5DD3L 2VDMH 2OLDA 4F9LC 4HUWA 1SJHB 2F5AH 1W0VA 5INCB 1NMCC 4UTBH 1A7BA 4OCRL 1IGMH 3WHE1 5DD5L 3RWJB 1ZGLM 3NIFE 2YKLL 5DJAA 3O3BB 1NCAL 2LTQC 5DUPH 3OKMA 1IT9H 1GYAA 4POZC 4JHZA 1UQSA 3BP5B 1C12A 5DJ2A 2JK5A 4Y4FB 3MACL 2Y5TB 4X83A 5DFVC 3UPRA 4HKZA 1LGVA 4XPGL 5E8DH 3UTTE 5IHUL 3MLWH 3VXUE 1ZHBB 4D0DB 4YGVB 3B6SA 4X8XA 5FO7B 1I7ZB 4HULB 1CFQB 4ISVA 3SO3B 5F7EL 3H9YA 4RMUA 5DF0A 5HHXH 4XMPL 3O45A 1YY8B 3TBSB 3MFFA 2W9DH 5IP4A 4CW1A 1N5YH 2BNQA 1HQRA 1UC6A 3VJ6B 3NGBB 3QCTL 1F4XL 4OI9A 2X9WA 5J11C 4JVWA 4XXCC 4I3SH 2VAAB 5ITFB 3MUJA 3L3GA 2JKXA 3VXOB 4JRYD 1WWWX 3O3DA 3JUZA 4WW1A 1UH4A 1H9VA 1KENL 5T1KB 1MHCA 4DCQB 3VFVB 5C0JA 1BD2D 5KBNC 3AS3A 4IBLT 1RUML 2PYEA 3P9LB 3QDMA 2XQBL 3TP4A 1RIHH 3GGWA 4JFEA 4QCIA 4PRID 1H3TA 4RAUA 4OCXH 4OF8A 3MRCB 1UB5A 4GW1A 4OUUA 2GTWB 1EHXA 1IM9B 3EHBD 1SEBA 3KPRB 5J9PB 3VDBA 4QGYA 3FKUS 1BQLH 4ZUSB 4U6YA 1UXSB 4K8RD 2YD6A 3CH1B 4HFUL 3WDHA 4MQXD 3F65A 4PLJC 4K7PY 3IDJB 1T1WA 2XACC 3RU8L 4I8DA 4HX1A 2AJ3A 4XRCA 4PJBA 4OFVA 3MMEA 5IF0A 2YD3A 3W0WD 1WZKA 4YNYB 1S9XB 1UVQA 4FZEL 4IEFB 4NM4L 1JNNH 3P30L 1BZ9B 1RIVL 2XTJB 4F7EB 1GPOH 2CIIB 4KUZH 4PGBA 3OKLA 1OQOA 3BPCB 4QTHB 1HXYB 4M3KB 3SO5A 4JFZH 4V1DE 4KDVA 1MAMH 3O4LA 3NABL 4R90H 4DFIA 5FB8A 1BM3L 1PLGL 4YXHH 2C3XA 2CLVA 2WIMA 3TESA 1M6OA 3LV3B 4K3GA 4PJ9A 1N6VA 5ICXB 5TPWL 3DIFA 3VFMB 1WV7T 4LSUL 5DYOB 3MLXH 5CEYA 5M94B 1IQDB 5BO1H 1XF2B 1BVZA 4H26A 4K94H 3W0WA 4TVSa 4JQXC 1KJ2A 2R2BA 2FR4B 2Z4QA 4MX7B 3TGXA 1IGCL 3A6CH 2JB5H 2X70B 4WHYG 3MJ9A 4JDTH 3ZKND 3X17A 4PGZA 3VRLE 5J1SC 4QHNA 1ULVA 5DHYA 1QBLL 3ZKXC 4K23H 1KTDA 2GK0A 5EU5A 1ORSB 4ZQKA 2P5EE 4CL7A 2XPGA 1X5ZA 4FQQB 1TPXB 3G9VA 2IPKB 3ULUL 3EOTH 3SDCB 5DC0A 4DEPC 4TSAL 3GBNL 5EZOL 4O2EB 2Z93A 1KIQB 4FNLH 3HNSL 3FN0L 2P46B 3DUHA 1T0NB 4U3CA 1S5HB 5HHNB 2F9BT 2X10A 1II4E 4GAFB 3RWEB 2VDOL 4Y4KA 2W65B 2YK1H 4ZFZB 1QQDB 4JRYA 1GIGH 2R1XA 4PJFE 4M4PA 3QBTB 1EHLL 5BO1L 3EKCA 3O8XC 3STLA 3T0ED 1T4KA 1I3RA 2ICEB 2E6PA 4P5MB 1PZ5A 4MJ6B 3F12A 4CDHA 3RIFF 3SE3A 4LK4A 3VW3H 3K8MA 1SJXA 3CMOH 3RUGA 4X5WB 5CGTA 3C08H 3DX7B 3EDDA 1B0RB 3BN3B 3O6ML 5L8KB 1UG9A 1JGVH 3OGOE 3QEUB 4L8SA 1W8NA 1NBYA 1AQDB 5DVNA 3VWKA 5TF1L 3GUTB 3GSVA 5EUOA 2A9MH 3ARQA 4FZEH 2ILLA 3ULSB 4LEOB 2XZAL 1KUMA 3U83A 1JNHA 5DEFA 3DSFL 4RIRB 4H25A 4IIQB 2NXZB 5L0QC 4UT6L 4LCWB 4LRNH 3KYMA 4JKPL 2EKJA 1DZBA 3IDYB 2VL4A 5CJ8A 1CFSB 2NW3B 1GGTA 5KG9A 3EZ8A 4N1HB 1T66D 4HKXA 1W72H 4HK0A 2M8XA 3B6SB 1I8IA 2FEEI 4L1HA 4KAQL 3AB0C 3VA6A 3MO1A 1UWXH 3V6BR 3VD3A 3SGKA 5BW7A 4LLUA 1FZOA 2IGFL 3RKDD 2V7HA 4CVXA 4Y5VC 1KENH 4ZS6C 5HI5D 3BIAX 5I17A 3ZYZA 2BVUA 3VWJC 3K0WA 3OAYK 2AV7A 1Z9MA 4MS8D 4GG6B 3RVVC 3GSNH 3TWCL 5T3XH 1T80A 3ULUF 1MCBA 3WUWG 2D3VA 3HE7A 2RGSA 5GRUH 2DLGA 3L1OH 3OPZL 2E8YA 3DWTA 5HHXL 3W0WE 2MCPL 1AKJD 5DK2A 4D8PA 3W9DB 1G7LA 4R2GB 4R7DA 3GI9L 1TVHA 4HLZG 2V9QA 5IFJA 3U9PH 1D9KA 4MVBC 4A6YB 2VZTA 2A74A 4QOKA 2BVOA 4JFPA 2FWOB 5I8OL 1VEMA 3MLVL 2DQTL 3BO8A 2YWZA 4EXKA 4Z7WE 5C07D 5B39B 4JN2A 4J7RA 3BPNB 3ZZ1A 2ZKHL 4S1QH 3A67H 4XBEH 2QQNL 1NCAH 3BJ91 1YN7B 1ITBB 5DUPL 1YNKH 1VFBA 3FQWA 1XGUB 5CBEA 1HQ4A 3V6OE 2VH5H 3B8SA 1L7TH 5TE4L 2Y06L 1JF1B 1W8OA 4O2FA 5EU3B 3QFDB 2VDML 3T65B 4UDUB 1CDGA 1T1XB 3MRHB 2WQ8A 3K4ZA 2BSSB 1E27A 3FQRA 2CMRH 3HAEA 3QCVH 4NZUL 2IADA 3JTSB 1YEGL 4HWEH 1NAKL 4WTZG 1HWHB 1JRHL 1VENA 3BOVA 5FDYA 1KEML 2MCG1 5L2JA 4NNYB 1T20B 4MQSB 3W2DL 4NO0D 5C2BL 2CIKB 3I9GL 2F54D 3INUL 1CU4H 3LB6D