4ODWB

Unliganded fab structure of lipid a-specific antibody a6
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
b'DIVLTQSTSSLSASLGDRVTITCRASQDIRNYLSWYQQRPDGTVKLLIYYTSKLHSGVPSRFSGSGSGTDYSLTITNLEQEDIATYFCQQGKTLPLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A6 Fab (IgG2b kappa) light chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwB01
5HJ3A 1KXTB 1XGRB 3VXNA 4UNTA 4WRLA 2VZOA 4W4NA 3CSPA 1J0KA 2W60B 3KPNB 1AGDB 3WO3B 1MJ8H 4P2QB 4YX2L 1MHPH 3IU3B 5IVXB 1HIMH 4HX1B 4PUBL 5JO5B 1N3NA 4LAJH 1QSEA 1CE6B 2OQJB 5J7CC 5MI0B 3MUHL 3T4AB 4AMKL 1ZLUK 1ACYL 4Y1AD 3G6AA 3HZVB 4ZUVA 5CBAB 5BMFL 1JHLH 4YGVB 1KN2H 3BT2H 4JFEB 1LP9E 3QR2A 4OCRL 5F3HA 3NZHH 5HDQL 3SDYL 3GNMH 1P6FA 4HWZB 1NCBL 1YJDL 4NP4H 3RVXC 2EZ0D 1TVDA 5DI8B 3D3VA 1A7QH 1KXVC 1ZLVH 3O2DA 3MA7B 1IILE 4XP5H 1IGJB 1BJ8A 5KAQG 1V3LA 1KENH 2WINA 4H0GA 2VDOH 4IHOB 1HNGA 3DPBA 1KJ2H 1SVCP 3MV8A 4Z76B 1NUNB 3EJZC 4PRDA 3P77A 5IEKA 2IGFH 5FGSA 1F4XL 5EZOL 4B7LA 3RQ3A 4F8QA 3MRLA 4X83A 1BBDH 1YEKL 3P4OA 1MIMH 2O26U 4RZCB 5GJTH 4HDIA 4FZEH 1CGVA 4RAUA 1V3KA 2P24A 4PRNB 3RNQB 3TFKD 5B39G 3CFCH 3LQZB 3EYOA 4BH8A 3E8UH 5CS7A 1ND0B 1A1MB 3PQYA 4EDWL 1PZ5B 2VL5A 4JDZB 1NC4B 3D85A 3ORJA 5I1AA 1HHHA 4PG2C 1UEYA 5MEQA 3FKUS 5SX4H 3VG9C 5T33L 1MH5B 3WFEH 4M7JL 3FTGA 5JORA 5ITFA 4MVBD 2NY1B 5D5MB 4L9LB 4WFHE 2X7LA 4QRTB 3T04D 2ERJC 4FABL 5D2NA 3DO7B 4PJ9C 1CXIA 1HSBB 3BEWB 4Z5RA 4HPOH 3TVMC 4PR5A 3QUZD 5GRVL 4CBPA 3LKOB 1NCAH 2ATPA 3FB7A 3ULUH 3IGAB 5C08D 3VFMB 3LH2H 2XIDA 1BD2B 2GAZB 4P2OB 1KJ3H 2CKBH 1MHCB 4NKDA 2NXYD 3BIBX 1BIIB 2OJEA 2CMRH 5I1JL 2GSGB 1EUUA 5IFAH 5I6XB 2W65B 4XHJC 4IIQA 3R1GH 5HHNB 1FO0L 4PRIE 1TETL 4I0PB 1OP3H 3ZDXE 5J13C 5EZJA 4ZNEE 5IEHA 3F7VB 2CUIA 4PV8B 1FYHB 4X6DB 3UJIH 3FAWA 1UKSA 1QQDA 1A9BA 4JRYE 2OJZH 2YD2A 1CQKA 1Q9OA 3F5WA 1GGYA 3MRBB 3IDYC 3CVIH 2Z4QA 4GOSA 2Z91B 4C58B 4F9LC 3IVKB 2ZPKH 2R2EB 5TDNA 3NIGE 2K1MA 5C9KA 1WF5A 4GBXA 5D7JB 3VFWA 2DM4A 5JOEA 4WW2B 4BM7A 4LPTA 5F1NA 3OX8B 1G6VK 1VERA 5C71A 5HYJD 3A6OA 1WAAF 5IVZB 1MRFL 1XGRA 3ZYIA 1LNUB 1GH7A 4XCFH 5C8JB 5J6HB 1B2WH 4G8GD 4JJ5B 3KPNA 4M48L 2CRYA 1AGDA 1WTLA 3ABZA 5H94B 5J9PB 3BE1L 3WXVL 5GS0C 3IU3A 4HD9A 5IVXA 5IMLB 2FR4B 1IT9L 2XN9A 4FQXA 4G9FE 1NMBL 4FQLH 5AG9A 1LE9A 2E8YA 1CE6A 2BRQA 3NCCB 4Q6IA 4WTWA 4HIHB 2OMNA 1CK0L 2CO7B 3T4AA 5IW3A 4MA1B 1SEBA 2X4UB 3VXSB 5DD0L 4U0RC 1FG9C 3NA9L 1FFRA 5GRJH 1W8OA 5E5RB 3G5YB 4YGVA 4ZD3L 1G7HB 4JFEA 1W0VA 5KSUB 2ZG3A 4YH6A 1KELH 1KCUL 1VGKB 5CLTA 5I8OH 4JFDD 1BX2B 3B8SA 2XFXB 5DMGC 5C0AE 5LQBH 4NCC1 3NFNB 1J87A 1YYLL 3WDJA 4F7MA 1S7UB 3MRJB 4FQ2H 1LILA 1BJ1J 4HH9B 4P46C 4LCIH 3SBWC 4KI1A 4IHOA 2OTUA 4P3DB 3D25B 3CC5B 3BRDA 4WI6A 2Y06L 4Z76A 1GYAA 1CICB 5E03A 5EG6C 2RCSL 3ARTA 3IF1B 2D0HA 2V5YA 5CHNB 1GGBH 4MB5A 1PKQE 2VR4A 5GIRA 1LP9B 1VDGA 4OKVB 4V1DA 3O45B 4EOWL 4X7CC 4RZCA 2LU7A 4R7NA 4DFHA 1RZ7L 4N0YL 5E2VL 1UCTA 2YK1H 1GVIA 2JIXB 3O6LH 3KPRD 4JKWA 4A2MA 3L3KB 4KK8C 1DBML 3VGHA 4A6YL 5D2NC 3KS0J 1E28B 1F2XK 3LQZA 1KCKA 1FIEA 3RDTB 1VHPA 3PIQA 2L7UA 1QSFE 3VXRE 4DK6A 1RZJC 3QXDB 1G9NH 4JDZA 1FO0B 4ZG1A 4NKMB 4OZIB 4WI7A 3CSGA 4NZJA 4H25B 4GMSL 4UIMB 4Y4HB 4R97C 4WI3A 3SKJH 1MH5A 4QTIH 1TXKA 3GK8L 1JGUH 1HIML 4HEPG 1NPUA 5EO0A 4L9LA 2ZNWA 4QRTA 3DO3A 3DO7A 1QSZA 5IROA 3W11C 1AJ7L 2P1YA 4HMEA 2G5RA 1J0JA 4EI5C 5I17B 5T1KD 3C5ZB 5DUBB 4OSUH 1FL6B 2FJHB 4FQQA 5DRXA 2JK5A 3ZE1E 6FABH 3DYPA 1F4WL 4BQCA 3BI9X 1JHLL 3WJLC 1KN2L 1Y6NR 3BT2L 4CJ1A 5EO9B 2GJJA 4GXVL 3C5SB 4P2OA 3ULVD 4R2GB 3ULUE 1LO3L 2NY2C 4X98A 4XMLH 4OF0A 1UYWL 4M5ZH 3U7WH 1BIIA 1NFKA 3GNML 5DLMH 2ZUQC 5HHOE 3RVWC 2W65A 4ZOBA 5CEZD 3EOTL 4NP4L 3LB6D 3RIFK 5DVMA 5L7XH 3VFSB 1A7QL 2P44B 3LRHA 3QQ9C 1I3RB 4CU7A 1EVTC 4PV8A 4XI5C 1A2YB 2VDOL 2Z91A 3IVKA 3ECBB 1T5WB 2ZJSL 3LIZH 2R2BA 3TZVD 4LSRL 3IKCB 3MODH 3F8UB 4Q58C 4AL8L 5MI0C 3HE7A 2GITB 3UTQB 4ALAH 2IGFL 4JHWH 4WW2A 5D72L 3OX8A 2G9HB 3ZHKA 5E2TH 1BBDL 1YC7A 4ELKB 2X44D 4EXPX 5GJTL 1HI6A 4G8EA 4PY7B 4JJ5A 5J9PA 3CFCL 4CL7A 3E8UL 2YS4A 5IMLA 2QV2A 2FR4A 4PRIB 1KSRA 2YA1A 2ZOKA 3BP5A 3WNNA 1IGFH 5T3ZD 4G3YL 4KHTH 5AD0B 2X4UA 4JRYB 1KIPB 2PR4H 5EUOF 3WFEL 3ZKXB 3TBVB 2ICWJ 4LIQL 3ZHDA 1VGKA 2HLFC 3WL9B 1TVHA 2MKLC 3T77B 1BX2A 3BIKB 1CWVA 1V3JA 5K59E 1AH1A 2XFXA 2VJXA 3S36X 5EH1A 4J3TA 4PLJC 4EZMA 4BFEA 4U2YA 3LH2L 3MRJA 4MA8H 4YDLB 4TYUA 4QRRE 2CMRL 5K9KA 3QRFM 2JJWA 5DK2B 1B0RB 3D25A 4G9FB 5EU6E 4M6AA 3SE4C 1IAIH 2AXGB 4DJMA 3R1GL 3TJEH 4NQSB 1MREH 3GMRB 2I07A 1QEWB 5CHNA 4DKAA 3SY0B 1JGVH 3UJIL 2X41A 1X5FA 5IM7B 4BK4A 3O4OB 4X5WA 2OZ4A 5DEGB 5MHSD 1LP9A 3O45A 4GG8B 4JREC 4N1HB 3FQUB 1JTOA 2HJLA 4EXKA 2JIXA 5C07E 4HWBL 2X89A 1VFMA 4JHBA 4G6AD 5C0AB 1XGUB 4MXWH 3RDTA 5ACZA 4ZFFA 4L3CB 3ZKND 4NO2B 2F5AH 4AZ8A 4F7CA 1FO0A 1S9WB 2VE6A 3ROLB 1S5IH 4HT1L 4XCFL 1CFSB 4OZIA 4BZYA 3WFHA 4Z0XB 1B2WL 4Y4HA 2P8LA 4GKZA 1FFPA 5KZCD 4ZXBD 4L8DB 3OXSA 4FQLL 3PP4L 4L1HA 2EDNA 5H2BB 5I17A 1PKQB 2P48B 4I0PC 5DUBA 1O0VA 1PG7H 4OM1L 3VD4A 1FL6A 1NGQL 2FJHA 2GJZB 4GRLD 5GRJL 3FFCB 2VXSH 5AAMA 3C5SA 2ICES 3PWLB 1XIWB 1PBYA 1KELL 3D0VB 3QHFH 5KTEH 5FO7A 1AGEB 5I8OL 4ODSH 1FNFA 5D9SB 2NR6D 1QSFB 3VXRB 3MJ8B 4E42B 3HAEG 5LQBL 5D7JC 5KVFL 4JFYB 2P46B 3VI3F 4WW2C 4WWKA 3MROA 4FQ2L 4LU5L 3RUGE 3C2AH 3SO3B 2E9IA 1CTOA 3NPSB 2A83A 1D5MB 4LCIL 2P5WD 5FYKL 3NN8B 3KLDA 1KIQA 5E8PB 1MCQA 4WCYH 4XNQB 3U1SH 1GSMA 5AYQA 3FRUB 3ECBA 5EPMA 1T5WA 2A2QT 3GRWH 4PRAA 2VC2H 2XNAB 4OCLC 5H8DA 3QI9B 1PVHA 1TPXB 1FSKC 4JM2B 4KV5E 3TM6A 1GGBL 3VRIB 3KHOA 2G9HA 2LQRA 4FG6D 5FA3A 4BYHA 4XP9H 3Q0HA 2X2YA 4YDVB 3X3GH 1NFIB 2VIRA 1OB1B 5IW1A 4OZGF 2CKBB 3QIBB 5HHOB 2W0LA 4P9HH 2XWTB 5E00B 4IRSB 4Z77B 1SJHA 3GEWB 4ONOA 3MRPA 1QSVA 2E6PA 3VXPB 4UTBL 2XXCB 1H3WM 5IFHH 1WWWX 4NGHL 4HULB 5AD0A 1FYTA 3DUHA 4XB8A 4QTIL 2P5WE 1JGUL 4W70A 5E94A 2NXZB 1TTFA 3EHBD 5IHLB 3TIDA 2WBJB 4ZS6C 3T77A 2BVTA 1CICC 3QBTB 3S35H 3BIKA 4A6YA 1WVZA 4OSUL 1MHHB 3Q5TA 4Y4FB 6FABL 3UBXI 5JW5B 4N8CH 4QRPD 2V7HB 1H0DB 2BY3A 2ZCHH 1LVEA 1QD0A 3NZ8B 4Y19D 5KSBF 3K7UA 4P2RD 4XMLL 2UWEF 2AW2A 4M5ZL 3QYCA 1YUHA 4E41D 5DK2A 1NGZB 3GI8L 4ONHB 3RPIB 4G9FA 5E1HB 3RDTC 2AXGA 2EDDA 5KANG 2SEBB 3SDDD 3GMRA 4G42B 5F6HJ 3VXTB 4L4TD 1F97A 4W81A 1MFNA 1UWXH 4Y4HC 4GG8A 2NY6B 5FEBA 5JA8B 3QEHB 1TZHA 2EDJA 3FQUA 5EDXA 1LK2A 4F7PB 4JAMB 5C0AA 4ZUWB 3MODL 4D0BA 5FDWA 3X12B 4ALAL 3JV6B 3C5ZC 4WI5A 4X6CF 4NHUB 3IXTB 5E2TL 3OKEB 2X9XA 1S9WA 4BFBD 3ROLA 1QSED 3BDYL 5DJ8B 5D7IA 1CFSA 4QRRB 1HQRA 4Z0XA 4ZFOL 3GHEL 5C9JB 5C0BE 3IXAB 1J05A 1M71B 3MLYL 4IBLT 4MNHB 3K4AA 5LVEA 5EU6B 5K93A 3RX7A 2CO6B 4E41E 5JQ6H 1GJIA 1Z0NA 5FKAB 4OUUB 4PJ8B 4P59L 2EZ0C 1IGFL 1VEOA 1PAMA 5H2BA 1OTUD 2FLBT 1IAMA 2CLVB 4KHTL 1I7TB 4TUJA 3FFCA 2AKRA 3G08B 5I0ZA 4F57H 1T3FB 3D0VA 5C07B 1MFBH 3ZZ1A 5FHBH 1CGXA 1AGEA 3BXNB 3TCXA 2DJ4A 1AO7B 1CFQB 2HTLC 5BS0B 3HG1E 3VGGA 2H2PC 4X9FA 2YUWA 3MV8D 4ODTH 4K23H 4KK9D 1PEZA 5F1IB 5FYJL 2FO4B 3UAJC 2NZ9C 5FV2A 1D5MA 3U48A 1RV6X 1ULVA 3NN8A 4XNQA 4XBPB 4X7FC 3TFKC 1FNSH 4NDMB 4XXCA 1WZKA 2J88H 2XNAA 1S8DB 3QI9A 3PDDA 3QWRA 3C6SB 1UJ3B 5EU4B 1DCLA 5TQ2L 3PQYD 4OTXH 4L9DA 4YDVA 5EC1B 1NFIA 1QLRB 1XH3B 3GMLA 3IAPA 3ZKXC 4C56A 5FECB 3D85D 1OB1A 4JY4B 1HXMB 1JF1B 4D0DA 3ALPA 3QIBA 3U30B 2EO9A 1P6AB 1OY3B 2AXHA 4PJGE 4PB9H 3TBWA 4ZPTA 4IRSA 5TDOA 3MRDB 4MB3A 1QFPA 5TDPB 3VXPA 2N7AA 1QYGH 3CH8A 1S5IL 1U8QA 4B7IA 1R24B 4JZOB 4MCYB 4YDLC 5C0ND 4X9HA 1RPQA 4Q9BA 4YFEA 4LDOB 1I7UB 3SPVB 4WHYH 1ZHBB 1NAML 4CADB 4HWBA 1IEBB 3MNVB 5HI3C 3VFGL 3ARGB 3P3YA 1MHHA 2IAMD 1FGVH 4WJ5B 5DVOA 1KB9J 2XZQL 5JW5A 2HG5B 3JVGC 4KI5F 2HLAB 4LFHG 1H0DA 3V6ZA 1IGCH 2NLJB 3NZ8A 2I5YH 1OGAA 4OF5A 3QHFL 5KTEL 3CFKA 3I9GL 1IM3B 4ODSL 4U1GB 2AK4E 5ICZB 3VJ6B 4IRZH 5FO8A 1A7PH 1NGZA 3RRQA 3N1PC 2EDOA 3QO0A 4PJIA 5CJXA 4HKJA 3T8XB 2SEBA 4G42A 1SVZA 3P4MB 5DJCB 1M7XA 3DGGB 1WWAX 3VXTA 5BZDB 2XZAL 4GBXD 5DK3A 3DROA 3REVB 2W59A 1LK3L 4XCYA 3BPNB 5DHVB 1XGQB 3D18A 4WCYL 3D9AH 3U1SL 2EXYD 4N5EC 4IEFB 4FQHA 5DO2D 5TF0A 1OQXA 3L3HB 1X5YA 3TBSB 4NNPL 4F7PA 4JAMA 3KS0H 4U6HB 4ZUWA 4PG9B 3VGDA 4U3HA 1BOGB 3X12A 2VAAA 3ZT5A 3JV6A 2DQIH 4NYLB 4NHUA 3BUYB 2XN9D 4FQXD 3OKEA 5JOFB 2FD6H 3EOYG 4XP9L 1NJ9B 4BSVA 3WFZA 3CJJA 1AI1L 2E7HA 1XIWC 2UVEA 1GIGH 1M71A 5IB1B 2YD3A 1MCPH 4P9HL 4JFZH 4M6ML 4Z7VF 4KAQL 1W72A 5BJTB 1P7QA 1T1WB 3HZMB 4OUUA 3HE6B 4KVNL 3X14B 1NFDF 5IFHL 2CLVA 5KW9L 3SQOL 3WO4B 3MLWH 3SO3C 1I7TA 5IUSA 2OI9B 3NPSC 1T1YB 5JLZA 2AEIT 4MD4B 1T3FA 3DX6A 1BAFH 3OF6D 3CUPA 2B8OT 3S35L 1AO7A 2FJFA 2ZG1A 1CFQA 4JM2C 5BS0A 4UI2A 2E8ZA 3OJDA 4NNYA 4N8CL 5D2LE 3ZO0A 2BFVL 1A22B 4UT6H 5F1IA 4NZDA 3ULUC 3HRPA 4BSJA 2EDKA 2ESVB 5C0BB 5EB9A 1PKOA 1IKFL 2EC8A 3QNZB 4K3EL 2IBZX 4XBPA 4V1DD 3WJJA 1CFTB 4KKLC 3O3BB 3LKRB 4IRSC 4N68A 5CZVL 1F58H 1S8DA 3BP6A 5I30H 2DQJH 1FVEB 2FGZA 3C6SA 2H26B 2OMBA 5SWZE 5EU4A 5CSBA 2I25N 3QDJD 1YC8A 1GOGA 5EC1A 5EIIB 4ZYKB 1XH3A 4JY4A 5ID1B 1FBIL 4RBPH 3TA3A 3GZKA 1CF8H 4W6YB 3GIZH 1SM3H 2WBJC 5EO1B 2VOTA 3B9KD 4POUB 2R23A 3HG1B 4PGCB 1XGPB 2UVFA 1NGYA 4Y4FC 5TDPA 3W82A 4N0FA 3C6LA 4P3WA 2HFTA 2UZIL 3LEYH 1EK3A 2DMBA 2J6EA 3MC0A 1T6VN 4RFOH 3NCMA 3DXAA 3HMXH 3V5DB 3SPVA 1KCSH 1YN6A 5JQ6L 1ES0B 2FX7L 2ORBH 2VSDA 4CADA 1A4KB 4NC2B 4PGDB 4I0CC 3VGEA 3H0TA 4J4PA 3HLAB 2AQ1A 3HZYA 4TQEH 1MY7A 1KACB 1YMHA 1LMKA 1U8KB 1AGBA 5EBLB 1X5KA 2HG5A 1CIUA 2HLAA 2E6QA 1SYVB 2DKSA 2APFA 2NY6C 4F57L 2NLJA 4KKBC 3QDJE 4JDTH 4PJGB 5ICZA 3U36B 4ZFOA 4R4FH 3HI6L 1WIUA 1SBSH 5JW4R 5EBMA 2IPUK 3QUMA 3QZWA 1WWCA 4WU5B 3T8XA 3MBEA 4ODTL 4PGZA 3VWKC 3F12B 4K23L 5DJCA 3DGGA 5BZDA 1C7TA 1J1OH 1ZLWK 1KPUA 5JHDE 4ERSL 3FN0H 5I66B 5I76B 2IAND 3HE7D 2D9CA 2PYEE 3H3PH 3MPCA 5I18H 4YO0A 4F33A 1MQ8A 5DHVA 1T21A 5EU5B 2G60L 4XAKE 3IFOA 4DGVH 1X5AA 2J88L 1TJIL 2X1QA 5ESQB 5FIEA 3LN9A 1ZGLP 5L0QB 4XCCH 5FA4B 4PG9A 1JN6A 4PJ8C 4XP1H 1RZGA 5CZXC 4HPYL 5DHYB 3O8XB 3MCLH 1GGIL 2JJSA 1J11A 3DUSB 4PP2A 3V5HB 1C8PA 1AD0B 3WS3A 1T5XA 5EA0H 3BUYA 3DMMA 5JOFA 3D87B 3DURA 4XPTH 2B4CH 1M7IB 1NJ9A 1IEAA 2GIYA 4JEGB 1QFUH 2AK4B 4NQCE 4CUCA 1AQDB 4DW2H 1J12A 3NTCH 1KGCE 2FBOJ 5HY9B 3G5VB 3WCYA 5DEZA 4H5SA 1J1PL 2X9WA 4Z0BH 2E9JA 3HZMA 1T1WA 4QT5A 3HE6A 1QYGL 3X14A 1DN2A 3LEXA 3NCJH 1G9NC 4FTVD 1WFOA 2R56L 2VN7A 3JWDL 1DBJH 3P0VL 1K3ZA 4HFWA 4LK4A 4MD4A 3CMOL 4MDIA 4GQPH 3OKOB 2HFFA 2VR5A 4FNLL 4OFKA 1H3PH 4YE4H 3S3PA 3UCRA 4I1NB 2A6JB 1UJ3C 3OGOE 1RFDL 4CMMB 4XNUL 5DYOA 2WSKA 2BVQB 1A21A 2I5YL 5J06A 2V5RA 2ESVA 5C0BA 2WNGA 4DGYL 3MBXH 3L95B 4IRZL 4KK5D 3U30C 1JBJA 3L5WB 1KFAL 5DURD 1CFTA 3O3BA 3OAZH 4U7MA 3DGCR 3KDMB 4R7DB 1SQ2N 1IGTA 1FVEA 4G6MH 3R0MA 5T1LD 1NAMA 1P9MA 1Z9SA 2X89D 5IB4B 3LKNB 2X4NB 1EEZA 2D3VA 2P4AB 4LVEA 3F65A 4FTVE 5A2LH 2ICCA 4JVUA 3LAFA 4NO3A 3D9AL 5EIIA 4KXZI 4P23B 4ZQKB 5E8EB 5ID1A 1FNAA 4FXKA 2HKFL 3QIUD 1EEUA 4GS7B 3E6FA 2QQKL 3FL7A 3K46A 3WKMH 1ZSDA 4PV9B 4J4PC 2FYYB 1DN0B 2DQIL 3ARGC 1XGPA 2QSQA 2X1PA 4CW1B 4UQ3B 4JO4H 2FD6L 4CN1A 1DQLL 1KTDB 1DJSA 4K94H 5F1OB 1CFVL 1LWRA 3NH7L 3O3AA 4U1GC 2WBKA 4FN0A 1UT9A 2UZYB 3V5DA 1ES0A 4M1GL 3BKMH 1A4KA 2IFFH 5SWZB 3LMJL 2E9BA 4XXDB 1PD6A 2YZ1A 3GJEB 4ISVB 1SYVA 3BPNC 2YA0A 1KCVH 3FMGH 1HSAA 3T0ED 4WWKD 4P5KA 3U36A 4LCWE 1UWGH 2VQ1B 5KS9F 2I9LB 4PJAA 3DHMA 4WV1B 4HWEH 4IS6B 3QEQB 3QULA 4M1CD 1MWAL 1TNMA 4GH7B 3V6OE 1JNJA 4XMKL 3G5ZB 1JHTB 5FUCE 3FT2B 4UT6L 3IB4A 1U91A 1WFTA 4W6WB 5I66A 1ZVSB 2EE3A 3VG0H 4OCNC 3QXTA 5HPMB 4JRXE 5I30L 2DDQL 1WT5C 4XHQA 3RHWK 4PGBA 3HE6C 2BC4A 5DHYA 3VA6A 3O8XA 2VZTA 3V5HA 1AD0A 4RGOL 3WO4C 2NY4D 4XP4H 2R2HB 2YPKB 25C8H 2OI9C 5KSAB 1MEXL 1M7IA 2X10A 2KQNA 1FIGH 1NCWH 1DQJA 3NBNA 1AQDA 3FQXA 1CF8L 3GIZL 3CU7A 5GGTH 3DHJA 4S1DC 1FYTD 3RTQA 4KUCD 5D1XB 5HY9A 1KEGH 3G5VA 4XWGH 2C3WA 2X4QB 1AGCB 4RAHA 1NBQA 3MLRH 3QHZL 5JHDB 2PYEB 3LEYL 1H5BB 1NMCB 5E1AA 1YEJH 4MZ2A 5CUSH 5GS1B 2QTEA 1RHFA 1KCSL 1CYGA 3OKOA 3RIFF 2ADJB 5SX4I 2ILLA 3BX7C 4TQEL 3UEZA 3WS6A 2RR3A 4CMMA 1AC0A 2NNAB 3BJ91 4MS8C 3IKKA 4XPFH 3VFNB 1OAUL 4NQEB 2YPLE 3LV3B 4LLYB 3QUYA 3DIFA 2BVQA 4NQCB 2XYCA 3FJTA 4JDTL 4MQXC 4JQVC 4TSAH 3H7LA 3VXUA 2J8OA 3MLXL 1Y18B 2FEDD 1ZLSL 3L95A 1RJZB 4R4FL 1UKTA 1FFNB 4LMQI 1CT8B 2O5YH 2E7CA 1CE1H 2UY7A 1RZ8A 3BKCL 2X4NA 1SBBA 4UT7H 3FN0L 5HGBA 3RVUC 2PNDA 4YR6B 3H3PL 3JV0A 1TIUA 3TEUA 4UDTA 3BGAA 1VFBA 4DGVL 2DLHA 2WUCL 3PWUB 4HKBB 3U9PL 3U4EB 3RKDD 2QQLL 4PIRF 4KTYA 5HI5D 1JGDB 4XP1L 5ENWA 4QOKA 4PV9A 3MCLL 1G7IB 2FYYA 2Y4SA 1OOAA 4YJZL 4CW1A 1G7QA 5GSVB 4XPTL 2B4CL 1KTDA 3MJ9H 2ZSWB 1QRNE 3G5XB 4M7LH 3WHE0 4NBYB 4G6KL 4DW2L 3O6KL 4KRPB 1U8LB 4M7KH 2A74B 4LHUB 1GL4B 4C83B 5LGJA 5E6IB 3VMNA 2JE8A 1B6UA 4P9HC 3WV0A 4PGEB 3SDAB 5DSCB 2KUTA 3GM8A 3R0NA 3T08A 4LSPH 1TZIB 2G75B 3MLVH 1WJ3A 1N0XH 4EBQL 2C3VB 1ZWIB 1JZ2A 5I8CB 5IF0A 3GJEA 4RFEA 3RJDA 4NKOB 5TQ0H 3Q48A 4LGSB 4J6RH 5DHXB 5GXBB 3M8OL 4YE4L 2VQ1A 5L0QC 3EZJB 3QEQA 3KPOB 4G8FB 4HJ0D 2Q7NA 4IS6A 3T1FA 2GK0B 1XR8A 3I6GA 3WFCH 5JDSA 1MCWW 3G5ZA 3H6JA 4PRBA 4ODHL 3QI9D 1L7IH 1WZLA 2NY5L 5K9JH 3F6LA 4H88H 2UYLB 3QWRD 3T4YB 3J7HA 5MEPB 4HIXL 5E5UB 5EULV 3RP1A 4WI2A 4Y5VC 4MJ6A 3QRGL 3HAEH 4K3HA 3TYGH 5HPMA 3SE9H 5EUOE 4XAWL 2FRGP 4C56D 5KN5B 3TBYA 3B5HA 2H32B 1NKRA 1AKJB 3IJSB 3BEVB 1K6QH 4KTEL 2D31B 5I1LB 5KSAA 2VWEE 1MIEH 4RCAA 2Z31B 4J23A 1DEDA 2PTVA 3UTSE 4Q74A 4RQQA 1I3GH 4K7PX 3S9DB 3WD5H 4LCWB 3CFEA 2AXFB 1MCDA 5D1XA 1A47A 2BNQE 5E7BA 5E8DH 1SEQH 1RIHH 3QPQC 2X4QA 2NXZD 3WS6C 3T65B 1PLGH 2HRLA 4JO4L 5DMIL 1R3LB 3M1BA 1N0LA 2HMID 2YRLA 2DQFB 5SWSE 2PYEA 3K81A 2VXUH 5E7FA 2F58H 3DBXB 4D9QE 1EHXA 2QR0A 1H5BA 4S0SD 3S4SB 3NFSH 4JRXB 5D93B 5EU3B 1NGXB 2F53B 4X80H 3NCYS 3V5KA 2Q3AA 3CZFB 1OGAD 5HYSB 4DWHA 1IC5L 2IFFL 4K2UL 4WEMB 2PW2A 2HKHL 3QFJE 4C59B 1EJ6A 1NSNL 4NJ9H 1S9XA 4NQEA 4TSCL 3LV3A 4ZTPL 2W1NA 3DVFA 1KCVL 1K2DB 1KUMA 3FMGL 4JG1H 4P23C 1Y18A 4GS7C 1RJZA 1R3JB 1LD9A 4WNQB 4G7VH 4OI9A 1FPTH 1DBBH 3MJ7B 1XF3B 4PYGA 3GJFH 4PJDA 2IPKB 1RZFH 2JKXA 3L3JB 1CD1B 1LDPH 4LSQH 2DQHL 2P5EA 3IJYB 3VG0L 1J5OL 3JXAA 4H1LH 3PWUA 2Y7QA 4K3JL 5C70A 1C5DB 1NCTA 1OF2B 2DWDB 4OJFH 3SJVE 4CU8A 1CDCA 1RUKH 4X8XA 3I50H 5FYKD 1G7IA 3V95A 1WBZB 1EV2E 2YPLB 5ID0B 2XZCL 1MWAA 2ZOLB 4U1NA 5GSVA 3DYOA 1P7QD 1NCWL 3VI3E 4U1MA 1OTSC 3G5XA 4H20H 5FYKU 4NM4L 4PJEA 4DKFH 4GMTH 1QNZH 2E5EA 5GGTL 2A74A 4JKPH 2VERN 4JZJA 3NVQA 3KXFB 5E6IA 1CXLA 1FL3B 4WV1C 2CDEA 1KEGL 3B9DA 1JZ7A 5DSCA 4PJXF 3MLRL 2VKXA 2G75A 4I3SH 2FHFA 5IWLA 3MLZH 2CKNA 2DOCA 4MNQE 3D69A 5BS0D 1GHFH 4J3WA 5B22A 1C7SA 2GJ6E 5CUSL 4NKOA 5CLWA 2D4DA 5M95B 1BFOB 1VENA 4PS4L 2R9HC 5KJRH 4HGMA 4RWYL 3P0YH 2LFGA 1UQSA 4OZGE 4G8FA 3Q6FB 1F6AA 1XGTB 3DSNA 5EOCJ 3DRQB 3S37X 4HUXA 4XPFL 3B9VA 4RX4D 1T6WA 3GMQB 3H3KA 1WGOA 3O4LB 1QRNB 2Y9RT 1CIDA 1FFOB 3BPCB 2UYLA 3L6FA 1NLDH 4TSAL 5F88A 5MEPA 1RMFH 3VFVA 1C1EL 1MAMH 2BOCB 3U2SB 3SO5A 3ZE2F 3RZCA 5TE4H 1ZK9A 1I8KB 9CGTA 4FFWD 2ICWA 3DI2B 5D6CB 1R3IL 1ZA3A 5KN5A 2X1XR 1U8IB 1DQMH 3TA3D 2H32A 4G80B 2GFBA 2R1WA 1AKJA 1YECL 3V6FB 1IAII 3ME0A 2D31A 5CSGA 2X4RA 1NMCC 5IR1B 3ARUA 35C8H 5GS1C 1WAAA 1QBLH 3C6LD 2BY1A 3W39B 4U6TA 3RWJB 4LCWA 1OGTA 3ZTJG 1CU4H 1QZ1A 5KSBE 4Z95L 3QP3A 1U8PB 2HT3D 2BOBB 3DXAD 1IM9B 5I73B 3BKYH 4K07A 4NCDA 4XNYH 4ZS7H 3TO4B 4DN3H 4GG6E 4M7LL 5DD1H 3DBXA 2ITDB 2H8PB 4OZFG 4A2LA 3KLHC 4RMRA 4M7KL 5GHWH 4YDKL 4HS8H 4MJ5A 3C60A 5D1QA 5EUOB 3BPLB 5EU3A 4WFGE 1NBYB 1QO3A 2F53A 4I2XE 5C0RL 1PDKA 5HBBA 1T7XA 5CD5C 3NCYP 4LSPL 3PJSA 3MLVL 2DKMA 3TNNB 2D2OA 1Q94A 2DAVA 4OZHF 4M1DH 4P9MH 4O5LH 4EVNA 5CILH 5CMAA 5AUMB 1FZMB 3UTSB 1IGIH 3MOAH 4X6CE 3MBED 1T22B 4J6RL 5H35B 4OZ4B 4NQXB 1JGEA 1NDMB 4PBVC 2BNQB 3DX7B 4WNQA 2ID5A 1F4YH 1U41A 4BQBA 1SYSB 3MJ7A 4KU1A 1XF3A 5IB5A 2ZG2A 5SWSB 2Q3ZA 2D7QA 5ISZE 1L7IL 1HYSD 1E4WL 1QTYT 4H88L 1JYWA 4NQTA 2IADA 3VXMD 1SY6H 5DJ2B 3MRIB 4ZUSB 4KJYB 4KRPC 3RVTD 4XBEH 1CDIA 3DMMD 2AV7B 4X7SL 4J8RB 3TYGL 4QTHB 3SE9L 3T0BA 1JGLH 5DUMH 5FYJD 2VR9A 5FO9A 1C5DA 3SDAC 2BNRA 1F3JB 2D0FA 1FNHA 5HGAB 2HH0H 2AGJL 5ID0A 3FO0H 4HZAA 1ZT4B 5FYJU 1XF5B 1JNLL 4YK4B 2YSSB 3GI9H 2VABB 5ADPH 3WD5L 1MCLA 5L2KB 5IBUG 4IMLA 5IJKA 4WIQA 2HVKB 3KXFA 5E8DL 4KTDH 1RIHL 3QQ3B 4NM8H 3HZKA 4WHDA 1PLGL 1BM3H 1MCBA 3B83A 4Y5YA 3VXME 2R8SH 5IQ7L 4WU7B 4HWUA 3KPPB 2PTTA 4YHLH 5FKPB 3SJVB 1OTTD 1N26A 2FIKA 2XY2A 2AJYH 3Q6FA 1DQDH 4MA3B 4R8WH 4ZAKB 2EH8L 2XT1B 4NJ9L 1ZLUH 2Y72A 1H3UA 2VZ1A 3O4LA 2IG2L 4APQB 1FFOA 4JG1L 3FO1B 2Z31C 4HLZG 3LKPA 4OF6A 4GUPB 3FO9B 1N5AB 2BOCA 4I3GA 4L5FH 5TE6L 1P1ZB 5IHBA 5EUKB 4OV6F 1I8KA 1MCEA 4HG4K 2YD4A 1MI5E 2DI7A 1FPTL 4G7VL 4ZOCA 1DBBL 3V6OC 5FUCC 1U8IA 1FLRL 1AR1D 1RZFL 1IFHL 3IJHA 4MNQB 2X4SB 4YHZH 5F96H 3DVGB 1T83A 4L8BA 2GJ6B 2J8UA 4KKAD 1OWWA 5TFSH 1PJ9A 3QJFB 4Y0GA 1DFBL 4JR9L 1DVFB 5F89B 1BBJB 4Z9KB 5D93C 3UO1L 4OZGB 5DFWH 5D7KD 3GSXB 5K9QI 4OJFL 3KWWB 1U8PA 3RY5A 5C2UB 2YRZA 4LQ1A 3I50L 2BOBA 3L3GB 1IM9A 3L7EA 3K4ZA 3QAZB 5L2JB 4LFHD 1D6VL 2ICEA 3LSOB 2P42B 4GW4B 4U3CA 4UIKH 4UUJB 2ZNXA 2B4CC 2ITDA 2H8PA 1EHAA 4PBWD 4DKFL 1QNZL 3T0EC 4DKEH 4HIJA 3RAJH 5HD8D 3VWJB 3NIDF 1YEIH 5EUOA 3AMKA 2DM3A 1NBYA 3HAEB 2O61B 4NUGH 1N5YL 4I3SL 2VH5H 2F54A 2BJMH 4NOBA 3OJVC 1MQKH 1GHFL 1RD6A 1Q1JH 2ADFH 3N06B 3UTSA 2PN5A 1HOCB 2EH7H 1T22A 2J4WH 3AMLA 4PRPE 5KSBB 4NQXA 3U0WH 2UWEB 5TF1L 4LBEB 3QG7L 5GGTA 3HFMH 5F1KC 3DX7A 3IDMA 2VYRE 3VCLA 4M7LT 5FHAL 1KLGB 1SYSA 2EYTA 1PYWB 4EUPG 2DKUA 4X0KA 5LGHL 1IEHA 3EZ8A 3QDGB 5INCB 2BZDA 1S7RA 4Q9QH 3O8XD 1RJLA 4ZUSA 4F9PA 4KJYA 3C8KB 3A0OA 4I2XB 1VSCA 3B9EA 4J8RA 4S2SA 1A0QL 1EBAA 1CBVL 4M6NL 4FFVD 3JUYA 4QKXB 3ESVF 1DQML 1FNGA 2OS7A 3ZTNH 1B9ZA 5F7FA 1T20A 3RTQD 3S36H 2VLJD 3HNVH 3ARFA 4O9HH 1ZT4A 4OGYL 4RDQF 4HS3A 4X6CB 3D2UB 4JKMA 3RKPA 5EZIL 2WUBH 4BA8A 1E4JA 5L2KA 1CU4L 3SGJA 5DWUH 2HAZA 3T2PA 1FRGH 2HVKA 4FQCH 1JPFB 1MF2H 1QHPA 3MV7E 4KQ3H 1D5XA 4N90E 5ISZB 3UROR 3AVEA 3GJFB 1EZVY 5JZ7C 4HKXB 4XNYL 4ZS7L 3ZKMC 4DN3L 1MAKA 2GYSA 4K94C 3I84A 4F37K 5GHWL 5I1KH 4HS8L 4MAYB 4XC1H 4NUJB 5ACMA 5IFJB 5CGYC 3C09B 4WU7A 3GSUB 1DQTA 3KPPA 2ZCKL 3QUYD 2X4OB 4NPYA 3SDCB 1KB5L 4JPIB 4H1LB 5FKPA 5I16B 3VXUD 3UJTL 1ORSB 1SJVA 1FNEB 4P9ML 1JFQH 4HBCL 4LVOB 4O5LL 3V0WH 1NCNA 5CILL 2DYPB 3IETB 2VLJE 1BFVH 4APQA 3FO1A 3H9HB 4ZTOH 3P73B 5CJOL 5FB8A 1ZGLB 1ACZA 4ZUTB 3O81A 3FO9A 2Z92A 1LQSR 1N5AA 2MCPH 1XCTB 2ED9A 2V7NB 1XZ0B 4UOW1 1OAZH 5GZOD 3KYOB 3UPAA 5I73C 3RY6A 4OIAA 3TO4C 1OAQL 4QOKD 2J2ZA 3C9NB 4WW1B 4XBEL 2DF3A 2DRUA 3CVHA 3D6GA 3QJFA 3RVVD 1DVFA 5F89A 5FUZL 1BBJA 2V17H 3QQ4B 1S7VB 1HZHL 4MXQD 4XWOD 1S7WB 5E2WH 3GSXA 4LCUB 2MNUA 4D8PA 3EBAA 2W9DL 2V5SA 2A73B 5HHXH 4UINH 3MRCB 1DUZB 5L2JA 4LP4A 2VWEC 1CDHA 3WBDA 3KGRA 3LSOA 5CSZB 1DEEB 2R39A 4KKCC 3NGBB 2KH2B 1K4DB 3IDGA 2NW2B 1MI5B 2LE9A 5IVOA 4U4BA 3RGVB 3KYMB 2J5LB 4MD0B 4HJ0C 2O61A 4KRLB 1IQWL 3WLWC 3VRLF 2Z8RA 4Z78B 2FECL 1BM3L 1CXHA 1KEMH 1CGSH 1G7LA 4UTAH 4LGPB 4CDHA 5TGBB 1MRCH 5ESVA 2BHUA 4OGAC 1NGPH 2WAHA 4YHLL 5KSBA 1KT2B 5F7EH 2UWEA 3WNLA 1JNHB 4LBEA 3TJHD 1VCAA 4WUUB 1GC1H 1V7NH 4J3UA 2NQCA 1MCKA 3MRRB 5HPOA 1KLGA 1ORQB 4LVHC 4M4PA 1KPRA 1Q0XH 1HH9B 3L9RB 2BNUB 4WTZG 3MNWB 1U0QA 4NZTH 3QDGA 3ZE0F 5KVEL 3CX5K 3RWIB 4KZEH 4YK4C 5JA9A 2PYFB 2NMSA 2DIBA 1QLFA 3IFPA 1E4XI 4MA7H 3ARBD 3C8KA 3SGJC 1R0AH 1CG9B 3O6FB 2X4TB 2IC2A 3BWUC 5J56B 2VN4A 4OLUH 1KB5B 2OP4H 3BRFA 5F96L 2DQDH 5D1XD 1UJTA 2EYSA 3LKSB 1T7WA 2Y5TB 1VEMA 3A67L 4X6CA 3KNBA 1YEHH 3JTTA 4OT1H 2CIKB 3SDXA 4PRPB 4PTTA 3RWGB 3I85A 4LPUA 1KCRH 2R1XA 2NCMA 5BO1H 2AJXH 4Z7VB 4ZAKC 1D9KB 3BH9B 4I13B 5GGSA 4HKXA 4X8JA 1J1XH 3H9SE 4APQC 5BW7A 1NFDB 2XKNA 5DTFA 3W0WE 4QHMA 4X4XA 1I8LC 3BRGC 4DKEL 4YXLH 5IHUH 3RAJL 3KLSA 4MAYA 5IFJA 4NUJA 4IDLA 1Q38A 2WIIB 1Z0MA 4NQED 3GSUA 4U6YB 3SDCA 1R3KB 2X4OA 5C7XH 5I16A 4DTGH 3QCTL 4R0LA 3R06B 4NUGL 3BPOB 2VH5L 4PJ5A 3V79C 1UXSB 2Q8BH 3HC3L 5C0GA 1V7MH 1MHEB 4M3KB 3IAGC 4UBDD 1G6RL 3CMGA 5GSRB 2EH7L 3H9HA 1ZGLA 2J4WL 4L8SB 1JWMB 3LEVL 1XEDA 2ARJA 1HHIA 1MFDH 1O7VA 5D7LE 3U0WL 3UDWA 2Q7YA 4D9LL 3U9UB 2ADIA 3U82B 3HFML 2P5ED 3MV7B 3RHWF 1CXFA 5IKCA 3F7QA 4BUGA 3UXFA 5JPMA 4BZ2H 3QAZC 1WTGT 1YEFH 2P8MB 5GS2H 3CIQA 3Q6GL 3LS5H 2BXZA 5ICXB 4GRWF 4HH8A 1YNKH 3C9NA 2DI9A 3H9YA 3VWJC 4U1HA 3O2VL 5DD6B 1RUPL 5KBNC 3GHBL 3QQ4A 1S7VA 1S7WA 1UH2A 3N50A 3GMPA 3IYLW 4XMPL 2A73A 3GMMB 3T0AA 2CDGA 4QHNA 5KS9E 3HNVL 1I85A 3LPFA 4O9HL 4X99B 4P4KB 1DUZA 4HQQH 3PDOA 4ZO9A 3W2DH 5JPNA 3EO0A 3ZE1F 4DVRH 2BRRL 3QEGH 2NX5E 3B2VH 4LNVA 1HE7A 3RBSA 1BQHB 1VA9A 1MI5A 2NW2A 1URLA 2VDQH 3DI3B 1FRGL 5DWUL 4FHBD 4FQCL 4L4VD 5A1AA 1MF2L 4MD0A 4OCWH 1FL5B 1YPZE 1ZOXA 5DJDB 4EI6B 1LEKB 1RQ5A 4CNIA 5JDJA 4NC1E 1BFTA 5J1AB 4OLWH 3MOBH 3MRNB 5IESH 2WLYA 4I77H 3MGTB 2I60H 5C3TA 5I1KL 1KOAA 5TGBA 4ODXB 4EUPA 4HF5H 1JNNH 1L7TH 4LHJB 3BZFB 1D5ZA 1A7OH 4M5YH 4Z7QF 4YHPB 4AG4H 3MRQA 1KT2A 5CCKL 2EIBA 4WUUA 3RZCD 1OW0A 3MRRA 1RURH 1T89A 4X7DC 1JFQL 3GSWB 3V0WL 5F7UA 2XTJE 1HH9A 3L9RA 1BFVL 2BNUA 3BW9B 3QDMD 5JQHC 3LHPH 1TTGA 4I9WD 1WQVT 1AKJD 1SMAA 1IGMH 2WV3A 2MCPL 7CGTA 1E6JH 2F74B 2FX8H 3KJ6H 1RHHB 1I1FB 3MXVL 4P5TB 2VXVH 4NO0B 3ULVF 4L4VE 4ZOAA 4EKXA 4O4YL 3IDXH 1KB5A 5E8OB 5GS3A 4S1SH 3FRPA 5BW7C 3K2UH 1VKXA 3AFLA 4MAYC 2HVJA 2CIKA 3OKMA 4K8RL 4PRPA 2Y6SC 5IJVA 1DBKL 3RWGA 2JB5L 2BERA 1ERNA 3A6CH 1CDJA 4HUUB 4I0KA 4U0QB 5GRXG 3C60D 4Z7VA 4FFZH 5D1QD 8FABA 3BH9A 3BGMA 3H3BC 5K59F 2N56A 5JIKA 3B5GA 1EHLH 1NFDA 1OAKH 2NY3B 4HUNB 4GKOA 3VGAB 1UGNA 1YEGL 3CLEH 4I9WE 4QXGL 1UKQA 2WIIA 1BIHA 2VL4A 1EFXA 4U6YA 5C0EB 2A9NL 2EKSB 1YA5A 3OKNB 5K9OA 3R06A 1KEML 5DUPH 1CGSL 2XWJB 2I24N 3DETC 3JTSA 1MHEA 5E2UH 3CDGA 1TZGH 4Y89A 1U9KA 4G7YH 1DSFL 3LD8B 2YBRB 2JLLA 1WCBA 2A0LD 1T80A 3S5LB 5F7EL 3U0TA 4PRHB 5GRUL 4Y4KA 4PD4K 3MV7A 2MQCA 4UV7L 1OAYL 3ZDYE 5ILTH 3L3IA 3S88H 4WDIB 1QA9B 3RA7H 3H9SB 2AEPH 5TH2B 3W0WB 2MOVA 5ICXA 1ZT7A 2BNRD 4JQXA 1G0XA 2WWMC 3DVNA 4YEFA 3NGBC 4MA7L 3REWB 5ADOL 1R0AL 3RGVC 4AH2A 1N2RA 4LEOA 1AY1H 3KR3L 2J5LC 1A4JA 5DJXB 3HNTH 2OP4L 3NMEA 2J7LA 3GMMA 5EOTB 4JN1H 4H26B 1FG2A 4TVPD 2JJTC 3ARXA 5MENE 5DZOA 1CLYH 4OT1L 3CXDL 2H9GB 3VH8G 5T1MA 1QR4A 2BVPA 3AREA 5D7LB 5CFHA 4Y16B 1KCRL 3PL6A 4R3SB 1YNLH 1BQHA 1CDYA 5BO1L 4AM0B 3C5JB 1K4CB 4YAQB 2AJ3B 1G1YA 5C0CE 1J1XL 4L29A 3QH3B 4JCLA 5J1AA 5HHVL 2H1PH 3MRNA 4XB7A 1QKZH 1EDQA 3MGTA 4HV8B 2CK0H 3ZHLA 5IHUL 1OLLA 1ZHKB 3I2CH 1TVBA 5ABDE 3ZLQC 3RUGF 5KSVA 5C09E 3BZFA 5J89A 3ALXA 3O6FC 1VADB 4F7EB 5JW3L 1IGYA 4IRJA 1X7QB 2C1PB 4O2FB 1P53A 4N9OB 4GSDH 5KS9B 3V9FA 4LSTH 1X6NA 4R4ND 1UWEL 3GSWA 3PP3K 3SE3C 5I75B 4M9OA 3MUGA 2WM0A 1T03L 1KC5H 2H3NB 5IK3B 5AAWA 2BCKA 1CQYA 5ERWA 2NX5B 1A9EB 2R1YB 3OKLB 3VFOA 3B2UD 3HC4L 2FEEI 2WWKO 1MOEA 2V2TA 2A38A 1I1FA 2Z0BA 1LEIB 1VPOH 1G0DA 2AJVL 2W0KA 1YPZB 2D9QB 3O3UN 2AV1B 1D9KC 2FNBA 4NRYB 5E8OA 3C08H 2QHRH 3LS5L 1U8NB 4XVTL 2JCCA 1I7RB 2QADD 1FAIH 3U0PA 4JANA 1NAKL 1U93A 4HUMB 4ZDHB 1G6RA 4XPGH 2X40A 1II4E 4UU9B 5KVDH 5DRNB 3BQUA 1XGYH 1NGWA 2DWEA 1DZBA 2FB4H 2OL3L 2AEWA 5FOBB 3BPOC 4HUUA 4XX1G 4F3FB 2QSVA 4HJJH 2XTJB 3T0DA 4NN5C 5DQJB 5DJYB 1N8ZB 1F5WA 2RHEA 4G6JH 1JZ3A 3HNSH 3MACH 4X9GA 4DVRL 4OLEA 2F54D 4L8SC 4O2CB 4X5XB 1IAOB 1X5XA 4FQPA 3ZTJH 1NANI 5E70A 3TCLB 1JJUA 1JTTA 5T3XD 1K5NB 4LQFL 3S3JA 2Y36L 5I8KH 2W0PA 3OWEA 2EKSA 1XCQB 3OKNA 1EIBA 1L4IA 4NN6B 4OQTH 4M93B 4OLWL 1RVFL 3MOBL 3PGFL 3O6ML 4OV5B 4OZFH 2VDKL 1Q9WB 4I77L 2I60L 1H3TA 4YHIA 1RIVL 3H8NA 2YBRA 5IP4A 5C6TH 1L7TL 5EC2B 1A7OL 4M5YL 4MCZB 2YA2A 4NO5B 3HI5H 4PRHA 3VW3H 2R4SL 4PJFE 2PXYB 1T0NB 4WDIA 3DUUB 5MERA 2QKIB 4P4KC 3AC0A 4ETQA 5TH2A 5AG8A 3LHPL 5BVJB 1NCCH 4PJXE 3MZTA 1IGML 5FV1L 3L3OB 1MLCB 1E6JL 3KJ6L 4OIIL 4Y2DB 3REWA 1G7JA 3ARFD 2DTMH 2VXVL 3FOMB 3QA3B 1EJOH 3GMOA 3MUZ1 3IDXL 5FM5M 2CJUH 5IV2B 2VZVA 1JPSH 1KTLB 3UX9B 5CIPA 4X6FB 3L1OL 4ORGB 5DVLA 5EOTA 4H26A 1NLBH 5KOMC 2VDNH 1S9VB 4HIEB 5LXGH 5JOPE 2H9GA 4ONFH 5D7LA 3HTLX 3QT2A 3RWCB 1CFNB 5J3HD 4R3SA 3FFDB 5EBWA 1FZKB 3WIHH 3SOBH 2IQAB 3JZ7A 3Q3GB 2VLMD 1A7BA 3ZE2E 2KQMA 4OD2B 5JTWA 2FBJL 4QGYA 1ZANH 1YMME 4DVBB 4X7TB 3W9DB 1EHLL 1A14H 1OAKL 4KC3B 4HV8A 4BH7B 5HYEA 4U6XB 3DTXB 5DA0B 1ZHKA 3B6SB 2VLKD 1OT2A 4JCMA 2FX9L 3G6DH 4U33A 4BZ1H 2IBGA 4P5TC 4PTUB 1KXQE 2C1PA 4O2FA 2E7LC 5DUPL 4GKSA 3CSBA 5KS9A 2OL3B 4PJCE 4QWWC 2DTSA 5MENB 3O11A 2YD7A 2GKIA 1PZUB 5E2UL 3WYRA 3ETBF 1PY4A 4G7YL 2P7TA 3DECA 2H3NA 3G9VA 5IK3A 1EERB 5AZEL 1A9EA 3RVVC 1DP0A 4GKNB 1B90A 3VXOA 5MEOB 1PSKL 4MX7A 1IL1B 2C4FT 1LEIA 3N9GL 3GSOA 1ZS8B 3EYFB 3S88L 1T4KB 3RA7L 5C0CB 2VLME 5A2IH 2AV1A 1INQB 3SCMB 1YEEL 2AEPL 2Q86B 1FZOB 4RGND 3CXHK 1N6QH 2B0SH 1EAJA 2NY3C 2R0ZH 2CK2A 4B50A 4U1IA 3VGAC 1UACH 4KJWD 1R5IB 3CK0H 4OZHE 5C09B 4AT6B 1LO2H 3MRGA 1AY1L 1DLFL 4HK0B 5DRNA 1NCUA 4DEPB 5C0JA 1ROWA 5DJ6B 3OKKA 5ESAB 4JN1L 5D1ZA 4S11A 4N9GB 5KANI 2HN7B 5DJYA 3QJHB 3WXWH 5BRZE 1DL7H 1CLYL 1N8ZA 1J8HE 4FA8A 1RUML 3LD8C 5DJAA 3IDIB 1FCGA 1C5CL 4HXAL 4AENA 3TBTA 4O2CA 4X5XA 1KLFA 1TQCB 1IAOA 3BN3B 1NBVH 1A6VH 3TCLA 1YNLL 4Z7WE 3B9AA 1X5ZA 4AEHH 3VGBA 5A3IC 2XY1A 1XCQA 4DGIH 1S78D 1TNNA 4ENED 3FT4B 3AUVA 1U3ZA 3IDYB 4JFOA 5DF0A 5FGBA 4OV5A 1WLHA 5A2JH 1ZV5A 3HS0B 2A6IB 2XKUA 1DLHB 4BSWB 4CRPA 5E08H 3ARBC 5EC2A 4MCZA 1JL8A 4NO5A 2D7MA 2DQCH 4F7TB 3HPLB 2Y25A 4GSDL 1HINH 4U2ZA 4LSTL 5LG1A 4OGXL 3DUUA 1F90H 1CGTA 4X7EC 3V4PH 1KC5L 3FT3B 1BQUA 1KIRA 3SGDI 1JUFA 1BGXH 1HHGB 3UTTE 3DX8B 3FQTA 3L3OA 1S9YB 4Y16C 4I3RH 3ILQD 2FZ3B 4Y2DA 1DUYB 2NY0D 2XG5A 2MMXA 1VPOL 4LCYB 3FOMA 4FFYH 5DK0B 2MQ3A 4U0RB 5SWQB 2YZ8A 3GBLA 3MV11 1MJJA 4KUZL 1HEZA 1ZLWH 2OTWB 1U42A 3QNYA 1FAIL 3P0GB 5SV4A 3D0LA 4ZUUB 3G6JE 2CRZA 1P4LB 1A64A 3UBXB 2XQYG 3WN5B 3Q5YA 4WFFE 4JFPB 3BZEB 1XGYL 3RWCA 1CFNA 2R69H 4JPWH 1ZEAH 1FZKA 3EYUH 2IQAA 4NRZB 1REIA 4HJJL 2H6PA 2APVA 2VZ3A 4XRCA 5C0FB 4NC0B 4OB5H 5JNYB 2FATH 4DVBA 3ARDB 4PJXB 4G6JL 3W9DA 2BHYA 3MACL 4WVRA 2XZZA 1VACB 2W0FB 4BH7A 2D4FA 4PJ5D 5D2LF 3DTXA 3B6SA 3QEUB 2HRPL 4KH2A 1TQBB 4DN4L 1HHJB 3PGDB 4PTUA 5AYUH 4JO1H 2IBBA 3RX8A 4LPVA 4NC1C 3L3DB 2OL3A 3NABH 1ZVYA 2W07A 4L3EA 3PF2A 5CBEB 5A16A 1UZ8A 4D9RD 1OD9A 1HCVA 5C6TL 1I1AB 2W9EH 3BMWA 3V0AC 2PF6A 3HI5L 4XP6H 5MEOA 1NEUA 3EOAB 2H2SD 3BD4A 4H0HB 3VW3L 1AGFB 1GPOH 1ZS8A 3EYFA 3NIDE 1T4KA 4PG2A 4YHOH 2XTJC 1JP5A 1YMMB 1GC1C 5IBLC 1INQA 3MO1A 4JB9H 4OIBA 4U1SB 2Q86A 1NCCL 3PWPA 2M26A 4MJIE 1I1CA 1RUAH 4NSKA 4QRQA 4YDIH 2DTML 2HTKC 2YD5A 3HI1B 3FQNB 4JZNA 1L9MA 1UZ6F 4NIKB 3X3FH 5DFVD 4HK0A 1EJOL 1A6WH 2DQGH 1XR9B 2EICA 1VESA 3B3IA 4DUVA 1JPSL 5ANMA 5B3NA 2P47B 5DJ6A 5D4QA 5ESAA 4M93C 3WFDL 5JXED 2A6KA 1NLBL 1YY9D 2NY2B 2Z93A 1TLKA 5LXGL 1VFAB 4F37F 5IQ9B 2H41A 2ZUQB 3IDIA 2GUOB 4MAUH 3TN0B 2DI8A 4YUEH 4D3CH 2NTFB 1WEJH 5F3BB 3SOBL 1N59B 3K8MA 4NOFA 1U95B 4NQVB 5MP6H 4KI5D 4Y88A 2PXYC 2DIJA 3FQRB 1J18A 3FT4A 1RIUL 5F97E 4HK3N 4CDGC 5FUOH 3JV5A 4F9LA 3D39A 4X6BA 4N1EA 4OZHB 4N1CA 1DLHA 2FECI 3EDKA 4BSWA 4Y2DC 3G6DL 3V52L 4K7PH 3O9WD 3H42H 1QFWM 1W8NA 5HDBE 3QIWD 4L3AA 3ES6B 5F7KC 1RK0B 5BRZB 4YDJB 3QUXD 1J8HB 1BLNB 1OQOA 1BF2A 4KMLB 2MHAA 1HHGA 3FQWB 3ARYA 4O51A 1BZ7A 4Z7WB 2Y1VA 1B4JH 3PABB 1A1OA 4XPHH 1IKNC 3O2WL 4LCYA 2HWZH 2D0GA 4FMFA 3PWJB 4E0RB 1UA6H 5SWQA 4FQIH 3QNXB 4N5UA 1ED3A 1N6QL 3TIEA 4U05A 3I02A 4YBHA 2V9RA 4HAFA 3F7YA 3X11B 3KPQB 2C7UB 1AXTL 4GXUM 1LO2L 3UBXA 3EJYD 3MGOB 5I0DA 4TTGA 3KAAA 2Q8AL 3BZEA 2MTPA 4OCYH 4Y1AE 5D70L 1D7FA 3GSVB 3EGSB 2AJUL 1VFOA 1EFXD 4P46A 2FGWH 3RWFB 1Z5LA 4Q7DA 3SBWA 4JFXA 3UTTB 5EFIB 4GLRH 1WSST 3T2NL 2G5BB 4M8QB 5SV3A 4GRWH 4K7FA 1NBVL 3GSQB 3INUL 3QEUA 3U4BH 4AEHL 4HUWB 4TPRH 2Q6WA 1HHJA 3PGDA 4DGIL 3ROOB 2CDFA 5F9OH 1B3JA 4M62L 3MXWH 2XA3A 3SCMC 3HCVB 2J8HA 4JREB 4Y4KD 3WIIH 1DANT 2HJFB 1YDPA 2Z8VC 4PLKC 5E08L 1I1AA 2CH8A 5CINH 1XF4B 2DM7A 1MELA 2DQCL 3ILPB 4NKIL 5E9DD 3CU1A 4DEPC 3OAUL 3EOAA 5EN2B 5KAQF 3VFPB 1AGFA 1HINL 2OSLB 3LS4L 4XVSH 5FGRA 1KBGH 3PHSA 4RMWA 1F90L 1BQLH 2CRMA 2LU4A 3V4PL 5L88H 3Q1SH 3WUWB 3VRLE 1BGXL 3MLTB 3U46B 1A3RH 2ZUXA 4JDVB 4NQDA 3MA9H 1TQCC 4I3RL 5E4EB 2A77L 2DN7A 1W0WA 4EI5A 5EORL 3OJ2C 3DV4B 2A9MH 2IBZY 1XR9A 3NFPB 4FFYL 3ARED 1EO8H 3CFJA 4WHTA 3PL6D 3WJLA 1D5BB 1A6ZB 1FQ9C 4Z7UE 4LF3B 1AXSA 3S37H 1NQBA 3V7AE 2JELH 5IQ9A 4KJPD 3RX5A 4MB4A 5HVFB 2GUOA 1RULH 1FVDA 3ZSTA 3ZE0E 2R69L 4JPWL 5F3BA 1ZEAL 3EYUL 1N59A 5J0BA 2XQBH 4NQVA 2PO6C 4M61B 1QPPA 3ULVH 2VXTH 4HKZB 3SKOB 5C08E 2VRAA 2W60A 4IRJD 4MJIB 1RJYB 4PYHA 4P2QA 2Z35B 5CEZH 5F7NC 1JPST 4HX1A 4J3VA 4PJBE 3B2UC 5JO5A 1FSKB 1UXWB 2OQJA 4KDTC 3B5TA 2EDRA 5AYUL 1GGCH 2UY6A 1OSPH 4NZUH 4Q9RH 4KJQC 4YC2C 3HZVA 4TNVK 3K4DA 5CBAA 3ES6A 4JQIL 1RK0A 1CI5A 5ITBL 3CDCA 4K9EH 4YDJA 1J8HA 3IFNL 4KK6C 2C1OB 1U3JA 4HWZA 5DJ0B 3WN5C 4XP6L 3PABA 1I9IL 4Z7OE 5DI8A 1GPOL 2A1WH 3LOWA 4BFIB 4M6OH 5HYJE 1T1ZB 4YHOL 2OX5A 3MA7A 3PWJA 3G9AB 3BQUD 1B6DA 1T0MB 4JB9L 1BZQK 1IGJA 1V8HA 1UM5H 3ARDC 2EDXA 2BMKB 1Q9LB 4G8GE 1BOYA 2BSED 3RL2B 3X11A 2EE2A 2C7UA 4YDIL 1XF2B 3MGOA 5T3ZH 1TQBC 4JHZA 4O58H 1AR2A 4S0TD 3OR7B 1M05B 2AABH 3GSVA 3I6LD 4UZGA 2R4RH 4N0CC 1QLEH 4WUKL 4OCSH 5EFIA 3RNQA 2D7TL 4PRNA 3RI5K 4JY6B 1I1AC 43C9B 4MAUL 5DQ9B 5GPRA 3SE4A 4YUEL 4D3CL 4JFDE 1ND0A 4Z8FH 1A1MA 3GSQA 4BKLB 1ADQH 1PZ5A 4GRWE 4LLVB 3SGKC 4WO4B 2C3XA 4C57C 4NZRH 1NC4A 3FCTB 3GMNB 2WQ8A 3ROOA 2YKLH 3M17B 2VQTA 2EEBA 3HCVA 1T66C 4PRHD 5A2KH 5FUOL 1MJ8L 2HJFA 4RIRB 1MHPL 4Q0XH 1CLOH 4MMXC 4JLRB 2HFGH 4ZNCD 5D5MA 3QXAB 3S98A 3MLUH 4J7RA 3B43A 1HSBA 1K9TA 5D6DC 3RWHB 5IVNA 3BEWA 4OUOA 4WEUD 4S1QH 4U1KB 4JPKH 3H42L 1G1CA 3OR6B 1GZQB 1U3HD 4Y1AB 4CGTA 3LKOA 3VFPA 1F45A 2UUDK 3IGAA 3VFMA 2OK0H 2YC1B 1BD2A 2GAZA 4KROD 3AM8C 3I6LE 1MHCA 3EYSH 3NZHL 4P3CH 3RY4A 2V2XB 1JI2A 3HRZB 3WUWA 4LMQE 2GSGA 3KPRE 5FYLD 4EIZC 3TN0C 4HFUH 3KPSD 2DQUH 1WIOA 2GW5A 4XPHL 5HHNA 2CLZB 3O3EB 2DLTA 4TTDD 3DV4A 4I0PA 5I9QC 1RJCA 3NFPA 3HUJE 3F7VA 1UA6L 4X6DA 4XP5L 4Z7QE 1D5BA 1KENL 3MRBA 2F8VA 4LF3A 1JMZA 3CX5J 3QDAA 1KJ2L 2R2EA 3FB6B 5GZNC 1A7NH 5HHMD 2F8OA 1OT1A 4K71B 3AGVA 5D7JA 1I3VA 5CKAA 3WFBH 5IVZA 1LNUA 1MIML 3OKDB 2FGWL 3SKOA 4BELD 5C8JA 4K8RD 1C16B 4FZEL 5J6HA 5D7IF 5DZNA 3ULVE 2YUZA 4ZFGH 5H94A 1ZHNB 1RJYA 12E8H 1EPFA 5I15H 1BJMA 3GKWH 2Z35A 5DS8B 1P69B 4X9IA 4EN3D 3L7FB 5CEZE 1E27B 3KPSE 2ENSA 2RQ8A 4HIHA 4M00A 1OM3H 1B0GB 1JYXA 3VXSA 3G5YA 3P9LB 1G7HA 4LNRB 2HT4D 5KSUA 1FFQA 2ZCLH 4DQOH 4IDJH 5DJ0A 5CINL 2FL5B 2JJUA 2FDBP 4HPOL 4MSWB 3E2HB 2FJGB 1J0ZA 1Q9KB 2XICA 3SKNB 2JTDA 1NCAL 2IH3B 4XVSL 3NFNA 3ULUL 5C08B 1S7UA 1T1ZA 1KBGL 4G6FB 1KJ3L 2CKBL 3ALWA 4HH9A 4LSUH 1BQLL 4YHMH 4YBQC 1QP1A 2NXYB 4LSSH 1UG9A 4TVSa 2BMKA 1Q9LA 1A3RL 5IFAL 3PNWB 4P3DA 1HKLH 3CC5A 5D1ZD 4F15C 1JIBA 3TGXA 1CICA 4P4RB 1GZPB 4GW1B 4DKDC 3IF1A 4OFIA 2EIDA 4HJGB 2GI7A 4CAGA 3OR7A 1I4FB 5T3ZE 2VLRD 3OZ9H 2ED7A 1H3GA 4ENEC 2OJZL 4LCCC 4OKVA 3CVIL 4PPTA 4JFFD 2ZPKL 3S37L 4NT6B 4F80A 4I18B 1L6ZA 2JELL 3L3KA 1WK0A 4LPCA 1E28A 1RULL 4LLDB 4Y5XC 4BKLA 2NYYC 1D5IH 2YMXH 2IH1B 3OKYA 4FMKA 3EDEA 1EGJH 3QXDA 5HYJB 4HSQA 3FCTA 1TCRB 4LLMB 5EIVA 4NKMA 3ULVL 2D03H 3DVIA 4H25A 4UIMA 3ZYJA 4G8GB 4RIRA 3SKUD 5IMKB 3CH1B 1S7TB 3ZDZF 2YN3A 4MNGE 5FGCE 1KJ2B 5E4EC 1J0HA 3ILQC 2IALB 3DV6B 3SKMB 3C5ZA 1OSPL 1EA9C 1GZQA 3UPRB 1JWUB 5IB2B 1DQQB 1MJUH 4LRIC 4ACPA 2VLRE 5EO9A 2ZUWA 2YOCA 5TE7H 5MHSE 4K9EL 2DJUA 3MX0A 2C4FU 4JFFE 3P11H 2XPGB 3ARQA 3MFFB 5JIHA 4JFDB 2QSCH 2V2WB 2DQEH 1OSZB 3BP7B 4GRWB 2DL9A 2J12B 3IDJB 4PJIF 3O3EA 2A1WL 4X6EB 4QHLB 3VFSA 4U3XA 1I3RA 1BVLB 1MCSA 3VFRB 4OFYA 4XGZB 3W5NA 1A2YA 3K0WA 1I8IB 1NC2D 1UB5B 3BN9D 4G8IB 4NHCH 1MPAH 1ETZB 3EYQC 5GGQH 4TUOB 3GIVB 1Z9LA 3IKCA 4OFPA 5T3ZL 3D5OF 3AU1B 1MFAH 4O58L 4EEEA 2GITA 3UTQA 3VMOA 2EXWD 5IOPB 1C5BH 1KNOB 4XPBH 1GGTA 5HGDB 4F2MB 5J11B 3MRMB 4ELKA 4OCXH 3EJZD 5M94B 3MV9D 1ZA6B 3O2DH 5LAXB 1C16A 2YK1L 4PY7A 3O6LL 1QLEL 4OCSL 4LLAA 5BV7H 3KPRB 4LSDA 5B38B 4CVXB 1ZHNA 3MCKB 4PP1C 5DS8A 4L3ED 4Z8FL 3MR9B 4PRIA 5LKNA 2GY5A 3L7FA 2EDTA 1G9NL 1E27A 4NZRL 5KVGH 4ZNEA 3LY6A 2R2CA 1B0GA 2YKLL 3EOBB 3X17A 4JRYA 1KIPA 3SKJL 4HZLB 3P9LA 1Z9MA 4YXKH 4Q0XL 3TBVA 5IB3B 3FO2B 2HFGL 4MLSA 4HUKB 3MLUL 4LPXA 3WL9A 5DDHB 3FONB 3PWPD 3BFOA 5DFVC 4MSWA 1QVOB 2OR9H 2XG4A 4PJ9D 5JXEC 3TVMD 3WNMA 3EYSL 4P3CL 5HDLA 3GFUA 5C0IB 1I9JH 3U7WL 5DLML 1BVKB 4JN2B 5A2FA 4KY1H 4MXVF 3PNWA 1B0RA 4HFUL 4ZODA 5TPWH 1LO0H 2DQUL 3ZYZA 4GG6F 4NQSA 2LV4A 5L7XL 3HB3C 4WO4C 1QEWA 3OB0K 3SY0A 4HJGA 4XHJD 5IM7A 4YHNB 1LDSA 5DEGA 4CVUA 3JVGA 4KDVA 3QZWG 3EO9H 4FQ1H 4LOUD 1LO4H 1NCDH 3MMEB 2JB6B 4NT6A 3RWDB 5GRYA 3QO1B 1F02I 3LIZL 1BF8A 3TZVB 4IJ3B 3E6HB 1XGUA 3O0RH 4GAFB 4PREB 3IAQA 2Z8WC 4JHWL 3O9WC 5CKGA 1JPTH 3D39D 4GO6B 1OARH 1MSPA 1AFVH 1CDGA 3VWKB 4L3CA 3ELAT 3QIWC 1TJHH 4NO2A 3J8F7 4LLMA 4YPGB 3WFBL 1I1YB 4YFLF 4QRPE 5HDOA 1PX3A 2MFNA 1IC4H 3WSQH 1ZT1B 2VDPH 4Y19E 4P2RE 3VD7A 5I15L 12E8L 3CH1A 2EIZB 2WIMA 1MRDH 1RZKH 1S7TA 4QEGA 1DDHB 2G2RB 4MHHG 2ENYA 1KJ2A 3CSYB 4L8DA 5KVMC 4WEBH 3DV6A 3IRZA 3THMH 4RRPA 5GS0D 1PKQA 4X4ME 1D6EB 1OM3L 3UPRA 1JWUA 1DQQA 2GJZA 4L4TE 2PR4L 3TWCH 3PWLA 1XIWA 3D3VD 3S7GA 2ZCLL 4DQOL 2ADGB 4IDJL 2XWBB 4UOW0 5D9SA 5T1DH 5ETUB 1QSFA 4K71C 3VXRA 4XVUD 3MJ8A 4E42A 4YIQB 3IDJA 3IDNB 4JFYA 4LAQH 2L4OA 4QHLA 4X6EA 1BVLA 1IZJA 1P84J 1PX4A 3V4UH 3VMPA 4LSUL 5DMGD 4MA8L 4XGZA 1QSEE 4YHML 1OAXH 1I8IA 4LSSL 5E8PA 1ETZA 1N6UA 5FGCB 3FRUA 1HKLL 4MJ2A 5DXWA 1IAIL 1JHKH 2R15A 5I1IH 4P46D 4TUOA 3TJEL 3RJQB 1MREL 1L6XA 3GIVA 4JM2A 1LHZA 5CP7B 2Y07H 2KZWA 1JGVL 3VRIA 1HK6A 5ALBH 1Z2KA 1KNOA 3OZ9L 4F2MA 6CGTA 3MRMA 1X5GA 1KYOK 1VGEH 4HUVB 5LAXA 1P4BH 5F8QC 4MVBC 2CKBA 4AJ0A 4S10A 1KB9K 5CEYB 4CVXA 4WY7L 5HHOA 2EDYA 1ZVHA 2XWTA 4MDJB 5E00A 4MXWL 4Z77A 1D5IL 2YMXL 2RFXB 1ZTXH 3E2HC 3QUZC 1EGJL 3A6BH 3RUGB 2F5AL 4KK8D 4PB0H 4UQ2B 2D03L 3LRSB 3MV8E 2QHLA 4N8VB 5B8CB 3DNKA 3FZUD 1ZMYA 1IQDB 2NXYC 3AS2A 2OYPA 5IB3A 5DFTA 1UM6H 5KZCB 2B20A 2WBJA 4ZXBB 32C2B 1QFWH 3PXHA 5DDHA 1MLBB 1PG7L 1A6TB 3PDGA 4NQDD 4Y4FA 1HKFA 5D8JH 1MJUL 2VXSL 4GRLB 2V7HA 3W11D 4UNVA 5TE7L 4B0MM 3PWNB 3BYTA 2OTPA 3PQYE 4EI5D 3BOVA 4N8PA 1U92B 4QRUB 3VXQB 3P11L 4I18C 1MCRA 3CCHB 5C0IA 3VH8B 1BVKA 4D94A 2CGRH 2XACC 2QSCL 3UYRH 2DQEL 4ONHA 5F9DC 3RPIA 4U1LB 4FQJH 4J2XA 5B3JF 5JMRA 3BH8B 3T2QA 4IOIB 4PLNC 5KG9B 1Y6KR 3RVWD 3C2AL 4JO2H 1RAMA 4YHNA 5D71H 3STZB 2DD8H 2P5WB 1N64H 3F62A 2B1AH 1IJ9A 1FVCB 1MPAL 2JB6A 3QEHA 3QQ9D 5GGQL 3GRWL 4OF3A 3QO1A 2VC2L 5FCUH 4XI5D 3E6HA 1MFAL 1JF6A 2WMPA 4P2QD 1F2QA 3MQIA 4YX2H 1C5BL 2C3HA 3DRTB 3IXTA 3VWKA 3IRPX 3IS0X 1M7DB 1ZHLB 3RBGA 3X3GL 4PUBH 4K55A 5DJ8A 4TN9A 4PY8I 4QRRA 4AK1A 5AEAA 5F44A 1INEH 1ZT1A 4OBSA 5C9JA 1WZMA 3IXAA 1ACYH 4MNHA 5EU6A 2P8PB 4R6UA 4JFHD 1MVUB 1JZ5A 4JFED 2VB5A 2EEDA 5FKAA 4PJ8A 4OCRH 1DANU 2GTWB 5HDQH 3SDYH 3OXRB 1D6EA 3SN6N 3F58H 2VKWA 2B5IC 1NCBH 1YJDH 1CZ8H 3G08A 4XZUB 1IE5A 4RMUA 1F00I 1IZKA 5C07A 1T04B 3BXNA 2ADGA 3BDXA 2WZPD 3UC0H 2XWBA 3EO1B 5T5NG 3BHBB 4U6VH 4PJAF 5K9QG 1YN7B 1FAKT 1E4XH 2AERT 2HLFD 4HMDA 1UH4A 2OR9L 4QRPB 5J11C 1H8NA 5IVXE 4GRMB 2ZCHL 2GT9B 4WFED 1H3XA 2FO4A 2XN9E 4KMTH 4Y19B 3KYNB 4P2RB 3QFDB 1PG7W 4PLJD 4E41B 1O7SA 4NDMA 2EDFA 3MJGX 5TPWL 3H7BB 2YPVH 3NIFF 3JWNC 4UDUB 3SDDB 5DMKB 3HPJB 1UJ3A 4L4TB 2B1HH 3I3EA 3EO9L 1LO4L 4OAWB 4EDWH 1QLRA 2ZUTA 4HUVA 4BFGA 1V3MA 5FECA 1NC4D 2YEZB 1X5IA 1HXMA 1LO5B 5HJ3B 5J1SC 1JF1A 3VXNB 5CEYA 1IARB 4MDJA 3MRDA 5T33H 1JPTL 4M7JH 2RFXA 2NY1D 1AFVL 1U3HC 5DVKA 3U79A 3RUGA 3D48R 1PQZB 2B2XH 4FABH 1N3NB 3LRSA 1QSEB 1R24A 1IC4L 1UZ6E 1N7MH 3HN3A 4JZOA 3WSQL 5B8CA 7FABH 4MCYA 3ULVC 2OZ4H 4ZUVB 1I7UA 1MRDL 1ZHBA 4CN4A 1BD2D 3T0WA 4P2OD 4V1DE 5LGKA 2DICA 32C2A 3LB6C 1IEBA 1MLBA 3THML 2APTA 3MNVA 3PHOB 1AHWC 3LN4B 1HYRC 3ARGA 4WJ5A 4GXUN 3TWCL 3K1KC 2GTZB 1FO0H 3WNKA 1TETH 1MFBL 4I0PD 3VXQA 5FHBL 5IW6B 1IM3A 3W81A 4K9EC 3CCHA 1BWMA 3VJ6A 3V2AR 5BV7B 3TZVC 4IJ3C 4WY7H 1H3VA 2WINB 4X4ZA 4LAQL 3BH8A 4IOIA 5KG9A 1MUJB 4UB0H 1JF5A 4OLYH 3P4MA 3V4UL 4PRDB 3REVA 3OG6B 5D7JD 3P30H 2P5WA 1JWSB 1XGQA 3AB0B 5CD3B 2Y23A 1FNSL 1EO5A 3MRLB 3OSKA 1MRFH 1JHKL 4QHKI 1S9KC 1DR9A 3L3HA 3TBSA 4EN3C 4U6HA 2M8XA 1BOGA 1BVZA 5ALBL 3WXVH 2F19H 3EYOB 4NYLA 3DRTA 1M7DA 3PQYB 4OTXL 1IT9H 1I75A 1VGEL 1NMBH 5C6WH 3UZQA 2VL5B 4XPAH 3D85B 1MFEH 2HT4C 5I1AB 4QY8B 1HHHB 5IB1A 3VXSD 4Y5VB 5MEQB 4CMHC 3CZJA 4PB9L 5HGGS 4ZD3H 1MVUA 4YXHH 2LAAA 4YBLB 1ZTXL 3FTGB 5BJTA 5JORB 5ITFB 1WT5A 5DVNA 1CD0A 3A6BL 2GTWA 2MQ0A 2YD8A 2BHZA 2CLRB 4GT7A 1JK8B 5E2JA 4OLVH 4Z5RB 4PR5B 4J12A 1A1NB 1T1YA 1Y0LB 2IANE 4HIIB 4JE4B 3EKCA 1HWGB 2QL1A 2ATPB 3FB7B 3ET9F 1YYLH 2IJ0C 3QCUH 1JV5B 4MZ3A 1JZ8A 1QFWL 4GAGH 3EO1A 4NKDB 1HQ4B 3BHBA 3CDFA 2OJEB 2DLFH 5D8JL 1FGVL 1XMWA 2IAMB 2OR7A 4H8WH 4ZS6D 4UT9H 4GRMA 2Y06H 4OD3H 1CICD 2GT9A 1IGCL 3BUTA 3OHXB 5IEHB 3QNZA 1HILB 1A7PL 4E41A 1Q72H 4G6AC 1QQDB 4FQJL 3LDBC 3LKRA 4EOWH 3H7BA 1WBYB 2Z4QB 2VTFA 2DBLH 4N0YH 4UDUA 2JIXD 5DMKA 2DB8A 2H26A 2X05A 3ZKNC 3W9EB 4A6YH 4JO2L 4GBXB 1CL7I 3RDTD 5D71L 5B8CC 2DD8L 5DR5H 1CDUA 2V6HA 3CGTA 3NCEB 4ZYKA 1TFHA 3CX2A 4JQVA 1LO5A 2YWZA 5FCUL 1A7RH 4ZXBC 5EO1A 4AQOA 4Y4HD 3HG1A 4GMSH 4TOYH 1X5HA 2PETA 4PGCA 1WV7T 2CPCA 3GK8H 1UFUA 5D2LB 4TNVF 3R4DA 5ICYB 2XN9B 4FQXB 2RJMA 1PQZA 4GRLC 1LE9B 2X4PB 1AJ7H 4MD5B 4Q6IB 1INEL 3C5ZD 1GIGL 3LQMA 4JY5H 1MCPL 1SEBB 2GSIB 2FO1A 3PXJA 4JFZL 1F4WH 2NR6C 4LHQB 1W0VB 3GRWA 4GXVH 4R2GD 4YFDB 3B4NA 1LO3H 1PGRB 4PGDA 3PHOA 1UYWH 3HLAA 3LN4A 4YGAB 4LASH 3VI4F 4LHUG 4LKCB 3SE8H 3F58L 3MLWL 1U8KA 3UJJH 5EBLA 2IMNA 3EOTH 1CZ8L 3BN9C 3UZVB 2GTZA 3N0PB 1BAFL 4F7MB 5IW6A 3DJ9A 3H9ZA 4PJGA 4OFYD 3UC0L 2E7BA 1EEQA 5L9DH 4OZIE 4U6VL 1EVUA 4WFHD 2EXWC 2OTUB 3TPKA 5E5MB 1E4XL 4WU5A 4PJDF 1MUJA 3F12A 2ZJSH 4FG6C 4LSRH 4KMTL 3JUZA 2HTLD 5I76A 1VEPA 4AL8H 1JWSA 1QRKA 2H2PD 4NCC2 5CD3A 5EU5A 3L5IA 3RI5F 5D72H 1YPZF 4LLUB 5GIRB 4V1DB 2D7OA 1CXEA 4KMQA 5FAAA 3UAJD 2ZZUT 2YPVL 2NZ9D 1F58L 5ESQA 2VDRH 4R7NB 3QDHA 1EBPA 3NOIA 2DQJL 3WEXB 5FA4A 4LSVH 2B1HL 3DUSA 4HHAB 4IMKC 3PIQB 4PRID 3QDJB 5EZLB 4MQSB 4UNUA 2AK4A 4QY8A 3EHBC 1SM3L 4PJEF 3T0EE 4G3YH 4JRYD 4Y5VA 3TT1H 3B9KB 3U6RB 1NEZB 1ZE3C 3IT8D 4QCIB 4CU6A 4EIGB 4LIQH 4GLRI 3WE6B 5EO0B 2CLRA 1JK8A 2B2XL 1HH6B 1N7ML 5C92A 7FABL 1F4AA 2OZ4L 1A1NA 1Y0LA 4FQQB 4HIIA 4RFOL 5F70A 5DRXB 2JK5B 3HMXL 1H8SA 1WFUA 4G6FD 2ORBL 1I1RA 1JV5A 1P7HL 2D7NA 1WFNA 4X98B 4NNXB 1HQ4A 3QSKB 3SDDC 3WMSA 2A6JA 3S4SG 2OXGA 1PW3A 4G9FD 2IAMA 5HYSG 4LOUC 5HI3D 5F9WB 3PP3H 3OHXA 3DLQR 1HILA 3L5WA 4PLOB 1SBSL 1FYTE 1WBYA 3KDMA 4R7DA 4QYOB 3NA4A 1FV1B 4UB0L 4P48A 4OLYL 4AYFA 5IB4A 2R2BB 4HWBH 3LKNA 2Z9TA 1J1OL 5C0AD 2D7PA 3W9EA 3BGFB 2IANB 3HE7B 3P30L 5I18L 1EFQA 2EDEA 4P99A 3GBNH 4P23A 3TH4T 1CVSC 4ZQKA 5E8EA 4EDXB 3SEPA 1HI6B 4HT1H 4XCCL 4G8EB 5DRWB 5IHZB 4N5ED 1DN0A 1OTUC 2F19L 5D2LA 5EA0L 1NANH 4UQ3A 1UCBH 5ICYA 2MSPA 1MCWM 5AWNH 2ZOKB 2EDWA 2X4PA 4XPAL 4MD5A 5HI4D 3BP5B 2WBWB 3PP4H 1MFEL 1QFUL 1I8MB 5I1EH 3CLFH 3ZDYF 4OM1H 1NGQH 2X42A 3NTCL 2GSIA 5BV7C 1M4KA 3FFCD 4DZBB 1TMCB 4YXHL 4NBZB 4XVUC 1XIWD 4Z0BL 5CJBA 5SWZA 5C6PB 4OLVL 1TVHB 3NCJL 4XXDA 4FTVB 4KK9C 4LKCA 4FS0A 4OGZA 4UMGA 1QSFD 3VXRD 1DBJL 4ELMF 1AE6H 4ISVA 3LPWA 5KVFH 5GRZA 3AB0C 5HHPB 1RY7B 4LU5H 4ZMAT 3QCUL 3OF6A 1H3PL 4GAGL 2I9LA 2EYRB 5D7IE 3ARPA 4WV1A 5FYKH 1BEYH 5K9KB 5C86A 2DLFL 3FN3A 5E5MA 4K3DH 4H8WL 1W72H 1JHTA 4UT9L 3FT2A 4OD3L 5A43C 4JM2D 4MJ4A 1GAFH 2I07B 1ZVSA 3MBXL 4X5WB 5B39B 4YZFF 1Q72L 4LLUA 5DURB 3ULUD 4NFCA 5L8KB 3FFCE 2OXHA 2DBLL 4YBLC 4G6ML 3WEXA 2HJLB 1OP5K 5T1LB 3QIBD 5HHOD 4CJ0A 1PFCA 4KKLD 2FH8A 4HHAA 4IRSD 4LGRB 4NRXB 5DR5L 2R2HA 2YPKA 5C0NC 3FZUC 3QDJA 5ACZB 4ZFFB 5EZLA 1GOHA 4UTBH 3RU8H 4F7CB 4C4KT 2ZKHH 2VE6B 3QIUB 1A7RL 3E0GA 4NGHH 2BVEA 3I75B 3WKML 3MFGB 3WFHB 2PUQT 3B9KA 3TP4A 4TOYL 2P8LB 3U6RA 5F6IB 1NEZA 4GKZB 4XH2B 1FFPB 4QCIA 1AGCA 3WE6A 2IAMC 2WBJD 5JHDA 3OXSB 1X5LA 1HH6A 4IIQC 4K94L 4LIQE 4QXUH 1EXUB 4NKQB 4Y4FD 4JY5L 5GS1A 4QO1A 1RZKC 3BKML 2ADJA 3RIAK 4NNXA 4C56E 5FO7B 4LASL 2IF7A 3SE8L 3GI8H 3VFNA 2NNAA 4GBXC 3UJJL 1N4XH 4LLYA 4NQCA 3HHRB 4PJ7F 3T0EB 4MYWB 2EXYC 4WWKB 3MROB 5DO2C 1K8DB 1ZXQA 1KLUB 1UWGL 2J6EH 5L9DL 2A83B 4HWEL 1FE8H 2NY6D 1KIQB 1OHQA 1FFNA 4KKBD 3VE0B 1CT8A 5EPMB 1CGYA 4QYOA 4PRAB 1FV1A 3ZDZE 5BCAA 4FQXC 3VD9A 4YR6A 2IANA 4Q6IC 1JI1A 4UV4H 2J8UF 3VWKD 4EDXA 5FA3B 2QSTA 4HKBA 2VDRL 3U4EA 2VIRB 3BDYH 4QRRD 2A6DB 1QHOA 5IW1B 1JGDA 2F8XC 5DRWA 1EMTH 1OGAE 2BP3A 3GHEH 4LSVL 5IHZA 3MLYH 5EU6D 2K3TA 3BAEH 5I8EB 2FHCA 3QUMH 3BVNB 4NJAH 4XP4L 1U3YA 1SJHB 25C8L 2NY4B 4JVWA 1G9EA 3MRPB 1S5HB 4PJ8D 1FIGL 5CZXD 2AEQH 2ZSWA 4P59H 4PJIE 5CGTA 1I8MA 4YEEA 4PJFF 1U8LA 4LHUA 1FDLH 3TT1L 3DSFH 5DHVH 1FYTB 4C83A 1KV3A 4DZBA 4XWGL 4PGEA 3SDAA 5E94B 1J0IA 5C07D 2QBWA 3ZKSD 4DAGH 3TIDB 1TZIA 2NW3B 2W91A 2C3VA 1AO7D 4FTVA 1ZWIA 1FC1A 4UILH 4A6YB 1YEJL 5I8CA 5EU7E 4EQ2A 5HHPA 3NCBB 2WLZA 4JGJA 5FYJH 2EYRA 3KYKH 1K8IB 3SGDH 3KPOA 2GK0A 1YUHB 1XT5A 2FEEL 5FYKE 5CWSB 4OBRA 4ZSOE 1C08B 2RAMA 3T4YA 2RIKA 1OWRM 5B39A 2YD1A 3T0XA 5TQ2H 3HMXA 3B9KC 5IMMB 2C5D<