4OELB

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
69
structure length
69
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 8
structure length 69
sequence length 69
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4oelB00
4CDEC 4CDFC 4CDCC 4OELB 1K3BC 2DJGC 2DJFC 1ICFB 4CDDC 4OEMB 1MHWC
chains in the Genus database with same CATH superfamily
4PG3A 1KLGD 1U4MA 2HQEA 4X62L 5IGBA 3KYHC 4F8MA 2LKVA 4BY7G 2UXDQ 4DAVA 2KVMA 1PTOH 1VQ4A 1CKOA 3NXWA 3VYTA 2L5TA 2QW7A 1GO3E 1PRTC 1GUTA 3I4MG 1ILPA 1PFNA 4A3IB 1Y1VB 4A3JH 3N6RA 3A54A 1AZPA 1IYJB 5LMNW 2QDLA 4PZ6A 4G4KA 3M9BA 4OIKA 1PMRA 1K0RA 1Z7TA 4OELB 1F2YA 5IYCH 3BVMA 1Y69U 3TP6A 4EQNA 4GS3A 1PH3A 1NBWA 1M90C 1LM0A 2F3IA 3K6OA 4ZLTF 1LABA 1VF5C 2E2IB 5EKLA 3PO3H 3T1YQ 2R6GA 4JYAL 1BO0A 2RDHA 1U4PA 3CP0A 1KHIA 3HKSA 3RLFA 1I5FA 1NR4A 3BZDB 3EVQA 2G9DA 4RKBA 4ME3A 4LF6Q 1HNWL 1MJEA 3W3AA 3J81L 2R92G 1JQYD 1VQOA 3HOUB 3HKZB 5K36G 1LTLA 3AQQA 3J81E 2TMPA 3EBEA 1BQQT 4R4IA 4JBKA 3MFGA 3HS0C 1KABA 3A7AB 3NWTA 4DUZQ 2PW5A 3M85A 2A68C 2PI2E 4DK6C 3OPOA 4JI4Q 4S3SA 4ABNA 1R4PB 1N36L 1S5CD 2EIFA 1JWSD 1XXGA 3S24A 1UE6A 3NBIA 2EZVA 4GKJQ 1EY5A 2WB1E 1LUZA 4H44C 4IQZA 5EPKA 1CA5A 2B2WA 1JJCB 4YWMA 3RD4A 1QWYA 3FKIB 4IURA 2F0UA 1TKWB 1BR9A 3G6EA 3CMAA 1SROA 1EY8A 2KEDA 3KF8A 4JBJA 3T53B 3J81c 4BA1I 4GN5A 2VXWA 1K83H 2O4XA 3M4QA 3K57A 1TT2A 1JB7A 1XMOQ 1AE3A 2F0PA 5M5YH 3H91A 4U673 1HR0W 1F9RA 2J7ZA 4AQYL 3KK7A 4I65A 5KIXA 1BCPD 4NDXA 3CQZH 2BE5C 4LFAQ 3V05A 2VQFQ 3ZYYX 2WAQB 1RCVD 5CR3A 1PH4A 4NXNQ 1STAA 4IOCA 3TRZA 3W2DA 1TWCH 1QVCA 1EUJA 2VY3A 3PF4A 3RN5A 1XNQL 4JW0A 2I46A 2HHHL 2N3SA 4PV1C 1P16A 3F8TA 1Q46A 3S15B 1K3RA 1I50B 1CFMA 4GN4B 4DN4M 3ERQA 2A69C 3OWFA 4DV2L 1QVGA 5F2DA 1HZ9A 3S2HB 3K0XA 3F2UA 3GTGB 3OWEB 5GADC 1SYFA 4P75A 1D1IA 4AH6A 1X3FA 1L1OB 4BBRB 2XWJB 4GN3B 3G48A 2VZAA 3N52A 4RMFA 2EYPA 3HOUG 2F0IA 2A6HD 2P5ZX 3GTLH 1IBLL 4B3TQ 2M9VA 5AJ3L 2F0SA 2EYHA 4RWSC 1XNRQ 3VR5A 4C1NK 3CXCA 4V0BA 4RCNA 5I6WA 3RLNA 1VQBA 2NVXH 1QE6A 4K14A 2JA7B 4X3UA 1ZYRD 3I3CA 4H0LC 1YHQA 2PNRC 3ND8A 2CKZB 3ITPA 3FKIG 3DEOA 4KKTA 2Q2HA 4LF7Q 2R7ZB 4IUQA 3H6MA 2KENA 1FNUA 4L6TB 4KN7C 1D8LA 4A3CH 3NEMA 5A2QE 4A3KH 2OT2A 3MXPA 1D5XC 2RCFA 2F03A 4BXXG 5FLXL 4C3JG 4WRDA 4RAUC 5FLXE 2QCPX 3PUXA 2AQ1B 3H3VC 1AH9A 2DY8A 4N9PA 3I72A 1WOCA 2K01A 1JCKB 2DNEA 3AU7A 1HNXL 1KNAA 2WIIB 4IUPA 4JCVE 1PLFA 4CJ2C 1WCMH 3S14B 2DY7A 2JA5H 2WAQG 2B3GA 1G291 1LACA 3UDFA 3GTQH 4R4QA 1VQ7A 1A8VA 1GHKA 3H09A 2I5LX 2L9HA 3M7GA 4NW2A 4QJFA 1BCPF 4HMJA 4KJOA 1N32Q 2K05A 1SMYD 2IX0A 4Q5VA 3CCUA 4KY7A 3S1QH 1DCZA 1D5MC 5DM63 5EAYA 3QR8A 3TEHB 4B3RQ 5FLXc 2ES2A 5IT9E 1HR0Q 1SDFA 5C3EB 2RHQB 2XTIA 2YTYA 4DV1Q 3OW2A 5M5XB 2CFMA 2QF7A 1F2LA 3S1NH 1I4GA 2VNUD 1EIGA 3OYYA 1GUOA 1YEZA 2FMMA 5I2XA 4BBRG 3ONAB 4F87A 4JOIC 5FO8B 2UUBQ 2B2UA 5KRUA 2RSOA 1S5FD 4HCSA 4X3KA 3I8ZA 1HNZQ 4CDDC 5DM73 2K28A 4BWGB 2B2VA 4PQXA 4IOAA 4JI5Q 3T1YL 1WI5A 3CAMA 2LY7A 2EYMA 5DEHA 3DUZA 4FF4A 1HUMA 3IL8A 2JA7G 4P72A 1YNND 1I94Q 1G2SA 4OO1H 2VB2X 4NKLA 1D1KA 4K5VA 3K5LA 5EPJA 3A8JE 3Q8DA 1PH6A 1EEID 1RIPA 2MJ8A 4A93H 3HG9A 1PH5A 3VR6A 5IP9G 1QNKA 1JB3A 1DD2A 1VQGA 2R92H 5K36H 1LYLA 2WINB 4IJLA 4OX9L 4DR2Q 1BKBA 1MSHA 1R9TH 3TSSA 4FVMA 4RKLA 3I4NB 1HHVA 3KLSX 4K0KL 1PTOD 2XWBB 1GVPA 2E2HH 2RSNA 3BG3A 2RCNA 3TZDA 2NYZD 2Q8RE 5EBDA 3TS0A 5JJZA 3HOZG 1JWUD 5CV8A 4X65Q 5IGFA 1JJ2A 2MUYA 5BR8Q 4QIWE 4LFBL 4N8FA 5C5MA 4WJ3M 5M5WH 2EY1A 1K3BC 2ZTDA 5C3EG 1RD9D 1NMGA 2NN6I 5C3XA 2QILA 5C4ZA 3K5NA 1CQFA 2OEOA 3I90A 1DZ1A 2F0GA 4NB3A 1VDZA 4OWTB 2SNMA 5KNCA 5EQ0A 3PIPA 4B9WA 1HPCA 1ZXTA 5FK9C 2CCZA 2A68D 4X62Q 1F2MA 3S17H 4DR3L 3KUPA 3S1RB 1ET9A 1NE3A 4JBWA 5CV5A 3MHBA 1DXMA 5CGKA 2MPMA 2Z4IA 4JVZA 2N55A 5KGUA 3NE5B 2NZOA 4MNOA 1YJ9A 5M3FH 4OL7A 1Y1WH 1KDAA 1SE3A 3KJOA 3L3OC 5JPMC 1Z6HA 4XT1B 1E2WA 4YY3Q 3EQLC 1RTNA 3OTOL 1PFBA 1Q81C 3RLOA 3Q24A 1JJGA 3GD7A 1ILQA 1HFNA 2B63H 1YHAA 1X6OA 3EROA 4DK1A 3HOUH 4OGQC 2L4NA 4IUTA 1PYBA 3R2IA 5C4HA 2JA9A 2NVTB 4HSVA 4JYAQ 1QOHA 3FPUB 5C0XH 3I4NG 3RNUA 1VQ5A 1DOLA 1NTGA 2BE5D 4CKCA 4GOPC 2KBNA 4QY7A 1RF2D 3W1BA 4QL5A 1F77A 3QIAA 4ILWA 4ZCKA 5JAVA 3H0GH 2G9HD 3CPWA 1L1OA 3NUCA 4A4IA 4A3FG 1A0IA 4R4TA 4RHSA 1EY6A 3Q6SA 2IWHA 1PTOF 2OF1A 4TVAB 1STGA 5I4DA 2ICEC 1N36Q 4HEDA 1H9JA 2A69D 4LAAA 1B8AA 3UE0A 3QOJA 3CC2A 4DPGA 3SR1A 4EVOA 2C35B 4IFDJ 1XMQL 1HTPA 4C3JH 3WDNA 3TQYA 1WTRA 4DK3C 3F1ZA 2Q8IB 3AYHB 4O1NA 5LMUL 3CPFA 1E7ZA 1IBML 1N33L 3F2BA 2Z9HA 3DHQA 2A6HC 3D4DA 3M4OH 1UUPA 4GNXB 4YCVA 3A5ZB 1ASYA 2ZJQA 3MFYA 1O7ZA 2K33A 1WD1A 2HIVA 3GTOH 5D65A 1I4XA 3CMEA 3S2DH 4DNRB 3K5MA 3M7NA 1I6VC 4UP8A 2JEBI 1IHZA 1ZEQX 1F9PA 1I50H 5GQOA 1EFID 2RQXA 2F0VA 5E4XA 1EQVA 2BA1A 3BDLA 4A3LG 1H9RA 4ALPA 1OO9B 3NBHB 4C56C 4DR1L 1AE2A 3P75A 1EU4A 1YNJC 4JI5L 4A3DH 3K5OA 4MTKA 1EZ8A 4JI8L 5IGDA 1E24A 1XNQQ 4KTAA 2HHHQ 3FPPA 5HY6A 4FO2A 2EY2A 3K8AA 5J39A 3K59A 1CK1A 1I4PA 2HT1A 1T5EA 1AFPA 3JAMi 4CKEA 1BBWA 1V8QA 1XTDA 2LXKA 1E3PA 3PUYA 1SE4A 3ER0A 4K8IA 3J7AV 2FXQA 4HN7A 5CORA 5EPLA 1PA6A 1U9RA 1LTGD 3C1FA 2F52A 1J5EL 1XPOA 2A73B 4DNIA 1C4QA 1CKNB 2ENBA 4UY8C 1IBLQ 4BY1H 2B8GA 1A62A 5AJ3Q 4CGYB 5L37A 3ICEA 1SNDA 4G57A 4KHZA 1KDCA 2JQOA 1SE2A 4B08A 4DF7A 1RJTA 1I6HH 5C4XB 2FMCA 4PMCA 4ZQ3A 2OTLA 4A3MB 5CBEE 1A15A 4JI3L 2KQ3A 1SE8A 4YWKA 1WTOA 1AP0A 4HCEA 3SHLA 3I7FA 3FHWA 3FMCA 4OIJA 2H1EA 2EJGC 1DJRD 3R8BA 1SBBB 1NJIC 1RTOA 1LTRD 1X54A 3Q22A 4FDBA 3SDZA 1EIHA 3NP8A 4C3IB 1HA5A 2PZWA 1N9WA 2NUCA 4EQPA 4KHPL 5IWAL 3HOYB 3F2DA 2B2TC 3NTKA 2JA8B 3HOZH 1AEXA 1EYDA 1W2BA 3JAML 3KBXA 1HNXQ 1EZ6A 4A3BH 3JAME 4B3ML 2TSSA 2R93H 4APVA 3L2PA 2LSSA 1ET6A 3I4OA 2E2JB 4XXEA 1E2ZA 1Y8OB 4UHVA 2O5IC 5ELDA 4I7ZC 2KEEA 1GUNA 1WTWA 3EN2A 3C1EA 4GLAC 3GTPH 1HCZA 1IW7D 2IX3A 5CC4A 4AYBB 1CI3M 3CF5A 1PTOC 1FVIA 1SN8A 1N34Q 3HOVH 1L2FA 4UDUC 5C6AA 3JAMc 3DWAA 1PVOA 4QUCA 4K5XA 1B7YB 3E9IA 3PUZA 4YY3L 2B39A 2VL6A 3OMGA 5J3BA 4A3GH 3GTJB 2E76C 4PMWA 4WFN3 4JV5L 3F2CA 2VQEL 1WTXA 2YU9H 2Z6KC 5FO9B 4IFDG 4A3EB 2A19A 5C4XG 3HOWH 4R9WA 3BYTB 1VS0A 1Q8KA 3E3XA 4M1UB 4A3MG 3QOLA 5IP7H 2F4VQ 1VQFA 3J81j 1B3AA 2SDFA 2YV5A 1EOTA 1JOQA 4KD3A 5I2YA 1QILA 1UEAB 3K81C 2OWOA 1B44D 4TSSA 1JORA 1EIYB 4DA2A 1CZWA 3ULJA 3IFDA 3TBIB 2K50A 3MXNB 4RGMA 2AKWB 3DM1A 4C3IG 2KOLA 4A3FH 1Q90A 2AWOA 1TWFB 3HOYG 4OX9Q 2JA8G 2Y0SE 2LS01 4FNFA 1BCPB 4O2DA 4BS9A 4MHEA 2X6GA 1VQIA 5D14A 1JICA 4K0KQ 1K28A 1X55A 1HFGA 3S16H 1VQEA 1VQNA 3NQTA 2K5HA 5C44H 5D3IB 2PZTA 1EQTA 2CW0C 2K5DA 3NTIA 5ELCA 4QIWB 1D5ZC 1JR0D 3HFZB 1WFQA 2HQLA 2RBMA 1EIFA 1PFSA 1TY2A 4HIKA 4LFBQ 5I9PA 2PMZE 2C5CA 4DUYL 5HGTA 1STHA 3E0JA 3K80C 3RR5A 3H3VI 1KAAA 4B3SL 1G51A 3HZXA 4H13C 1Q1EA 4AYBG 5DAUA 4LK1C 4Y7NH 2JA6B 4A3IG 1Y1VG 1ICWA 4RGTA 3J80i 5FLMG 1AN8A 4MTNA 2V1CC 2F0NA 2MNAA 2L15A 2KHJA 2JJQA 4C2MH 5KEEA 1TWGB 2UUAL 2O5JC 1A3UA 3E9HA 1E1TA 2BH2A 5C4JH 4GNXA 2DUDA 1WVLA 4LW1A 4DR3Q 5IYDG 4A3EG 1BUVT 5D3DA 2A74C 1M4VA 2YYZA 3D6CA 4WJ4A 3TP5A 1RODA 4DXFA 1VQDA 3MVVA 5JJIA 2Z6BA 4FF1A 1CUKA 2KJXA 1C48A 3HKZG 4GKKL 2A5HA 3RZOB 2K5VA 3TP7A 3OTOQ 3VA7A 1HQMC 3PO2H 4DFAA 3MXGA 2B2WC 3NBHA 3OIPA 4FYDA 3T1HL 4X6AH 1YITA 1EU3A 2AQ2B 2DJFC 4LUZA 1OTCA 3Q0AA 4POGA 1N8RC 3O13A 1D7QA 1VQJA 3BZKA 1HRJA 4R1JA 4L5RC 1UAPA 3X3NA 2ID0A 2A6ED 4YIJA 3J80L 2XRSD 3BVZA 3CRLC 3GTMB 1E2VA 4JOIA 1L0WA 3RMHA 1KLUD 2CQOA 3GTKH 4OO1I 1YNJD 1KRTA 3TREA 3SE0A 3M3YB 2KA7A 4KLKA 1VMPA 1CKNA 4PZ8A 4UP7A 4YHHL 2NN6G 1SJHD 2ATWA 4C3HH 1A2TA 3Q23A 3AMUA 1MSGA 2AUJD 2IX1A 2BDOA 5NUCA 1TY0A 3OOCA 4ZUJA 1XMQQ 2JA6G 5ELOA 1G6PA 4CDEC 3TZUA 5LMUQ 4FXDA 1LTSD 1STBA 3J80c 5IYBG 1IBMQ 1PH2A 1N33Q 3P20A 1E1OA 2KCMA 2D0OA 3RN2A 2NTSA 5CV7A 5C3WA 2GVBA 1JWMD 4C1NI 3MA2B 4YCWA 4L5QA 2D0PA 4OHJA 4NPSA 1DYQA 1MIUA 1LTTD 3S1MH 4K2LA 4BY7H 1QZHA 1OXSC 2MFIA 3BS1A 1N34L 3TDQA 2SNSA 1GHJA 1EFWA 1ESFA 1B2TA 2WFWA 1TXYA 2OCEA 3S9WA 2NVYB 1CA6A 2QKIC 2X69A 1TWAB 2OTJA 1I3QH 3I4MH 2JEAI 3RZDH 4QCLA 4J8QA 2F0EA 1K0SA 4DR1Q 5J22A 2XIWA 2KHSA 1KD1C 1SR3A 5AFWA 1LTBD 4JI8Q 3JC66 3KFUA 1PRTB 2F4VL 1V43A 1PTOB 5IOCA 4UAIA 1X65A 3C46A 1YIJA 4IFDH 2PNHA 2HCIA 3CCLA 3WOEA 1I4HA 4DAPA 4IPHA 2R7ZG 1QUQB 1WTPA 5ELEA 1J9OA 3BYYB 4OWXB 3GP7A 1TVXA 1J5EQ 2L0CA 4KY6A 3R2TA 4OXPA 2F0FA 1G91A 2NTTA 3TP8A 1W6KA 1H9KA 1PFMA 2K03A 4A75A 1V1OA 1SSOA 2B2YC 2B29A 1CHPD 1IW7C 1CT1D 3K7AH 4DV4L 2CQAA 2Q2UA 3PO3B 1SFOH 1CKMA 1SYGA 3R93A 4JI3Q 2DJGC 5IGEA 1IL8A 2K5WA 3KDFA 2JA8H 1IKMA 2K14A 3EA6A 1TS2A 5JPNC 3GDEA 1LT3D 1E0BA 4N9TA 1ASZA 1TIID 3CCVA 5E1FA 5C0XI 4G7ZC 3CC4A 3K0YA 3SK4A 3URYA 1TR5A 3MAQA 1GKHA 3MTSA 4DXGA 3U50C 1MGSA 4G7HC 4JG2A 3MXNA 2EYOA 4KHPQ 3D4WA 5IWAQ 4RH6A 2YTXA 3U58A 4BA2I 2ZM6L 4FF3A 4X64L 2B2UC 2EDGA 5DLQE 1R4QB 1IYVA 3VYSA 4RGOS 2B2VC 4B3MQ 2CH4W 3PIO3 3P7JA 1PHJA 2MHVA 3BJUA 3VYUA 3PMFA 4A3IH 1Y1VH 2N8NA 4DR7L 4IPGA 4DU9A 1LLRD 4HIMA 1EWHA 1TQOA 5CV6A 1KIXA 2RDFA 1EY0A 1K83B 1Q1BA 1S40A 3NENA 3D3RA 2HDMA 3IRBA 2XVSA 5M5YB 2WAQE 1NAPA 4WORA 2UXCQ 4DV6L 2E2IH 5IYDH 3KF6B 1UE7A 5TSSA 2E8GA 4LF9L 1K8AC 4IUVA 3CQZB 1D6EC 1QB5D 3G7LA 2RVLA 1VQPA 5EKIA 1BVSA 3TS2A 2CW0D 2XSCA 2HIXA 1RDPD 1O78A 4XYQA 2ZJRA 5I6YA 1TWCB 3VR2A 1GXDC 1HZCA 4RG1A 4JV5Q 1HZAA 2KHIA 2R7FA 5IYCG 2F0LA 2VQEQ 2D9UA 2HCCA 1WTVA 1VQCA 5LMNL 3CU7A 2HUGA 1B50A 4JI6Q 1S72A 1DGSA 1OXVA 1Y8NB 3GV6A 4U68A 1TWFH 3V96A 5IY0A 3ULLA 4MN3A 1BBXC 3MZ5A 1G2TA 1SLJA 3FKIH 3UDIA 3I56A 1TWHB 5JJKA 1XPUA 1ENFA 2BH8A 3NPPA 3GTLB 2WB1B 3STBC 1L0XB 2N49A 1B53A 4BXXH 1STEA 4J15A 4HSPA 1FNWA 4XT3B 2NVXB 2NZHA 1WTQA 1GD7A 2VB3X 2NN6H 4N8X1 3V2TA 4XQJA 3QWNA 4LF5L 3BZCA 1K8OA 1XYIA 2AMCB 3KOJA 1Y14B 3FP9A 1YZ6A 1X56A 3PV0A 1OXTA 1WJJA 1IKLA 1X3EA 3KBGA 2MGSA 1EY7A 1JC7A 3ERSX 2QEXA 4EGVA 1DM0B 2JXMB 2KUMA 3T51B 3NQIA 2C9OA 4QMGA 4DUYQ 1C9OA 4LWCA 4OONA 2CWPA 3OHXC 1YVCA 4B3SQ 4LF4L 1KDBA 3S15H 1FYCA 2ZTEA 1IZ6A 2A6EC 3FEWX 3GO5A 1ICFB 1VQ8A 3A56A 1SNOA 2F0DA 3S2HH 1CZGA 5BN4A 3D0FA 1WCMB 2FJ2A 3GTGH 4IALA 1WD0A 2JA5B 1VQKA 5ELNA 3A5UA 1B1ZA 4BBRH 4HJ9A 2UUAQ 3DMUA 2EE1A 5KYIA 3LWEA 2A1AA 2XGTA 4KJNA 4LUOA 1QZGA 1SNQA 2J0TD 4NXML 4CHTB 3S1QB 1L1OC 1NUCA 1TS3A 1HXYD 3X3MA 2QGQA 2JE6I 1OXXK 4HR7B 1VQMA 2EJFC 3UE1A 1JE5A 2JA7H 5I9OA 1A2UA 2BA0A 2NZ1D 1Q86C 3S1NB 3HP3A 3NWSA 4GKKQ 2WP8J 4RA8A 1X32A 2R7ZH 3E0EA 4IUUA 1BDOA 5LHY1 2R61A 1L0YB 2WB1G 3T1HQ 5KYLA 4DKAC 4WJWA 5IP9H 1JE4A 2VW9A 1HJPA 5GAGC 2SOBA 2IPKD 2ZJPA 1SYDA 3D31A 4JI7L 5JEAG 3DWQA 2K32A 4ZAIA 4TRDA 1GUGA 1QUQA 3UI2A 4MIUA 5IODA 2AUKA 1LO5D 3S14H 4A93B 4DV3L 2Z6KA 1VQ9A 4BBSB 4IN3A 1V1PB 2OQKA 2J4XA 4OEMB 3D8GA 2K7VA 5IE8A 1TU2B 3NELA 1TS4A 4YHHQ 2K6AA 1IYUA 3LX0A 3AFPA 2IL8A 1FR3A 1SNMA 3GQBA 1R9TB 1SNPA 1B70B 1NR2A 1Q3LA 5C3EH 1QCBD 5M5XH 4R4CA 5E7NA 4ZUIA 1PYSB 2B8FA 4CDFC 1HH2P 3EIVA 1WCMG 1W6JA 4RFBA 4F7XA 2JA5G 2JN4A 1M8AA 2NVYH 2L55A 1PZID 2XRQD 1JMCA 2L1BA 2VUMB 5J1ZA 3G4SA 1GM5A 4K5WA 5M3MB 1KNEA 4EQ5A 2UXCL 1K73C 4XIGS 5M5WB 1PXUA 4Z9CB 2X6LA 2FINB 3I2ZA 3BDCA 4NMZA 4DV0L 1HZBA 2E5LL 2RKSA 2EY6A 2FFKB 4A76A 4DGZA 3BDOA 3A8IE 4JI2L 1S5BD 2IT1A 1E22A 2Q8TA 3SK6A 2CHBD 4O0AA 3ZJYC 1U5KA 3MXUA 4YWLA 1YJWA 2KCNA 4H7BA 2Z1CA 3MEHA 2F0WA 2XNAC 3QG1A 4JI6L 2EYJA 1O7YA 4X3TA 3RUZA 3S17B 1KL9A 1H95A 4HJ8A 3DWPA 1ML0D 2JYOA 3KDFB 4HIOA 3I55A 4JBMA 1SXTA 1LT6D 3L9AX 3KF6A 3I4NH 4IUNA 2OXPA 4ME5A 4OO1G 5M3FB 1V1QA 1Y1WB 1B3QA 2IHEA 2RDGA 3B6YA 4O42A 4A93G 1IBKL 1F9QA 1BXTA 1JOOA 4BBSG 3LNNA 2NB0A 2B63B 4YCUA 1DONA 3SXHA 5E3FA 4J1MA 4GOPB 4DR5L 2F0KA 1VQ6A 4DV4Q 4RGNA 4LFCL 2F1MA 3M4PA 5CV9A 2FHTA 3W1GA 2F0JA 2UU9L 2PCFB 1Z47A 4J6HA 3CRKC 2ZXPA 4TKOB 3I73A 4CJ1B 4KI0A 5CYUA 4GLXA 3H0GB 2ZXRA 2PI2A 4V190 2R3ZA 3AFQA 2EOTA 3HOXB 3FVQA 1JOKA 3AB9A 5A35A 5LL6X 2VUMG 2K1BA 2CVRA 5M3MG 4DAYB 2K75A 3T4AC 2SEBD 2DN8A 4ZRZA 3CHBD 5EKKA 2F0TA 1PZJD 1EYCA 2ZM6Q 3S1RH 1SAPA 4L8JA 4X64Q 1GJXA 4DR6L 1ENCA 1XTCD 4P73A 4C3JB 4K2KA 4XQNA 1FJGL 1V9PA 1CQVA 1TS5A 2Q2TA 1VF7A 2I07B 4K6LA 4RHRA 4DR7Q 2F0QA 3U4ZA 3GV3A 5COYA 4A3LH 3STBD 1MI2A 4CKBA 3M4OB 1YJNA 1X3GA 3CW2C 3CCEA 1I4QA 1WTHA 2WKCA 3SK5A 3GTOB 3S2DB 1EEFD 2UXBL 4JI1L 4DV6Q 3VR4A 2NVTH 2UUCL 2E2DC 1SMXA 3BU2A 4LF9Q 2CH4A 5JVH3 1YBYA 1Q8IA 1H9SB 5M3FG 5CV4A 1Y1WG 2JSOA 3T16A 1GUSA 4R8IA 2BDNA 5CMDA 2HDLA 2GVAA 3DM3A 3VDYA 3TMEA 4I7AA 1Q12A 2G5DA 4CJ0B 1C7YA 3FDTA 5E4WC 1PH9A 4LNQA 1SYBA 3UDXA 5DNFA 1GOZA 4A3DB 5LMNQ 1TWHH 2B63G 4DV7L 4HAEA 3HGBA 1FL0A 1MHWC 1EYGA 3C2PA 4E6IA 4DV5L 1KXLA 2D5DA 2PQAA 4FXGC 3HEJA 5C0XG 5EBCA 5ELFA 3KLWA 4JI0L 3CCJA 3J80E 1Q82C 4KKUA 3LWUA 1K8GA 5JEAH 1SYEA 1YNXA 3E5SA 4IFDI 3H0GG 4FF2A 1FGBD 2DNCA 3J7YW 3MC0B 1PV4A 3HOXG 1P8LA 1G8ZD 4BY1B 4DR4L 2K5QA 2NVQB 4PNYA 4Q0FA 1PH1A 2CWAA 2K04A 3KLRA 3A55A 5A2QL 4QUFA 2M00A 1I6HB 1MJCA 3C3LA 4LF8Q 3H94A 3MWYW 3H3VH 2LMCB 2WACA 5T1GA 2IW3A 3J7A5 4GNXC 5HURA 5GAHC 3SEBA 4ULLA 4LF5Q 3PIP3 5ISRA 3U4VA 2D62A 3L7ZC 1LT4D 4K8JA 3QB3A 4UP9A 2YTVA 4L63B 4KD4A 5FJ8G 3LGJA 1H9MA 1UWVA 2PW7A 3VR3A 2B2YA 4ZK9B 1V1PA 4QQBX 1VQHA 3HOZB 5EJWA 2UXDL 4LF4Q 4NP5A 5JJLA 1GUWA 5IIFA 3DLLA 5FKAC 3A74A 2QDBA 2NWGA 2Z4HA 5IT9L 3PUVA 4L5TA 4A3BB 1Y8PB 2I5MX 1VCIA 2R93B 4QB4A 3ND9A 5HGQA 4DNTB 1QG7A 4AYBE 3EFXD 2PPBC 3A7LA 3L0OA 2I0QA 2QEJC 2RHSB 4A3DG 1RKNA 4X3SA 4NXMQ 4UPAA 2GN5A 4EX5A 3GTPB 1EYAA 5C4XH 4PZ7A 3K58A 3I91A 1A6XA 2VS1A 4A3MH 1K9MC 1UNSA 3D6WA 1STYA 2AWNA 1MKHA 4A3JB 1KC8C 3HOVB 1C0AA 2AHOB 4LMQD 1S5DD 2N88A 5IT9c 1EL0A 1SEBD 3PSIA 4XDXA 4X66Q 1SRUA 4A3GB 3U9SA 3NK9A 4LF6L 2N78A 4ZKCB 1J6QA 3DEPA 2EXDA 4BY1G 4HTHA 2YU9B 4OWWB 4C3IH 4DUZL 3HKZE 1CHQD 4LJZC 3HOWB 1EY4A 2PYKA 4R8NA 4JI4L 3HOYH 4BBSH 4IO9A 4JI7Q 1HA6A 1EWIA 2OQ0A 1BNZA 2EXZA 3A8KE 5JVG3 3K7UC 1PZKD 4GKJL 3PCOB 3CCSA 2F0OA 1WYDA 2LXJA 1PRTD 5JOBA 1KTKA 1X3PA 5K5PA 1Z9FA 4ODGA 4DV3Q 2E2JH 1J8IA 2F3VA 2K5NA 3SK8A 4GLVB 1NNXA 3HRZC 4A3FB 1O80A 1RHPA 1PDQA 1B9MA 4GOPA 4JPBW 2VUMH 1LTAD 2I5HA 1XMOL 1XPRA 5M3MH 5G3LD 2LFNA 4Y52H 2PQEA 1XJVA 5JEAJ 1FGUA 1X9NA 4A3BG 1O7IA 1YHBA 1FD7D 2R93G 3IKJA 3G71A 3S16B 1A3VA 3VYRA 5FLMH 1PH8A 1ZKOA 4LFAL 4IZ8A 1U0LA 2VQFL 3KJPA 4LUVA 5C44B 1CTMA 4NXNL 3GTJH 1SNCA 4F88A 2IHFA 1YI2A 1KRSA 4GZYC 3PF5A 1X3QA 3WWVA 2F3WA 4JC0A 3FRPB 1MBYA 4DAYA 3BVGA 2ICIA 2Z8LA 4A3EH 2E74C 1C8CA 4KHVA 4DV0Q 3QJYA 2E5LQ 2PO4A 4Y7NB 3U9OA 4ZKBB 2ZXOA 3SVMA 2PZUA 4A3JG 3HOVG 1NMFA 2EYLA 4JI2Q 2ZTCA 3R3OA 1QNUA 2MO0A 2BCOA 4C2MB 4A3GG 2E75C 3CCMA 2H5XA 3M4YA 1PYWD 3WOFA 3CC7A 4HJ5A 5C4JB 1AW7A 1CM9A 4B3TL 3PO3G 4H02A 4PMBA 4POFA 1XNRL 1VMCA 3HOWG 2IY5B 1HUNA 1EWCA 1RL2A 2HD3A 3VA5A 5IP7G 4IPCA 4TQUS 1UE1A 3KLSA 1T5XD 2F0HA 3E6ZX 4RCOA 1H9SA 5BN5A 1SJED 2O2LD 4G7OC 3SGIA 4HIDA 1CSPA 1BCPC 2Y0SB 3KF8B 2QA4A 4LF7L 5IGCA 3PO2B 3OW7A 1S5ED 4DK0A 2F4IA 2NBFA 4KV6A 1IBKQ 1CSQA 4JK1C 3OSOA 3CCQA 1K8MA 1S3OA 1HNWQ 4P74A 4LF8L 4XQQA 1PRTF 1A3TA 4DR5Q 3HOXH 2ALYB 1HTLD 4KY5A 2IJ0A 1VQLA 5KNDA 2AQ3B 1EOVA 3T56B 4LFCQ 2DGYA 5CBAE 4B9XA 2UU9Q 4P2CB 4DAMA 1IL2A 1PH7A 2JA6H 3D4RA 4R4OA 4CBVA 4HMIA 2L12A 1SYCA 4KK7A 5G3LF 3NHHA 3IFTA 1NSNS 2EYFA 1EY9A 2PMZB 3DXJC 4A3KB 3PQIA 5C44G 3GTKB 5IYBH 1EQRA 1EQQA 3T13A 1OXUA 1TWGH 1ENAA 2L11A 3CKIB 1B9NA 1AZQA 2EY5A 1N32L 5FJ8H 4C3HB 4MZ9A 4KKSA 1FNVA 4HJ7A 4B3RL 1B4OA 4DR6Q 1HR0L 1II3A 4EQOA 1FJGQ 1KQSA 1LT5D 1G6ZA 2K4KA 3GTQB 2KECA 1ZYRC 3OIQA 4DV1L 1O7LA 2A8VA 4AQYQ 1ESRA 5T1IA 3UDGA 1Q7YC 3CD6A 2M2LA 1D2BA 1BBUA 3RZOH 5ELBA 5GROA 3G6JB 3PIOA 2Z0SA 2B2TA 2KCTA 2ASBA 2H4OA 2UUBL 5EGTA 2PQAB 1T9HA 2JP1A 1STNA 1HNZL 2EJMA 2Q2IA 2EPBA 3NTHA 4HJAA 3S1MB 2EQSA 2WV6D 3PUWA 2WKDA 2UXBQ 4BY7B 4JI1Q 5IGGA 2UUCQ 5FO7B 1IXRA 3EJIA 1W3SA 3TN2A 3IAYA 1JT8A 4X66L 5LL6S 2ZT9C 4DV2Q 1I94L 1A63A 2MO1A 1I3QB 2V4DA 1QVFA 3I4MB 4IJHA 5H1SE 3GTMH 4FXKC 4M8AA 3RZDB 2Y0SG 2GA4B 3W5OA 1UEBA 1XX8A 3PO2G 3P1HA 4ZYSA 4P71A 3M3YH 1DOKA 3OMCA 1XWEA 2R7DA 5M9OA 4DV7Q 4CDCC 1F2ZA 3I4LA 4AIMA 5BN3A 2F0MA 1SMYC 1U4RA 3I70A 1LV9A 4DV5Q 4XYOA 2NVQH 3QO2A 4K6DA 1S4ZA 4DR2L 1QJOA 3H15A 4JI0Q 1M1KC 3MEFA 4QF4A 1BOSA 5FOBB 5C5LA 1I4RA 3AEVA 1ONLA 3CCRA 4A3CG 4A3KG 1HQRD 2MQHA 2RA4A 1NCVA 2BOSA 3PGZA 3A0JA 4KN4C 1NY4A 3J7AF 4DR4Q 1BF4A 2R92B 1MD2D 5KNBA 1VQAA 4KMUC 1UE5A 4IPDA 4X65L 3ULPA 4C3HG 1KAWA 5BR8L 3K7AB 2JK8A 1SFOB 2K52A 3J7ZC 2E2HB 1DOMA 5GAEC 3NSWA 5C0XJ 4QGUA 1U4LA 2EVBA 4ID6A 1YNNC 2D2CC 2MP1A 2KCCA 1LTID 2XN9C 1TWAH 1F9SA 2RF4A 4L5SA 4FP5D 3J81i 4XTCS
chains in the Genus database with same CATH topology
4CDEC 4CDFC 4CDCC 4OELB 1K3BC 2DJGC 2DJFC 1ICFB 4CDDC 4OEMB 1MHWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDE C;  4CDF C;  4CDC C;  4OEL B;  1K3B C;  2DJG C;  2DJF C;  1ICF B;  4CDD C;  4OEM B;  1MHW C; 
#chains in the Genus database with same CATH topology
 4PG3 A;  1KLG D;  1U4M A;  2HQE A;  4X62 L;  5IGB A;  3KYH C;  4F8M A;  2LKV A;  4BY7 G;  2UXD Q;  4DAV A;  2KVM A;  1PTO H;  1VQ4 A;  1CKO A;  3NXW A;  3VYT A;  2L5T A;  2QW7 A;  1GO3 E;  1PRT C;  1GUT A;  3I4M G;  1ILP A;  1PFN A;  4A3I B;  1Y1V B;  4A3J H;  3N6R A;  3A54 A;  1AZP A;  1IYJ B;  5LMN W;  2QDL A;  4PZ6 A;  4G4K A;  3M9B A;  4OIK A;  1PMR A;  1K0R A;  1Z7T A;  4OEL B;  1F2Y A;  5IYC H;  3BVM A;  1Y69 U;  3TP6 A;  4EQN A;  4GS3 A;  1PH3 A;  1NBW A;  1M90 C;  1LM0 A;  2F3I A;  3K6O A;  4ZLT F;  1LAB A;  1VF5 C;  2E2I B;  5EKL A;  3PO3 H;  3T1Y Q;  2R6G A;  4JYA L;  1BO0 A;  2RDH A;  1U4P A;  3CP0 A;  1KHI A;  3HKS A;  3RLF A;  1I5F A;  1NR4 A;  3BZD B;  3EVQ A;  2G9D A;  4RKB A;  4ME3 A;  4LF6 Q;  1HNW L;  1MJE A;  3W3A A;  3J81 L;  2R92 G;  1JQY D;  1VQO A;  3HOU B;  3HKZ B;  5K36 G;  1LTL A;  3AQQ A;  3J81 E;  2TMP A;  3EBE A;  1BQQ T;  4R4I A;  4JBK A;  3MFG A;  3HS0 C;  1KAB A;  3A7A B;  3NWT A;  4DUZ Q;  2PW5 A;  3M85 A;  2A68 C;  2PI2 E;  4DK6 C;  3OPO A;  4JI4 Q;  4S3S A;  4ABN A;  1R4P B;  1N36 L;  1S5C D;  2EIF A;  1JWS D;  1XXG A;  3S24 A;  1UE6 A;  3NBI A;  2EZV A;  4GKJ Q;  1EY5 A;  2WB1 E;  1LUZ A;  4H44 C;  4IQZ A;  5EPK A;  1CA5 A;  2B2W A;  1JJC B;  4YWM A;  3RD4 A;  1QWY A;  3FKI B;  4IUR A;  2F0U A;  1TKW B;  1BR9 A;  3G6E A;  3CMA A;  1SRO A;  1EY8 A;  2KED A;  3KF8 A;  4JBJ A;  3T53 B;  3J81 c;  4BA1 I;  4GN5 A;  2VXW A;  1K83 H;  2O4X A;  3M4Q A;  3K57 A;  1TT2 A;  1JB7 A;  1XMO Q;  1AE3 A;  2F0P A;  5M5Y H;  3H91 A;  4U67 3;  1HR0 W;  1F9R A;  2J7Z A;  4AQY L;  3KK7 A;  4I65 A;  5KIX A;  1BCP D;  4NDX A;  3CQZ H;  2BE5 C;  4LFA Q;  3V05 A;  2VQF Q;  3ZYY X;  2WAQ B;  1RCV D;  5CR3 A;  1PH4 A;  4NXN Q;  1STA A;  4IOC A;  3TRZ A;  3W2D A;  1TWC H;  1QVC A;  1EUJ A;  2VY3 A;  3PF4 A;  3RN5 A;  1XNQ L;  4JW0 A;  2I46 A;  2HHH L;  2N3S A;  4PV1 C;  1P16 A;  3F8T A;  1Q46 A;  3S15 B;  1K3R A;  1I50 B;  1CFM A;  4GN4 B;  4DN4 M;  3ERQ A;  2A69 C;  3OWF A;  4DV2 L;  1QVG A;  5F2D A;  1HZ9 A;  3S2H B;  3K0X A;  3F2U A;  3GTG B;  3OWE B;  5GAD C;  1SYF A;  4P75 A;  1D1I A;  4AH6 A;  1X3F A;  1L1O B;  4BBR B;  2XWJ B;  4GN3 B;  3G48 A;  2VZA A;  3N52 A;  4RMF A;  2EYP A;  3HOU G;  2F0I A;  2A6H D;  2P5Z X;  3GTL H;  1IBL L;  4B3T Q;  2M9V A;  5AJ3 L;  2F0S A;  2EYH A;  4RWS C;  1XNR Q;  3VR5 A;  4C1N K;  3CXC A;  4V0B A;  4RCN A;  5I6W A;  3RLN A;  1VQB A;  2NVX H;  1QE6 A;  4K14 A;  2JA7 B;  4X3U A;  1ZYR D;  3I3C A;  4H0L C;  1YHQ A;  2PNR C;  3ND8 A;  2CKZ B;  3ITP A;  3FKI G;  3DEO A;  4KKT A;  2Q2H A;  4LF7 Q;  2R7Z B;  4IUQ A;  3H6M A;  2KEN A;  1FNU A;  4L6T B;  4KN7 C;  1D8L A;  4A3C H;  3NEM A;  5A2Q E;  4A3K H;  2OT2 A;  3MXP A;  1D5X C;  2RCF A;  2F03 A;  4BXX G;  5FLX L;  4C3J G;  4WRD A;  4RAU C;  5FLX E;  2QCP X;  3PUX A;  2AQ1 B;  3H3V C;  1AH9 A;  2DY8 A;  4N9P A;  3I72 A;  1WOC A;  2K01 A;  1JCK B;  2DNE A;  3AU7 A;  1HNX L;  1KNA A;  2WII B;  4IUP A;  4JCV E;  1PLF A;  4CJ2 C;  1WCM H;  3S14 B;  2DY7 A;  2JA5 H;  2WAQ G;  2B3G A;  1G29 1;  1LAC A;  3UDF A;  3GTQ H;  4R4Q A;  1VQ7 A;  1A8V A;  1GHK A;  3H09 A;  2I5L X;  2L9H A;  3M7G A;  4NW2 A;  4QJF A;  1BCP F;  4HMJ A;  4KJO A;  1N32 Q;  2K05 A;  1SMY D;  2IX0 A;  4Q5V A;  3CCU A;  4KY7 A;  3S1Q H;  1DCZ A;  1D5M C;  5DM6 3;  5EAY A;  3QR8 A;  3TEH B;  4B3R Q;  5FLX c;  2ES2 A;  5IT9 E;  1HR0 Q;  1SDF A;  5C3E B;  2RHQ B;  2XTI A;  2YTY A;  4DV1 Q;  3OW2 A;  5M5X B;  2CFM A;  2QF7 A;  1F2L A;  3S1N H;  1I4G A;  2VNU D;  1EIG A;  3OYY A;  1GUO A;  1YEZ A;  2FMM A;  5I2X A;  4BBR G;  3ONA B;  4F87 A;  4JOI C;  5FO8 B;  2UUB Q;  2B2U A;  5KRU A;  2RSO A;  1S5F D;  4HCS A;  4X3K A;  3I8Z A;  1HNZ Q;  4CDD C;  5DM7 3;  2K28 A;  4BWG B;  2B2V A;  4PQX A;  4IOA A;  4JI5 Q;  3T1Y L;  1WI5 A;  3CAM A;  2LY7 A;  2EYM A;  5DEH A;  3DUZ A;  4FF4 A;  1HUM A;  3IL8 A;  2JA7 G;  4P72 A;  1YNN D;  1I94 Q;  1G2S A;  4OO1 H;  2VB2 X;  4NKL A;  1D1K A;  4K5V A;  3K5L A;  5EPJ A;  3A8J E;  3Q8D A;  1PH6 A;  1EEI D;  1RIP A;  2MJ8 A;  4A93 H;  3HG9 A;  1PH5 A;  3VR6 A;  5IP9 G;  1QNK A;  1JB3 A;  1DD2 A;  1VQG A;  2R92 H;  5K36 H;  1LYL A;  2WIN B;  4IJL A;  4OX9 L;  4DR2 Q;  1BKB A;  1MSH A;  1R9T H;  3TSS A;  4FVM A;  4RKL A;  3I4N B;  1HHV A;  3KLS X;  4K0K L;  1PTO D;  2XWB B;  1GVP A;  2E2H H;  2RSN A;  3BG3 A;  2RCN A;  3TZD A;  2NYZ D;  2Q8R E;  5EBD A;  3TS0 A;  5JJZ A;  3HOZ G;  1JWU D;  5CV8 A;  4X65 Q;  5IGF A;  1JJ2 A;  2MUY A;  5BR8 Q;  4QIW E;  4LFB L;  4N8F A;  5C5M A;  4WJ3 M;  5M5W H;  2EY1 A;  1K3B C;  2ZTD A;  5C3E G;  1RD9 D;  1NMG A;  2NN6 I;  5C3X A;  2QIL A;  5C4Z A;  3K5N A;  1CQF A;  2OEO A;  3I90 A;  1DZ1 A;  2F0G A;  4NB3 A;  1VDZ A;  4OWT B;  2SNM A;  5KNC A;  5EQ0 A;  3PIP A;  4B9W A;  1HPC A;  1ZXT A;  5FK9 C;  2CCZ A;  2A68 D;  4X62 Q;  1F2M A;  3S17 H;  4DR3 L;  3KUP A;  3S1R B;  1ET9 A;  1NE3 A;  4JBW A;  5CV5 A;  3MHB A;  1DXM A;  5CGK A;  2MPM A;  2Z4I A;  4JVZ A;  2N55 A;  5KGU A;  3NE5 B;  2NZO A;  4MNO A;  1YJ9 A;  5M3F H;  4OL7 A;  1Y1W H;  1KDA A;  1SE3 A;  3KJO A;  3L3O C;  5JPM C;  1Z6H A;  4XT1 B;  1E2W A;  4YY3 Q;  3EQL C;  1RTN A;  3OTO L;  1PFB A;  1Q81 C;  3RLO A;  3Q24 A;  1JJG A;  3GD7 A;  1ILQ A;  1HFN A;  2B63 H;  1YHA A;  1X6O A;  3ERO A;  4DK1 A;  3HOU H;  4OGQ C;  2L4N A;  4IUT A;  1PYB A;  3R2I A;  5C4H A;  2JA9 A;  2NVT B;  4HSV A;  4JYA Q;  1QOH A;  3FPU B;  5C0X H;  3I4N G;  3RNU A;  1VQ5 A;  1DOL A;  1NTG A;  2BE5 D;  4CKC A;  4GOP C;  2KBN A;  4QY7 A;  1RF2 D;  3W1B A;  4QL5 A;  1F77 A;  3QIA A;  4ILW A;  4ZCK A;  5JAV A;  3H0G H;  2G9H D;  3CPW A;  1L1O A;  3NUC A;  4A4I A;  4A3F G;  1A0I A;  4R4T A;  4RHS A;  1EY6 A;  3Q6S A;  2IWH A;  1PTO F;  2OF1 A;  4TVA B;  1STG A;  5I4D A;  2ICE C;  1N36 Q;  4HED A;  1H9J A;  2A69 D;  4LAA A;  1B8A A;  3UE0 A;  3QOJ A;  3CC2 A;  4DPG A;  3SR1 A;  4EVO A;  2C35 B;  4IFD J;  1XMQ L;  1HTP A;  4C3J H;  3WDN A;  3TQY A;  1WTR A;  4DK3 C;  3F1Z A;  2Q8I B;  3AYH B;  4O1N A;  5LMU L;  3CPF A;  1E7Z A;  1IBM L;  1N33 L;  3F2B A;  2Z9H A;  3DHQ A;  2A6H C;  3D4D A;  3M4O H;  1UUP A;  4GNX B;  4YCV A;  3A5Z B;  1ASY A;  2ZJQ A;  3MFY A;  1O7Z A;  2K33 A;  1WD1 A;  2HIV A;  3GTO H;  5D65 A;  1I4X A;  3CME A;  3S2D H;  4DNR B;  3K5M A;  3M7N A;  1I6V C;  4UP8 A;  2JEB I;  1IHZ A;  1ZEQ X;  1F9P A;  1I50 H;  5GQO A;  1EFI D;  2RQX A;  2F0V A;  5E4X A;  1EQV A;  2BA1 A;  3BDL A;  4A3L G;  1H9R A;  4ALP A;  1OO9 B;  3NBH B;  4C56 C;  4DR1 L;  1AE2 A;  3P75 A;  1EU4 A;  1YNJ C;  4JI5 L;  4A3D H;  3K5O A;  4MTK A;  1EZ8 A;  4JI8 L;  5IGD A;  1E24 A;  1XNQ Q;  4KTA A;  2HHH Q;  3FPP A;  5HY6 A;  4FO2 A;  2EY2 A;  3K8A A;  5J39 A;  3K59 A;  1CK1 A;  1I4P A;  2HT1 A;  1T5E A;  1AFP A;  3JAM i;  4CKE A;  1BBW A;  1V8Q A;  1XTD A;  2LXK A;  1E3P A;  3PUY A;  1SE4 A;  3ER0 A;  4K8I A;  3J7A V;  2FXQ A;  4HN7 A;  5COR A;  5EPL A;  1PA6 A;  1U9R A;  1LTG D;  3C1F A;  2F52 A;  1J5E L;  1XPO A;  2A73 B;  4DNI A;  1C4Q A;  1CKN B;  2ENB A;  4UY8 C;  1IBL Q;  4BY1 H;  2B8G A;  1A62 A;  5AJ3 Q;  4CGY B;  5L37 A;  3ICE A;  1SND A;  4G57 A;  4KHZ A;  1KDC A;  2JQO A;  1SE2 A;  4B08 A;  4DF7 A;  1RJT A;  1I6H H;  5C4X B;  2FMC A;  4PMC A;  4ZQ3 A;  2OTL A;  4A3M B;  5CBE E;  1A15 A;  4JI3 L;  2KQ3 A;  1SE8 A;  4YWK A;  1WTO A;  1AP0 A;  4HCE A;  3SHL A;  3I7F A;  3FHW A;  3FMC A;  4OIJ A;  2H1E A;  2EJG C;  1DJR D;  3R8B A;  1SBB B;  1NJI C;  1RTO A;  1LTR D;  1X54 A;  3Q22 A;  4FDB A;  3SDZ A;  1EIH A;  3NP8 A;  4C3I B;  1HA5 A;  2PZW A;  1N9W A;  2NUC A;  4EQP A;  4KHP L;  5IWA L;  3HOY B;  3F2D A;  2B2T C;  3NTK A;  2JA8 B;  3HOZ H;  1AEX A;  1EYD A;  1W2B A;  3JAM L;  3KBX A;  1HNX Q;  1EZ6 A;  4A3B H;  3JAM E;  4B3M L;  2TSS A;  2R93 H;  4APV A;  3L2P A;  2LSS A;  1ET6 A;  3I4O A;  2E2J B;  4XXE A;  1E2Z A;  1Y8O B;  4UHV A;  2O5I C;  5ELD A;  4I7Z C;  2KEE A;  1GUN A;  1WTW A;  3EN2 A;  3C1E A;  4GLA C;  3GTP H;  1HCZ A;  1IW7 D;  2IX3 A;  5CC4 A;  4AYB B;  1CI3 M;  3CF5 A;  1PTO C;  1FVI A;  1SN8 A;  1N34 Q;  3HOV H;  1L2F A;  4UDU C;  5C6A A;  3JAM c;  3DWA A;  1PVO A;  4QUC A;  4K5X A;  1B7Y B;  3E9I A;  3PUZ A;  4YY3 L;  2B39 A;  2VL6 A;  3OMG A;  5J3B A;  4A3G H;  3GTJ B;  2E76 C;  4PMW A;  4WFN 3;  4JV5 L;  3F2C A;  2VQE L;  1WTX A;  2YU9 H;  2Z6K C;  5FO9 B;  4IFD G;  4A3E B;  2A19 A;  5C4X G;  3HOW H;  4R9W A;  3BYT B;  1VS0 A;  1Q8K A;  3E3X A;  4M1U B;  4A3M G;  3QOL A;  5IP7 H;  2F4V Q;  1VQF A;  3J81 j;  1B3A A;  2SDF A;  2YV5 A;  1EOT A;  1JOQ A;  4KD3 A;  5I2Y A;  1QIL A;  1UEA B;  3K81 C;  2OWO A;  1B44 D;  4TSS A;  1JOR A;  1EIY B;  4DA2 A;  1CZW A;  3ULJ A;  3IFD A;  3TBI B;  2K50 A;  3MXN B;  4RGM A;  2AKW B;  3DM1 A;  4C3I G;  2KOL A;  4A3F H;  1Q90 A;  2AWO A;  1TWF B;  3HOY G;  4OX9 Q;  2JA8 G;  2Y0S E;  2LS0 1;  4FNF A;  1BCP B;  4O2D A;  4BS9 A;  4MHE A;  2X6G A;  1VQI A;  5D14 A;  1JIC A;  4K0K Q;  1K28 A;  1X55 A;  1HFG A;  3S16 H;  1VQE A;  1VQN A;  3NQT A;  2K5H A;  5C44 H;  5D3I B;  2PZT A;  1EQT A;  2CW0 C;  2K5D A;  3NTI A;  5ELC A;  4QIW B;  1D5Z C;  1JR0 D;  3HFZ B;  1WFQ A;  2HQL A;  2RBM A;  1EIF A;  1PFS A;  1TY2 A;  4HIK A;  4LFB Q;  5I9P A;  2PMZ E;  2C5C A;  4DUY L;  5HGT A;  1STH A;  3E0J A;  3K80 C;  3RR5 A;  3H3V I;  1KAA A;  4B3S L;  1G51 A;  3HZX A;  4H13 C;  1Q1E A;  4AYB G;  5DAU A;  4LK1 C;  4Y7N H;  2JA6 B;  4A3I G;  1Y1V G;  1ICW A;  4RGT A;  3J80 i;  5FLM G;  1AN8 A;  4MTN A;  2V1C C;  2F0N A;  2MNA A;  2L15 A;  2KHJ A;  2JJQ A;  4C2M H;  5KEE A;  1TWG B;  2UUA L;  2O5J C;  1A3U A;  3E9H A;  1E1T A;  2BH2 A;  5C4J H;  4GNX A;  2DUD A;  1WVL A;  4LW1 A;  4DR3 Q;  5IYD G;  4A3E G;  1BUV T;  5D3D A;  2A74 C;  1M4V A;  2YYZ A;  3D6C A;  4WJ4 A;  3TP5 A;  1ROD A;  4DXF A;  1VQD A;  3MVV A;  5JJI A;  2Z6B A;  4FF1 A;  1CUK A;  2KJX A;  1C48 A;  3HKZ G;  4GKK L;  2A5H A;  3RZO B;  2K5V A;  3TP7 A;  3OTO Q;  3VA7 A;  1HQM C;  3PO2 H;  4DFA A;  3MXG A;  2B2W C;  3NBH A;  3OIP A;  4FYD A;  3T1H L;  4X6A H;  1YIT A;  1EU3 A;  2AQ2 B;  2DJF C;  4LUZ A;  1OTC A;  3Q0A A;  4POG A;  1N8R C;  3O13 A;  1D7Q A;  1VQJ A;  3BZK A;  1HRJ A;  4R1J A;  4L5R C;  1UAP A;  3X3N A;  2ID0 A;  2A6E D;  4YIJ A;  3J80 L;  2XRS D;  3BVZ A;  3CRL C;  3GTM B;  1E2V A;  4JOI A;  1L0W A;  3RMH A;  1KLU D;  2CQO A;  3GTK H;  4OO1 I;  1YNJ D;  1KRT A;  3TRE A;  3SE0 A;  3M3Y B;  2KA7 A;  4KLK A;  1VMP A;  1CKN A;  4PZ8 A;  4UP7 A;  4YHH L;  2NN6 G;  1SJH D;  2ATW A;  4C3H H;  1A2T A;  3Q23 A;  3AMU A;  1MSG A;  2AUJ D;  2IX1 A;  2BDO A;  5NUC A;  1TY0 A;  3OOC A;  4ZUJ A;  1XMQ Q;  2JA6 G;  5ELO A;  1G6P A;  4CDE C;  3TZU A;  5LMU Q;  4FXD A;  1LTS D;  1STB A;  3J80 c;  5IYB G;  1IBM Q;  1PH2 A;  1N33 Q;  3P20 A;  1E1O A;  2KCM A;  2D0O A;  3RN2 A;  2NTS A;  5CV7 A;  5C3W A;  2GVB A;  1JWM D;  4C1N I;  3MA2 B;  4YCW A;  4L5Q A;  2D0P A;  4OHJ A;  4NPS A;  1DYQ A;  1MIU A;  1LTT D;  3S1M H;  4K2L A;  4BY7 H;  1QZH A;  1OXS C;  2MFI A;  3BS1 A;  1N34 L;  3TDQ A;  2SNS A;  1GHJ A;  1EFW A;  1ESF A;  1B2T A;  2WFW A;  1TXY A;  2OCE A;  3S9W A;  2NVY B;  1CA6 A;  2QKI C;  2X69 A;  1TWA B;  2OTJ A;  1I3Q H;  3I4M H;  2JEA I;  3RZD H;  4QCL A;  4J8Q A;  2F0E A;  1K0S A;  4DR1 Q;  5J22 A;  2XIW A;  2KHS A;  1KD1 C;  1SR3 A;  5AFW A;  1LTB D;  4JI8 Q;  3JC6 6;  3KFU A;  1PRT B;  2F4V L;  1V43 A;  1PTO B;  5IOC A;  4UAI A;  1X65 A;  3C46 A;  1YIJ A;  4IFD H;  2PNH A;  2HCI A;  3CCL A;  3WOE A;  1I4H A;  4DAP A;  4IPH A;  2R7Z G;  1QUQ B;  1WTP A;  5ELE A;  1J9O A;  3BYY B;  4OWX B;  3GP7 A;  1TVX A;  1J5E Q;  2L0C A;  4KY6 A;  3R2T A;  4OXP A;  2F0F A;  1G91 A;  2NTT A;  3TP8 A;  1W6K A;  1H9K A;  1PFM A;  2K03 A;  4A75 A;  1V1O A;  1SSO A;  2B2Y C;  2B29 A;  1CHP D;  1IW7 C;  1CT1 D;  3K7A H;  4DV4 L;  2CQA A;  2Q2U A;  3PO3 B;  1SFO H;  1CKM A;  1SYG A;  3R93 A;  4JI3 Q;  2DJG C;  5IGE A;  1IL8 A;  2K5W A;  3KDF A;  2JA8 H;  1IKM A;  2K14 A;  3EA6 A;  1TS2 A;  5JPN C;  3GDE A;  1LT3 D;  1E0B A;  4N9T A;  1ASZ A;  1TII D;  3CCV A;  5E1F A;  5C0X I;  4G7Z C;  3CC4 A;  3K0Y A;  3SK4 A;  3URY A;  1TR5 A;  3MAQ A;  1GKH A;  3MTS A;  4DXG A;  3U50 C;  1MGS A;  4G7H C;  4JG2 A;  3MXN A;  2EYO A;  4KHP Q;  3D4W A;  5IWA Q;  4RH6 A;  2YTX A;  3U58 A;  4BA2 I;  2ZM6 L;  4FF3 A;  4X64 L;  2B2U C;  2EDG A;  5DLQ E;  1R4Q B;  1IYV A;  3VYS A;  4RGO S;  2B2V C;  4B3M Q;  2CH4 W;  3PIO 3;  3P7J A;  1PHJ A;  2MHV A;  3BJU A;  3VYU A;  3PMF A;  4A3I H;  1Y1V H;  2N8N A;  4DR7 L;  4IPG A;  4DU9 A;  1LLR D;  4HIM A;  1EWH A;  1TQO A;  5CV6 A;  1KIX A;  2RDF A;  1EY0 A;  1K83 B;  1Q1B A;  1S40 A;  3NEN A;  3D3R A;  2HDM A;  3IRB A;  2XVS A;  5M5Y B;  2WAQ E;  1NAP A;  4WOR A;  2UXC Q;  4DV6 L;  2E2I H;  5IYD H;  3KF6 B;  1UE7 A;  5TSS A;  2E8G A;  4LF9 L;  1K8A C;  4IUV A;  3CQZ B;  1D6E C;  1QB5 D;  3G7L A;  2RVL A;  1VQP A;  5EKI A;  1BVS A;  3TS2 A;  2CW0 D;  2XSC A;  2HIX A;  1RDP D;  1O78 A;  4XYQ A;  2ZJR A;  5I6Y A;  1TWC B;  3VR2 A;  1GXD C;  1HZC A;  4RG1 A;  4JV5 Q;  1HZA A;  2KHI A;  2R7F A;  5IYC G;  2F0L A;  2VQE Q;  2D9U A;  2HCC A;  1WTV A;  1VQC A;  5LMN L;  3CU7 A;  2HUG A;  1B50 A;  4JI6 Q;  1S72 A;  1DGS A;  1OXV A;  1Y8N B;  3GV6 A;  4U68 A;  1TWF H;  3V96 A;  5IY0 A;  3ULL A;  4MN3 A;  1BBX C;  3MZ5 A;  1G2T A;  1SLJ A;  3FKI H;  3UDI A;  3I56 A;  1TWH B;  5JJK A;  1XPU A;  1ENF A;  2BH8 A;  3NPP A;  3GTL B;  2WB1 B;  3STB C;  1L0X B;  2N49 A;  1B53 A;  4BXX H;  1STE A;  4J15 A;  4HSP A;  1FNW A;  4XT3 B;  2NVX B;  2NZH A;  1WTQ A;  1GD7 A;  2VB3 X;  2NN6 H;  4N8X 1;  3V2T A;  4XQJ A;  3QWN A;  4LF5 L;  3BZC A;  1K8O A;  1XYI A;  2AMC B;  3KOJ A;  1Y14 B;  3FP9 A;  1YZ6 A;  1X56 A;  3PV0 A;  1OXT A;  1WJJ A;  1IKL A;  1X3E A;  3KBG A;  2MGS A;  1EY7 A;  1JC7 A;  3ERS X;  2QEX A;  4EGV A;  1DM0 B;  2JXM B;  2KUM A;  3T51 B;  3NQI A;  2C9O A;  4QMG A;  4DUY Q;  1C9O A;  4LWC A;  4OON A;  2CWP A;  3OHX C;  1YVC A;  4B3S Q;  4LF4 L;  1KDB A;  3S15 H;  1FYC A;  2ZTE A;  1IZ6 A;  2A6E C;  3FEW X;  3GO5 A;  1ICF B;  1VQ8 A;  3A56 A;  1SNO A;  2F0D A;  3S2H H;  1CZG A;  5BN4 A;  3D0F A;  1WCM B;  2FJ2 A;  3GTG H;  4IAL A;  1WD0 A;  2JA5 B;  1VQK A;  5ELN A;  3A5U A;  1B1Z A;  4BBR H;  4HJ9 A;  2UUA Q;  3DMU A;  2EE1 A;  5KYI A;  3LWE A;  2A1A A;  2XGT A;  4KJN A;  4LUO A;  1QZG A;  1SNQ A;  2J0T D;  4NXM L;  4CHT B;  3S1Q B;  1L1O C;  1NUC A;  1TS3 A;  1HXY D;  3X3M A;  2QGQ A;  2JE6 I;  1OXX K;  4HR7 B;  1VQM A;  2EJF C;  3UE1 A;  1JE5 A;  2JA7 H;  5I9O A;  1A2U A;  2BA0 A;  2NZ1 D;  1Q86 C;  3S1N B;  3HP3 A;  3NWS A;  4GKK Q;  2WP8 J;  4RA8 A;  1X32 A;  2R7Z H;  3E0E A;  4IUU A;  1BDO A;  5LHY 1;  2R61 A;  1L0Y B;  2WB1 G;  3T1H Q;  5KYL A;  4DKA C;  4WJW A;  5IP9 H;  1JE4 A;  2VW9 A;  1HJP A;  5GAG C;  2SOB A;  2IPK D;  2ZJP A;  1SYD A;  3D31 A;  4JI7 L;  5JEA G;  3DWQ A;  2K32 A;  4ZAI A;  4TRD A;  1GUG A;  1QUQ A;  3UI2 A;  4MIU A;  5IOD A;  2AUK A;  1LO5 D;  3S14 H;  4A93 B;  4DV3 L;  2Z6K A;  1VQ9 A;  4BBS B;  4IN3 A;  1V1P B;  2OQK A;  2J4X A;  4OEM B;  3D8G A;  2K7V A;  5IE8 A;  1TU2 B;  3NEL A;  1TS4 A;  4YHH Q;  2K6A A;  1IYU A;  3LX0 A;  3AFP A;  2IL8 A;  1FR3 A;  1SNM A;  3GQB A;  1R9T B;  1SNP A;  1B70 B;  1NR2 A;  1Q3L A;  5C3E H;  1QCB D;  5M5X H;  4R4C A;  5E7N A;  4ZUI A;  1PYS B;  2B8F A;  4CDF C;  1HH2 P;  3EIV A;  1WCM G;  1W6J A;  4RFB A;  4F7X A;  2JA5 G;  2JN4 A;  1M8A A;  2NVY H;  2L55 A;  1PZI D;  2XRQ D;  1JMC A;  2L1B A;  2VUM B;  5J1Z A;  3G4S A;  1GM5 A;  4K5W A;  5M3M B;  1KNE A;  4EQ5 A;  2UXC L;  1K73 C;  4XIG S;  5M5W B;  1PXU A;  4Z9C B;  2X6L A;  2FIN B;  3I2Z A;  3BDC A;  4NMZ A;  4DV0 L;  1HZB A;  2E5L L;  2RKS A;  2EY6 A;  2FFK B;  4A76 A;  4DGZ A;  3BDO A;  3A8I E;  4JI2 L;  1S5B D;  2IT1 A;  1E22 A;  2Q8T A;  3SK6 A;  2CHB D;  4O0A A;  3ZJY C;  1U5K A;  3MXU A;  4YWL A;  1YJW A;  2KCN A;  4H7B A;  2Z1C A;  3MEH A;  2F0W A;  2XNA C;  3QG1 A;  4JI6 L;  2EYJ A;  1O7Y A;  4X3T A;  3RUZ A;  3S17 B;  1KL9 A;  1H95 A;  4HJ8 A;  3DWP A;  1ML0 D;  2JYO A;  3KDF B;  4HIO A;  3I55 A;  4JBM A;  1SXT A;  1LT6 D;  3L9A X;  3KF6 A;  3I4N H;  4IUN A;  2OXP A;  4ME5 A;  4OO1 G;  5M3F B;  1V1Q A;  1Y1W B;  1B3Q A;  2IHE A;  2RDG A;  3B6Y A;  4O42 A;  4A93 G;  1IBK L;  1F9Q A;  1BXT A;  1JOO A;  4BBS G;  3LNN A;  2NB0 A;  2B63 B;  4YCU A;  1DON A;  3SXH A;  5E3F A;  4J1M A;  4GOP B;  4DR5 L;  2F0K A;  1VQ6 A;  4DV4 Q;  4RGN A;  4LFC L;  2F1M A;  3M4P A;  5CV9 A;  2FHT A;  3W1G A;  2F0J A;  2UU9 L;  2PCF B;  1Z47 A;  4J6H A;  3CRK C;  2ZXP A;  4TKO B;  3I73 A;  4CJ1 B;  4KI0 A;  5CYU A;  4GLX A;  3H0G B;  2ZXR A;  2PI2 A;  4V19 0;  2R3Z A;  3AFQ A;  2EOT A;  3HOX B;  3FVQ A;  1JOK A;  3AB9 A;  5A35 A;  5LL6 X;  2VUM G;  2K1B A;  2CVR A;  5M3M G;  4DAY B;  2K75 A;  3T4A C;  2SEB D;  2DN8 A;  4ZRZ A;  3CHB D;  5EKK A;  2F0T A;  1PZJ D;  1EYC A;  2ZM6 Q;  3S1R H;  1SAP A;  4L8J A;  4X64 Q;  1GJX A;  4DR6 L;  1ENC A;  1XTC D;  4P73 A;  4C3J B;  4K2K A;  4XQN A;  1FJG L;  1V9P A;  1CQV A;  1TS5 A;  2Q2T A;  1VF7 A;  2I07 B;  4K6L A;  4RHR A;  4DR7 Q;  2F0Q A;  3U4Z A;  3GV3 A;  5COY A;  4A3L H;  3STB D;  1MI2 A;  4CKB A;  3M4O B;  1YJN A;  1X3G A;  3CW2 C;  3CCE A;  1I4Q A;  1WTH A;  2WKC A;  3SK5 A;  3GTO B;  3S2D B;  1EEF D;  2UXB L;  4JI1 L;  4DV6 Q;  3VR4 A;  2NVT H;  2UUC L;  2E2D C;  1SMX A;  3BU2 A;  4LF9 Q;  2CH4 A;  5JVH 3;  1YBY A;  1Q8I A;  1H9S B;  5M3F G;  5CV4 A;  1Y1W G;  2JSO A;  3T16 A;  1GUS A;  4R8I A;  2BDN A;  5CMD A;  2HDL A;  2GVA A;  3DM3 A;  3VDY A;  3TME A;  4I7A A;  1Q12 A;  2G5D A;  4CJ0 B;  1C7Y A;  3FDT A;  5E4W C;  1PH9 A;  4LNQ A;  1SYB A;  3UDX A;  5DNF A;  1GOZ A;  4A3D B;  5LMN Q;  1TWH H;  2B63 G;  4DV7 L;  4HAE A;  3HGB A;  1FL0 A;  1MHW C;  1EYG A;  3C2P A;  4E6I A;  4DV5 L;  1KXL A;  2D5D A;  2PQA A;  4FXG C;  3HEJ A;  5C0X G;  5EBC A;  5ELF A;  3KLW A;  4JI0 L;  3CCJ A;  3J80 E;  1Q82 C;  4KKU A;  3LWU A;  1K8G A;  5JEA H;  1SYE A;  1YNX A;  3E5S A;  4IFD I;  3H0G G;  4FF2 A;  1FGB D;  2DNC A;  3J7Y W;  3MC0 B;  1PV4 A;  3HOX G;  1P8L A;  1G8Z D;  4BY1 B;  4DR4 L;  2K5Q A;  2NVQ B;  4PNY A;  4Q0F A;  1PH1 A;  2CWA A;  2K04 A;  3KLR A;  3A55 A;  5A2Q L;  4QUF A;  2M00 A;  1I6H B;  1MJC A;  3C3L A;  4LF8 Q;  3H94 A;  3MWY W;  3H3V H;  2LMC B;  2WAC A;  5T1G A;  2IW3 A;  3J7A 5;  4GNX C;  5HUR A;  5GAH C;  3SEB A;  4ULL A;  4LF5 Q;  3PIP 3;  5ISR A;  3U4V A;  2D62 A;  3L7Z C;  1LT4 D;  4K8J A;  3QB3 A;  4UP9 A;  2YTV A;  4L63 B;  4KD4 A;  5FJ8 G;  3LGJ A;  1H9M A;  1UWV A;  2PW7 A;  3VR3 A;  2B2Y A;  4ZK9 B;  1V1P A;  4QQB X;  1VQH A;  3HOZ B;  5EJW A;  2UXD L;  4LF4 Q;  4NP5 A;  5JJL A;  1GUW A;  5IIF A;  3DLL A;  5FKA C;  3A74 A;  2QDB A;  2NWG A;  2Z4H A;  5IT9 L;  3PUV A;  4L5T A;  4A3B B;  1Y8P B;  2I5M X;  1VCI A;  2R93 B;  4QB4 A;  3ND9 A;  5HGQ A;  4DNT B;  1QG7 A;  4AYB E;  3EFX D;  2PPB C;  3A7L A;  3L0O A;  2I0Q A;  2QEJ C;  2RHS B;  4A3D G;  1RKN A;  4X3S A;  4NXM Q;  4UPA A;  2GN5 A;  4EX5 A;  3GTP B;  1EYA A;  5C4X H;  4PZ7 A;  3K58 A;  3I91 A;  1A6X A;  2VS1 A;  4A3M H;  1K9M C;  1UNS A;  3D6W A;  1STY A;  2AWN A;  1MKH A;  4A3J B;  1KC8 C;  3HOV B;  1C0A A;  2AHO B;  4LMQ D;  1S5D D;  2N88 A;  5IT9 c;  1EL0 A;  1SEB D;  3PSI A;  4XDX A;  4X66 Q;  1SRU A;  4A3G B;  3U9S A;  3NK9 A;  4LF6 L;  2N78 A;  4ZKC B;  1J6Q A;  3DEP A;  2EXD A;  4BY1 G;  4HTH A;  2YU9 B;  4OWW B;  4C3I H;  4DUZ L;  3HKZ E;  1CHQ D;  4LJZ C;  3HOW B;  1EY4 A;  2PYK A;  4R8N A;  4JI4 L;  3HOY H;  4BBS H;  4IO9 A;  4JI7 Q;  1HA6 A;  1EWI A;  2OQ0 A;  1BNZ A;  2EXZ A;  3A8K E;  5JVG 3;  3K7U C;  1PZK D;  4GKJ L;  3PCO B;  3CCS A;  2F0O A;  1WYD A;  2LXJ A;  1PRT D;  5JOB A;  1KTK A;  1X3P A;  5K5P A;  1Z9F A;  4ODG A;  4DV3 Q;  2E2J H;  1J8I A;  2F3V A;  2K5N A;  3SK8 A;  4GLV B;  1NNX A;  3HRZ C;  4A3F B;  1O80 A;  1RHP A;  1PDQ A;  1B9M A;  4GOP A;  4JPB W;  2VUM H;  1LTA D;  2I5H A;  1XMO L;  1XPR A;  5M3M H;  5G3L D;  2LFN A;  4Y52 H;  2PQE A;  1XJV A;  5JEA J;  1FGU A;  1X9N A;  4A3B G;  1O7I A;  1YHB A;  1FD7 D;  2R93 G;  3IKJ A;  3G71 A;  3S16 B;  1A3V A;  3VYR A;  5FLM H;  1PH8 A;  1ZKO A;  4LFA L;  4IZ8 A;  1U0L A;  2VQF L;  3KJP A;  4LUV A;  5C44 B;  1CTM A;  4NXN L;  3GTJ H;  1SNC A;  4F88 A;  2IHF A;  1YI2 A;  1KRS A;  4GZY C;  3PF5 A;  1X3Q A;  3WWV A;  2F3W A;  4JC0 A;  3FRP B;  1MBY A;  4DAY A;  3BVG A;  2ICI A;  2Z8L A;  4A3E H;  2E74 C;  1C8C A;  4KHV A;  4DV0 Q;  3QJY A;  2E5L Q;  2PO4 A;  4Y7N B;  3U9O A;  4ZKB B;  2ZXO A;  3SVM A;  2PZU A;  4A3J G;  3HOV G;  1NMF A;  2EYL A;  4JI2 Q;  2ZTC A;  3R3O A;  1QNU A;  2MO0 A;  2BCO A;  4C2M B;  4A3G G;  2E75 C;  3CCM A;  2H5X A;  3M4Y A;  1PYW D;  3WOF A;  3CC7 A;  4HJ5 A;  5C4J B;  1AW7 A;  1CM9 A;  4B3T L;  3PO3 G;  4H02 A;  4PMB A;  4POF A;  1XNR L;  1VMC A;  3HOW G;  2IY5 B;  1HUN A;  1EWC A;  1RL2 A;  2HD3 A;  3VA5 A;  5IP7 G;  4IPC A;  4TQU S;  1UE1 A;  3KLS A;  1T5X D;  2F0H A;  3E6Z X;  4RCO A;  1H9S A;  5BN5 A;  1SJE D;  2O2L D;  4G7O C;  3SGI A;  4HID A;  1CSP A;  1BCP C;  2Y0S B;  3KF8 B;  2QA4 A;  4LF7 L;  5IGC A;  3PO2 B;  3OW7 A;  1S5E D;  4DK0 A;  2F4I A;  2NBF A;  4KV6 A;  1IBK Q;  1CSQ A;  4JK1 C;  3OSO A;  3CCQ A;  1K8M A;  1S3O A;  1HNW Q;  4P74 A;  4LF8 L;  4XQQ A;  1PRT F;  1A3T A;  4DR5 Q;  3HOX H;  2ALY B;  1HTL D;  4KY5 A;  2IJ0 A;  1VQL A;  5KND A;  2AQ3 B;  1EOV A;  3T56 B;  4LFC Q;  2DGY A;  5CBA E;  4B9X A;  2UU9 Q;  4P2C B;  4DAM A;  1IL2 A;  1PH7 A;  2JA6 H;  3D4R A;  4R4O A;  4CBV A;  4HMI A;  2L12 A;  1SYC A;  4KK7 A;  5G3L F;  3NHH A;  3IFT A;  1NSN S;  2EYF A;  1EY9 A;  2PMZ B;  3DXJ C;  4A3K B;  3PQI A;  5C44 G;  3GTK B;  5IYB H;  1EQR A;  1EQQ A;  3T13 A;  1OXU A;  1TWG H;  1ENA A;  2L11 A;  3CKI B;  1B9N A;  1AZQ A;  2EY5 A;  1N32 L;  5FJ8 H;  4C3H B;  4MZ9 A;  4KKS A;  1FNV A;  4HJ7 A;  4B3R L;  1B4O A;  4DR6 Q;  1HR0 L;  1II3 A;  4EQO A;  1FJG Q;  1KQS A;  1LT5 D;  1G6Z A;  2K4K A;  3GTQ B;  2KEC A;  1ZYR C;  3OIQ A;  4DV1 L;  1O7L A;  2A8V A;  4AQY Q;  1ESR A;  5T1I A;  3UDG A;  1Q7Y C;  3CD6 A;  2M2L A;  1D2B A;  1BBU A;  3RZO H;  5ELB A;  5GRO A;  3G6J B;  3PIO A;  2Z0S A;  2B2T A;  2KCT A;  2ASB A;  2H4O A;  2UUB L;  5EGT A;  2PQA B;  1T9H A;  2JP1 A;  1STN A;  1HNZ L;  2EJM A;  2Q2I A;  2EPB A;  3NTH A;  4HJA A;  3S1M B;  2EQS A;  2WV6 D;  3PUW A;  2WKD A;  2UXB Q;  4BY7 B;  4JI1 Q;  5IGG A;  2UUC Q;  5FO7 B;  1IXR A;  3EJI A;  1W3S A;  3TN2 A;  3IAY A;  1JT8 A;  4X66 L;  5LL6 S;  2ZT9 C;  4DV2 Q;  1I94 L;  1A63 A;  2MO1 A;  1I3Q B;  2V4D A;  1QVF A;  3I4M B;  4IJH A;  5H1S E;  3GTM H;  4FXK C;  4M8A A;  3RZD B;  2Y0S G;  2GA4 B;  3W5O A;  1UEB A;  1XX8 A;  3PO2 G;  3P1H A;  4ZYS A;  4P71 A;  3M3Y H;  1DOK A;  3OMC A;  1XWE A;  2R7D A;  5M9O A;  4DV7 Q;  4CDC C;  1F2Z A;  3I4L A;  4AIM A;  5BN3 A;  2F0M A;  1SMY C;  1U4R A;  3I70 A;  1LV9 A;  4DV5 Q;  4XYO A;  2NVQ H;  3QO2 A;  4K6D A;  1S4Z A;  4DR2 L;  1QJO A;  3H15 A;  4JI0 Q;  1M1K C;  3MEF A;  4QF4 A;  1BOS A;  5FOB B;  5C5L A;  1I4R A;  3AEV A;  1ONL A;  3CCR A;  4A3C G;  4A3K G;  1HQR D;  2MQH A;  2RA4 A;  1NCV A;  2BOS A;  3PGZ A;  3A0J A;  4KN4 C;  1NY4 A;  3J7A F;  4DR4 Q;  1BF4 A;  2R92 B;  1MD2 D;  5KNB A;  1VQA A;  4KMU C;  1UE5 A;  4IPD A;  4X65 L;  3ULP A;  4C3H G;  1KAW A;  5BR8 L;  3K7A B;  2JK8 A;  1SFO B;  2K52 A;  3J7Z C;  2E2H B;  1DOM A;  5GAE C;  3NSW A;  5C0X J;  4QGU A;  1U4L A;  2EVB A;  4ID6 A;  1YNN C;  2D2C C;  2MP1 A;  2KCC A;  1LTI D;  2XN9 C;  1TWA H;  1F9S A;  2RF4 A;  4L5S A;  4FP5 D;  3J81 i;  4XTC S; 
#chains in the Genus database with same CATH homology
 4CDE C;  4CDF C;  4CDC C;  4OEL B;  1K3B C;  2DJG C;  2DJF C;  1ICF B;  4CDD C;  4OEM B;  1MHW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...