4OEFA

Crystal structure analysis of fgf2-disaccharide (s6i2) complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'DPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 2
publication title Interactions that influence the binding of synthetic heparan sulfate based disaccharides to fibroblast growth factor-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4oefA00
3C9ZA 3UDAA 1P63A 3AJ5A 4I2SA 1AVWB 4I4PA 4LO2A 1VCLA 1JT7A 4QBCA 3BAOA 3S8JA 1NZKA 4QO3A 3CA6A 1S0CA 2MIBA 4DEPA 2HW9A 1WD4A 1BFFA 2VXTI 4L4IA 5BP5A 3WMVA 3VUOA 5BXSA 2Y9FA 2AAIB 1M2TB 2VU9A 4ZA3B 3N0KA 4ENDA 1BASA 4IZXA 3A07A 3B9UA 4IY9A 2HWMA 1TWEA 3HMYA 3AZVA 4JKXB 5BXRA 4EEEB 3QR5A 2Y9WC 1ISXA 3ZXDA 1HCEA 3T8SA 4XFUA 3OGGA 4OWLA 4JAWA 1T9FA 1S0EA 3V0AA 4LO7C 2BEBA 2L5XA 4KEJA 3NBNA 4IZEA 1N4KA 4EFQA 1DQGA 1F31A 1AXMA 1MC9A 4A7ZA 1HWMB 1XYFA 1I1EA 1BA7A 2D24A 4DENA 3I2XA 4OWKA 3FUOA 3R4UA 1EPWA 1ISVA 2J3PA 2LIQA 1II4A 3I29B 3N7JA 2Z48A 3HSMA 1G9DA 1I1BA 1AVUA 3OBTA 4J2SA 4J2XA 1ISYA 1XHBA 2F8XC 1BARA 4ISRA 3FJBA 3UD7A 3FGMA 5EHAA 1GGPB 3FJAA 6I1BA 5FZYA 1IRAX 1AFCA 4HR6C 4G9NA 5BXTA 2YUGA 3BB2A 3P6IA 2P23A 3FJIA 3N7LA 3Q7WA 2DS0A 3FJJA 1OQLB 4QD2B 3IM5A 4P0KA 4R6UB 4EKXB 3IM6A 3WINC 4X37A 3ZXGA 3K1XA 4LO0A 5F8YA 5DVHA 4EFRA 3E8LC 3O4CA 3PG0A 3JUTA 3CA3A 2HZ9A 5D63A 1Z0HA 3CA1A 1PZZA 3AKHA 2ESUA 2D7IA 4G9MA 3IIRA 3PUBA 1FV3A 1EYLA 2BFHA 2D44A 2P39A 3VT2A 3POKA 1IOBA 4IQPA 4F83A 1L2HA 2ET2A 3FJCA 4I4VA 1ABRB 1V6WA 4QALA 41BIA 1DZCA 4XFTA 4Z8SB 2NTDA 4I3NA 3BTAA 2D23A 2KI4A 3AH1A 1V6XA 2VXRA 4ISQA 3FJFA 2XOAA 1KNMA 1DIWA 1AVXB 1FMZA 3WMUA 4I7IA 1JT3A 4LO8B 4Q9GA 4P0LA 3P53A 4I4YA 1FWUA 1HCDA 3N7KA 3ZC9A 1IJTA 3I2AA 2D22A 1R8NA 3RMYA 3WA1A 3O3QA 4ZFUB 4USPA 3OJMA 1G9CA 4ZOTA 2X2SA 5EC5A 2F2FC 4H9WA 3AKIA 2M49A 2VUAA 1AVAC 1ILR1 1SR4C 4I6IA 3SNVA 4D8HA 4LO2C 4PC4A 4IHZA 2DREA 2KH2A 3WO3A 3BRFA 4I4OA 2D7RA 3BX1C 3P6JA 1WBCA 4LO3A 4D0ZA 2D1ZA 2VLCA 4G1RA 3W9TA 3A21A 5DSSB 1HWOB 3UJ0A 4JPZA 3H6SE 4WBCA 5BQUC 3O4DA 1W3AA 3Q7YA 5BXPA 4OEFA 1ISWA 1FV2A 1JT4A 2R9KB 3BAGA 5G00A 3UD9A 3V79C 1XZZA 3O4BA 1JLYA 1JT5A 3BAQA 3JRRA 5EG6C 3UD8A 3BAVA 1S0GA 4A7YA 5DZUA 1QQLA 1FGAA 3BRDA 4JKQA 4OW4A 2Q3NB 1YBIA 4LO7B 3FJEA 3VWCA 3H6RA 2K4AB 3F62B 1WBAA 4I1EA 1BLDA 3O44A 3CRGA 3ILAA 7I1BA 4KEIA 2RG9B 2I1BA 1HWNB 2NYYA 3CRHA 3H6RB 4P0JA 3S8KA 1PC8B 2Z49A 4QKSA 3NJ5A 4GP0A 4LO1A 2DRYA 1QXMA 1S0BA 1S0DA 1TFMB 2LIEA 1WD3A 4USOA 3MPPG 4QKRA 2DRZA 1FWVA 3WINA 4GOVA 3BRGC 1Z2VA 5E24E 2GO2A 21BIA 4II0A 2FFUA 4GOYA 4GP3A 2UUSA 3OGFA 2X2TA 3BA5A 3FJKA 4KC3A 3N7MA 5I1BA 1HKNA 3A22A 4AN6A 5FZZA 1IRPA 3FJHA 3UJ4A 2D20A 1BLAA 9ILBA 5F8SA 3D7WB 3TC2A 1T4QA 1W3GA 1S0FA 2ERMA 3RSJA 4I0YA 1YYNA 1J0SA 2VSEA 1DLLA 4I4SA 3VEQA 1Q1UA 1E0OA 4AN7B 2E4MC 3CA0A 4FVVA 3FFZA 1EV2A 4ZFYB 3EF2A 4ZBVB 3HBWA 2RSTA 3CA5A 4FGFA 4J2KA 3VSZA 4I4QA 2FGFA 4G6MA 3RMXA 4F34A 31BIA 1FQ9A 2K8RA 3HALA 1IT0A 4I4RA 4IYBA 2WRYA 4GAIA 1DQOA 1ISZA 3FJ8A 4QBVA 3BAHA 4Z9WB 4ZKTB 1PWAA 1BFCA 4OEGA 4I4XA 5HPZA 4KEKA 2MC2A 1FN0A 1SZ6B 3AKGA 3RTJB 3WO2A 3V0BA 3FJDA 1FMMS 4P6AA 8I1BA 1CE7B 2IHOA 1RY7A 2F2FA 1Q03A 1SR4A 1V6VA 1JLXA 1CVSA 1G9BA 4HA2A 3PMEA 2MLLB 1HWPB 3V0BB 1IHKA 4CJMA 1TWMA 3CU1B 4JQ0A 4X39A 3CAHA 3HOMA 5BP5C 3RTIB 5JLVA 3MALA 3ZX7A 2Q9XA 2NZ9A 5BQUA 1AF9A 1JTCA 1ITBA 3OJ2A 4I96A 1D0HA 4ZGRB 4JRAA 1BFGA 2KKIA 4I1BA 3BA4A 4A7KA 3CQAA 2ZR1B 4IY8A 2NM1A 3WO4A 4ZLBB 3CA4A 1QQKA 4ZFWB 3OBRA 1W3FA 4LO3C 1BFBA 1TIEA 1JQZA 3F1RA 3LLPA 4OUJA 1XG6A 2RQ9A 2WBCA 3HN1A 3O49A 2FDBM 4X3AA 3AJ6A 4J23B 3A23A 1YXWA 3IM7A 4HJJA 4I4UA 4D0TA 4EB2B 5BVPI 5FZUA 3Q7XA 2QN4A 1Q04A 3VT1A 3PHZA 2AXMA 3QYDA 1RMLA 1V6UA 4GAFA 1S0LA 3VSFA 1K5UA 4I8MA 2AFGA 1PUUB 3V0AB 1G9AA 3CRIA 5D61A 3NBDA 5F8WA 3VT0A 2AQZA 5FNWA 3IAGC 1DFQA 4IONA 4OWJA 1Z4SA 4QD2C 3NBEA 5F90A 2D43A 4Q91A 2NP0A 3AH2A 1YTOA 3O4AA 1TOOA 1ONKB 4DCKC 4EFPA 4XKIA 1RZOB 1EVTA 3LTQA 4LO1C 1TTUA 1G82A 4I37A 5D62A 1A8DA 5DUYA 1RG8A 1IILA 3BA7A 2BEAA 5BOWA 4OEEA 4QC4A 3O5WB 4H04A 1M16A 1R8OA 3AKFA 3H6QA 4LO0C 2NVHA 4J2YA 4TLPA 1TP0A 1NUNA 3O4OA 4L4HA 3BAUA 3R4SA 3FJ9A 2FO1A 2E4MA 3FUQA 2HWAA 4YOLA 4Q9PA 1DFCA 2ZQOA 1PUMB 2Y9GA 4JP0A 5JMCA 3KMVA 3NBCA 1DJSB 3AH4A 2KLLA 3OJVA 2K43A 1JY0A 2ZQNA 2FFVA 1MD6A 3AZWA 1K5VA 1HIBA 2Y9XE 4G6JA 5FNXA 4XFSA 3ZC8A 4KBBA 2QYIB 4X38A 2IWTB 1UPSA 1DZDA 1YF8B 2VSAA 2KI6B 2GZBA 3BADA 5GAQA 5B2HA
chains in the Genus database with same CATH superfamily
3C9ZA 3UDAA 1P63A 3AJ5A 4I2SA 1AVWB 4I4PA 4LO2A 1VCLA 1JT7A 4QBCA 3BAOA 3S8JA 1NZKA 4QO3A 3CA6A 1S0CA 2MIBA 4DEPA 2HW9A 1WD4A 1BFFA 2VXTI 4L4IA 5BP5A 3WMVA 3VUOA 5BXSA 2NS2A 2Y9FA 2AAIB 1M2TB 2VU9A 4ZA3B 3N0KA 4ENDA 1BASA 4IZXA 3A07A 3B9UA 4IY9A 2HWMA 1TWEA 3HMYA 3AZVA 4JKXB 5BXRA 4EEEB 3QR5A 2Y9WC 1ISXA 3ZXDA 1HCEA 3T8SA 4XFUA 3OGGA 4OWLA 4JAWA 1T9FA 1S0EA 3V0AA 4LO7C 2BEBA 2L5XA 4KEJA 3NBNA 4IZEA 1N4KA 4EFQA 1DQGA 1F31A 1AXMA 1MC9A 4A7ZA 1HWMB 1XYFA 1I1EA 1BA7A 2D24A 4DENA 3I2XA 4OWKA 3FUOA 3R4UA 1EPWA 1ISVA 2J3PA 2LIQA 1II4A 3I29B 3N7JA 2Z48A 3HSMA 1G9DA 1I1BA 1AVUA 3OBTA 4J2SA 4J2XA 1ISYA 1XHBA 2F8XC 1BARA 4ISRA 3FJBA 3UD7A 3FGMA 5EHAA 1GGPB 3FJAA 6I1BA 5FZYA 1IRAX 1AFCA 4HR6C 4G9NA 5BXTA 2YUGA 3BB2A 3P6IA 2P23A 3FJIA 3N7LA 3Q7WA 2DS0A 3FJJA 1OQLB 4QD2B 3IM5A 4P0KA 4R6UB 4EKXB 3IM6A 3WINC 4X37A 3ZXGA 3K1XA 4LO0A 5F8YA 5DVHA 4EFRA 3E8LC 3O4CA 3PG0A 3JUTA 3CA3A 2HZ9A 5D63A 1Z0HA 3CA1A 1PZZA 3AKHA 2ESUA 2D7IA 4G9MA 3IIRA 3PUBA 1FV3A 1EYLA 2BFHA 2D44A 2P39A 3VT2A 3POKA 1IOBA 4IQPA 4F83A 1L2HA 2ET2A 3FJCA 4I4VA 1ABRB 1V6WA 4QALA 41BIA 1DZCA 4XFTA 4Z8SB 2NTDA 4I3NA 3BTAA 2D23A 2KI4A 3AH1A 1V6XA 2VXRA 4ISQA 3FJFA 2XOAA 1KNMA 1DIWA 1AVXB 1FMZA 3WMUA 4I7IA 1JT3A 4LO8B 4Q9GA 4P0LA 3P53A 4I4YA 1FWUA 1HCDA 3N7KA 3ZC9A 1IJTA 3I2AA 2D22A 1R8NA 3RMYA 3WA1A 3O3QA 4ZFUB 4USPA 3OJMA 1G9CA 4ZOTA 2X2SA 5EC5A 2F2FC 4H9WA 3AKIA 2M49A 2VUAA 1AVAC 1ILR1 1SR4C 4I6IA 3SNVA 4D8HA 4LO2C 4PC4A 4IHZA 2DREA 2KH2A 3WO3A 3BRFA 4I4OA 2D7RA 3BX1C 3P6JA 1WBCA 4LO3A 4D0ZA 2D1ZA 2VLCA 4G1RA 3W9TA 3A21A 5DSSB 1HWOB 3UJ0A 4JPZA 3H6SE 4WBCA 5BQUC 3O4DA 1W3AA 3Q7YA 5BXPA 4OEFA 1ISWA 1FV2A 1JT4A 2R9KB 3BAGA 5G00A 3UD9A 3V79C 1XZZA 3O4BA 1JLYA 1JT5A 3BAQA 3JRRA 5EG6C 3UD8A 3BAVA 1S0GA 4A7YA 5DZUA 1QQLA 1FGAA 3BRDA 4JKQA 4OW4A 2Q3NB 1YBIA 4LO7B 3FJEA 3VWCA 3H6RA 2K4AB 3F62B 1WBAA 4I1EA 1BLDA 3O44A 3CRGA 3ILAA 7I1BA 4KEIA 2RG9B 2I1BA 1HWNB 4MZHA 2NYYA 3CRHA 3H6RB 4P0JA 3S8KA 1PC8B 2Z49A 4QKSA 3NJ5A 4GP0A 4LO1A 2DRYA 1QXMA 1S0BA 1S0DA 1TFMB 4H75A 2LIEA 1WD3A 4USOA 3MPPG 4QKRA 2DRZA 1FWVA 3WINA 4GOVA 3BRGC 1Z2VA 5E24E 2GO2A 21BIA 4II0A 2FFUA 4GOYA 4GP3A 2UUSA 3OGFA 2X2TA 3BA5A 3FJKA 4KC3A 3N7MA 5I1BA 1HKNA 3A22A 4AN6A 5FZZA 1IRPA 3FJHA 3UJ4A 2D20A 1BLAA 9ILBA 5F8SA 3D7WB 3TC2A 1T4QA 1W3GA 1S0FA 2ERMA 3RSJA 4I0YA 1YYNA 1J0SA 2VSEA 1DLLA 4I4SA 3VEQA 1Q1UA 1E0OA 4AN7B 2E4MC 3CA0A 4FVVA 3FFZA 1EV2A 4ZFYB 3EF2A 4ZBVB 3HBWA 2RSTA 3CA5A 4FGFA 4J2KA 3VSZA 4I4QA 2FGFA 4G6MA 3RMXA 4F34A 31BIA 1FQ9A 2K8RA 3HALA 1IT0A 4I4RA 4IYBA 2WRYA 4GAIA 1DQOA 1ISZA 3FJ8A 4QBVA 3BAHA 4Z9WB 4ZKTB 1PWAA 1BFCA 4OEGA 4I4XA 5HPZA 4KEKA 2MC2A 1FN0A 1SZ6B 3AKGA 3RTJB 3WO2A 3V0BA 3FJDA 1FMMS 4P6AA 8I1BA 1CE7B 2IHOA 1RY7A 2F2FA 1Q03A 1SR4A 1V6VA 1JLXA 1CVSA 1G9BA 4HA2A 3PMEA 2MLLB 1HWPB 3V0BB 1IHKA 4CJMA 4MZGB 1TWMA 3CU1B 4JQ0A 4X39A 3CAHA 4UY4A 3HOMA 5BP5C 3RTIB 5JLVA 3MALA 3ZX7A 2Q9XA 2NZ9A 5BQUA 1AF9A 1JTCA 1ITBA 3OJ2A 4I96A 1D0HA 4ZGRB 4JRAA 1BFGA 2KKIA 4I1BA 3BA4A 4A7KA 3CQAA 2ZR1B 4IY8A 2NM1A 3WO4A 4ZLBB 3CA4A 1QQKA 4ZFWB 3OBRA 1W3FA 4LO3C 1BFBA 1TIEA 1JQZA 3F1RA 3LLPA 4OUJA 1XG6A 2RQ9A 2WBCA 3HN1A 3O49A 2FDBM 4X3AA 3AJ6A 4J23B 3A23A 1YXWA 3IM7A 4HJJA 4I4UA 4D0TA 4EB2B 5BVPI 5FZUA 3Q7XA 2QN4A 1Q04A 3VT1A 3PHZA 2AXMA 3QYDA 1RMLA 1V6UA 4GAFA 1S0LA 3VSFA 1K5UA 4I8MA 2AFGA 1PUUB 3V0AB 1G9AA 3CRIA 5D61A 3NBDA 5F8WA 3VT0A 2AQZA 5FNWA 3IAGC 1DFQA 4IONA 4OWJA 4MZFB 1Z4SA 4QD2C 3NBEA 5F90A 2D43A 4Q91A 2NP0A 3AH2A 1YTOA 3O4AA 1TOOA 1ONKB 4DCKC 4EFPA 4XKIA 1RZOB 1EVTA 3LTQA 4LO1C 1TTUA 1G82A 4I37A 5D62A 1A8DA 5DUYA 1RG8A 1IILA 3BA7A 2BEAA 5BOWA 4OEEA 4QC4A 3O5WB 4H04A 1M16A 1R8OA 3AKFA 3H6QA 4LO0C 2NVHA 4J2YA 4TLPA 1TP0A 1NUNA 3O4OA 4L4HA 3BAUA 3R4SA 3FJ9A 2FO1A 2E4MA 3FUQA 2HWAA 4YOLA 4Q9PA 1DFCA 2ZQOA 1PUMB 2Y9GA 4JP0A 5JMCA 3KMVA 3NBCA 1DJSB 3AH4A 2KLLA 3OJVA 2K43A 1JY0A 2ZQNA 2FFVA 1MD6A 3AZWA 1K5VA 1HIBA 2Y9XE 4G6JA 5FNXA 4XFSA 3ZC8A 4KBBA 2QYIB 4X38A 2IWTB 1UPSA 1DZDA 1YF8B 2VSAA 2KI6B 2GZBA 3BADA 5GAQA 5B2HA
chains in the Genus database with same CATH topology
3C9ZA 3UDAA 1P63A 3AJ5A 4I2SA 1AVWB 4I4PA 4LO2A 1VCLA 1JT7A 4QBCA 3BAOA 3S8JA 1NZKA 4QO3A 3CA6A 1S0CA 2MIBA 4DEPA 2HW9A 1WD4A 1BFFA 2VXTI 4L4IA 5BP5A 3WMVA 3VUOA 5BXSA 2NS2A 2Y9FA 2AAIB 1M2TB 2VU9A 4ZA3B 3N0KA 4ENDA 1BASA 4IZXA 3A07A 3B9UA 4IY9A 2HWMA 1TWEA 3HMYA 3AZVA 4JKXB 5BXRA 4EEEB 3QR5A 2Y9WC 1ISXA 3ZXDA 1HCEA 3T8SA 4XFUA 3OGGA 4OWLA 4JAWA 1T9FA 1S0EA 3V0AA 4LO7C 2BEBA 2L5XA 4KEJA 3NBNA 4IZEA 1N4KA 4EFQA 1DQGA 1F31A 1AXMA 1MC9A 4A7ZA 1HWMB 1XYFA 1I1EA 1BA7A 2D24A 4DENA 3I2XA 4OWKA 3FUOA 3R4UA 1EPWA 1ISVA 2J3PA 2LIQA 1II4A 3I29B 3N7JA 2Z48A 3HSMA 1G9DA 1I1BA 1AVUA 3OBTA 4J2SA 4J2XA 1ISYA 1XHBA 2F8XC 1BARA 4ISRA 3FJBA 3UD7A 3FGMA 5EHAA 1GGPB 3FJAA 6I1BA 5FZYA 1IRAX 1AFCA 4HR6C 4G9NA 5BXTA 2YUGA 3BB2A 3P6IA 2P23A 3FJIA 3N7LA 3Q7WA 2DS0A 3FJJA 1OQLB 4QD2B 3IM5A 4P0KA 4R6UB 4EKXB 3IM6A 3WINC 4X37A 3ZXGA 3K1XA 4LO0A 5F8YA 5DVHA 4EFRA 3E8LC 3O4CA 3PG0A 3JUTA 3CA3A 2HZ9A 5D63A 1Z0HA 3CA1A 1PZZA 3AKHA 2ESUA 2D7IA 4G9MA 3IIRA 3PUBA 1FV3A 1EYLA 2BFHA 2D44A 2P39A 3VT2A 3POKA 1IOBA 4IQPA 4F83A 1L2HA 2ET2A 3FJCA 4I4VA 1ABRB 1V6WA 4QALA 41BIA 1DZCA 4XFTA 4Z8SB 2NTDA 4I3NA 3BTAA 2D23A 2KI4A 3AH1A 1V6XA 2VXRA 4ISQA 3FJFA 2XOAA 1KNMA 1DIWA 1AVXB 1FMZA 3WMUA 4I7IA 1JT3A 4LO8B 4Q9GA 4P0LA 3P53A 4I4YA 1FWUA 1HCDA 3N7KA 3ZC9A 1IJTA 3I2AA 2D22A 1R8NA 3RMYA 3WA1A 3O3QA 4ZFUB 4USPA 3OJMA 1G9CA 4ZOTA 2X2SA 5EC5A 2F2FC 4H9WA 3AKIA 2M49A 2VUAA 1AVAC 1ILR1 1SR4C 4I6IA 3SNVA 4D8HA 4LO2C 4PC4A 4IHZA 2DREA 2KH2A 3WO3A 3BRFA 4I4OA 2D7RA 3BX1C 3P6JA 1WBCA 4LO3A 4D0ZA 2D1ZA 2VLCA 4G1RA 3W9TA 3A21A 5DSSB 1HWOB 3UJ0A 4JPZA 3H6SE 4WBCA 5BQUC 3O4DA 1W3AA 3Q7YA 5BXPA 4OEFA 1ISWA 1FV2A 1JT4A 2R9KB 3BAGA 5G00A 3UD9A 3V79C 1XZZA 3O4BA 1JLYA 1JT5A 3BAQA 3JRRA 5EG6C 3UD8A 3BAVA 1S0GA 4A7YA 5DZUA 1QQLA 1FGAA 3BRDA 4JKQA 4OW4A 2Q3NB 1YBIA 4LO7B 3FJEA 3VWCA 3H6RA 2K4AB 3F62B 1WBAA 4I1EA 1BLDA 3O44A 3CRGA 3ILAA 7I1BA 4KEIA 2RG9B 2I1BA 1HWNB 4MZHA 2NYYA 3CRHA 3H6RB 4P0JA 3S8KA 1PC8B 2Z49A 4QKSA 3NJ5A 4GP0A 4LO1A 2DRYA 1QXMA 1S0BA 1S0DA 1TFMB 4H75A 2LIEA 1WD3A 4USOA 3MPPG 4QKRA 2DRZA 1FWVA 3WINA 4GOVA 3BRGC 1Z2VA 5E24E 2GO2A 21BIA 4II0A 2FFUA 4GOYA 4GP3A 2UUSA 3OGFA 2X2TA 3BA5A 3FJKA 4KC3A 3N7MA 5I1BA 1HKNA 3A22A 4AN6A 5FZZA 1IRPA 3FJHA 3UJ4A 2D20A 1BLAA 9ILBA 5F8SA 3D7WB 3TC2A 1T4QA 1W3GA 1S0FA 2ERMA 3RSJA 4I0YA 1YYNA 1J0SA 2VSEA 1DLLA 4I4SA 3VEQA 1Q1UA 1E0OA 4AN7B 2E4MC 3CA0A 4FVVA 3FFZA 1EV2A 4ZFYB 3EF2A 4ZBVB 3HBWA 2RSTA 3CA5A 4FGFA 4J2KA 3VSZA 4I4QA 2FGFA 4G6MA 3RMXA 4F34A 31BIA 1FQ9A 2K8RA 3HALA 1IT0A 4I4RA 4IYBA 2WRYA 4GAIA 1DQOA 1ISZA 3FJ8A 4QBVA 3BAHA 4Z9WB 4ZKTB 1PWAA 1BFCA 4OEGA 4I4XA 5HPZA 4KEKA 2MC2A 1FN0A 1SZ6B 3AKGA 3RTJB 3WO2A 3V0BA 3FJDA 1FMMS 4P6AA 8I1BA 1CE7B 2IHOA 1RY7A 2F2FA 1Q03A 1SR4A 1V6VA 1JLXA 1CVSA 1G9BA 4HA2A 3PMEA 2MLLB 1HWPB 3V0BB 1IHKA 4CJMA 4MZGB 1TWMA 3CU1B 4JQ0A 4X39A 3CAHA 4UY4A 3HOMA 5BP5C 3RTIB 5JLVA 3MALA 3ZX7A 2Q9XA 2NZ9A 5BQUA 1AF9A 1JTCA 1ITBA 3OJ2A 4I96A 1D0HA 4ZGRB 4JRAA 1BFGA 2KKIA 4I1BA 3BA4A 4A7KA 3CQAA 2ZR1B 4IY8A 2NM1A 3WO4A 4ZLBB 3CA4A 1QQKA 4ZFWB 3OBRA 1W3FA 4LO3C 1BFBA 1TIEA 1JQZA 3F1RA 3LLPA 4OUJA 1XG6A 2RQ9A 2WBCA 3HN1A 3O49A 2FDBM 4X3AA 3AJ6A 4J23B 3A23A 1YXWA 3IM7A 4HJJA 4I4UA 4D0TA 4EB2B 5BVPI 5FZUA 3Q7XA 2QN4A 1Q04A 3VT1A 3PHZA 2AXMA 3QYDA 1RMLA 1V6UA 4GAFA 1S0LA 3VSFA 1K5UA 4I8MA 2AFGA 1PUUB 3V0AB 1G9AA 3CRIA 5D61A 3NBDA 5F8WA 3VT0A 2AQZA 5FNWA 3IAGC 1DFQA 4IONA 4OWJA 4MZFB 1Z4SA 4QD2C 3NBEA 5F90A 2D43A 4Q91A 2NP0A 3AH2A 1YTOA 3O4AA 1TOOA 1ONKB 4DCKC 4EFPA 4XKIA 1RZOB 1EVTA 3LTQA 4LO1C 1TTUA 1G82A 4I37A 5D62A 1A8DA 5DUYA 1RG8A 1IILA 3BA7A 2BEAA 5BOWA 4OEEA 4QC4A 3O5WB 4H04A 1M16A 1R8OA 3AKFA 3H6QA 4LO0C 2NVHA 4J2YA 4TLPA 1TP0A 1NUNA 3O4OA 4L4HA 3BAUA 3R4SA 3FJ9A 2FO1A 2E4MA 3FUQA 2HWAA 4YOLA 4Q9PA 1DFCA 2ZQOA 1PUMB 2Y9GA 4JP0A 5JMCA 3KMVA 3NBCA 1DJSB 3AH4A 2KLLA 3OJVA 2K43A 1JY0A 2ZQNA 2FFVA 1MD6A 3AZWA 1K5VA 1HIBA 2Y9XE 4G6JA 5FNXA 4XFSA 3ZC8A 4KBBA 2QYIB 4X38A 2IWTB 1UPSA 1DZDA 1YF8B 2VSAA 2KI6B 2GZBA 3BADA 5GAQA 5B2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9Z A;  3UDA A;  1P63 A;  3AJ5 A;  4I2S A;  1AVW B;  4I4P A;  4LO2 A;  1VCL A;  1JT7 A;  4QBC A;  3BAO A;  3S8J A;  1NZK A;  4QO3 A;  3CA6 A;  1S0C A;  2MIB A;  4DEP A;  2HW9 A;  1WD4 A;  1BFF A;  2VXT I;  4L4I A;  5BP5 A;  3WMV A;  3VUO A;  5BXS A;  2Y9F A;  2AAI B;  1M2T B;  2VU9 A;  4ZA3 B;  3N0K A;  4END A;  1BAS A;  4IZX A;  3A07 A;  3B9U A;  4IY9 A;  2HWM A;  1TWE A;  3HMY A;  3AZV A;  4JKX B;  5BXR A;  4EEE B;  3QR5 A;  2Y9W C;  1ISX A;  3ZXD A;  1HCE A;  3T8S A;  4XFU A;  3OGG A;  4OWL A;  4JAW A;  1T9F A;  1S0E A;  3V0A A;  4LO7 C;  2BEB A;  2L5X A;  4KEJ A;  3NBN A;  4IZE A;  1N4K A;  4EFQ A;  1DQG A;  1F31 A;  1AXM A;  1MC9 A;  4A7Z A;  1HWM B;  1XYF A;  1I1E A;  1BA7 A;  2D24 A;  4DEN A;  3I2X A;  4OWK A;  3FUO A;  3R4U A;  1EPW A;  1ISV A;  2J3P A;  2LIQ A;  1II4 A;  3I29 B;  3N7J A;  2Z48 A;  3HSM A;  1G9D A;  1I1B A;  1AVU A;  3OBT A;  4J2S A;  4J2X A;  1ISY A;  1XHB A;  2F8X C;  1BAR A;  4ISR A;  3FJB A;  3UD7 A;  3FGM A;  5EHA A;  1GGP B;  3FJA A;  6I1B A;  5FZY A;  1IRA X;  1AFC A;  4HR6 C;  4G9N A;  5BXT A;  2YUG A;  3BB2 A;  3P6I A;  2P23 A;  3FJI A;  3N7L A;  3Q7W A;  2DS0 A;  3FJJ A;  1OQL B;  4QD2 B;  3IM5 A;  4P0K A;  4R6U B;  4EKX B;  3IM6 A;  3WIN C;  4X37 A;  3ZXG A;  3K1X A;  4LO0 A;  5F8Y A;  5DVH A;  4EFR A;  3E8L C;  3O4C A;  3PG0 A;  3JUT A;  3CA3 A;  2HZ9 A;  5D63 A;  1Z0H A;  3CA1 A;  1PZZ A;  3AKH A;  2ESU A;  2D7I A;  4G9M A;  3IIR A;  3PUB A;  1FV3 A;  1EYL A;  2BFH A;  2D44 A;  2P39 A;  3VT2 A;  3POK A;  1IOB A;  4IQP A;  4F83 A;  1L2H A;  2ET2 A;  3FJC A;  4I4V A;  1ABR B;  1V6W A;  4QAL A;  41BI A;  1DZC A;  4XFT A;  4Z8S B;  2NTD A;  4I3N A;  3BTA A;  2D23 A;  2KI4 A;  3AH1 A;  1V6X A;  2VXR A;  4ISQ A;  3FJF A;  2XOA A;  1KNM A;  1DIW A;  1AVX B;  1FMZ A;  3WMU A;  4I7I A;  1JT3 A;  4LO8 B;  4Q9G A;  4P0L A;  3P53 A;  4I4Y A;  1FWU A;  1HCD A;  3N7K A;  3ZC9 A;  1IJT A;  3I2A A;  2D22 A;  1R8N A;  3RMY A;  3WA1 A;  3O3Q A;  4ZFU B;  4USP A;  3OJM A;  1G9C A;  4ZOT A;  2X2S A;  5EC5 A;  2F2F C;  4H9W A;  3AKI A;  2M49 A;  2VUA A;  1AVA C;  1ILR 1;  1SR4 C;  4I6I A;  3SNV A;  4D8H A;  4LO2 C;  4PC4 A;  4IHZ A;  2DRE A;  2KH2 A;  3WO3 A;  3BRF A;  4I4O A;  2D7R A;  3BX1 C;  3P6J A;  1WBC A;  4LO3 A;  4D0Z A;  2D1Z A;  2VLC A;  4G1R A;  3W9T A;  3A21 A;  5DSS B;  1HWO B;  3UJ0 A;  4JPZ A;  3H6S E;  4WBC A;  5BQU C;  3O4D A;  1W3A A;  3Q7Y A;  5BXP A;  4OEF A;  1ISW A;  1FV2 A;  1JT4 A;  2R9K B;  3BAG A;  5G00 A;  3UD9 A;  3V79 C;  1XZZ A;  3O4B A;  1JLY A;  1JT5 A;  3BAQ A;  3JRR A;  5EG6 C;  3UD8 A;  3BAV A;  1S0G A;  4A7Y A;  5DZU A;  1QQL A;  1FGA A;  3BRD A;  4JKQ A;  4OW4 A;  2Q3N B;  1YBI A;  4LO7 B;  3FJE A;  3VWC A;  3H6R A;  2K4A B;  3F62 B;  1WBA A;  4I1E A;  1BLD A;  3O44 A;  3CRG A;  3ILA A;  7I1B A;  4KEI A;  2RG9 B;  2I1B A;  1HWN B;  2NYY A;  3CRH A;  3H6R B;  4P0J A;  3S8K A;  1PC8 B;  2Z49 A;  4QKS A;  3NJ5 A;  4GP0 A;  4LO1 A;  2DRY A;  1QXM A;  1S0B A;  1S0D A;  1TFM B;  2LIE A;  1WD3 A;  4USO A;  3MPP G;  4QKR A;  2DRZ A;  1FWV A;  3WIN A;  4GOV A;  3BRG C;  1Z2V A;  5E24 E;  2GO2 A;  21BI A;  4II0 A;  2FFU A;  4GOY A;  4GP3 A;  2UUS A;  3OGF A;  2X2T A;  3BA5 A;  3FJK A;  4KC3 A;  3N7M A;  5I1B A;  1HKN A;  3A22 A;  4AN6 A;  5FZZ A;  1IRP A;  3FJH A;  3UJ4 A;  2D20 A;  1BLA A;  9ILB A;  5F8S A;  3D7W B;  3TC2 A;  1T4Q A;  1W3G A;  1S0F A;  2ERM A;  3RSJ A;  4I0Y A;  1YYN A;  1J0S A;  2VSE A;  1DLL A;  4I4S A;  3VEQ A;  1Q1U A;  1E0O A;  4AN7 B;  2E4M C;  3CA0 A;  4FVV A;  3FFZ A;  1EV2 A;  4ZFY B;  3EF2 A;  4ZBV B;  3HBW A;  2RST A;  3CA5 A;  4FGF A;  4J2K A;  3VSZ A;  4I4Q A;  2FGF A;  4G6M A;  3RMX A;  4F34 A;  31BI A;  1FQ9 A;  2K8R A;  3HAL A;  1IT0 A;  4I4R A;  4IYB A;  2WRY A;  4GAI A;  1DQO A;  1ISZ A;  3FJ8 A;  4QBV A;  3BAH A;  4Z9W B;  4ZKT B;  1PWA A;  1BFC A;  4OEG A;  4I4X A;  5HPZ A;  4KEK A;  2MC2 A;  1FN0 A;  1SZ6 B;  3AKG A;  3RTJ B;  3WO2 A;  3V0B A;  3FJD A;  1FMM S;  4P6A A;  8I1B A;  1CE7 B;  2IHO A;  1RY7 A;  2F2F A;  1Q03 A;  1SR4 A;  1V6V A;  1JLX A;  1CVS A;  1G9B A;  4HA2 A;  3PME A;  2MLL B;  1HWP B;  3V0B B;  1IHK A;  4CJM A;  1TWM A;  3CU1 B;  4JQ0 A;  4X39 A;  3CAH A;  3HOM A;  5BP5 C;  3RTI B;  5JLV A;  3MAL A;  3ZX7 A;  2Q9X A;  2NZ9 A;  5BQU A;  1AF9 A;  1JTC A;  1ITB A;  3OJ2 A;  4I96 A;  1D0H A;  4ZGR B;  4JRA A;  1BFG A;  2KKI A;  4I1B A;  3BA4 A;  4A7K A;  3CQA A;  2ZR1 B;  4IY8 A;  2NM1 A;  3WO4 A;  4ZLB B;  3CA4 A;  1QQK A;  4ZFW B;  3OBR A;  1W3F A;  4LO3 C;  1BFB A;  1TIE A;  1JQZ A;  3F1R A;  3LLP A;  4OUJ A;  1XG6 A;  2RQ9 A;  2WBC A;  3HN1 A;  3O49 A;  2FDB M;  4X3A A;  3AJ6 A;  4J23 B;  3A23 A;  1YXW A;  3IM7 A;  4HJJ A;  4I4U A;  4D0T A;  4EB2 B;  5BVP I;  5FZU A;  3Q7X A;  2QN4 A;  1Q04 A;  3VT1 A;  3PHZ A;  2AXM A;  3QYD A;  1RML A;  1V6U A;  4GAF A;  1S0L A;  3VSF A;  1K5U A;  4I8M A;  2AFG A;  1PUU B;  3V0A B;  1G9A A;  3CRI A;  5D61 A;  3NBD A;  5F8W A;  3VT0 A;  2AQZ A;  5FNW A;  3IAG C;  1DFQ A;  4ION A;  4OWJ A;  1Z4S A;  4QD2 C;  3NBE A;  5F90 A;  2D43 A;  4Q91 A;  2NP0 A;  3AH2 A;  1YTO A;  3O4A A;  1TOO A;  1ONK B;  4DCK C;  4EFP A;  4XKI A;  1RZO B;  1EVT A;  3LTQ A;  4LO1 C;  1TTU A;  1G82 A;  4I37 A;  5D62 A;  1A8D A;  5DUY A;  1RG8 A;  1IIL A;  3BA7 A;  2BEA A;  5BOW A;  4OEE A;  4QC4 A;  3O5W B;  4H04 A;  1M16 A;  1R8O A;  3AKF A;  3H6Q A;  4LO0 C;  2NVH A;  4J2Y A;  4TLP A;  1TP0 A;  1NUN A;  3O4O A;  4L4H A;  3BAU A;  3R4S A;  3FJ9 A;  2FO1 A;  2E4M A;  3FUQ A;  2HWA A;  4YOL A;  4Q9P A;  1DFC A;  2ZQO A;  1PUM B;  2Y9G A;  4JP0 A;  5JMC A;  3KMV A;  3NBC A;  1DJS B;  3AH4 A;  2KLL A;  3OJV A;  2K43 A;  1JY0 A;  2ZQN A;  2FFV A;  1MD6 A;  3AZW A;  1K5V A;  1HIB A;  2Y9X E;  4G6J A;  5FNX A;  4XFS A;  3ZC8 A;  4KBB A;  2QYI B;  4X38 A;  2IWT B;  1UPS A;  1DZD A;  1YF8 B;  2VSA A;  2KI6 B;  2GZB A;  3BAD A;  5GAQ A;  5B2H A; 
#chains in the Genus database with same CATH topology
 3C9Z A;  3UDA A;  1P63 A;  3AJ5 A;  4I2S A;  1AVW B;  4I4P A;  4LO2 A;  1VCL A;  1JT7 A;  4QBC A;  3BAO A;  3S8J A;  1NZK A;  4QO3 A;  3CA6 A;  1S0C A;  2MIB A;  4DEP A;  2HW9 A;  1WD4 A;  1BFF A;  2VXT I;  4L4I A;  5BP5 A;  3WMV A;  3VUO A;  5BXS A;  2NS2 A;  2Y9F A;  2AAI B;  1M2T B;  2VU9 A;  4ZA3 B;  3N0K A;  4END A;  1BAS A;  4IZX A;  3A07 A;  3B9U A;  4IY9 A;  2HWM A;  1TWE A;  3HMY A;  3AZV A;  4JKX B;  5BXR A;  4EEE B;  3QR5 A;  2Y9W C;  1ISX A;  3ZXD A;  1HCE A;  3T8S A;  4XFU A;  3OGG A;  4OWL A;  4JAW A;  1T9F A;  1S0E A;  3V0A A;  4LO7 C;  2BEB A;  2L5X A;  4KEJ A;  3NBN A;  4IZE A;  1N4K A;  4EFQ A;  1DQG A;  1F31 A;  1AXM A;  1MC9 A;  4A7Z A;  1HWM B;  1XYF A;  1I1E A;  1BA7 A;  2D24 A;  4DEN A;  3I2X A;  4OWK A;  3FUO A;  3R4U A;  1EPW A;  1ISV A;  2J3P A;  2LIQ A;  1II4 A;  3I29 B;  3N7J A;  2Z48 A;  3HSM A;  1G9D A;  1I1B A;  1AVU A;  3OBT A;  4J2S A;  4J2X A;  1ISY A;  1XHB A;  2F8X C;  1BAR A;  4ISR A;  3FJB A;  3UD7 A;  3FGM A;  5EHA A;  1GGP B;  3FJA A;  6I1B A;  5FZY A;  1IRA X;  1AFC A;  4HR6 C;  4G9N A;  5BXT A;  2YUG A;  3BB2 A;  3P6I A;  2P23 A;  3FJI A;  3N7L A;  3Q7W A;  2DS0 A;  3FJJ A;  1OQL B;  4QD2 B;  3IM5 A;  4P0K A;  4R6U B;  4EKX B;  3IM6 A;  3WIN C;  4X37 A;  3ZXG A;  3K1X A;  4LO0 A;  5F8Y A;  5DVH A;  4EFR A;  3E8L C;  3O4C A;  3PG0 A;  3JUT A;  3CA3 A;  2HZ9 A;  5D63 A;  1Z0H A;  3CA1 A;  1PZZ A;  3AKH A;  2ESU A;  2D7I A;  4G9M A;  3IIR A;  3PUB A;  1FV3 A;  1EYL A;  2BFH A;  2D44 A;  2P39 A;  3VT2 A;  3POK A;  1IOB A;  4IQP A;  4F83 A;  1L2H A;  2ET2 A;  3FJC A;  4I4V A;  1ABR B;  1V6W A;  4QAL A;  41BI A;  1DZC A;  4XFT A;  4Z8S B;  2NTD A;  4I3N A;  3BTA A;  2D23 A;  2KI4 A;  3AH1 A;  1V6X A;  2VXR A;  4ISQ A;  3FJF A;  2XOA A;  1KNM A;  1DIW A;  1AVX B;  1FMZ A;  3WMU A;  4I7I A;  1JT3 A;  4LO8 B;  4Q9G A;  4P0L A;  3P53 A;  4I4Y A;  1FWU A;  1HCD A;  3N7K A;  3ZC9 A;  1IJT A;  3I2A A;  2D22 A;  1R8N A;  3RMY A;  3WA1 A;  3O3Q A;  4ZFU B;  4USP A;  3OJM A;  1G9C A;  4ZOT A;  2X2S A;  5EC5 A;  2F2F C;  4H9W A;  3AKI A;  2M49 A;  2VUA A;  1AVA C;  1ILR 1;  1SR4 C;  4I6I A;  3SNV A;  4D8H A;  4LO2 C;  4PC4 A;  4IHZ A;  2DRE A;  2KH2 A;  3WO3 A;  3BRF A;  4I4O A;  2D7R A;  3BX1 C;  3P6J A;  1WBC A;  4LO3 A;  4D0Z A;  2D1Z A;  2VLC A;  4G1R A;  3W9T A;  3A21 A;  5DSS B;  1HWO B;  3UJ0 A;  4JPZ A;  3H6S E;  4WBC A;  5BQU C;  3O4D A;  1W3A A;  3Q7Y A;  5BXP A;  4OEF A;  1ISW A;  1FV2 A;  1JT4 A;  2R9K B;  3BAG A;  5G00 A;  3UD9 A;  3V79 C;  1XZZ A;  3O4B A;  1JLY A;  1JT5 A;  3BAQ A;  3JRR A;  5EG6 C;  3UD8 A;  3BAV A;  1S0G A;  4A7Y A;  5DZU A;  1QQL A;  1FGA A;  3BRD A;  4JKQ A;  4OW4 A;  2Q3N B;  1YBI A;  4LO7 B;  3FJE A;  3VWC A;  3H6R A;  2K4A B;  3F62 B;  1WBA A;  4I1E A;  1BLD A;  3O44 A;  3CRG A;  3ILA A;  7I1B A;  4KEI A;  2RG9 B;  2I1B A;  1HWN B;  4MZH A;  2NYY A;  3CRH A;  3H6R B;  4P0J A;  3S8K A;  1PC8 B;  2Z49 A;  4QKS A;  3NJ5 A;  4GP0 A;  4LO1 A;  2DRY A;  1QXM A;  1S0B A;  1S0D A;  1TFM B;  4H75 A;  2LIE A;  1WD3 A;  4USO A;  3MPP G;  4QKR A;  2DRZ A;  1FWV A;  3WIN A;  4GOV A;  3BRG C;  1Z2V A;  5E24 E;  2GO2 A;  21BI A;  4II0 A;  2FFU A;  4GOY A;  4GP3 A;  2UUS A;  3OGF A;  2X2T A;  3BA5 A;  3FJK A;  4KC3 A;  3N7M A;  5I1B A;  1HKN A;  3A22 A;  4AN6 A;  5FZZ A;  1IRP A;  3FJH A;  3UJ4 A;  2D20 A;  1BLA A;  9ILB A;  5F8S A;  3D7W B;  3TC2 A;  1T4Q A;  1W3G A;  1S0F A;  2ERM A;  3RSJ A;  4I0Y A;  1YYN A;  1J0S A;  2VSE A;  1DLL A;  4I4S A;  3VEQ A;  1Q1U A;  1E0O A;  4AN7 B;  2E4M C;  3CA0 A;  4FVV A;  3FFZ A;  1EV2 A;  4ZFY B;  3EF2 A;  4ZBV B;  3HBW A;  2RST A;  3CA5 A;  4FGF A;  4J2K A;  3VSZ A;  4I4Q A;  2FGF A;  4G6M A;  3RMX A;  4F34 A;  31BI A;  1FQ9 A;  2K8R A;  3HAL A;  1IT0 A;  4I4R A;  4IYB A;  2WRY A;  4GAI A;  1DQO A;  1ISZ A;  3FJ8 A;  4QBV A;  3BAH A;  4Z9W B;  4ZKT B;  1PWA A;  1BFC A;  4OEG A;  4I4X A;  5HPZ A;  4KEK A;  2MC2 A;  1FN0 A;  1SZ6 B;  3AKG A;  3RTJ B;  3WO2 A;  3V0B A;  3FJD A;  1FMM S;  4P6A A;  8I1B A;  1CE7 B;  2IHO A;  1RY7 A;  2F2F A;  1Q03 A;  1SR4 A;  1V6V A;  1JLX A;  1CVS A;  1G9B A;  4HA2 A;  3PME A;  2MLL B;  1HWP B;  3V0B B;  1IHK A;  4CJM A;  4MZG B;  1TWM A;  3CU1 B;  4JQ0 A;  4X39 A;  3CAH A;  4UY4 A;  3HOM A;  5BP5 C;  3RTI B;  5JLV A;  3MAL A;  3ZX7 A;  2Q9X A;  2NZ9 A;  5BQU A;  1AF9 A;  1JTC A;  1ITB A;  3OJ2 A;  4I96 A;  1D0H A;  4ZGR B;  4JRA A;  1BFG A;  2KKI A;  4I1B A;  3BA4 A;  4A7K A;  3CQA A;  2ZR1 B;  4IY8 A;  2NM1 A;  3WO4 A;  4ZLB B;  3CA4 A;  1QQK A;  4ZFW B;  3OBR A;  1W3F A;  4LO3 C;  1BFB A;  1TIE A;  1JQZ A;  3F1R A;  3LLP A;  4OUJ A;  1XG6 A;  2RQ9 A;  2WBC A;  3HN1 A;  3O49 A;  2FDB M;  4X3A A;  3AJ6 A;  4J23 B;  3A23 A;  1YXW A;  3IM7 A;  4HJJ A;  4I4U A;  4D0T A;  4EB2 B;  5BVP I;  5FZU A;  3Q7X A;  2QN4 A;  1Q04 A;  3VT1 A;  3PHZ A;  2AXM A;  3QYD A;  1RML A;  1V6U A;  4GAF A;  1S0L A;  3VSF A;  1K5U A;  4I8M A;  2AFG A;  1PUU B;  3V0A B;  1G9A A;  3CRI A;  5D61 A;  3NBD A;  5F8W A;  3VT0 A;  2AQZ A;  5FNW A;  3IAG C;  1DFQ A;  4ION A;  4OWJ A;  4MZF B;  1Z4S A;  4QD2 C;  3NBE A;  5F90 A;  2D43 A;  4Q91 A;  2NP0 A;  3AH2 A;  1YTO A;  3O4A A;  1TOO A;  1ONK B;  4DCK C;  4EFP A;  4XKI A;  1RZO B;  1EVT A;  3LTQ A;  4LO1 C;  1TTU A;  1G82 A;  4I37 A;  5D62 A;  1A8D A;  5DUY A;  1RG8 A;  1IIL A;  3BA7 A;  2BEA A;  5BOW A;  4OEE A;  4QC4 A;  3O5W B;  4H04 A;  1M16 A;  1R8O A;  3AKF A;  3H6Q A;  4LO0 C;  2NVH A;  4J2Y A;  4TLP A;  1TP0 A;  1NUN A;  3O4O A;  4L4H A;  3BAU A;  3R4S A;  3FJ9 A;  2FO1 A;  2E4M A;  3FUQ A;  2HWA A;  4YOL A;  4Q9P A;  1DFC A;  2ZQO A;  1PUM B;  2Y9G A;  4JP0 A;  5JMC A;  3KMV A;  3NBC A;  1DJS B;  3AH4 A;  2KLL A;  3OJV A;  2K43 A;  1JY0 A;  2ZQN A;  2FFV A;  1MD6 A;  3AZW A;  1K5V A;  1HIB A;  2Y9X E;  4G6J A;  5FNX A;  4XFS A;  3ZC8 A;  4KBB A;  2QYI B;  4X38 A;  2IWT B;  1UPS A;  1DZD A;  1YF8 B;  2VSA A;  2KI6 B;  2GZB A;  3BAD A;  5GAQ A;  5B2H A; 
#chains in the Genus database with same CATH homology
 3C9Z A;  3UDA A;  1P63 A;  3AJ5 A;  4I2S A;  1AVW B;  4I4P A;  4LO2 A;  1VCL A;  1JT7 A;  4QBC A;  3BAO A;  3S8J A;  1NZK A;  4QO3 A;  3CA6 A;  1S0C A;  2MIB A;  4DEP A;  2HW9 A;  1WD4 A;  1BFF A;  2VXT I;  4L4I A;  5BP5 A;  3WMV A;  3VUO A;  5BXS A;  2NS2 A;  2Y9F A;  2AAI B;  1M2T B;  2VU9 A;  4ZA3 B;  3N0K A;  4END A;  1BAS A;  4IZX A;  3A07 A;  3B9U A;  4IY9 A;  2HWM A;  1TWE A;  3HMY A;  3AZV A;  4JKX B;  5BXR A;  4EEE B;  3QR5 A;  2Y9W C;  1ISX A;  3ZXD A;  1HCE A;  3T8S A;  4XFU A;  3OGG A;  4OWL A;  4JAW A;  1T9F A;  1S0E A;  3V0A A;  4LO7 C;  2BEB A;  2L5X A;  4KEJ A;  3NBN A;  4IZE A;  1N4K A;  4EFQ A;  1DQG A;  1F31 A;  1AXM A;  1MC9 A;  4A7Z A;  1HWM B;  1XYF A;  1I1E A;  1BA7 A;  2D24 A;  4DEN A;  3I2X A;  4OWK A;  3FUO A;  3R4U A;  1EPW A;  1ISV A;  2J3P A;  2LIQ A;  1II4 A;  3I29 B;  3N7J A;  2Z48 A;  3HSM A;  1G9D A;  1I1B A;  1AVU A;  3OBT A;  4J2S A;  4J2X A;  1ISY A;  1XHB A;  2F8X C;  1BAR A;  4ISR A;  3FJB A;  3UD7 A;  3FGM A;  5EHA A;  1GGP B;  3FJA A;  6I1B A;  5FZY A;  1IRA X;  1AFC A;  4HR6 C;  4G9N A;  5BXT A;  2YUG A;  3BB2 A;  3P6I A;  2P23 A;  3FJI A;  3N7L A;  3Q7W A;  2DS0 A;  3FJJ A;  1OQL B;  4QD2 B;  3IM5 A;  4P0K A;  4R6U B;  4EKX B;  3IM6 A;  3WIN C;  4X37 A;  3ZXG A;  3K1X A;  4LO0 A;  5F8Y A;  5DVH A;  4EFR A;  3E8L C;  3O4C A;  3PG0 A;  3JUT A;  3CA3 A;  2HZ9 A;  5D63 A;  1Z0H A;  3CA1 A;  1PZZ A;  3AKH A;  2ESU A;  2D7I A;  4G9M A;  3IIR A;  3PUB A;  1FV3 A;  1EYL A;  2BFH A;  2D44 A;  2P39 A;  3VT2 A;  3POK A;  1IOB A;  4IQP A;  4F83 A;  1L2H A;  2ET2 A;  3FJC A;  4I4V A;  1ABR B;  1V6W A;  4QAL A;  41BI A;  1DZC A;  4XFT A;  4Z8S B;  2NTD A;  4I3N A;  3BTA A;  2D23 A;  2KI4 A;  3AH1 A;  1V6X A;  2VXR A;  4ISQ A;  3FJF A;  2XOA A;  1KNM A;  1DIW A;  1AVX B;  1FMZ A;  3WMU A;  4I7I A;  1JT3 A;  4LO8 B;  4Q9G A;  4P0L A;  3P53 A;  4I4Y A;  1FWU A;  1HCD A;  3N7K A;  3ZC9 A;  1IJT A;  3I2A A;  2D22 A;  1R8N A;  3RMY A;  3WA1 A;  3O3Q A;  4ZFU B;  4USP A;  3OJM A;  1G9C A;  4ZOT A;  2X2S A;  5EC5 A;  2F2F C;  4H9W A;  3AKI A;  2M49 A;  2VUA A;  1AVA C;  1ILR 1;  1SR4 C;  4I6I A;  3SNV A;  4D8H A;  4LO2 C;  4PC4 A;  4IHZ A;  2DRE A;  2KH2 A;  3WO3 A;  3BRF A;  4I4O A;  2D7R A;  3BX1 C;  3P6J A;  1WBC A;  4LO3 A;  4D0Z A;  2D1Z A;  2VLC A;  4G1R A;  3W9T A;  3A21 A;  5DSS B;  1HWO B;  3UJ0 A;  4JPZ A;  3H6S E;  4WBC A;  5BQU C;  3O4D A;  1W3A A;  3Q7Y A;  5BXP A;  4OEF A;  1ISW A;  1FV2 A;  1JT4 A;  2R9K B;  3BAG A;  5G00 A;  3UD9 A;  3V79 C;  1XZZ A;  3O4B A;  1JLY A;  1JT5 A;  3BAQ A;  3JRR A;  5EG6 C;  3UD8 A;  3BAV A;  1S0G A;  4A7Y A;  5DZU A;  1QQL A;  1FGA A;  3BRD A;  4JKQ A;  4OW4 A;  2Q3N B;  1YBI A;  4LO7 B;  3FJE A;  3VWC A;  3H6R A;  2K4A B;  3F62 B;  1WBA A;  4I1E A;  1BLD A;  3O44 A;  3CRG A;  3ILA A;  7I1B A;  4KEI A;  2RG9 B;  2I1B A;  1HWN B;  4MZH A;  2NYY A;  3CRH A;  3H6R B;  4P0J A;  3S8K A;  1PC8 B;  2Z49 A;  4QKS A;  3NJ5 A;  4GP0 A;  4LO1 A;  2DRY A;  1QXM A;  1S0B A;  1S0D A;  1TFM B;  4H75 A;  2LIE A;  1WD3 A;  4USO A;  3MPP G;  4QKR A;  2DRZ A;  1FWV A;  3WIN A;  4GOV A;  3BRG C;  1Z2V A;  5E24 E;  2GO2 A;  21BI A;  4II0 A;  2FFU A;  4GOY A;  4GP3 A;  2UUS A;  3OGF A;  2X2T A;  3BA5 A;  3FJK A;  4KC3 A;  3N7M A;  5I1B A;  1HKN A;  3A22 A;  4AN6 A;  5FZZ A;  1IRP A;  3FJH A;  3UJ4 A;  2D20 A;  1BLA A;  9ILB A;  5F8S A;  3D7W B;  3TC2 A;  1T4Q A;  1W3G A;  1S0F A;  2ERM A;  3RSJ A;  4I0Y A;  1YYN A;  1J0S A;  2VSE A;  1DLL A;  4I4S A;  3VEQ A;  1Q1U A;  1E0O A;  4AN7 B;  2E4M C;  3CA0 A;  4FVV A;  3FFZ A;  1EV2 A;  4ZFY B;  3EF2 A;  4ZBV B;  3HBW A;  2RST A;  3CA5 A;  4FGF A;  4J2K A;  3VSZ A;  4I4Q A;  2FGF A;  4G6M A;  3RMX A;  4F34 A;  31BI A;  1FQ9 A;  2K8R A;  3HAL A;  1IT0 A;  4I4R A;  4IYB A;  2WRY A;  4GAI A;  1DQO A;  1ISZ A;  3FJ8 A;  4QBV A;  3BAH A;  4Z9W B;  4ZKT B;  1PWA A;  1BFC A;  4OEG A;  4I4X A;  5HPZ A;  4KEK A;  2MC2 A;  1FN0 A;  1SZ6 B;  3AKG A;  3RTJ B;  3WO2 A;  3V0B A;  3FJD A;  1FMM S;  4P6A A;  8I1B A;  1CE7 B;  2IHO A;  1RY7 A;  2F2F A;  1Q03 A;  1SR4 A;  1V6V A;  1JLX A;  1CVS A;  1G9B A;  4HA2 A;  3PME A;  2MLL B;  1HWP B;  3V0B B;  1IHK A;  4CJM A;  4MZG B;  1TWM A;  3CU1 B;  4JQ0 A;  4X39 A;  3CAH A;  4UY4 A;  3HOM A;  5BP5 C;  3RTI B;  5JLV A;  3MAL A;  3ZX7 A;  2Q9X A;  2NZ9 A;  5BQU A;  1AF9 A;  1JTC A;  1ITB A;  3OJ2 A;  4I96 A;  1D0H A;  4ZGR B;  4JRA A;  1BFG A;  2KKI A;  4I1B A;  3BA4 A;  4A7K A;  3CQA A;  2ZR1 B;  4IY8 A;  2NM1 A;  3WO4 A;  4ZLB B;  3CA4 A;  1QQK A;  4ZFW B;  3OBR A;  1W3F A;  4LO3 C;  1BFB A;  1TIE A;  1JQZ A;  3F1R A;  3LLP A;  4OUJ A;  1XG6 A;  2RQ9 A;  2WBC A;  3HN1 A;  3O49 A;  2FDB M;  4X3A A;  3AJ6 A;  4J23 B;  3A23 A;  1YXW A;  3IM7 A;  4HJJ A;  4I4U A;  4D0T A;  4EB2 B;  5BVP I;  5FZU A;  3Q7X A;  2QN4 A;  1Q04 A;  3VT1 A;  3PHZ A;  2AXM A;  3QYD A;  1RML A;  1V6U A;  4GAF A;  1S0L A;  3VSF A;  1K5U A;  4I8M A;  2AFG A;  1PUU B;  3V0A B;  1G9A A;  3CRI A;  5D61 A;  3NBD A;  5F8W A;  3VT0 A;  2AQZ A;  5FNW A;  3IAG C;  1DFQ A;  4ION A;  4OWJ A;  4MZF B;  1Z4S A;  4QD2 C;  3NBE A;  5F90 A;  2D43 A;  4Q91 A;  2NP0 A;  3AH2 A;  1YTO A;  3O4A A;  1TOO A;  1ONK B;  4DCK C;  4EFP A;  4XKI A;  1RZO B;  1EVT A;  3LTQ A;  4LO1 C;  1TTU A;  1G82 A;  4I37 A;  5D62 A;  1A8D A;  5DUY A;  1RG8 A;  1IIL A;  3BA7 A;  2BEA A;  5BOW A;  4OEE A;  4QC4 A;  3O5W B;  4H04 A;  1M16 A;  1R8O A;  3AKF A;  3H6Q A;  4LO0 C;  2NVH A;  4J2Y A;  4TLP A;  1TP0 A;  1NUN A;  3O4O A;  4L4H A;  3BAU A;  3R4S A;  3FJ9 A;  2FO1 A;  2E4M A;  3FUQ A;  2HWA A;  4YOL A;  4Q9P A;  1DFC A;  2ZQO A;  1PUM B;  2Y9G A;  4JP0 A;  5JMC A;  3KMV A;  3NBC A;  1DJS B;  3AH4 A;  2KLL A;  3OJV A;  2K43 A;  1JY0 A;  2ZQN A;  2FFV A;  1MD6 A;  3AZW A;  1K5V A;  1HIB A;  2Y9X E;  4G6J A;  5FNX A;  4XFS A;  3ZC8 A;  4KBB A;  2QYI B;  4X38 A;  2IWT B;  1UPS A;  1DZD A;  1YF8 B;  2VSA A;  2KI6 B;  2GZB A;  3BAD A;  5GAQ A;  5B2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...