4OELB

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
69
structure length
69
Chain Sequence
b'PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 8
structure length 69
sequence length 69
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4oelB00
2DJFC 1ICFB 4OELB 1MHWC 2DJGC 4CDCC 4CDDC 4CDFC 4OEMB 4CDEC 1K3BC
chains in the Genus database with same CATH superfamily
1MKHA 4GLXA 5JPMC 4LUZA 3M3YH 2N8NA 1VCIA 1D5MC 1I5FA 1HH2P 3OTOL 1A6XA 4KHZA 1KL9A 4JI5Q 2EYFA 1SJED 3QG1A 2B2YA 4A3FB 3PUYA 4DV0L 2NVTB 4AH6A 1Y1WB 5C3EB 2E2DC 5DNFA 1QUQB 3GTGH 4GN5A 3DM1A 1B4OA 2ENBA 2WAQG 3E3XA 2K50A 1SEBD 4DR7L 3NWSA 4L5TA 1XPOA 4QIWB 1G2SA 3SE0A 1IL2A 2A5HA 4LF9Q 2UUAQ 5IYBG 5EPLA 1E7ZA 5LMNQ 4LFAL 3K0XA 1SYGA 1SNDA 5ELNA 2WB1G 2F0JA 2HT1A 2VW9A 3KBXA 5JVH3 3I4NH 1LO5D 2B29A 2WAQB 2Z0SA 3KF6B 1CZWA 2JA7G 4DR6L 4LF7Q 1M1KC 1BUVT 1SE2A 1O7ZA 1SYEA 1YNND 3HG9A 4FXKC 2EYLA 4DR5L 4DK6C 3HOYG 2MGSA 2UU9L 2PMZB 2KJXA 3S1NH 3VR3A 4DKAC 4A75A 1HFNA 3TMEA 1SBBB 1WTQA 4X62Q 1XTCD 2I5LX 3HOXH 1K73C 3NQTA 4A3BH 1HFGA 2WB1B 2B2UA 4JI4L 1B53A 1SR3A 2I0QA 3PUWA 2NZ1D 5G3LF 2JA7B 2SEBD 4R4TA 2LSSA 3HOYB 2LS01 1LT5D 3Q6SA 4X65L 4KHPL 1ML0D 3H15A 2UUCL 3HZXA 4QJFA 5ELCA 4O2DA 5AFWA 2F0PA 2IX3A 1S5DD 2L12A 4K5XA 4KKTA 3MFYA 1L0XB 1Z9FA 4JBWA 1OXTA 1JICA 3OIPA 4HJ9A 5CBAE 2E8GA 1PH7A 1G2TA 2KHIA 1H95A 4GKJL 1WD0A 1HZAA 1D2BA 2Z4HA 3OWFA 1M90C 4B9XA 4U68A 2A6ED 1NBWA 1DOLA 3J81E 2IHFA 3RZDB 1FNUA 2PCFB 4AYBG 2ZTCA 2WFWA 2BDOA 4KN4C 1T5XD 2R7ZH 3GV3A 3QR8A 1U5KA 3DEPA 4B3RQ 4DV2L 2UXCQ 3M3YB 4XTCS 3V05A 3CCMA 4JV5Q 2Q2UA 4DR2L 3SGIA 1EOVA 1O78A 4PZ8A 4CJ2C 3U58A 3AFQA 5C44G 2I46A 3CCJA 1NR2A 3CCSA 3TP6A 4JI6L 1G6ZA 5C4HA 2Z6KA 4IQZA 2IW3A 3M7NA 4BWGB 5I9PA 4JI2L 2H4OA 2F0UA 4AYBB 2E2IB 4ZRZA 2HUGA 3I4NG 1HQMC 2KHSA 3GTGB 5FO7B 4GOPB 2QA4A 5JVG3 3QWNA 1VF5C 4RKBA 4DFAA 3U4ZA 1YBYA 2SNSA 2P5ZX 3G48A 2ASBA 5C44B 2ZM6Q 4LF5L 1K3BC 3C46A 3EQLC 5IP9H 3BS1A 2JEBI 3HOXG 4G7OC 5I6YA 4F87A 5KYLA 2UXDL 3I4NB 4CDDC 1N32L 2D62A 2OT2A 4C1NK 4AQYQ 5IGBA 3A0JA 2WV6D 2FMMA 3R2IA 5EBCA 1STHA 2B8FA 2BH8A 1GUOA 5C6AA 3K59A 3HKSA 3CCRA 2J0TD 1EZ6A 2E76C 3VR5A 1I4RA 3H91A 3HOXB 2N78A 3L3OC 5BN5A 1CSQA 1PH9A 3HOZH 1BO0A 5BN4A 4KD4A 3NQIA 5IODA 2MQHA 3GTMH 1KDBA 5M5XH 2EY6A 4JI0L 2YU9H 2MHVA 4G57A 2A69C 3VDYA 1RTOA 1PZKD 1X3EA 2IT1A 4OWXB 4KTAA 4PG3A 2PPBC 1RJTA 2OQKA 2XN9C 4LF4Q 1SLJA 4HCEA 1Y8PB 1MGSA 2LFNA 3NBHA 1JOKA 4ULLA 3KLRA 1IHZA 1Q90A 5ISRA 1X3GA 3L9AX 3GTJH 3CD6A 1IL8A 2HQLA 2A1AA 3KBGA 4LF6Q 1LACA 2SOBA 2F0FA 1HNWQ 5FJ8H 2MJ8A 3P7JA 1PTOB 1S5FD 4QMGA 2JP1A 4U673 1KDCA 2X69A 5ELOA 2UUBL 3S1QH 1D1KA 1W6JA 1EOTA 1GUSA 1EYCA 1K83B 1VQDA 1SROA 5JPNC 1X56A 4DK3C 1PFNA 2CW0D 4B3TQ 2A6HC 2CWAA 1CQVA 1ZEQX 4C3HH 5JJKA 4EGVA 2F4VQ 1KNEA 4LFBQ 1IW7D 1HR0W 1S3OA 1OTCA 1OXVA 2CHBD 3DXJC 4FF1A 4A3IH 2BE5D 4H44C 2F4IA 1UEBA 4FNFA 5D3DA 4LF8Q 3BVMA 5IP9G 4KKSA 3T13A 3DM3A 1SNQA 1PA6A 2KCNA 1W6KA 2N55A 3M4OH 4FDBA 4DUYQ 5FLMH 2OWOA 4B3SL 2F0VA 4DN4M 2G9DA 2R93G 1NSNS 2QW7A 1TWGH 3SR1A 1SYDA 2OQ0A 2KECA 1EY7A 5I2XA 1N34Q 1EWCA 1EIYB 3U9SA 3V96A 1VQ9A 3MWYW 3HOZG 4L8JA 2MO1A 2CQAA 3H3VI 1BR9A 4UAIA 1IBMQ 3FPUB 1S5ED 3NTKA 1OXUA 3ND9A 3AB9A 2R93B 5LMUL 3HOVH 3F2CA 4HSPA 5LHY1 4QGUA 5IGGA 5I6WA 1FR3A 4WJ3M 2GVAA 4JCVE 1WTXA 1HTLD 1C48A 3CC4A 5CC4A 3S24A 4ZLTF 4DV4Q 4DV5L 3RN2A 3VYTA 1BCPD 2KQ3A 4B9WA 3R2TA 4DNTB 3HOZB 1KTKA 4ZK9B 2JN4A 1KLGD 4PMWA 3GTMB 2QGQA 4DV1Q 5M5XB 2AHOB 2WAQE 1NE3A 4P2CB 4PZ7A 1XMQQ 1C9OA 4NDXA 4H13C 3JAME 2PMZE 2XGTA 3R93A 4DAMA 4DGZA 2VXWA 3BDLA 4ZKCB 5F2DA 1J8IA 1BBUA 4BY1G 1CKNA 1ZKOA 4P75A 4BA2I 3X3MA 4A3LH 4KJNA 2WB1E 4X6AH 2IL8A 3GTJB 1WVLA 2E2HH 4L6TB 3E9IA 1FGUA 1R4PB 1ENCA 1SNOA 2F0DA 2VB3X 3HOUG 4C3HG 2C5CA 1BKBA 3I73A 2RCNA 1JCKB 3PIOA 4NXNL 1G51A 4X64L 3IFTA 1I50H 3MXNB 1SFOB 4BY1B 2K5HA 1TWAH 4V0BA 4A3CG 1PRTC 4YCUA 3HOUB 5EPJA 1V43A 1T5EA 1AW7A 3F2UA 1IKLA 1JE5A 4FVMA 2F0MA 3A8IE 2A68D 3TDQA 4Q0FA 5IY0A 4RGMA 4IUNA 2HD3A 2NVYH 5J1ZA 3WOEA 4YY3L 3PIO3 1K8GA 2Q8TA 4DU9A 1ZYRD 4K6LA 2ICEC 5E4WC 2RDGA 5LMNL 1UE5A 2N88A 4BBSG 1SNMA 3NE5B 3PIPA 4XIGS 2RHSB 3O13A 3SEBA 3SVMA 1NTGA 4GNXB 1PHJA 3M4OB 1E0BA 1HNZL 2QEJC 4X66L 5C4ZA 3HKZG 1K9MC 2QCPX 4BS9A 3S1MH 4BY7G 2BOSA 4BBRG 4OONA 2L5TA 2SNMA 5I4DA 4GLVB 2Z6BA 2A73B 3FHWA 2R3ZA 2DNCA 1YHQA 3OWEB 3D4DA 3PMFA 5M3FH 4BBSB 2NVXH 3N6RA 5C4JB 1B70B 4AYBE 1PH1A 3GTOH 4JYAQ 5I9OA 2F0KA 2NVTH 1HRJA 4XDXA 3PIP3 2ZXOA 1Y1WH 3HKZB 4N9TA 5C3EH 2VUMH 3K5LA 4BY7B 1JOQA 4BBRB 3X3NA 4QCLA 1I4QA 1ASZA 3PCOB 1G91A 1DJRD 5EKKA 2F0NA 2IJ0A 3AEVA 3W5OA 1XXGA 3H0GH 3STBD 1JJGA 5C0XI 4LW1A 1WCMG 2EY2A 2RF4A 1YITA 1QVFA 4JI8Q 3D31A 1HQRD 3PF5A 2LY7A 2Y0SG 4CDFC 2HQEA 2ZXRA 2Q2HA 4JI7L 2B63G 1PVOA 4DR1Q 1RIPA 2A74C 1HNXQ 2K7VA 2ZTDA 4HN7A 3C1EA 3LNNA 1M4VA 5BR8Q 2IPKD 3NXWA 2AQ3B 1H9SB 1BBXC 1NAPA 4UP9A 2EE1A 3L0OA 1XMOL 1BOSA 1WCMB 1VF7A 1NCVA 4CKCA 3OW2A 2E2HB 1FJGQ 2K28A 4QQBX 1BNZA 2EY1A 2V4DA 3DWAA 2Y0SB 3BJUA 1N8RC 2B63B 5CV5A 1LUZA 2UXCL 1WTVA 2N49A 1FGBD 3IFDA 5DEHA 1I50B 4DAYB 4ABNA 5KYIA 5GAGC 4HMJA 1U4RA 3VYRA 3J80L 1Q86C 5AJ3L 4GKKL 2E2JH 3D4WA 3GP7A 4FF2A 1ICWA 2FINB 5NUCA 5EKIA 1NMFA 3K8AA 1A8VA 1Y8OB 2AQ2B 1J6QA 1UUPA 4A3MG 1GOZA 2K5VA 2ICIA 1PFSA 2XWBB 1N36L 2KEDA 3U9OA 1VQ4A 4IZ8A 4JI1Q 1PZID 3GTPB 2DN8A 1KD1C 2PZUA 2EOTA 4A93H 4V190 5M3FG 2O5IC 3ERSX 3DEOA 3DHQA 5JEAH 3H09A 3MTSA 5FLXL 3WOFA 1JWSD 1Q1BA 2JE6I 1QCBD 3RZDH 5FKAC 5HURA 1Y1WG 1N33Q 2E5LQ 2VUMG 1QUQA 4A3MB 2B2VC 4J8QA 2NZOA 1O7LA 4DNRB 1I4HA 2VL6A 3CCEA 4AIMA 5IYCG 4LWCA 2BH2A 4CDEC 1EUJA 3H0GG 5M3FB 2KA7A 1VQLA 2NVXB 4L63B 3TP5A 1I94Q 2CWPA 5KEEA 3GTOB 2D0OA 3M4YA 1STAA 3EROA 2JSOA 3VYUA 2A6EC 2VUMB 2E2IH 4XQQA 1HZBA 4R4OA 2C35B 3RLNA 4WJ4A 2HCIA 1L2FA 4BXXG 2TSSA 1SAPA 3KF6A 1AEXA 1CUKA 5CMDA 1ESRA 2EXZA 3M85A 4KY7A 1PTOD 5C44H 1F2YA 3H0GB 5C3XA 1S4ZA 4DAPA 2EYHA 1CFMA 3J81j 1D7QA 2EJGC 2CFMA 4DR4L 2F3WA 3J80c 2F0GA 5L37A 5IWAL 1LTTD 1O7YA 3KLSX 1GUTA 1X3QA 2JA9A 3A5ZB 4QB4A 3BDCA 5LMNW 4POFA 2WIIB 5LL6X 3DWQA 3QIAA 1IBKQ 4JI3L 2XWJB 1Q46A 1E1OA 2K33A 1SJHD 2DJFC 3G7LA 3FP9A 5E1FA 4J1MA 5A2QE 4DV6L 1GXDC 5CV8A 1HR0L 4HIMA 3EBEA 5D3IB 4PV1C 4IOCA 3W1BA 3WDNA 2AQ1B 2K5NA 1STBA 5COYA 1TS5A 5FLXc 2PQAB 4KY5A 1LM0A 4NW2A 1PXUA 1II3A 1V9PA 2NVQB 4XYQA 3NTHA 4G7ZC 4ME3A 4N8FA 1LABA 3V2TA 3M7GA 1JWUD 1NNXA 1L0WA 1EU3A 2E2JB 4A93G 1SDFA 4IUVA 3OIQA 4NXMQ 1F2ZA 5GAEC 3NHHA 5JEAG 1H9RA 2YYZA 2PI2E 3P75A 2L11A 4KHVA 5IT9E 4L5QA 1I4PA 2HHHQ 1A3UA 3KF8B 4NKLA 2BA0A 3L2PA 2AKWB 2EPBA 1PH8A 3CRKC 4K0KQ 2B2TC 3FKIG 2PZTA 2GVBA 2OTLA 1PTOH 1GUWA 4YCVA 1RTNA 4TKOB 4A93B 1ET6A 1CK1A 3I4LA 2EYJA 1X9NA 1K83H 3T1YQ 1ENAA 2RVLA 3CAMA 3M4PA 1AZPA 3ULLA 3J81L 5DM63 4R4CA 1TWFB 1XNRQ 4DV7L 2RSNA 5IGFA 4GOPA 2PQEA 2RQXA 1WTRA 1YJNA 3PO3G 3FKIB 1OO9B 1VQAA 2R7DA 4IFDG 1DCZA 4LAAA 4JOIA 2EYMA 2QDBA 5ELEA 1K0SA 1PZJD 1EFID 4DAVA 2CQOA 4DUZL 4IOAA 2HIVA 2JXMB 3Q22A 2OTJA 1L1OC 1JWMD 4OWTB 3D6CA 3T1HL 1KHIA 2IX0A 3TREA 1U9RA 2WKCA 4LFCL 3RLFA 3UE1A 1KRSA 3PO3B 1PFMA 2LKVA 2ZXPA 3K5OA 1PRTB 3MC0B 4J6HA 1SYBA 1IW7C 2LMCB 3S16H 4A3JH 1EEID 2VQEQ 2NZHA 2WACA 1FNWA 2JJQA 4MZ9A 1STEA 2CVRA 3HKZE 4RGOS 5IIFA 1UNSA 1YI2A 4QY7A 2DUDA 3A8KE 4CDCC 3RUZA 3I91A 4IURA 1F77A 1LTRD 2R93H 4OO1H 2NN6H 3QOJA 3CU7A 4O1NA 3UI2A 1C7YA 1TKWB 3EFXD 1LTLA 1IXRA 2KUMA 1D6EC 1GKHA 4ZKBB 3PGZA 1SE8A 5EGTA 3NTIA 3SK5A 4YHHL 3CC2A 2VB2X 2Q8IB 4XYOA 3BZCA 4K8IA 1STGA 2VQFL 1Q7YC 1XNQL 3J81c 4NP5A 2VZAA 1EU4A 3RMHA 4KD3A 2O5JC 5CGKA 1QE6A 1FD7D 4IUQA 1FYCA 2QDLA 4DV0Q 3HGBA 4H02A 1D5XC 1PTOF 2Y0SE 1WYDA 2KBNA 4B3ML 3MAQA 5EQ0A 3GTQH 1C0AA 4RGNA 3MXUA 4DR7Q 1XX8A 1V8QA 1PFBA 3RNUA 1Y8NB 1SMXA 4YWMA 1WTPA 2G9HD 4GN4B 3SHLA 1PH6A 2KENA 3KOJA 5KNDA 1KNAA 2HDMA 4LFAQ 3G6EA 1SFOH 4BY1H 3BDOA 2EQSA 4KK7A 4JYAL 3I4OA 4XXEA 4TVAB 3HOUH 4MIUA 3CRLC 4DR6Q 2B2WA 2QEXA 1HHVA 4DXFA 1JC7A 4DR5Q 1E24A 4PZ6A 4RA8A 4ZCKA 2UU9Q 3RR5A 2XSCA 1EYAA 1H9KA 2K05A 2L55A 3MXPA 1PLFA 5HGTA 4A3JG 3T51B 1J9OA 1Q3LA 2E74C 2IHEA 2K5DA 3A7LA 3GO5A 4OIJA 4JI4Q 1EY8A 1KQSA 4A3CH 1CZGA 1JMCA 2AUJD 3PF4A 2D0PA 1RD9D 4IO9A 2B3GA 2B2YC 4RCOA 1G8ZD 1RCVD 4CJ1B 2XTIA 4DR1L 3UDGA 2KVMA 1GHJA 2F3IA 2Z4IA 4OO1G 2NN6G 4IN3A 3S16B 4A3JB 4X65Q 4KHPQ 2UUCQ 2L15A 3GD7A 2OCEA 2BA1A 1ESFA 5D65A 3A54A 3K7UC 1SE4A 2R6GA 1IKMA 2AUKA 1B7YB 4BBSH 1GUGA 1KRTA 5C4JH 1QWYA 1A63A 2RSOA 3URYA 3HEJA 1B44D 1MHWC 1DOMA 2JQOA 1TVXA 4BY7H 4BBRH 4GKJQ 1XTDA 2AMCB 3KLSA 1A3VA 3DLLA 1IZ6A 4OIKA 4GLAC 4L5SA 4OX9L 3GDEA 1B50A 2L9HA 4CHTB 2YTYA 4E6IA 4OELB 2UXBL 2Q8RE 1KIXA 5FO9B 1S72A 2A69D 3BYYB 1EFWA 1E1TA 1XPUA 1F9SA 2Z1CA 2PI2A 3OHXC 4DV2Q 2JK8A 1SYFA 4HCSA 1J5EL 2EXDA 4PMBA 1FNVA 2J7ZA 3D6WA 1IYVA 4EX5A 4DR3L 3GTKB 4DR2Q 3H3VC 4H0LC 3JAML 1EY4A 2B2UC 2QKIC 3C2PA 3QOLA 3CCLA 2RA4A 1TXYA 3FVQA 4DNIA 4JI6Q 2Q2IA 3J80i 3MZ5A 3MXNA 1VQKA 1UEAB 3CQZB 4JI2Q 1WCMH 3NP8A 3CMEA 4FXGC 1SXTA 1XPRA 1K8OA 3CPWA 1I3QH 2EYPA 1EEFD 3GTQB 4P71A 4ILWA 2B63H 1YNJC 3S15B 2EDGA 2KCMA 2DGYA 1UE1A 4PNYA 1PV4A 4LF5Q 5DLQE 2A6HD 4J15A 1R9TB 4JI5L 3QO2A 1PDQA 3LX0A 4RMFA 2UXDQ 5JOBA 2BDNA 5J3BA 1DXMA 3M4QA 1V1PB 3A7AB 1N32Q 2PW7A 3LWEA 2F0TA 4GNXA 1SMYC 2M9VA 1QB5D 4Y52H 4EQPA 1JR0D 3SXHA 1QJOA 1DZ1A 3TQYA 3T53B 3HOWH 3KYHC 1X65A 1X54A 5T1IA 4HAEA 3NBIA 5T1GA 3K7AB 3GTPH 5EBDA 3F1ZA 4LF9L 2UUAL 3SK6A 4S3SA 2ZTEA 4F88A 2M2LA 4IUPA 4UDUC 5JEAJ 2XRSD 1F9RA 3ZJYC 3K6OA 3UDXA 2QF7A 3KDFB 3NWTA 2Z6KC 1WFQA 4A3MH 4RHSA 1VQJA 5H1SE 3Q0AA 4LF7L 3J7AF 4LNQA 4HJ5A 1FVIA 3BZKA 3D0FA 1RKNA 4LUOA 3K5MA 3S2DB 2F3VA 1JB3A 4OXPA 1H9JA 1AFPA 4Y7NB 4K2LA 4FYDA 2K4KA 4X62L 1A62A 3PUXA 4FP5D 1G291 1W3SA 3ITPA 1IBLQ 3PO2H 3KLWA 5CV4A 1VDZA 3M9BA 1CSPA 3FDTA 4O42A 5GROA 1CQFA 2UUBQ 4JK1C 4IFDJ 2O2LD 5IYCH 4C2MH 1YJ9A 1B9NA 1C4QA 1H9SA 3FPPA 1GD7A 1YEZA 1RHPA 2RCFA 5TSSA 3I2ZA 4CKBA 4HR7B 1D5ZC 4P74A 1OXXK 4KKUA 4ME5A 2XVSA 1GO3E 1K28A 1BVSA 4BXXH 3GV6A 1L1OB 2DY7A 2NYZD 4C3JH 4R4IA 2YTXA 4DAYA 1V1QA 4FF4A 2WINB 2F0HA 3TS0A 5JJIA 3SK4A 2F0WA 1GJXA 3D3RA 1GUNA 1I3QB 3H6MA 4B3SQ 1JB7A 5LL6S 1QOHA 2H5XA 1A0IA 1U0LA 4WORA 3CXCA 3E0EA 4B3RL 3R3OA 4CKEA 3NPPA 3EVQA 4F8MA 3HOWG 4HEDA 4JV5L 1EQVA 2NVQH 1EQRA 4HJ7A 1PRTD 1YNNC 3KFUA 2F0IA 5A35A 1MSHA 5EJWA 2C9OA 5ELBA 4ODGA 5HY6A 5GADC 1A3TA 1F9PA 4JBKA 1QVCA 1TY0A 2MNAA 1KDAA 1QILA 4P72A 3J81i 2A19A 3P1HA 1VQCA 3G4SA 1MJEA 5LMUQ 2I5HA 3MXGA 2PW5A 4C1NI 3ND8A 3HOWB 3QB3A 4RH6A 2IWHA 2EJMA 3NK9A 1K8AC 4IJLA 2NN6I 4DV5Q 1PMRA 1BBWA 2ZM6L 1ONLA 3H3VH 3ONAB 2K04A 3F2DA 1E2VA 1CI3M 3S1RB 5J22A 3PO2G 5K5PA 1TWFH 5IGEA 3S2HB 1LT6D 4AQYL 3C3LA 4C56C 2R61A 5M5WB 3S17H 2ZJPA 2AWOA 2XRQD 2ZJRA 3FKIH 3Q8DA 3MHBA 3HS0C 5C0XJ 3UDFA 2ALYB 1TU2B 4I7ZC 1HUNA 1F2MA 2K5WA 1EWIA 4ALPA 3PO2B 1LYLA 3I56A 4A3GG 1LTAD 3E6ZX 4NXNQ 1E3PA 2MP1A 4WJWA 4X64Q 4XT3B 1JQYD 5E4XA 3K5NA 3PO3H 1T9HA 2M00A 3W3AA 3MA2B 2FFKB 4C3JG 5I2YA 4IFDH 1TT2A 3ICEA 4C2MB 5CV9A 4UPAA 4IPCA 3FMCA 3T16A 2H1EA 2EY5A 2BCOA 5ELDA 1PH2A 4LF4L 2JA8G 3CKIB 4NPSA 1R4QB 1WTHA 4A3GB 1D1IA 1DYQA 3MFGA 4LF6L 2JYOA 4YIJA 1HNWL 3BVZA 4K6DA 4X3SA 1IYJB 1L0YB 2PQAA 1QZHA 3P20A 4C3JB 4YY3Q 4JBMA 1AH9A 1STNA 3IKJA 2NBFA 1SYCA 1WOCA 3HP3A 1EIGA 5A2QL 1YHBA 2JA8B 1TY2A 1PYBA 4DF7A 3CW2C 1HNZQ 1P8LA 2L4NA 4RGTA 5JJLA 1UAPA 1I4XA 4X66Q 2RDFA 4B3TL 1CM9A 2TMPA 5M9OA 1QG7A 3I90A 4MNOA 2K14A 3KF8A 4Z9CB 5KNBA 1SN8A 4DV3Q 3GQBA 3W2DA 3I4MH 2F4VL 4LFBL 4F7XA 1EY9A 3CHBD 1Y14B 3BG3A 1Z6HA 4GZYC 1CT1D 4OEMB 3RLOA 1VMCA 3A8JE 4C3IH 4MTNA 3SK8A 1VQHA 4LF8L 3BYTB 4R9WA 4Q5VA 2OEOA 3IAYA 5IT9L 3HRZC 1DGSA 2J4XA 1OXSC 1BQQT 4EQ5A 1Q8KA 5M3MH 1LT4D 5CV7A 2HCCA 2ES2A 3VR6A 4DUYL 1JT8A 3IRBA 1Z7TA 1AE2A 4HTHA 2CH4W 1TWCH 2B39A 4GNXC 1JE4A 1ILQA 1XJVA 5M5YH 5HGQA 4FXDA 1N34L 1VS0A 1RF2D 3UE0A 3I8ZA 3TP7A 5IP7G 1EQQA 4LK1C 5C5LA 3BU2A 4DXGA 4A76A 3TN2A 5IGCA 2RKSA 3NUCA 1SNCA 3U50C 3TBIB 1QZGA 4JI7Q 1LLRD 2D2CC 4NMZA 2G5DA 4R8IA 3S17B 1IBML 1CHQD 4KLKA 2MFIA 3T4AC 1TR5A 4KV6A 5C0XH 1KAWA 1U4MA 3DUZA 3AU7A 4RG1A 4OL7A 1XMOQ 3TZUA 1XWEA 5KGUA 1TS4A 4X3TA 4DV4L 4UP8A 3F2BA 2ATWA 5C3WA 3J7YW 4WRDA 2CH4A 1PRTF 4JBJA 4QF4A 3NEMA 4R1JA 1TQOA 4DV1L 4NB3A 1XMQL 2LXJA 2CW0C 3I72A 4IUUA 2RBMA 1JJCB 4IUTA 1CKMA 5CYUA 4LJZC 1HJPA 5AJ3Q 1F2LA 4GKKQ 4QUFA 3VR4A 2EYOA 2BE5C 2F52A 2PNRC 2DJGC 3I7FA 4YWLA 3K57A 3CPFA 2JA5H 2R7FA 1CTMA 3IL8A 5EAYA 3CMAA 4CBVA 2VS1A 3I4MG 5KNCA 1N36Q 1VQ6A 3MVVA 5IT9c 1EQTA 4UY8C 1S5CD 5IOCA 3RZOH 2VNUD 3JAMi 1I6VC 3OOCA 4UHVA 4C3IG 2DNEA 4A3BG 1LV9A 1Q12A 3OSOA 1FL0A 5M3MG 4APVA 1Y69U 2ID0A 4TSSA 3I4MB 4OHJA 3K0YA 3L7ZC 3GTKH 4YCWA 3S1NB 2K52A 3K81C 3OTOQ 3CCQA 2JA6H 1SNPA 1PYSB 4C3IB 3U4VA 1EZ8A 3OW7A 4A3BB 3A56A 3AYHB 1WTWA 3CQZH 4PQXA 4K8JA 1TWHH 1WJJA 5GQOA 1LTBD 2WKDA 5IYDH 1BCPC 5M3MB 4A3EH 2O4XA 4CGYB 2MUYA 4ZYSA 1AZQA 3NSWA 4HIOA 1TWCB 2I5MX 3PV0A 3S15H 5C0XG 1PH5A 3DWPA 2IX1A 5M5YB 1P16A 3SDZA 2RHQB 3K58A 4CJ0B 1SRUA 1VQGA 4QUCA 1B3AA 5EKLA 3ULJA 4DR4Q 1B1ZA 1R9TH 2YTVA 3G6JB 3FRPB 3E9HA 3CF5A 1CA5A 3FEWX 1IBLL 5IWAQ 2R7ZG 2K32A 1E2WA 1K0RA 3E5SA 4BA1I 1WI5A 3R8BA 4M1UB 2L1BA 4HIDA 3ERQA 4JI3Q 3OMCA 1VQIA 4R4QA 5IGDA 1VQBA 4JC0A 4DV6Q 3AQQA 1YNXA 3K80C 1XYIA 4XT1B 5CV6A 3ER0A 1HR0Q 3NBHB 4HMIA 2OXPA 1BDOA 3K7AH 1S40A 1MSGA 4N8X1 1O80A 3TZDA 1VQPA 1Q1EA 2A8VA 4OGQC 2R7ZB 4EQOA 1YZ6A 4FO2A 4M8AA 4JI8L 1STYA 3Q24A 4L5RC 1NY4A 2AWNA 2JA5G 1X55A 2EIFA 1VQNA 2VY3A 2FJ2A 3GTLH 1HNXL 3PUZA 1HA6A 5C4XH 2PNHA 5BR8L 3EA6A 1KXLA 2A68C 1DONA 2HIXA 2B2VA 3S2DH 1MD2D 2NB0A 1I4GA 3B6YA 4IPHA 3S14H 1ZYRC 2WP8J 4Y7NH 1ICFB 2ZJQA 1FJGL 4K2KA 1YHAA 4P73A 2JA5B 4IALA 1Q82C 5BN3A 1N9WA 3LGJA 5E7NA 2KEEA 3RZOB 2JA6G 4TRDA 4RKLA 3MEFA 1I6HH 2GA4B 1LTID 1UE6A 1AE3A 2I07B 3CCUA 5C5MA 4N9PA 1GVPA 2FHTA 3CC7A 1K3RA 1RODA 1SSOA 4DV7Q 4ZUIA 2F0EA 5IYDG 1WTOA 4KY6A 3HFZB 4A3EG 3JC66 1EIFA 3AFPA 4I65A 4IPDA 4QIWE 2K5QA 5ELFA 3EN2A 1TIID 2JA6B 1RL2A 1A15A 4QL5A 4DUZQ 2XIWA 4JI1L 4X3KA 2D5DA 1KLUD 1H9MA 4FF3A 5KRUA 1YIJA 1MJCA 3EJIA 1MIUA 1QNKA 1TWHB 3CCVA 3T1HQ 3STBC 2SDFA 1Y1VH 1V1PA 1NJIC 2CCZA 1Q81C 5FJ8G 2YU9B 1A2TA 4A3EB 4ID6A 4A3DH 4LFCQ 3D8GA 1N33L 1HUMA 2E5LL 3T56B 3MEHA 1HZ9A 1Q8IA 2DY8A 4DA2A 1EYGA 4G4KA 5CBEE 3H94A 1B2TA 1HXYD 2IY5B 2LXKA 4ZUJA 5K36H 3NELA 4IFDI 4A3KH 2OF1A 1X3PA 1S5BD 2RDHA 1CKOA 2QILA 1X6OA 1I94L 1TS3A 3OMGA 1DOKA 4RAUC 1G6PA 4IPGA 1ZXTA 1NUCA 4O0AA 4TQUS 3BVGA 4RFBA 4EVOA 2Z9HA 3KDFA 1GM5A 1IYUA 4G7HC 3I3CA 3N52A 1O7IA 1U4LA 2L0CA 3ZYYX 3VA5A 3S1QB 4A3IG 4R8NA 4DK1A 4YWKA 5JAVA 2MPMA 3E0JA 3LWUA 5C4XG 3ULPA 1JOOA 2GN5A 1CKNB 1UWVA 4LUVA 2PO4A 4GOPC 2K03A 4KMUC 1VQ5A 2R92H 4YHHQ 2B2TA 4HJ8A 1E2ZA 1EY5A 3G71A 1PH4A 5DAUA 4JOIC 3UDIA 2YV5A 4UP7A 4C3HB 1V1OA 5GAHC 3PSIA 3TP8A 4MHEA 3S1RH 5E3FA 5CR3A 3DMUA 5FLMG 3S1MB 3CP0A 4JI0Q 2VQFQ 2X6LA 4GS3A 1XNQQ 1AP0A 3S2HH 3GTLB 4A3IB 5M5WH 5C4XB 5FK9C 3EIVA 3I70A 2KCCA 1IBKL 2F0LA 1B9MA 2FXQA 3A74A 5KIXA 2F03A 3S14B 1EL0A 4HSVA 3JAMc 4K5VA 1HA5A 4B3MQ 2EVBA 1YJWA 1PH3A 4A4IA 3NENA 4IJHA 3TS2A 2F0QA 1TWGB 3TSSA 4ZQ3A 4DV3L 1BXTA 1YVCA 2CKZB 3HOVG 4B08A 4KJOA 1L1OA 1WD1A 1JJ2A 1I6HB 2PZWA 4DK0A 3KK7A 1F9QA 4OWWB 3F8TA 1BF4A 1ASYA 1HCZA 5JJZA 3QJYA 5G3LD 1VQEA 2JEAI 4A3FH 4NXML 1MBYA 3KUPA 3PQIA 2PYKA 4EQNA 1K8MA 1PYWD 1Y1VG 3OPOA 4MN3A 1B3QA 2HHHL 4JPBW 4A3DG 4RCNA 4A3GH 1QNUA 1VQMA 3OYYA 3HOVB 1GHKA 4K0KL 2F0OA 1EIHA 1X3FA 1AN8A 3Q23A 1RDPD 1X32A 2MO0A 4XQJA 3RN5A 3A55A 1MI2A 4LMQD 1U4PA 3W1GA 1HPCA 4JW0A 4A3KG 5K36G 1TS2A 2B8GA 2E75C 4A3LG 1LTSD 1KC8C 2NUCA 2Q2TA 5D14A 2JA8H 1PTOC 2NTTA 1VQOA 3T1YL 1Y1VB 1D8LA 2KCTA 1YNJD 2K6AA 1EY0A 4A3DB 1QVGA 2XNAC 1XNRL 2F1MA 1VMPA 4I7AA 3J7ZC 1VQ8A 2V1CC 3KJPA 1CA6A 3VYSA 3J7A5 2EZVA 4K5WA 4JG2A 4MTKA 2KHJA 3D4RA 2HDLA 4XQNA 4A3KB 5IYBH 1KABA 2R92G 2KOLA 1SMYD 3WWVA 3PUVA 4ZAIA 4HJAA 1W2BA 1CHPD 1C8CA 2NWGA 5EPKA 1EWHA 5DM73 1HZCA 1EYDA 2JA7H 4JVZA 3RD4A 5J39A 1DD2A 1DM0B 4PMCA 4WFN3 3C1FA 1ILPA 2N3SA 5CORA 1KAAA 4OX9Q 3J80E 3HOYH 4OO1I 1TWAB 1UE7A 3TEHB 2B2WC 2UXBQ 2R92B 2D9UA 1LTGD 1Z47A 5IE8A 5FOBB 2EJFC 3TRZA 2FMCA 3BZDB 4KI0A 1HTPA 2VQEL 1ENFA 2ZT9C 3VA7A 1E22A 1JORA 3I55A 1BCPF 2K1BA 4X3UA 1EY6A 1J5EQ 3A5UA 4GN3B 3AMUA 4DR3Q 4RHRA 2K01A 2NVYB 1ET9A 2NTSA 4RWSC 1SE3A 1B8AA 1BCPB 1LT3D 1NMGA 1NR4A 1VQ7A 4K14A 1M8AA 3VR2A 4HIKA 3S9WA 4POGA 5FLXE 3KJOA 4A3FG 2F0SA 2X6GA 5IP7H 4DPGA 1A2UA 1VQFA 5FO8B 2K75A 4H7BA 4KN7C 5C3EG 2Z8LA 3J7AV
chains in the Genus database with same CATH topology
2DJFC 1ICFB 4OELB 1MHWC 2DJGC 4CDCC 4CDDC 4CDFC 4OEMB 4CDEC 1K3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJF C;  1ICF B;  4OEL B;  1MHW C;  2DJG C;  4CDC C;  4CDD C;  4CDF C;  4OEM B;  4CDE C;  1K3B C; 
#chains in the Genus database with same CATH topology
 1MKH A;  4GLX A;  5JPM C;  4LUZ A;  3M3Y H;  2N8N A;  1VCI A;  1D5M C;  1I5F A;  1HH2 P;  3OTO L;  1A6X A;  4KHZ A;  1KL9 A;  4JI5 Q;  2EYF A;  1SJE D;  3QG1 A;  2B2Y A;  4A3F B;  3PUY A;  4DV0 L;  2NVT B;  4AH6 A;  1Y1W B;  5C3E B;  2E2D C;  5DNF A;  1QUQ B;  3GTG H;  4GN5 A;  3DM1 A;  1B4O A;  2ENB A;  2WAQ G;  3E3X A;  2K50 A;  1SEB D;  4DR7 L;  3NWS A;  4L5T A;  1XPO A;  4QIW B;  1G2S A;  3SE0 A;  1IL2 A;  2A5H A;  4LF9 Q;  2UUA Q;  5IYB G;  5EPL A;  1E7Z A;  5LMN Q;  4LFA L;  3K0X A;  1SYG A;  1SND A;  5ELN A;  2WB1 G;  2F0J A;  2HT1 A;  2VW9 A;  3KBX A;  5JVH 3;  3I4N H;  1LO5 D;  2B29 A;  2WAQ B;  2Z0S A;  3KF6 B;  1CZW A;  2JA7 G;  4DR6 L;  4LF7 Q;  1M1K C;  1BUV T;  1SE2 A;  1O7Z A;  1SYE A;  1YNN D;  3HG9 A;  4FXK C;  2EYL A;  4DR5 L;  4DK6 C;  3HOY G;  2MGS A;  2UU9 L;  2PMZ B;  2KJX A;  3S1N H;  3VR3 A;  4DKA C;  4A75 A;  1HFN A;  3TME A;  1SBB B;  1WTQ A;  4X62 Q;  1XTC D;  2I5L X;  3HOX H;  1K73 C;  3NQT A;  4A3B H;  1HFG A;  2WB1 B;  2B2U A;  4JI4 L;  1B53 A;  1SR3 A;  2I0Q A;  3PUW A;  2NZ1 D;  5G3L F;  2JA7 B;  2SEB D;  4R4T A;  2LSS A;  3HOY B;  2LS0 1;  1LT5 D;  3Q6S A;  4X65 L;  4KHP L;  1ML0 D;  3H15 A;  2UUC L;  3HZX A;  4QJF A;  5ELC A;  4O2D A;  5AFW A;  2F0P A;  2IX3 A;  1S5D D;  2L12 A;  4K5X A;  4KKT A;  3MFY A;  1L0X B;  1Z9F A;  4JBW A;  1OXT A;  1JIC A;  3OIP A;  4HJ9 A;  5CBA E;  2E8G A;  1PH7 A;  1G2T A;  2KHI A;  1H95 A;  4GKJ L;  1WD0 A;  1HZA A;  1D2B A;  2Z4H A;  3OWF A;  1M90 C;  4B9X A;  4U68 A;  2A6E D;  1NBW A;  1DOL A;  3J81 E;  2IHF A;  3RZD B;  1FNU A;  2PCF B;  4AYB G;  2ZTC A;  2WFW A;  2BDO A;  4KN4 C;  1T5X D;  2R7Z H;  3GV3 A;  3QR8 A;  1U5K A;  3DEP A;  4B3R Q;  4DV2 L;  2UXC Q;  3M3Y B;  4XTC S;  3V05 A;  3CCM A;  4JV5 Q;  2Q2U A;  4DR2 L;  3SGI A;  1EOV A;  1O78 A;  4PZ8 A;  4CJ2 C;  3U58 A;  3AFQ A;  5C44 G;  2I46 A;  3CCJ A;  1NR2 A;  3CCS A;  3TP6 A;  4JI6 L;  1G6Z A;  5C4H A;  2Z6K A;  4IQZ A;  2IW3 A;  3M7N A;  4BWG B;  5I9P A;  4JI2 L;  2H4O A;  2F0U A;  4AYB B;  2E2I B;  4ZRZ A;  2HUG A;  3I4N G;  1HQM C;  2KHS A;  3GTG B;  5FO7 B;  4GOP B;  2QA4 A;  5JVG 3;  3QWN A;  1VF5 C;  4RKB A;  4DFA A;  3U4Z A;  1YBY A;  2SNS A;  2P5Z X;  3G48 A;  2ASB A;  5C44 B;  2ZM6 Q;  4LF5 L;  1K3B C;  3C46 A;  3EQL C;  5IP9 H;  3BS1 A;  2JEB I;  3HOX G;  4G7O C;  5I6Y A;  4F87 A;  5KYL A;  2UXD L;  3I4N B;  4CDD C;  1N32 L;  2D62 A;  2OT2 A;  4C1N K;  4AQY Q;  5IGB A;  3A0J A;  2WV6 D;  2FMM A;  3R2I A;  5EBC A;  1STH A;  2B8F A;  2BH8 A;  1GUO A;  5C6A A;  3K59 A;  3HKS A;  3CCR A;  2J0T D;  1EZ6 A;  2E76 C;  3VR5 A;  1I4R A;  3H91 A;  3HOX B;  2N78 A;  3L3O C;  5BN5 A;  1CSQ A;  1PH9 A;  3HOZ H;  1BO0 A;  5BN4 A;  4KD4 A;  3NQI A;  5IOD A;  2MQH A;  3GTM H;  1KDB A;  5M5X H;  2EY6 A;  4JI0 L;  2YU9 H;  2MHV A;  4G57 A;  2A69 C;  3VDY A;  1RTO A;  1PZK D;  1X3E A;  2IT1 A;  4OWX B;  4KTA A;  4PG3 A;  2PPB C;  1RJT A;  2OQK A;  2XN9 C;  4LF4 Q;  1SLJ A;  4HCE A;  1Y8P B;  1MGS A;  2LFN A;  3NBH A;  1JOK A;  4ULL A;  3KLR A;  1IHZ A;  1Q90 A;  5ISR A;  1X3G A;  3L9A X;  3GTJ H;  3CD6 A;  1IL8 A;  2HQL A;  2A1A A;  3KBG A;  4LF6 Q;  1LAC A;  2SOB A;  2F0F A;  1HNW Q;  5FJ8 H;  2MJ8 A;  3P7J A;  1PTO B;  1S5F D;  4QMG A;  2JP1 A;  4U67 3;  1KDC A;  2X69 A;  5ELO A;  2UUB L;  3S1Q H;  1D1K A;  1W6J A;  1EOT A;  1GUS A;  1EYC A;  1K83 B;  1VQD A;  1SRO A;  5JPN C;  1X56 A;  4DK3 C;  1PFN A;  2CW0 D;  4B3T Q;  2A6H C;  2CWA A;  1CQV A;  1ZEQ X;  4C3H H;  5JJK A;  4EGV A;  2F4V Q;  1KNE A;  4LFB Q;  1IW7 D;  1HR0 W;  1S3O A;  1OTC A;  1OXV A;  2CHB D;  3DXJ C;  4FF1 A;  4A3I H;  2BE5 D;  4H44 C;  2F4I A;  1UEB A;  4FNF A;  5D3D A;  4LF8 Q;  3BVM A;  5IP9 G;  4KKS A;  3T13 A;  3DM3 A;  1SNQ A;  1PA6 A;  2KCN A;  1W6K A;  2N55 A;  3M4O H;  4FDB A;  4DUY Q;  5FLM H;  2OWO A;  4B3S L;  2F0V A;  4DN4 M;  2G9D A;  2R93 G;  1NSN S;  2QW7 A;  1TWG H;  3SR1 A;  1SYD A;  2OQ0 A;  2KEC A;  1EY7 A;  5I2X A;  1N34 Q;  1EWC A;  1EIY B;  3U9S A;  3V96 A;  1VQ9 A;  3MWY W;  3HOZ G;  4L8J A;  2MO1 A;  2CQA A;  3H3V I;  1BR9 A;  4UAI A;  1IBM Q;  3FPU B;  1S5E D;  3NTK A;  1OXU A;  3ND9 A;  3AB9 A;  2R93 B;  5LMU L;  3HOV H;  3F2C A;  4HSP A;  5LHY 1;  4QGU A;  5IGG A;  5I6W A;  1FR3 A;  4WJ3 M;  2GVA A;  4JCV E;  1WTX A;  1HTL D;  1C48 A;  3CC4 A;  5CC4 A;  3S24 A;  4ZLT F;  4DV4 Q;  4DV5 L;  3RN2 A;  3VYT A;  1BCP D;  2KQ3 A;  4B9W A;  3R2T A;  4DNT B;  3HOZ B;  1KTK A;  4ZK9 B;  2JN4 A;  1KLG D;  4PMW A;  3GTM B;  2QGQ A;  4DV1 Q;  5M5X B;  2AHO B;  2WAQ E;  1NE3 A;  4P2C B;  4PZ7 A;  1XMQ Q;  1C9O A;  4NDX A;  4H13 C;  3JAM E;  2PMZ E;  2XGT A;  3R93 A;  4DAM A;  4DGZ A;  2VXW A;  3BDL A;  4ZKC B;  5F2D A;  1J8I A;  1BBU A;  4BY1 G;  1CKN A;  1ZKO A;  4P75 A;  4BA2 I;  3X3M A;  4A3L H;  4KJN A;  2WB1 E;  4X6A H;  2IL8 A;  3GTJ B;  1WVL A;  2E2H H;  4L6T B;  3E9I A;  1FGU A;  1R4P B;  1ENC A;  1SNO A;  2F0D A;  2VB3 X;  3HOU G;  4C3H G;  2C5C A;  1BKB A;  3I73 A;  2RCN A;  1JCK B;  3PIO A;  4NXN L;  1G51 A;  4X64 L;  3IFT A;  1I50 H;  3MXN B;  1SFO B;  4BY1 B;  2K5H A;  1TWA H;  4V0B A;  4A3C G;  1PRT C;  4YCU A;  3HOU B;  5EPJ A;  1V43 A;  1T5E A;  1AW7 A;  3F2U A;  1IKL A;  1JE5 A;  4FVM A;  2F0M A;  3A8I E;  2A68 D;  3TDQ A;  4Q0F A;  5IY0 A;  4RGM A;  4IUN A;  2HD3 A;  2NVY H;  5J1Z A;  3WOE A;  4YY3 L;  3PIO 3;  1K8G A;  2Q8T A;  4DU9 A;  1ZYR D;  4K6L A;  2ICE C;  5E4W C;  2RDG A;  5LMN L;  1UE5 A;  2N88 A;  4BBS G;  1SNM A;  3NE5 B;  3PIP A;  4XIG S;  2RHS B;  3O13 A;  3SEB A;  3SVM A;  1NTG A;  4GNX B;  1PHJ A;  3M4O B;  1E0B A;  1HNZ L;  2QEJ C;  4X66 L;  5C4Z A;  3HKZ G;  1K9M C;  2QCP X;  4BS9 A;  3S1M H;  4BY7 G;  2BOS A;  4BBR G;  4OON A;  2L5T A;  2SNM A;  5I4D A;  4GLV B;  2Z6B A;  2A73 B;  3FHW A;  2R3Z A;  2DNC A;  1YHQ A;  3OWE B;  3D4D A;  3PMF A;  5M3F H;  4BBS B;  2NVX H;  3N6R A;  5C4J B;  1B70 B;  4AYB E;  1PH1 A;  3GTO H;  4JYA Q;  5I9O A;  2F0K A;  2NVT H;  1HRJ A;  4XDX A;  3PIP 3;  2ZXO A;  1Y1W H;  3HKZ B;  4N9T A;  5C3E H;  2VUM H;  3K5L A;  4BY7 B;  1JOQ A;  4BBR B;  3X3N A;  4QCL A;  1I4Q A;  1ASZ A;  3PCO B;  1G91 A;  1DJR D;  5EKK A;  2F0N A;  2IJ0 A;  3AEV A;  3W5O A;  1XXG A;  3H0G H;  3STB D;  1JJG A;  5C0X I;  4LW1 A;  1WCM G;  2EY2 A;  2RF4 A;  1YIT A;  1QVF A;  4JI8 Q;  3D31 A;  1HQR D;  3PF5 A;  2LY7 A;  2Y0S G;  4CDF C;  2HQE A;  2ZXR A;  2Q2H A;  4JI7 L;  2B63 G;  1PVO A;  4DR1 Q;  1RIP A;  2A74 C;  1HNX Q;  2K7V A;  2ZTD A;  4HN7 A;  3C1E A;  3LNN A;  1M4V A;  5BR8 Q;  2IPK D;  3NXW A;  2AQ3 B;  1H9S B;  1BBX C;  1NAP A;  4UP9 A;  2EE1 A;  3L0O A;  1XMO L;  1BOS A;  1WCM B;  1VF7 A;  1NCV A;  4CKC A;  3OW2 A;  2E2H B;  1FJG Q;  2K28 A;  4QQB X;  1BNZ A;  2EY1 A;  2V4D A;  3DWA A;  2Y0S B;  3BJU A;  1N8R C;  2B63 B;  5CV5 A;  1LUZ A;  2UXC L;  1WTV A;  2N49 A;  1FGB D;  3IFD A;  5DEH A;  1I50 B;  4DAY B;  4ABN A;  5KYI A;  5GAG C;  4HMJ A;  1U4R A;  3VYR A;  3J80 L;  1Q86 C;  5AJ3 L;  4GKK L;  2E2J H;  3D4W A;  3GP7 A;  4FF2 A;  1ICW A;  2FIN B;  5NUC A;  5EKI A;  1NMF A;  3K8A A;  1A8V A;  1Y8O B;  2AQ2 B;  1J6Q A;  1UUP A;  4A3M G;  1GOZ A;  2K5V A;  2ICI A;  1PFS A;  2XWB B;  1N36 L;  2KED A;  3U9O A;  1VQ4 A;  4IZ8 A;  4JI1 Q;  1PZI D;  3GTP B;  2DN8 A;  1KD1 C;  2PZU A;  2EOT A;  4A93 H;  4V19 0;  5M3F G;  2O5I C;  3ERS X;  3DEO A;  3DHQ A;  5JEA H;  3H09 A;  3MTS A;  5FLX L;  3WOF A;  1JWS D;  1Q1B A;  2JE6 I;  1QCB D;  3RZD H;  5FKA C;  5HUR A;  1Y1W G;  1N33 Q;  2E5L Q;  2VUM G;  1QUQ A;  4A3M B;  2B2V C;  4J8Q A;  2NZO A;  1O7L A;  4DNR B;  1I4H A;  2VL6 A;  3CCE A;  4AIM A;  5IYC G;  4LWC A;  2BH2 A;  4CDE C;  1EUJ A;  3H0G G;  5M3F B;  2KA7 A;  1VQL A;  2NVX B;  4L63 B;  3TP5 A;  1I94 Q;  2CWP A;  5KEE A;  3GTO B;  2D0O A;  3M4Y A;  1STA A;  3ERO A;  2JSO A;  3VYU A;  2A6E C;  2VUM B;  2E2I H;  4XQQ A;  1HZB A;  4R4O A;  2C35 B;  3RLN A;  4WJ4 A;  2HCI A;  1L2F A;  4BXX G;  2TSS A;  1SAP A;  3KF6 A;  1AEX A;  1CUK A;  5CMD A;  1ESR A;  2EXZ A;  3M85 A;  4KY7 A;  1PTO D;  5C44 H;  1F2Y A;  3H0G B;  5C3X A;  1S4Z A;  4DAP A;  2EYH A;  1CFM A;  3J81 j;  1D7Q A;  2EJG C;  2CFM A;  4DR4 L;  2F3W A;  3J80 c;  2F0G A;  5L37 A;  5IWA L;  1LTT D;  1O7Y A;  3KLS X;  1GUT A;  1X3Q A;  2JA9 A;  3A5Z B;  4QB4 A;  3BDC A;  5LMN W;  4POF A;  2WII B;  5LL6 X;  3DWQ A;  3QIA A;  1IBK Q;  4JI3 L;  2XWJ B;  1Q46 A;  1E1O A;  2K33 A;  1SJH D;  2DJF C;  3G7L A;  3FP9 A;  5E1F A;  4J1M A;  5A2Q E;  4DV6 L;  1GXD C;  5CV8 A;  1HR0 L;  4HIM A;  3EBE A;  5D3I B;  4PV1 C;  4IOC A;  3W1B A;  3WDN A;  2AQ1 B;  2K5N A;  1STB A;  5COY A;  1TS5 A;  5FLX c;  2PQA B;  4KY5 A;  1LM0 A;  4NW2 A;  1PXU A;  1II3 A;  1V9P A;  2NVQ B;  4XYQ A;  3NTH A;  4G7Z C;  4ME3 A;  4N8F A;  1LAB A;  3V2T A;  3M7G A;  1JWU D;  1NNX A;  1L0W A;  1EU3 A;  2E2J B;  4A93 G;  1SDF A;  4IUV A;  3OIQ A;  4NXM Q;  1F2Z A;  5GAE C;  3NHH A;  5JEA G;  1H9R A;  2YYZ A;  2PI2 E;  3P75 A;  2L11 A;  4KHV A;  5IT9 E;  4L5Q A;  1I4P A;  2HHH Q;  1A3U A;  3KF8 B;  4NKL A;  2BA0 A;  3L2P A;  2AKW B;  2EPB A;  1PH8 A;  3CRK C;  4K0K Q;  2B2T C;  3FKI G;  2PZT A;  2GVB A;  2OTL A;  1PTO H;  1GUW A;  4YCV A;  1RTN A;  4TKO B;  4A93 B;  1ET6 A;  1CK1 A;  3I4L A;  2EYJ A;  1X9N A;  1K83 H;  3T1Y Q;  1ENA A;  2RVL A;  3CAM A;  3M4P A;  1AZP A;  3ULL A;  3J81 L;  5DM6 3;  4R4C A;  1TWF B;  1XNR Q;  4DV7 L;  2RSN A;  5IGF A;  4GOP A;  2PQE A;  2RQX A;  1WTR A;  1YJN A;  3PO3 G;  3FKI B;  1OO9 B;  1VQA A;  2R7D A;  4IFD G;  1DCZ A;  4LAA A;  4JOI A;  2EYM A;  2QDB A;  5ELE A;  1K0S A;  1PZJ D;  1EFI D;  4DAV A;  2CQO A;  4DUZ L;  4IOA A;  2HIV A;  2JXM B;  3Q22 A;  2OTJ A;  1L1O C;  1JWM D;  4OWT B;  3D6C A;  3T1H L;  1KHI A;  2IX0 A;  3TRE A;  1U9R A;  2WKC A;  4LFC L;  3RLF A;  3UE1 A;  1KRS A;  3PO3 B;  1PFM A;  2LKV A;  2ZXP A;  3K5O A;  1PRT B;  3MC0 B;  4J6H A;  1SYB A;  1IW7 C;  2LMC B;  3S16 H;  4A3J H;  1EEI D;  2VQE Q;  2NZH A;  2WAC A;  1FNW A;  2JJQ A;  4MZ9 A;  1STE A;  2CVR A;  3HKZ E;  4RGO S;  5IIF A;  1UNS A;  1YI2 A;  4QY7 A;  2DUD A;  3A8K E;  4CDC C;  3RUZ A;  3I91 A;  4IUR A;  1F77 A;  1LTR D;  2R93 H;  4OO1 H;  2NN6 H;  3QOJ A;  3CU7 A;  4O1N A;  3UI2 A;  1C7Y A;  1TKW B;  3EFX D;  1LTL A;  1IXR A;  2KUM A;  1D6E C;  1GKH A;  4ZKB B;  3PGZ A;  1SE8 A;  5EGT A;  3NTI A;  3SK5 A;  4YHH L;  3CC2 A;  2VB2 X;  2Q8I B;  4XYO A;  3BZC A;  4K8I A;  1STG A;  2VQF L;  1Q7Y C;  1XNQ L;  3J81 c;  4NP5 A;  2VZA A;  1EU4 A;  3RMH A;  4KD3 A;  2O5J C;  5CGK A;  1QE6 A;  1FD7 D;  4IUQ A;  1FYC A;  2QDL A;  4DV0 Q;  3HGB A;  4H02 A;  1D5X C;  1PTO F;  2Y0S E;  1WYD A;  2KBN A;  4B3M L;  3MAQ A;  5EQ0 A;  3GTQ H;  1C0A A;  4RGN A;  3MXU A;  4DR7 Q;  1XX8 A;  1V8Q A;  1PFB A;  3RNU A;  1Y8N B;  1SMX A;  4YWM A;  1WTP A;  2G9H D;  4GN4 B;  3SHL A;  1PH6 A;  2KEN A;  3KOJ A;  5KND A;  1KNA A;  2HDM A;  4LFA Q;  3G6E A;  1SFO H;  4BY1 H;  3BDO A;  2EQS A;  4KK7 A;  4JYA L;  3I4O A;  4XXE A;  4TVA B;  3HOU H;  4MIU A;  3CRL C;  4DR6 Q;  2B2W A;  2QEX A;  1HHV A;  4DXF A;  1JC7 A;  4DR5 Q;  1E24 A;  4PZ6 A;  4RA8 A;  4ZCK A;  2UU9 Q;  3RR5 A;  2XSC A;  1EYA A;  1H9K A;  2K05 A;  2L55 A;  3MXP A;  1PLF A;  5HGT A;  4A3J G;  3T51 B;  1J9O A;  1Q3L A;  2E74 C;  2IHE A;  2K5D A;  3A7L A;  3GO5 A;  4OIJ A;  4JI4 Q;  1EY8 A;  1KQS A;  4A3C H;  1CZG A;  1JMC A;  2AUJ D;  3PF4 A;  2D0P A;  1RD9 D;  4IO9 A;  2B3G A;  2B2Y C;  4RCO A;  1G8Z D;  1RCV D;  4CJ1 B;  2XTI A;  4DR1 L;  3UDG A;  2KVM A;  1GHJ A;  2F3I A;  2Z4I A;  4OO1 G;  2NN6 G;  4IN3 A;  3S16 B;  4A3J B;  4X65 Q;  4KHP Q;  2UUC Q;  2L15 A;  3GD7 A;  2OCE A;  2BA1 A;  1ESF A;  5D65 A;  3A54 A;  3K7U C;  1SE4 A;  2R6G A;  1IKM A;  2AUK A;  1B7Y B;  4BBS H;  1GUG A;  1KRT A;  5C4J H;  1QWY A;  1A63 A;  2RSO A;  3URY A;  3HEJ A;  1B44 D;  1MHW C;  1DOM A;  2JQO A;  1TVX A;  4BY7 H;  4BBR H;  4GKJ Q;  1XTD A;  2AMC B;  3KLS A;  1A3V A;  3DLL A;  1IZ6 A;  4OIK A;  4GLA C;  4L5S A;  4OX9 L;  3GDE A;  1B50 A;  2L9H A;  4CHT B;  2YTY A;  4E6I A;  4OEL B;  2UXB L;  2Q8R E;  1KIX A;  5FO9 B;  1S72 A;  2A69 D;  3BYY B;  1EFW A;  1E1T A;  1XPU A;  1F9S A;  2Z1C A;  2PI2 A;  3OHX C;  4DV2 Q;  2JK8 A;  1SYF A;  4HCS A;  1J5E L;  2EXD A;  4PMB A;  1FNV A;  2J7Z A;  3D6W A;  1IYV A;  4EX5 A;  4DR3 L;  3GTK B;  4DR2 Q;  3H3V C;  4H0L C;  3JAM L;  1EY4 A;  2B2U C;  2QKI C;  3C2P A;  3QOL A;  3CCL A;  2RA4 A;  1TXY A;  3FVQ A;  4DNI A;  4JI6 Q;  2Q2I A;  3J80 i;  3MZ5 A;  3MXN A;  1VQK A;  1UEA B;  3CQZ B;  4JI2 Q;  1WCM H;  3NP8 A;  3CME A;  4FXG C;  1SXT A;  1XPR A;  1K8O A;  3CPW A;  1I3Q H;  2EYP A;  1EEF D;  3GTQ B;  4P71 A;  4ILW A;  2B63 H;  1YNJ C;  3S15 B;  2EDG A;  2KCM A;  2DGY A;  1UE1 A;  4PNY A;  1PV4 A;  4LF5 Q;  5DLQ E;  2A6H D;  4J15 A;  1R9T B;  4JI5 L;  3QO2 A;  1PDQ A;  3LX0 A;  4RMF A;  2UXD Q;  5JOB A;  2BDN A;  5J3B A;  1DXM A;  3M4Q A;  1V1P B;  3A7A B;  1N32 Q;  2PW7 A;  3LWE A;  2F0T A;  4GNX A;  1SMY C;  2M9V A;  1QB5 D;  4Y52 H;  4EQP A;  1JR0 D;  3SXH A;  1QJO A;  1DZ1 A;  3TQY A;  3T53 B;  3HOW H;  3KYH C;  1X65 A;  1X54 A;  5T1I A;  4HAE A;  3NBI A;  5T1G A;  3K7A B;  3GTP H;  5EBD A;  3F1Z A;  4LF9 L;  2UUA L;  3SK6 A;  4S3S A;  2ZTE A;  4F88 A;  2M2L A;  4IUP A;  4UDU C;  5JEA J;  2XRS D;  1F9R A;  3ZJY C;  3K6O A;  3UDX A;  2QF7 A;  3KDF B;  3NWT A;  2Z6K C;  1WFQ A;  4A3M H;  4RHS A;  1VQJ A;  5H1S E;  3Q0A A;  4LF7 L;  3J7A F;  4LNQ A;  4HJ5 A;  1FVI A;  3BZK A;  3D0F A;  1RKN A;  4LUO A;  3K5M A;  3S2D B;  2F3V A;  1JB3 A;  4OXP A;  1H9J A;  1AFP A;  4Y7N B;  4K2L A;  4FYD A;  2K4K A;  4X62 L;  1A62 A;  3PUX A;  4FP5 D;  1G29 1;  1W3S A;  3ITP A;  1IBL Q;  3PO2 H;  3KLW A;  5CV4 A;  1VDZ A;  3M9B A;  1CSP A;  3FDT A;  4O42 A;  5GRO A;  1CQF A;  2UUB Q;  4JK1 C;  4IFD J;  2O2L D;  5IYC H;  4C2M H;  1YJ9 A;  1B9N A;  1C4Q A;  1H9S A;  3FPP A;  1GD7 A;  1YEZ A;  1RHP A;  2RCF A;  5TSS A;  3I2Z A;  4CKB A;  4HR7 B;  1D5Z C;  4P74 A;  1OXX K;  4KKU A;  4ME5 A;  2XVS A;  1GO3 E;  1K28 A;  1BVS A;  4BXX H;  3GV6 A;  1L1O B;  2DY7 A;  2NYZ D;  4C3J H;  4R4I A;  2YTX A;  4DAY A;  1V1Q A;  4FF4 A;  2WIN B;  2F0H A;  3TS0 A;  5JJI A;  3SK4 A;  2F0W A;  1GJX A;  3D3R A;  1GUN A;  1I3Q B;  3H6M A;  4B3S Q;  1JB7 A;  5LL6 S;  1QOH A;  2H5X A;  1A0I A;  1U0L A;  4WOR A;  3CXC A;  3E0E A;  4B3R L;  3R3O A;  4CKE A;  3NPP A;  3EVQ A;  4F8M A;  3HOW G;  4HED A;  4JV5 L;  1EQV A;  2NVQ H;  1EQR A;  4HJ7 A;  1PRT D;  1YNN C;  3KFU A;  2F0I A;  5A35 A;  1MSH A;  5EJW A;  2C9O A;  5ELB A;  4ODG A;  5HY6 A;  5GAD C;  1A3T A;  1F9P A;  4JBK A;  1QVC A;  1TY0 A;  2MNA A;  1KDA A;  1QIL A;  4P72 A;  3J81 i;  2A19 A;  3P1H A;  1VQC A;  3G4S A;  1MJE A;  5LMU Q;  2I5H A;  3MXG A;  2PW5 A;  4C1N I;  3ND8 A;  3HOW B;  3QB3 A;  4RH6 A;  2IWH A;  2EJM A;  3NK9 A;  1K8A C;  4IJL A;  2NN6 I;  4DV5 Q;  1PMR A;  1BBW A;  2ZM6 L;  1ONL A;  3H3V H;  3ONA B;  2K04 A;  3F2D A;  1E2V A;  1CI3 M;  3S1R B;  5J22 A;  3PO2 G;  5K5P A;  1TWF H;  5IGE A;  3S2H B;  1LT6 D;  4AQY L;  3C3L A;  4C56 C;  2R61 A;  5M5W B;  3S17 H;  2ZJP A;  2AWO A;  2XRQ D;  2ZJR A;  3FKI H;  3Q8D A;  3MHB A;  3HS0 C;  5C0X J;  3UDF A;  2ALY B;  1TU2 B;  4I7Z C;  1HUN A;  1F2M A;  2K5W A;  1EWI A;  4ALP A;  3PO2 B;  1LYL A;  3I56 A;  4A3G G;  1LTA D;  3E6Z X;  4NXN Q;  1E3P A;  2MP1 A;  4WJW A;  4X64 Q;  4XT3 B;  1JQY D;  5E4X A;  3K5N A;  3PO3 H;  1T9H A;  2M00 A;  3W3A A;  3MA2 B;  2FFK B;  4C3J G;  5I2Y A;  4IFD H;  1TT2 A;  3ICE A;  4C2M B;  5CV9 A;  4UPA A;  4IPC A;  3FMC A;  3T16 A;  2H1E A;  2EY5 A;  2BCO A;  5ELD A;  1PH2 A;  4LF4 L;  2JA8 G;  3CKI B;  4NPS A;  1R4Q B;  1WTH A;  4A3G B;  1D1I A;  1DYQ A;  3MFG A;  4LF6 L;  2JYO A;  4YIJ A;  1HNW L;  3BVZ A;  4K6D A;  4X3S A;  1IYJ B;  1L0Y B;  2PQA A;  1QZH A;  3P20 A;  4C3J B;  4YY3 Q;  4JBM A;  1AH9 A;  1STN A;  3IKJ A;  2NBF A;  1SYC A;  1WOC A;  3HP3 A;  1EIG A;  5A2Q L;  1YHB A;  2JA8 B;  1TY2 A;  1PYB A;  4DF7 A;  3CW2 C;  1HNZ Q;  1P8L A;  2L4N A;  4RGT A;  5JJL A;  1UAP A;  1I4X A;  4X66 Q;  2RDF A;  4B3T L;  1CM9 A;  2TMP A;  5M9O A;  1QG7 A;  3I90 A;  4MNO A;  2K14 A;  3KF8 A;  4Z9C B;  5KNB A;  1SN8 A;  4DV3 Q;  3GQB A;  3W2D A;  3I4M H;  2F4V L;  4LFB L;  4F7X A;  1EY9 A;  3CHB D;  1Y14 B;  3BG3 A;  1Z6H A;  4GZY C;  1CT1 D;  4OEM B;  3RLO A;  1VMC A;  3A8J E;  4C3I H;  4MTN A;  3SK8 A;  1VQH A;  4LF8 L;  3BYT B;  4R9W A;  4Q5V A;  2OEO A;  3IAY A;  5IT9 L;  3HRZ C;  1DGS A;  2J4X A;  1OXS C;  1BQQ T;  4EQ5 A;  1Q8K A;  5M3M H;  1LT4 D;  5CV7 A;  2HCC A;  2ES2 A;  3VR6 A;  4DUY L;  1JT8 A;  3IRB A;  1Z7T A;  1AE2 A;  4HTH A;  2CH4 W;  1TWC H;  2B39 A;  4GNX C;  1JE4 A;  1ILQ A;  1XJV A;  5M5Y H;  5HGQ A;  4FXD A;  1N34 L;  1VS0 A;  1RF2 D;  3UE0 A;  3I8Z A;  3TP7 A;  5IP7 G;  1EQQ A;  4LK1 C;  5C5L A;  3BU2 A;  4DXG A;  4A76 A;  3TN2 A;  5IGC A;  2RKS A;  3NUC A;  1SNC A;  3U50 C;  3TBI B;  1QZG A;  4JI7 Q;  1LLR D;  2D2C C;  4NMZ A;  2G5D A;  4R8I A;  3S17 B;  1IBM L;  1CHQ D;  4KLK A;  2MFI A;  3T4A C;  1TR5 A;  4KV6 A;  5C0X H;  1KAW A;  1U4M A;  3DUZ A;  3AU7 A;  4RG1 A;  4OL7 A;  1XMO Q;  3TZU A;  1XWE A;  5KGU A;  1TS4 A;  4X3T A;  4DV4 L;  4UP8 A;  3F2B A;  2ATW A;  5C3W A;  3J7Y W;  4WRD A;  2CH4 A;  1PRT F;  4JBJ A;  4QF4 A;  3NEM A;  4R1J A;  1TQO A;  4DV1 L;  4NB3 A;  1XMQ L;  2LXJ A;  2CW0 C;  3I72 A;  4IUU A;  2RBM A;  1JJC B;  4IUT A;  1CKM A;  5CYU A;  4LJZ C;  1HJP A;  5AJ3 Q;  1F2L A;  4GKK Q;  4QUF A;  3VR4 A;  2EYO A;  2BE5 C;  2F52 A;  2PNR C;  2DJG C;  3I7F A;  4YWL A;  3K57 A;  3CPF A;  2JA5 H;  2R7F A;  1CTM A;  3IL8 A;  5EAY A;  3CMA A;  4CBV A;  2VS1 A;  3I4M G;  5KNC A;  1N36 Q;  1VQ6 A;  3MVV A;  5IT9 c;  1EQT A;  4UY8 C;  1S5C D;  5IOC A;  3RZO H;  2VNU D;  3JAM i;  1I6V C;  3OOC A;  4UHV A;  4C3I G;  2DNE A;  4A3B G;  1LV9 A;  1Q12 A;  3OSO A;  1FL0 A;  5M3M G;  4APV A;  1Y69 U;  2ID0 A;  4TSS A;  3I4M B;  4OHJ A;  3K0Y A;  3L7Z C;  3GTK H;  4YCW A;  3S1N B;  2K52 A;  3K81 C;  3OTO Q;  3CCQ A;  2JA6 H;  1SNP A;  1PYS B;  4C3I B;  3U4V A;  1EZ8 A;  3OW7 A;  4A3B B;  3A56 A;  3AYH B;  1WTW A;  3CQZ H;  4PQX A;  4K8J A;  1TWH H;  1WJJ A;  5GQO A;  1LTB D;  2WKD A;  5IYD H;  1BCP C;  5M3M B;  4A3E H;  2O4X A;  4CGY B;  2MUY A;  4ZYS A;  1AZQ A;  3NSW A;  4HIO A;  1TWC B;  2I5M X;  3PV0 A;  3S15 H;  5C0X G;  1PH5 A;  3DWP A;  2IX1 A;  5M5Y B;  1P16 A;  3SDZ A;  2RHQ B;  3K58 A;  4CJ0 B;  1SRU A;  1VQG A;  4QUC A;  1B3A A;  5EKL A;  3ULJ A;  4DR4 Q;  1B1Z A;  1R9T H;  2YTV A;  3G6J B;  3FRP B;  3E9H A;  3CF5 A;  1CA5 A;  3FEW X;  1IBL L;  5IWA Q;  2R7Z G;  2K32 A;  1E2W A;  1K0R A;  3E5S A;  4BA1 I;  1WI5 A;  3R8B A;  4M1U B;  2L1B A;  4HID A;  3ERQ A;  4JI3 Q;  3OMC A;  1VQI A;  4R4Q A;  5IGD A;  1VQB A;  4JC0 A;  4DV6 Q;  3AQQ A;  1YNX A;  3K80 C;  1XYI A;  4XT1 B;  5CV6 A;  3ER0 A;  1HR0 Q;  3NBH B;  4HMI A;  2OXP A;  1BDO A;  3K7A H;  1S40 A;  1MSG A;  4N8X 1;  1O80 A;  3TZD A;  1VQP A;  1Q1E A;  2A8V A;  4OGQ C;  2R7Z B;  4EQO A;  1YZ6 A;  4FO2 A;  4M8A A;  4JI8 L;  1STY A;  3Q24 A;  4L5R C;  1NY4 A;  2AWN A;  2JA5 G;  1X55 A;  2EIF A;  1VQN A;  2VY3 A;  2FJ2 A;  3GTL H;  1HNX L;  3PUZ A;  1HA6 A;  5C4X H;  2PNH A;  5BR8 L;  3EA6 A;  1KXL A;  2A68 C;  1DON A;  2HIX A;  2B2V A;  3S2D H;  1MD2 D;  2NB0 A;  1I4G A;  3B6Y A;  4IPH A;  3S14 H;  1ZYR C;  2WP8 J;  4Y7N H;  1ICF B;  2ZJQ A;  1FJG L;  4K2K A;  1YHA A;  4P73 A;  2JA5 B;  4IAL A;  1Q82 C;  5BN3 A;  1N9W A;  3LGJ A;  5E7N A;  2KEE A;  3RZO B;  2JA6 G;  4TRD A;  4RKL A;  3MEF A;  1I6H H;  2GA4 B;  1LTI D;  1UE6 A;  1AE3 A;  2I07 B;  3CCU A;  5C5M A;  4N9P A;  1GVP A;  2FHT A;  3CC7 A;  1K3R A;  1ROD A;  1SSO A;  4DV7 Q;  4ZUI A;  2F0E A;  5IYD G;  1WTO A;  4KY6 A;  3HFZ B;  4A3E G;  3JC6 6;  1EIF A;  3AFP A;  4I65 A;  4IPD A;  4QIW E;  2K5Q A;  5ELF A;  3EN2 A;  1TII D;  2JA6 B;  1RL2 A;  1A15 A;  4QL5 A;  4DUZ Q;  2XIW A;  4JI1 L;  4X3K A;  2D5D A;  1KLU D;  1H9M A;  4FF3 A;  5KRU A;  1YIJ A;  1MJC A;  3EJI A;  1MIU A;  1QNK A;  1TWH B;  3CCV A;  3T1H Q;  3STB C;  2SDF A;  1Y1V H;  1V1P A;  1NJI C;  2CCZ A;  1Q81 C;  5FJ8 G;  2YU9 B;  1A2T A;  4A3E B;  4ID6 A;  4A3D H;  4LFC Q;  3D8G A;  1N33 L;  1HUM A;  2E5L L;  3T56 B;  3MEH A;  1HZ9 A;  1Q8I A;  2DY8 A;  4DA2 A;  1EYG A;  4G4K A;  5CBE E;  3H94 A;  1B2T A;  1HXY D;  2IY5 B;  2LXK A;  4ZUJ A;  5K36 H;  3NEL A;  4IFD I;  4A3K H;  2OF1 A;  1X3P A;  1S5B D;  2RDH A;  1CKO A;  2QIL A;  1X6O A;  1I94 L;  1TS3 A;  3OMG A;  1DOK A;  4RAU C;  1G6P A;  4IPG A;  1ZXT A;  1NUC A;  4O0A A;  4TQU S;  3BVG A;  4RFB A;  4EVO A;  2Z9H A;  3KDF A;  1GM5 A;  1IYU A;  4G7H C;  3I3C A;  3N52 A;  1O7I A;  1U4L A;  2L0C A;  3ZYY X;  3VA5 A;  3S1Q B;  4A3I G;  4R8N A;  4DK1 A;  4YWK A;  5JAV A;  2MPM A;  3E0J A;  3LWU A;  5C4X G;  3ULP A;  1JOO A;  2GN5 A;  1CKN B;  1UWV A;  4LUV A;  2PO4 A;  4GOP C;  2K03 A;  4KMU C;  1VQ5 A;  2R92 H;  4YHH Q;  2B2T A;  4HJ8 A;  1E2Z A;  1EY5 A;  3G71 A;  1PH4 A;  5DAU A;  4JOI C;  3UDI A;  2YV5 A;  4UP7 A;  4C3H B;  1V1O A;  5GAH C;  3PSI A;  3TP8 A;  4MHE A;  3S1R H;  5E3F A;  5CR3 A;  3DMU A;  5FLM G;  3S1M B;  3CP0 A;  4JI0 Q;  2VQF Q;  2X6L A;  4GS3 A;  1XNQ Q;  1AP0 A;  3S2H H;  3GTL B;  4A3I B;  5M5W H;  5C4X B;  5FK9 C;  3EIV A;  3I70 A;  2KCC A;  1IBK L;  2F0L A;  1B9M A;  2FXQ A;  3A74 A;  5KIX A;  2F03 A;  3S14 B;  1EL0 A;  4HSV A;  3JAM c;  4K5V A;  1HA5 A;  4B3M Q;  2EVB A;  1YJW A;  1PH3 A;  4A4I A;  3NEN A;  4IJH A;  3TS2 A;  2F0Q A;  1TWG B;  3TSS A;  4ZQ3 A;  4DV3 L;  1BXT A;  1YVC A;  2CKZ B;  3HOV G;  4B08 A;  4KJO A;  1L1O A;  1WD1 A;  1JJ2 A;  1I6H B;  2PZW A;  4DK0 A;  3KK7 A;  1F9Q A;  4OWW B;  3F8T A;  1BF4 A;  1ASY A;  1HCZ A;  5JJZ A;  3QJY A;  5G3L D;  1VQE A;  2JEA I;  4A3F H;  4NXM L;  1MBY A;  3KUP A;  3PQI A;  2PYK A;  4EQN A;  1K8M A;  1PYW D;  1Y1V G;  3OPO A;  4MN3 A;  1B3Q A;  2HHH L;  4JPB W;  4A3D G;  4RCN A;  4A3G H;  1QNU A;  1VQM A;  3OYY A;  3HOV B;  1GHK A;  4K0K L;  2F0O A;  1EIH A;  1X3F A;  1AN8 A;  3Q23 A;  1RDP D;  1X32 A;  2MO0 A;  4XQJ A;  3RN5 A;  3A55 A;  1MI2 A;  4LMQ D;  1U4P A;  3W1G A;  1HPC A;  4JW0 A;  4A3K G;  5K36 G;  1TS2 A;  2B8G A;  2E75 C;  4A3L G;  1LTS D;  1KC8 C;  2NUC A;  2Q2T A;  5D14 A;  2JA8 H;  1PTO C;  2NTT A;  1VQO A;  3T1Y L;  1Y1V B;  1D8L A;  2KCT A;  1YNJ D;  2K6A A;  1EY0 A;  4A3D B;  1QVG A;  2XNA C;  1XNR L;  2F1M A;  1VMP A;  4I7A A;  3J7Z C;  1VQ8 A;  2V1C C;  3KJP A;  1CA6 A;  3VYS A;  3J7A 5;  2EZV A;  4K5W A;  4JG2 A;  4MTK A;  2KHJ A;  3D4R A;  2HDL A;  4XQN A;  4A3K B;  5IYB H;  1KAB A;  2R92 G;  2KOL A;  1SMY D;  3WWV A;  3PUV A;  4ZAI A;  4HJA A;  1W2B A;  1CHP D;  1C8C A;  2NWG A;  5EPK A;  1EWH A;  5DM7 3;  1HZC A;  1EYD A;  2JA7 H;  4JVZ A;  3RD4 A;  5J39 A;  1DD2 A;  1DM0 B;  4PMC A;  4WFN 3;  3C1F A;  1ILP A;  2N3S A;  5COR A;  1KAA A;  4OX9 Q;  3J80 E;  3HOY H;  4OO1 I;  1TWA B;  1UE7 A;  3TEH B;  2B2W C;  2UXB Q;  2R92 B;  2D9U A;  1LTG D;  1Z47 A;  5IE8 A;  5FOB B;  2EJF C;  3TRZ A;  2FMC A;  3BZD B;  4KI0 A;  1HTP A;  2VQE L;  1ENF A;  2ZT9 C;  3VA7 A;  1E22 A;  1JOR A;  3I55 A;  1BCP F;  2K1B A;  4X3U A;  1EY6 A;  1J5E Q;  3A5U A;  4GN3 B;  3AMU A;  4DR3 Q;  4RHR A;  2K01 A;  2NVY B;  1ET9 A;  2NTS A;  4RWS C;  1SE3 A;  1B8A A;  1BCP B;  1LT3 D;  1NMG A;  1NR4 A;  1VQ7 A;  4K14 A;  1M8A A;  3VR2 A;  4HIK A;  3S9W A;  4POG A;  5FLX E;  3KJO A;  4A3F G;  2F0S A;  2X6G A;  5IP7 H;  4DPG A;  1A2U A;  1VQF A;  5FO8 B;  2K75 A;  4H7B A;  4KN7 C;  5C3E G;  2Z8L A;  3J7A V; 
#chains in the Genus database with same CATH homology
 2DJF C;  1ICF B;  4OEL B;  1MHW C;  2DJG C;  4CDC C;  4CDD C;  4CDF C;  4OEM B;  4CDE C;  1K3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...