4OENA

Crystal structure of the second substrate binding domain of a putative amino acid abc transporter from streptococcus pneumoniae canada mdr_19a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
220
Chain Sequence
b'KYIIASDSSFAPFVFQNSSNQYTGIDMELIKAIAKDQGFEIEITNPGFDAAISAVQAGQADGIIAGMSVTDARKATFDFSESYYTANTILGVKESSNIASYEDLKGKTVGVKNGTASQTFLTENQSKYGYKIKTFADGSSMYDSLNTGAIDAVMDDEPVLKYSISQGQKLKTPISGTPIGETAFAVKKGANPELIEMFNNGLANLKANGEFQKILDKYLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Second substrate binding domain of putative amino acid ABC t
publication title Crystal structure of the second substrate binding domain of a putative amino acid ABC transporter from Streptococcus pneumoniae Canada MDR_19A
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 75
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oenA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oenA02
3ILUB 5TU0A 4OWDA 1FQEA 5FHNA 1H43A 3UA8A 2I3VA 3IB1A 1SW5A 1MDQA 1P1NA 2Z8EA 1LB9A 4G8MA 4EF2A 1Y3QA 3KOSA 3FVGA 2AYSA 3PGFA 1LBBA 2I0CA 4LA9A 5CI5A 3RUMA 2UYEA 4ZE8A 2DWAA 4FIMA 3MBPA 4Q30B 3U72A 3H6WA 2Y7PA 3C4MA 1ZKBA 1MQHA 1DTGA 3ZSFA 2OLBA 1MG1A 4BDMA 3I5OA 2CZLA 3IX1A 1QUIA 1B3LA 3DM0A 3TELA 1NL5A 3UIFA 2QPQA 3Q29A 2FYIA 2O6AA 4DZ1A 2I58A 2UXAA 5H8QB 4QFPA 5L9SA 3TDJA 2E0SA 4OEUA 1B7ZA 4DLDA 4ELRA 3GLBA 4OTEA 4ZDMA 4PFYA 4KYSA 4G77A 2RCAA 5H8NA 3UP9A 4NF5A 4O3CA 3M8UA 3UORA 2DE4A 5AA2A 3K1MA 1S9TA 1P1QA 2NOOA 1B3GA 3BKIB 3Q27A 1OLCA 3HHFA 5I57A 1LFIA 2GFEA 4R72A 1AMFA 3PMWA 2ONSA 1NNFA 3LC8A 3TEPA 1B2HA 2REGA 3V8XB 2F6PA 2Q88A 2HXWA 5H8HA 3PPQA 1KWHA 1EZPA 1DTZA 3BFUA 3K02A 4XKRA 1ZBMA 3G7WA 3PUXE 1UTBB 4WKMA 4F31B 3EQ1A 1MH3A 4E0WA 2XX7A 1B3FA 3OMBA 4X9TA 1GGGA 5HBCA 1N04A 3O2AA 1SI0A 3SEYA 1LFHA 3D4GA 3MVYA 4RPNA 1R9LA 5EHMA 2XXIA 3MUQA 3FV1A 3KEIA 4LVQA 3TODA 3CFXA 2A5SA 4IY5A 3OO9A 4I62A 4F2QA 1NNPA 5IAIA 5TPAA 1NFTA 3TQLA 5L9OA 3K01A 5I2NA 1TXFA 4FE8A 1TT1A 2ESNA 5F1QA 3N5LA 5ITOA 5FHOA 1D9VA 3MZBA 4NE4A 1MXZA 2QMWA 4EQ9A 4JBZA 4YAHX 5B70A 1DMBA 2OCUA 2Q8JA 3E4RA 3QSLA 4ZEIA 2RC7A 3O6IA 1RYOA 2M8CA 4OESA 1IXIA 1NKXA 1XVYA 4YMBA 3KFMA 4P0GA 3CVGA 2ZNSA 2VHAA 4TOZA 3IJXB 4U1OA 1DOTA 3FXRA 3FD3A 1WODA 4K3FA 1Y1ZA 1DSNA 1POY1 1PB9A 1QW0A 4QFOA 1JETA 1A55A 1ELJA 3KN7A 3OELA 3BBRA 1PEBA 4BDRA 3K6UA 3N94A 1POTA 3K1PA 4UACA 1YCJA 4KFQA 1N76A 1P1OA 1R1NA 4QHQA 4LQ5A 4PE5B 1FTKA 1B4ZA 5DEXA 5AA4A 3DP6A 1UIVA 3H3GA 4FJPA 3SDFA 5IKBA 4IO7A 3OO6A 4DXUA 4TLMB 1F9BA 4JWYA 1JW5A 2UYFA 4ZEKA 3RLFE 3KG2A 3RN8A 5HM4B 1QUJA 1B5JA 5JEIA 5J1DA 3QUFA 1XS5A 1L5TA 1NH8A 3FVOA 1YAEA 1OLAA 5I2KB 1Z7ME 3G3HA 4PETA 2LAOA 3Q25A 5I59B 1HSJA 2I3WA 3C9HA 1S50A 3FASA 2QJEA 2F7CA 1SYHA 2DE3A 3IO6A 1FQDA 3IR1A 3SESA 2FNCA 3EN3A 4KPTA 2I0BA 3MP6A 2A5TB 4R73A 4XIGQ 1ANFA 5EHSA 2H5YA 3IORA 3LSLA 3H6TA 1JNFA 2AL4A 3MVWA 2Y7RA 1MDP1 3ONMA 4GL0A 4OENA 1UTHB 4OQOA 3MVZA 3H6VA 5H8SA 4ELQA 1JEVA 3HN0A 3G3FA 3KSXA 3PPRA 3TZAA 1B05A 4X48A 2QS2A 3E3KA 3DP8A 4YZZA 3IOVA 4DXBA 4BDNA 4NWDA 4MFIA 5DTBA 3K6VA 4H8JA 4R2FA 1Q1KA 2H4IA 3PUVE 2Z8FA 1PBQA 4I9DA 1MPCA 3SETA 1MQIA 1I69A 2I48A 1D9YA 3ECRA 2DVZA 1MM6A 2HFBA 2V3UA 1O7TA 4F1UA 3KN8A 5TP9B 1Y1MA 2AL5A 4OERA 4GVOA 1LCFA 4MLQA 4DIGA 3A3CA 3PV0E 2XHDA 4OXVA 3O97A 5M2VA 3QUJA 2B3BA 2O69A 3T9VA 3SEVA 3DP4A 3CR9A 4YKPA 5CMBA 4L17A 2IEEA 1MY3A 4H65A 2O51A 1I6QA 4OMBA 1QKAA 2Y84A 1O64A 2UVJA 4GFRA 3ZKKA 3R26A 2DWHA 3FXQA 2DXYA 4JWOA 5I58B 3HPIA 3PU5A 2F7AA 3KOTA 3S9NC 3S4UA 3ZKLA 5H8QA 4GOTA 4ESXA 2VGQA 3C35A 4ZE9A 3TPAA 1B1XA 1USYE 1WDNA 3PPNA 3VVFA 3OD7A 2GHAA 1VFEA 3H03A 1MXXA 1RKMA 2F97A 2HAUA 1B5HA 4QFKA 1B7HA 1B7UA 5BUUA 3OSRA 3FXUA 2VP1A 1B3HA 1B0LA 2D3IA 2ZYOA 2DS9A 3PUWE 2DE2A 1SD3A 4F1YA 4F3SA 1N84A 4Z0IA 3C32A 1MPBA 1FQCA 3PPPA 1AIVA 4LZ8A 1MQJA 3FZVA 3BFTA 5L9MA 4F1VA 2XXRA 4GF8A 1R9QA 1FTJA 4QFLA 5CBRA 1UTBA 3F11A 1JW4A 1M5EA 1DPEA 2QRYA 3GBAA 1VR5A 2OWSA 1IEJA 1US5A 3B6QA 5CMMA 4DCYA 3TFLA 4ZS9A 1GVCA 1B6HA 1B5IA 3ODBA 4ELPA 1IXHA 1EU8A 1A8FA 3PMVA 1P1WA 1IXGA 2DQVA 4ZEDA 1MQDA 5A5XB 2VD3A 1MXUA 4F22A 4GWOA 2DXRA 2HQ0A 1LLSA 2F8DA 2F36A 3TTNA 4HTGA 2HEUA 4KI0E 5H8FA 4PQJA 4Q5TA 1ZMGA 4C1UA 1AOVA 1UIUA 1XT8A 3H4ZA 4I1DA 4IO4A 3T9XB 3OO7A 3IB2A 2P0SA 5KDTB 1H3DA 4Q8RA 3N6UA 3H6UA 1GTKA 2O68A 1PB8A 3SEUA 4RPOA 4OZ9A 3OSQA 2OBGA 2ALUA 2BJJX 1B9JA 1B58A 3Q28A 2ZYNA 3OOAA 2P1SA 4OETA 3VDFA 3L6HA 3KBRA 3TTMA 4EF1A 1MQGA 3V5AA 3OEMA 4O3AA 4F3GA 1D4NA 1FQAA 1Y20A 3KN3A 1PC3A 5JK4A 4GL8A 5FHMA 2F6GA 3Q26A 5DT6A 1URGA 2F34A 1ZIUA 3O66A 4X1DA 4MF3A 1IIWA 5CC2A 2REJA 5JTYB 5BWJA 3G3IA 4YKKA 2KLFA 2XD3A 4LONB 4PFUA 5DVJA 2YJPA 3G3GA 2E1SA 2OK2A 1II5A 3RY3A 3VVDA 4GXAA 3RGYA 5I2KA 1IITA 3OXNA 5I59A 5KCJB 1LSTA 2XXHA 4G68A 4ND9A 3CFLA 4GRKA 3OO8A 3W9WA 1XVXA 3MWBA 3RT6B 2RF1A 3QXMA 1MXVA 2UVHA 2XXUA 2GRVA 1SYIA 1Q35A 1Z7NE 2QMXA 3N6TA 4EXLA 2F78A 4YB7A 3PUYE 1GV8A 3PUZE 1VFDA 3W9VA 3HV1A 4ZECA 3IOUA 3CG1A 3VLVA 4EXKA 2F7BA 1UTHA 4MH5A 1TFDA 4G4PA 3VXBA 3FV2A 4H67A 4R9GA 2Y7WA 1SQYA 1SW1A 4MBPA 1FW0A 4POXA 4N07A 3TCHA 4BDOA 4I8CA 4XKQA 4HCYA 2ZYKA 4H6DA 4H5FA 3FIRA 4DXCA 2Y7KA 1IQ7A 3EHSA 4F3PA 2P2AA 4O3BA 3TMGA 3K6WA 5K2YA 4Q0CA 4YB6A 1H45A 5ICQA 5TP9A 4THIA 4KCCA 4KR5A 3AXFA 1IXCA 2XD2A 2Q9TA 1JW1A 3VV5A 3CIJA 3K6XA 1EZOA 4GD5A 4GXSB 4QSDA 3JZJA 1Y3NA 3B6WA 5KZTA 4OYVA 1MS7A 2HZKA 2XXVA 1MXWA 3RQTA 2XX8A 3LSWA 5I58A 1N3WA 4YKJA 3ZS6A 1URDA 2H98A 3O9PA 4ESWA 2ZNUA 1Y9UA 3D4CA 4IO5A 3U8QA 3O6GA 1FTLA 3CI8A 1H44A 1R6ZA 3USDA 3MPLA 4G8HA 3T22A 2DP8A 3CRBA 1M5BA 2QS4A 2X26A 3VLUA 4WXJA 5CMKA 3FUZA 2O1LA 3T9UA 3KJTA 2PMSA 2ABHA 3ILTB 2ZMBA 2ZNTA 4XKNA 4IY6A 1URSA 2W7YA 1MPDA 3M3LA 2PT1A 2Z22A 2V93A 3IK6B 4PFTA 3K4UA 4NF6B 4BDQA 4HS7A 2ZXTA 4QFNA 4YU0A 3MZ9A 3FJGA 1FTMA 1TWYA 3O28A 1LB8A 2ONRA 1S7YA 1GR2A 5FTHA 4DDDA 3W15C 2Z23A 3U92A 4FATA 1N3XA 4U21A 4BDLA 4ZEFA 2ANJA 3A09A 4F3BA 4R6YA 3FJMA 1ZLQA 1MRPA 2H99A 5HPQA 4R6KA 5A5XA 4KD5A 4UA8A 1MY2A 3T96B 3SEWA 2YLNA 1MY4A 3PPOA 4JSOA 4XTCQ 5DYHA 2QL3A 4OVJA 3T93B 2RCBA 4C1TA 3S9EA 3IO4A 5ICTA 2YPNA 2CMOA 2Q89A 3TTKA 3VFJA 2XX9A 4NF4B 1A7LA 2GH9A 4EDPA 4JWXA 2H25A 1BP5A 4PFWA 3SKPA 3H06B 2QS3A 4LATA 4ISUA 5AA3A 1CE2A 3S9LC 4QSCA 5F7VA 4NMYA 3PMXA 4GLIA 3QAXA 2D5WA 4ZEBA 2UVGA 1BTJA 3MC2A 1B4HA 1B32A 3RTWB 1SDXA 4F18A 1LBCA 4HW8A 3QK6A 5KDTA 3WAEA 3O6HA 5ITPA 3RT8A 1LGBC 2FA7A 4ONYA 2RC9A 4LUBA 3R7XA 1NNKA 4RJZA 5CRYA 1NH7A 3TCGA 4NTLA 1EH3A 1LAGE 1DPPA 3K0VA 3IL1B 4H1XA 3TTRA 3GBBA 5CBSA 3R6UA 1MM7A 3V83A 4RY1A 1ZJLA 1JEUA 3SERA 3E9XA 2G29A 4MLVA 1IUDA 1SBPA 1Y3PA 4YB5A 2I49A 2B3FA 3HHGA 3TAJA 1N7XA 2ZYMA 4G2ZA 4QRZA 2O84X 5JTYA 3SEXA 3T66A 4XXUA 5I84A 3TYHA 2HCAA 4N13A 1N7WA 4RA1A 4C0RA 4EQ7A 2V25A 5CM6A 4NEDA 4NF8A 4OFJA 1SW4A 2NXOA 5CMCA 1T0KA 5KCJA 3IAZA 4DE8A 1JVYA 1BLFA 1BKAA 3FGSA 4P0IA 1XHYA 2O7IA 3S2VA 3C33A 4U22A 1XOCA 3TTLA 1QULA 2Y7IA 3CG3A 5I56B 3IB0A 4Z7EA 1JQFA 4NF8B 3OEKA 1A40A 2R9JA 4U4SA 4F2OA 1LCTA 1BIYA 2X7QA 1LAXA 3JYRA 3B6TA 3GZGA 3VLWA 1Y4CA 1AH5A 1MY0A 3GXAA 4QSEA 3T9HB 5ISUA 1B52A 2R71A 1J1NA 3QYTA 4KCDA 3C34A 2V84A 1NNTA 3IJOB 3MW0A 5ELVA 1B3EA 3M3FA 1LFGA 2RC8A 3UN6A 4RXLA 1FQFA 2R6GE 1TFAA 3CSBA 4P11A 3HCQA 2DYXA 5AE4A 2PX1A 4F19A 3C36A 4R75A 1JVXA 3FJ7A 3P7IA 2XXPA 4JB7A 1EZ9A 4JXIA 1LAFE 4U23A 1YTVA 1HSLA 1US4A 1MY1A 4KYDA 5L8DA 3N26A 4NWCA 1OQHA 4EQBA 4BLAA 3V89B 4FORA 3K1NA 2WKYA 4U4XA 1B0HA 2O1MA 1MXYA 1QKBA 2I4BA 4GQOA 2ONKE 2XXYA 1OQGA 3E13X 3IOTA 4DCXA 1A99A 2F5XA 4IO2A 5AA2D 5K2XA 2I4CA 5H8FB 3MPKA 5H8NB 4LQ2A 3O29A 1LAHE 2A5TA 4NF5B 3LUYA 5AA2B 1M5FA 4AB5A 4H0WA 5AA1A 2Q2CA 3QIMA 1ZTYA 1RYXA 2DWJA 3MP1A 4AB6A 4RK9A 3H7MA 1B1HA 3I6VA 2V3TA 4U2RA 1B46A 1M5CA 4ZZAA 5I57B 2NWJA 1B51A 1H76A 3KGCA 3OENA 4HCWA 3RPWA 2Z8DA 4POWA 5H8HB 3U94A 3TKDA 3TQWA 3KZGA 1VE4A 3TCFA 3LBSA 4E0XA 4F39A 4KHZE 4IO6A 1FCKA 4IO3A 2PYYA 1VSOA 3EHUA 4TQUQ 1HSEA 1D3KA 1OIBA 2HZLA 1PB7A 4NF6A 1ZU0A 1OMPA 3G3JA 3G3KA 3IOWA 4ZZEA 4AQ4A 3A3UA 1O63A 4FEBA 1QJMA 1MH4A 4FEDA 4G68C 1PDAA 2XXQA 4OEVA 3UK4A 3FVNA 2O7UA 3KSJA 4LP2B 2B65A 3RNNA 2OWTA 3RTFB 1XC1A 3I3VA 5TPAB 1N0TA 3LSFB 3M3KA 4U1ZA 4ECFA 3KJ7A 3MQ9A 2V3QA 1PBPA 5I2NB 4EUOA 4R74A 3FATA 5DVFA 5EYFA 5LOMA 3HSTA 4G68B 3C31A 3DELB 2VD2A 2NUVA 1I6BA 4TLLB 3CFZA 5FTIA 3EPEA 4NF4A 3U93A 4ELOA 3VE1B 4IGRA 2DVCA 4M1VA 2H9BA 3THIA 1M5DA 4PP0A 3VXCA 2G93A 3VVEA 1A8EA 2Q2AA 2UVIA 3EHTA 1OVBA 4RK2A 3U1OA 2AIXA 2QS1A 1NMUA 4LZ5A 1Y4TA 3CSGA 4R6HA 2NVUB 1B40A 4X1BA 4M4GA 3MJNA 2OZZA 4KYEA 5DEXB 2RKMA 5AA4B 4FECA 1AL3A 3FVKA 4YICA 4OFLA 4N6PA 1SVXB 2IA4A 1SW2A 4OHNA 2HAVA 4RNSA 2DOJA 4JSDA 3MAMA 3K00A 3HO7A 2PBWA 1QVSA 1CB6A 2I6EA 2PVUA 1WVJA 3B7DA 4JDFA 4G8NA 4F29A 3MP8A 3S9MC 3TUSA 2PT2A 1YPNA 4IGTA 4RYAA 4GIZA 3UGWA 5DVIA 3LSXA 1SI1A 2VOZA 2XXTA 4LZ7A 1P99A 4R9FA 4QF9A 3PD9A 1A54A 4WEDA 1QUKA 4R2BA 4H8IA 4XKPA 1I6AA 4FAJA 3DLNA 3K2DA 4YKIA 4IB2A 2RINA 1USYH 2XXWA 2THIA 1OVTA 1P1UA 1IZ1A 2X7PA 3EF7A 4YMAA 1FTOA 3PD8A 2XXXA 5B7DA 2D21A 2DSFA 3LR1A 3MVXA 3L6GA 4KQPA 1FQBA 2F35A 2OJTA 3WAFA 4OFOA 2DWIA 2GHBA 1ATGA 3JV9A 1UQWA 4H5GA 3MZ1A 2QSXA 5I56A 4WEPA
chains in the Genus database with same CATH superfamily
3ILUB 5TU0A 4OWDA 5LDZA 1FQEA 5FHNA 1H43A 3UA8A 2I3VA 3IB1A 1SW5A 1MDQA 1P1NA 2Z8EA 1LB9A 4G8MA 4EF2A 1Y3QA 3KOSA 4DI4B 1IMBA 3FVGA 2AYSA 3PGFA 1LBBA 2I0CA 4LA9A 1YYZA 5CI5A 3RUMA 2UYEA 4ZE8A 2DWAA 4FIMA 3MBPA 4Q30B 4PFIA 3U72A 3H6WA 2Y7PA 3C4MA 1ZKBA 1MQHA 1DTGA 4G61A 4PAFA 1DBZA 3ZSFA 2OLBA 1MG1A 4BDMA 3I5OA 2CZLA 4HE1A 3IX1A 4H46A 1QUIA 1D9QA 2HPGA 1B3LA 1NV2A 3DM0A 1NL5A 3TELA 3UIFA 2QPQA 3Q29A 2FYIA 2O6AA 4DZ1A 2I58A 2UXAA 5H8QB 4QFPA 5L9SA 3TDJA 2E0SA 4MEVA 4OEUA 1B7ZA 4PF8A 4DLDA 4ELRA 3GLBA 4OTEA 4MNIA 4ZDMA 4PFYA 4KYSA 4G77A 4N4UA 2RCAA 2WX9A 5H8NA 3UP9A 4NF5A 4O3CA 3M8UA 3UORA 3IFCA 2DE4A 5AA2A 3K1MA 1S9TA 1P1QA 2NOOA 1B3GA 3BKIB 3Q27A 5IZ3B 4X04A 1OLCA 3HHFA 5I57A 1LFIA 2GFEA 4R72A 1AMFA 3PMWA 2ONSA 1NNFA 3LC8A 3TEPA 1B2HA 2REGA 3V8XB 2F6PA 2Q88A 5EQAA 2HXWA 5H8HA 3PPQA 1KWHA 1EZPA 1DTZA 3LUZA 3BFUA 3K02A 4XKRA 2CZIA 1ZBMA 3G7WA 3PUXE 1FJ9A 1UTBB 4MJOA 4WKMA 4F31B 3EQ1A 1MH3A 4E0WA 2XX7A 1B3FA 3OMBA 2HHMA 4X9TA 1QGXA 1GGGA 3A29A 5HBCA 1N04A 3O2AA 1SI0A 3SEYA 1LFHA 3D4GA 3MVYA 4RPNA 1R9LA 5EHMA 2XXIA 3MUQA 2ZZWA 4PGNA 3FV1A 3KEIA 4LVQA 3TODA 3CFXA 4PAKA 2A5SA 3BIHA 4IY5A 1FPFA 3OO9A 4I62A 4F2QA 1FBEA 1NNPA 4P3LA 5IAIA 5TPAA 1NFTA 4PC9A 3TQLA 1SPIA 4I3YA 5L9OA 1YXIA 3K01A 5I2NA 1TXFA 4FE8A 1TT1A 2ESNA 5F1QA 3N5LA 5ITOA 5FHOA 1D9VA 3MZBA 4NE4A 1MXZA 2QMWA 4EQ9A 4JBZA 4YAHX 1DMBA 2OCUA 5B70A 2Q8JA 3E4RA 3QSLA 4ZEIA 2RC7A 4GX6A 3O6IA 1RYOA 2M8CA 3GYYA 4OESA 1IXIA 1NKXA 1XVYA 4YMBA 4N6DA 3KFMA 4P0GA 3CVGA 2ZNSA 2VHAA 4TOZA 3IJXB 4U1OA 1DOTA 4GWZA 3FXRA 4K3FA 1FBHA 1WODA 3FD3A 1Y1ZA 1DSNA 1POY1 1PB9A 1QW0A 4QFOA 1JETA 1A55A 1ELJA 5ESYA 1FPEA 3KN7A 3OELA 2CEYA 3BBRA 1PEBA 4BDRA 3K6UA 3N94A 1POTA 3K1PA 4UACA 1YCJA 4KFQA 1N76A 1P1OA 1R1NA 4QHQA 4LQ5A 4O8MA 4PE5B 1FTKA 1B4ZA 5DEXA 5AA4A 4N6KA 3DP6A 1UIVA 3H3GA 5EQ9A 4FJPA 3SDFA 5IKBA 4NF0A 4IO7A 1IMDA 3OO6A 4DXUA 4TLMB 2VPOA 1F9BA 4JWYA 1JW5A 2UYFA 5T3JA 4ZEKA 3RLFE 1AWBA 1NUWA 3KG2A 3RN8A 4MIJA 5HM4B 1QUJA 1B5JA 5JEIA 5J1DA 3QUFA 1XS5A 1L5TA 1NH8A 3FVOA 1YAEA 1OLAA 5I2KB 1Z7ME 3G3HA 4PETA 2LAOA 4KXPA 3Q25A 5I59B 1HSJA 2I3WA 3C9HA 1S50A 3FASA 2QJEA 2F7CA 4IR8A 1SYHA 2DE3A 3IO6A 4PAIA 1FQDA 2P3NA 3IR1A 3SESA 2FNCA 3EN3A 4KPTA 2I0BA 3MP6A 2A5TB 4R73A 4XIGQ 1ANFA 5EHSA 2H5YA 2B4LA 3IORA 2R8TA 3LSLA 3H6TA 1JNFA 2WEFA 2AL4A 2OWZA 3MVWA 2Y7RA 4PGPA 1VDWA 1MDP1 3ONMA 4GL0A 4OENA 1UTHB 4OQOA 3MVZA 3H6VA 5H8SA 4I40A 4ELQA 5IM2A 1IMEA 1JEVA 3HN0A 3G3FA 3KSXA 3PPRA 3TZAA 1B05A 4X48A 2QS2A 3E3KA 3DP8A 4YZZA 3IOVA 4DXBA 4BDNA 4NWDA 4MFIA 5DTBA 3K6VA 4H8JA 1XI6A 4O94A 4R2FA 1Q1KA 2H4IA 3PUVE 2Z8FA 1PBQA 4I9DA 1MPCA 3SETA 4N91A 1MQIA 1I69A 2I48A 1D9YA 3ECRA 2DVZA 1MM6A 2HFBA 2V3UA 2Y5LA 1O7TA 4F1UA 3KN8A 4PTKA 5TP9B 1Y1MA 2AL5A 4OERA 4GVOA 1LCFA 4MLQA 4DIGA 3A3CA 3PV0E 2XHDA 4OXVA 3O97A 5M2VA 3QUJA 2B3BA 2O69A 4JVCA 3T9VA 3SEVA 5IGAA 3DP4A 4HE2A 3CR9A 4YKPA 5CMBA 4L17A 2IEEA 1MY3A 4H65A 2O51A 1INPA 1I6QA 4OMBA 1QKAA 2Y84A 1O64A 1LBZA 2UVJA 4GFRA 3ZKKA 3R26A 2DWHA 3FXQA 2DXYA 4JWOA 5I58B 1Q9DA 3HPIA 3PU5A 2F7AA 4MCOA 2HXRA 3KOTA 3S9NC 3S4UA 3ZKLA 5H8QA 4GOTA 4OVTA 4ESXA 2VGQA 3C35A 4ZE9A 1RDZA 3TPAA 1B1XA 1USYE 4QXDA 1WDNA 3PPNA 3VVFA 3OD7A 4XF5A 2PFYA 2GHAA 1VFEA 3H03A 1MXXA 1RKMA 2F97A 2DDKA 2HAUA 1B5HA 4QFKA 1B7HA 1B7UA 4H45A 2WBDA 5BUUA 3OSRA 3FXUA 2VP1A 2ZZVA 1B3HA 5IZ3A 1B0LA 2D3IA 2ZYOA 2DS9A 3PUWE 2DE2A 1SD3A 4F1YA 4F3SA 1FPIA 1N84A 4Z0IA 3C32A 5EYGA 1MPBA 1FQCA 3PPPA 1FRPA 1AIVA 4LZ8A 3MSTA 1MQJA 3FZVA 3QMFA 3BFTA 5L9MA 4F1VA 4GWUA 2XXRA 4GF8A 1R9QA 1FTJA 4QFLA 3U65A 4NN3A 5CBRA 1UTBA 3F11A 1JW4A 1M5EA 1DPEA 2QRYA 3GBAA 4JVIA 1VR5A 2OWSA 1IEJA 1NV3A 1US5A 2CZHA 3B6QA 2CZKA 5CMMA 4DCYA 3TFLA 4ZS9A 1GVCA 1B6HA 1B5IA 3ODBA 4ELPA 1IXHA 1EU8A 1A8FA 3PMVA 1P1WA 1IXGA 2DQVA 4ZEDA 1MQDA 2ZZXA 5A5XB 2VD3A 4PCDA 1MXUA 4F22A 4MMPA 4GWOA 2DXRA 2HQ0A 1LLSA 2F8DA 2F36A 3B8BA 1FBCA 3TTNA 4HTGA 2HEUA 4KI0E 5H8FA 4PQJA 4Q5TA 4O7MA 1ZMGA 4C1UA 1AOVA 1UIUA 1XT8A 3H4ZA 3ISPA 4I1DA 4OVRA 4IO4A 5FBPA 3T9XB 1DK4A 3OO7A 3IB2A 2JJKA 5ET7A 2P0SA 4GBVA 5KDTB 1H3DA 4Q8RA 3N6UA 4GWYA 3H6UA 5I7IA 1GTKA 2O68A 1PB8A 3SEUA 4N8GA 4RPOA 4OZ9A 3OSQA 2OBGA 2ALUA 2BJJX 1B9JA 1B58A 3Q28A 2ZYNA 3OOAA 2P1SA 4OETA 3VDFA 3L6HA 3KBRA 3TTMA 4EF1A 1MQGA 2V4CA 4OVSA 3V5AA 1NV1A 3OEMA 4O3AA 4F3GA 1D4NA 1FBDA 1FQAA 1Y20A 3KN3A 1PC3A 5JK4A 2FIEA 4GL8A 5FHMA 2F6GA 3Q26A 5DT6A 1URGA 2F34A 1ZIUA 3O66A 4X1DA 4MF3A 1IIWA 1KA1A 5CC2A 2XWOA 2REJA 5JTYB 5BWJA 3G3IA 4YKKA 5ET5A 2KLFA 1IMAA 2XD3A 4LONB 4PFUA 5DVJA 2Q8MA 2YJPA 3G3GA 2E1SA 2OK2A 4DI3D 1II5A 2XWIA 3B50A 3RY3A 3VVDA 4GXAA 3RGYA 5I2KA 1IITA 3OXNA 3E78A 2F3BA 5I59A 5KCJB 1FBGA 3PTYA 1LSTA 2QVUA 2XXHA 4G68A 4ND9A 3CFLA 4GRKA 3OO8A 3W9WA 1XVXA 3MWBA 3RT6B 3BIGA 2RF1A 3QXMA 1MXVA 2UVHA 5IZ1A 2MKZA 2XXUA 2GRVA 1SYIA 1Q35A 1Z7NE 2QMXA 3N6TA 4EXLA 2F78A 4YB7A 3PUYE 1GV8A 3PUZE 1VFDA 3HV1A 4XEQA 3W9VA 4ZECA 1NV5A 3IOUA 3CG1A 3VLVA 4EXKA 2F7BA 1UTHA 4MH5A 4UABA 1TFDA 4G4PA 3VXBA 1RDYA 3FV2A 4H67A 4R9GA 1FPLA 2KR0A 2Y7WA 1SQYA 1SW1A 4MBPA 1FW0A 4POXA 3RYDA 4N07A 3TCHA 4BDOA 4I8CA 4XKQA 1FPBA 4I3EA 4HCYA 3FBPA 2ZYKA 4H6DA 4H5FA 3FIRA 4DXCA 2Y7KA 5A5LA 1IQ7A 3EHSA 4F3PA 2P2AA 4FBPA 4O3BA 3TMGA 3K6WA 5K2YA 1RDXA 4Q0CA 4YB6A 1H45A 5ICQA 5TP9A 1NI9A 4THIA 4KCCA 4KR5A 3AXFA 1IXCA 2XD2A 2Q9TA 2FIXA 1JW1A 3VV5A 3CIJA 2XXKA 3K6XA 4GD5A 1EZOA 1CNQA 4GXSB 4OA4A 3EKIA 4QSDA 3JZJA 3RPLA 1Y3NA 5I5PA 3B6WA 2FVZA 1NV6A 2WYKA 5KZTA 4OYVA 1MS7A 2HZKA 2XXVA 1MXWA 3RQTA 2XX8A 3LSWA 5I58A 1N3WA 4YKJA 3ZS6A 1URDA 2H98A 3O9PA 1FPKA 4ESWA 2ZNUA 1Y9UA 3D4CA 4IO5A 3U8QA 3O6GA 1FTLA 3CI8A 1H44A 1R6ZA 3USDA 3MPLA 4G8HA 2BJIA 3T22A 2DP8A 3CRBA 1M5BA 4N8YA 2QS4A 2X26A 4PBHA 3VLUA 1FPGA 4WXJA 5CMKA 3FUZA 2F3DA 2O1LA 3T9UA 3KJTA 2PMSA 5F24A 2ABHA 3ILTB 2ZMBA 2ZNTA 4XKNA 4IY6A 1URSA 2W7YA 1MPDA 3M3LA 2PT1A 2Z22A 2V93A 3IK6B 4PFTA 3K4UA 4NF6B 4BDQA 4HS7A 2ZXTA 1EYKA 4QFNA 4YU0A 3MZ9A 3FJGA 1FTMA 1TWYA 3O28A 1LB8A 2ONRA 1NUZA 1S7YA 1GR2A 2XWKA 5FTHA 1LBXA 1YZ0A 4DDDA 3W15C 2Z23A 3U92A 4FATA 1N3XA 4U21A 3HFUA 4BDLA 4ZEFA 2ANJA 4X8RA 3A09A 4F3BA 5EQ8A 4R6YA 3FJMA 1ZLQA 1MRPA 2H99A 4GWXA 5HPQA 2Q74A 4R6KA 5A5XA 4KD5A 4UA8A 1MY2A 3T96B 3SEWA 2YLNA 1MY4A 4N81A 3PPOA 4JSOA 4XTCQ 5DYHA 2QL3A 4OVJA 3T93B 2RCBA 4C1TA 3S9EA 3IO4A 5ICTA 2YPNA 2CMOA 2Q89A 3TTKA 3VFJA 2XX9A 4NF4B 1A7LA 2GH9A 4EDPA 4PFBA 1LBYA 4JWXA 5EYHA 2H25A 1BP5A 4PFWA 3SKPA 3H06B 2QS3A 4LATA 4ISUA 5AA3A 1NUYA 1CE2A 5J16A 4QSCA 5F7VA 4NMYA 3S9LC 3PMXA 4GLIA 3QAXA 2D5WA 4ZEBA 2UVGA 1BTJA 3MC2A 1B4HA 1B32A 3RTWB 4MHFA 1SDXA 1LBVA 2WYPA 4F18A 1LBCA 4HW8A 4PE3A 3QK6A 5KDTA 3WAEA 3O6HA 5ITPA 3RT8A 1LGBC 2FA7A 1KA0A 4ONYA 2RC9A 4LUBA 3R7XA 1NNKA 4RJZA 5CRYA 1NH7A 3TCGA 4NTLA 1EH3A 1LAGE 1DPPA 4MX6A 3K0VA 3IL1B 4H1XA 1K9YA 2WBBA 3TTRA 4MNPA 3GBBA 5CBSA 3R6UA 1MM7A 4GWWA 3V83A 4RY1A 1ZJLA 1JEUA 3SERA 3IFAA 3E9XA 2G29A 4MLVA 1IUDA 1SBPA 1Y3PA 4YB5A 2I49A 2B3FA 3HHGA 4OANA 3TAJA 1N7XA 2ZYMA 4P47A 4G2ZA 4NG7A 4P9KA 4QRZA 3SZPA 2O84X 5JTYA 3SEXA 3T66A 4XXUA 5I84A 3TYHA 2PCRA 3MYUA 2XWVA 2HCAA 4N13A 1N7WA 4RA1A 4C0RA 4EQ7A 1NV4A 2V25A 5CM6A 4NEDA 4NF8A 4OFJA 1SW4A 2NXOA 5CMCA 1T0KA 5KCJA 3IAZA 4NGUA 2QVRA 1NUXA 2QVVA 4DE8A 1JVYA 1BLFA 3FGSA 1BKAA 4OVPA 4P0IA 1XHYA 2QFLA 2O7IA 3S2VA 3C33A 4N17A 4LN5A 4U22A 1XOCA 3TTLA 1QULA 2Y7IA 3CG3A 5I56B 3IB0A 4PDDA 4Z7EA 1JQFA 4NF8B 3OEKA 1A40A 2R9JA 4U4SA 4F2OA 1LCTA 1BIYA 2X7QA 1LEVA 2PFZA 1LAXA 3JYRA 3B6TA 3GZGA 3VLWA 1Y4CA 1AH5A 1MY0A 3GXAA 4QSEA 3T9HB 5ISUA 1B52A 2R71A 1J1NA 4OVQA 3QYTA 4KCDA 3C34A 2V84A 1NNTA 3IJOB 1KZ8A 5DW8A 3MW0A 5ELVA 1B3EA 3CHGA 3M3FA 1LFGA 5ET8A 2RC8A 3UN6A 4RXLA 3T0JA 2GQ1A 1FQFA 2R6GE 1TFAA 3CSBA 4P11A 3HCQA 2DYXA 4P56A 5AE4A 3T1BA 2PX1A 4F19A 3C36A 5LTCA 4R75A 1JVXA 3FJ7A 3P7IA 2XXPA 4JB7A 1EZ9A 4JXIA 1LAFE 4U23A 1YTVA 3FXBA 1HSLA 1US4A 1MY1A 4KYDA 4HXVA 4P1LA 5L8DA 4MAGA 1G0HA 3N26A 4NWCA 1OQHA 4EQBA 2L5VA 4BLAA 3V89B 4FORA 3K1NA 2WKYA 4U4XA 1B0HA 2O1MA 1MXYA 1QKBA 2I4BA 4GQOA 2ONKE 2XXYA 1OQGA 2B4MA 3E13X 3IOTA 4DCXA 1A99A 2F5XA 1FTAA 4IO2A 5AA2D 4HE0A 5K2XA 2I4CA 5H8FB 4NX1A 1FJ6A 4O7IA 3MPKA 1BK4A 5H8NB 4LQ2A 5ET6A 3O29A 4P1EA 1LAHE 2A5TA 4NF5B 3LUYA 1FPJA 5AA2B 1M5FA 4AB5A 4H0WA 5AA1A 1IMFA 2Q2CA 3QIMA 1ZTYA 1RYXA 2DWJA 3MP1A 4AB6A 4RK9A 3H7MA 3LV0A 4P8BA 1B1HA 3I6VA 2V3TA 4U2RA 1B46A 1M5CA 4ZZAA 5I57B 2NWJA 1B51A 1H76A 3KGCA 3OENA 4HCWA 3RPWA 2Z8DA 4POWA 5H8HB 3U94A 4PBQA 3TKDA 4GWSA 3TQWA 3KZGA 4NAPA 4NHBA 1VE4A 3TCFA 3LBSA 4E0XA 4F39A 4KHZE 4IO6A 1FCKA 1LBWA 4IO3A 4XFEA 2PYYA 1VSOA 3EHUA 4TQUQ 1HSEA 1D3KA 2CEXA 1OIBA 2HZLA 3NOHA 1PB7A 4NF6A 1ZU0A 1OMPA 3G3JA 3G3KA 4N15A 3IOWA 4ZZEA 4AQ4A 3A3UA 1O63A 4FEBA 1QJMA 1MH4A 4FEDA 4G68C 1PDAA 2XXQA 4OEVA 3UK4A 1NV7A 3FVNA 1FBFA 3KC0A 3KC1A 2O7UA 3KSJA 1FBPA 4LP2B 2B65A 3RNNA 2OX3A 2OWTA 3RTFB 1XC1A 3I3VA 4GX3A 2Y5KA 5TPAB 1N0TA 3LSFB 3M3KA 4U1ZA 4ECFA 3KJ7A 3MQ9A 2V3QA 1PBPA 5I2NB 4EUOA 4R74A 3FATA 5DVFA 5EYFA 5LOMA 5EQ7A 3HSTA 4G68B 3C31A 2FHYA 3DELB 2VD2A 2NUVA 1I6BA 4TLLB 4PFRA 3CFZA 5FTIA 3EPEA 4NF4A 3U93A 4ELOA 3VE1B 4IGRA 2DVCA 4M1VA 2H9BA 3THIA 1M5DA 1EYIA 4PDHA 4PP0A 3VXCA 2G93A 1EYJA 3VVEA 1A8EA 2Q2AA 2UVIA 3EHTA 4PF6A 1OVBA 4RK2A 3U1OA 2AIXA 2QS1A 2FBPA 1NMUA 4LZ5A 1Y4TA 3CSGA 4R6HA 2NVUB 4QBAA 1B40A 4X1BA 4M4GA 1IMCA 1FPDA 3MJNA 2OZZA 3KBZA 4KYEA 5DEXB 2RKMA 5AA4B 4FECA 1AL3A 3FVKA 1G0IA 4YICA 4GX4A 4OFLA 4N6PA 1SVXB 2VT5A 2IA4A 1SW2A 4OHNA 3D1RA 2HAVA 4RNSA 2DOJA 1NV0A 4JSDA 3MAMA 3K00A 3HO7A 2PBWA 4MNCA 1QVSA 1CB6A 2I6EA 2PVUA 1WVJA 4NQ8A 3B7DA 5I3SA 4JDFA 4G8NA 2XA5A 4F29A 3MP8A 3E79A 4AS4A 3S9MC 3TUSA 2PT2A 1YPNA 4IGTA 4RYAA 4GIZA 3UGWA 2P3VA 5DVIA 3LSXA 1SI1A 2VOZA 2VPNA 3RPLB 2XXTA 1K9ZA 4LZ7A 1P99A 4R9FA 4QF9A 3PD9A 1A54A 4GBWA 4WEDA 1QUKA 4R2BA 4H8IA 4XKPA 1I6AA 4FAJA 3DLNA 3K2DA 4YKIA 4JVDA 4IB2A 4AS5A 2RINA 1USYH 2XXWA 1FSAA 2THIA 1OVTA 1P1UA 1IZ1A 2X7PA 3EF7A 4YMAA 1FTOA 3PD8A 2XXXA 5B7DA 2D21A 2DSFA 3LR1A 3MVXA 5IZZA 1JP4A 3L6GA 4KQPA 1FQBA 2F35A 2OJTA 3WAFA 4OFOA 2DWIA 2GHBA 1ATGA 3ROJA 3JV9A 1DCUA 1UQWA 4H5GA 3MZ1A 2QSXA 5I56A 2KQZA 4WEPA
chains in the Genus database with same CATH topology
3ILUB 5TU0A 4OWDA 1FQEA 5FHNA 1H43A 3UA8A 2I3VA 3IB1A 1SW5A 1MDQA 1P1NA 2Z8EA 1LB9A 4G8MA 4EF2A 1Y3QA 3KOSA 3FVGA 2AYSA 3PGFA 1LBBA 2I0CA 4LA9A 5CI5A 3RUMA 2UYEA 4ZE8A 2DWAA 4FIMA 3MBPA 4Q30B 3U72A 3H6WA 2Y7PA 3C4MA 1ZKBA 1MQHA 1DTGA 3ZSFA 2OLBA 1MG1A 4BDMA 3I5OA 2CZLA 3IX1A 1QUIA 1B3LA 3DM0A 3TELA 1NL5A 3UIFA 2QPQA 3Q29A 2FYIA 2O6AA 4DZ1A 2I58A 2UXAA 5H8QB 4QFPA 5L9SA 3TDJA 2E0SA 4OEUA 1B7ZA 4DLDA 4ELRA 3GLBA 4OTEA 4ZDMA 4PFYA 4KYSA 4G77A 2RCAA 5H8NA 3UP9A 4NF5A 4O3CA 3M8UA 3UORA 2DE4A 5AA2A 3K1MA 1S9TA 1P1QA 2NOOA 1B3GA 3BKIB 3Q27A 1OLCA 3HHFA 5I57A 1LFIA 2GFEA 4R72A 1AMFA 3PMWA 2ONSA 1NNFA 3LC8A 3TEPA 1B2HA 2REGA 3V8XB 2F6PA 2Q88A 2HXWA 5H8HA 3PPQA 1KWHA 1EZPA 1DTZA 3BFUA 3K02A 4XKRA 1ZBMA 3G7WA 3PUXE 1UTBB 4WKMA 4F31B 3EQ1A 1MH3A 4E0WA 2XX7A 1B3FA 3OMBA 4X9TA 1GGGA 5HBCA 1N04A 3O2AA 1SI0A 3SEYA 1LFHA 3D4GA 3MVYA 4RPNA 1R9LA 5EHMA 2XXIA 3MUQA 3FV1A 3KEIA 4LVQA 3TODA 3CFXA 2A5SA 4IY5A 3OO9A 4I62A 4F2QA 1NNPA 5IAIA 5TPAA 1NFTA 3TQLA 5L9OA 3K01A 5I2NA 1TXFA 4FE8A 1TT1A 2ESNA 5F1QA 3N5LA 5ITOA 5FHOA 1D9VA 3MZBA 4NE4A 1MXZA 2QMWA 4EQ9A 4JBZA 4YAHX 5B70A 1DMBA 2OCUA 2Q8JA 3E4RA 3QSLA 4ZEIA 2RC7A 3O6IA 1RYOA 2M8CA 4OESA 1IXIA 1NKXA 1XVYA 4YMBA 3KFMA 4P0GA 3CVGA 2ZNSA 2VHAA 4TOZA 3IJXB 4U1OA 1DOTA 3FXRA 3FD3A 1WODA 4K3FA 1Y1ZA 1DSNA 1POY1 1PB9A 1QW0A 4QFOA 1JETA 1A55A 1ELJA 3KN7A 3OELA 3BBRA 1PEBA 4BDRA 3K6UA 3N94A 1POTA 3K1PA 4UACA 1YCJA 4KFQA 1N76A 1P1OA 1R1NA 4QHQA 4LQ5A 4PE5B 1FTKA 1B4ZA 5DEXA 5AA4A 3DP6A 1UIVA 3H3GA 4FJPA 3SDFA 5IKBA 4IO7A 3OO6A 4DXUA 4TLMB 1F9BA 4JWYA 1JW5A 2UYFA 4ZEKA 3RLFE 3KG2A 3RN8A 5HM4B 1QUJA 1B5JA 5JEIA 5J1DA 3QUFA 1XS5A 1L5TA 1NH8A 3FVOA 1YAEA 1OLAA 5I2KB 1Z7ME 3G3HA 4PETA 2LAOA 3Q25A 5I59B 1HSJA 2I3WA 3C9HA 1S50A 3FASA 2QJEA 2F7CA 1SYHA 2DE3A 3IO6A 1FQDA 3IR1A 3SESA 2FNCA 3EN3A 4KPTA 2I0BA 3MP6A 2A5TB 4R73A 4XIGQ 1ANFA 5EHSA 2H5YA 3IORA 3LSLA 3H6TA 1JNFA 2AL4A 3MVWA 2Y7RA 1MDP1 3ONMA 4GL0A 4OENA 1UTHB 4OQOA 3MVZA 3H6VA 5H8SA 4ELQA 1JEVA 3HN0A 3G3FA 3KSXA 3PPRA 3TZAA 1B05A 4X48A 2QS2A 3E3KA 3DP8A 4YZZA 3IOVA 4DXBA 4BDNA 4NWDA 4MFIA 5DTBA 3K6VA 4H8JA 4R2FA 1Q1KA 2H4IA 3PUVE 2Z8FA 1PBQA 4I9DA 1MPCA 3SETA 1MQIA 1I69A 2I48A 1D9YA 3ECRA 2DVZA 1MM6A 2HFBA 2V3UA 1O7TA 4F1UA 3KN8A 5TP9B 1Y1MA 2AL5A 4OERA 4GVOA 1LCFA 4MLQA 4DIGA 3A3CA 3PV0E 2XHDA 4OXVA 3O97A 5M2VA 3QUJA 2B3BA 2O69A 3T9VA 3SEVA 3DP4A 3CR9A 4YKPA 5CMBA 4L17A 2IEEA 1MY3A 4H65A 2O51A 1I6QA 4OMBA 1QKAA 2Y84A 1O64A 2UVJA 4GFRA 3ZKKA 3R26A 2DWHA 3FXQA 2DXYA 4JWOA 5I58B 3HPIA 3PU5A 2F7AA 3KOTA 3S9NC 3S4UA 3ZKLA 5H8QA 4GOTA 4ESXA 2VGQA 3C35A 4ZE9A 3TPAA 1B1XA 1USYE 1WDNA 3PPNA 3VVFA 3OD7A 2GHAA 1VFEA 3H03A 1MXXA 1RKMA 2F97A 2HAUA 1B5HA 4QFKA 1B7HA 1B7UA 5BUUA 3OSRA 3FXUA 2VP1A 1B3HA 1B0LA 2D3IA 2ZYOA 2DS9A 3PUWE 2DE2A 1SD3A 4F1YA 4F3SA 1N84A 4Z0IA 3C32A 1MPBA 1FQCA 3PPPA 1AIVA 4LZ8A 1MQJA 3FZVA 3BFTA 5L9MA 4F1VA 2XXRA 4GF8A 1R9QA 1FTJA 4QFLA 5CBRA 1UTBA 3F11A 1JW4A 1M5EA 1DPEA 2QRYA 3GBAA 1VR5A 2OWSA 1IEJA 1US5A 3B6QA 5CMMA 4DCYA 3TFLA 4ZS9A 1GVCA 1B6HA 1B5IA 3ODBA 4ELPA 1IXHA 1EU8A 1A8FA 3PMVA 1P1WA 1IXGA 2DQVA 4ZEDA 1MQDA 5A5XB 2VD3A 1MXUA 4F22A 4GWOA 2DXRA 2HQ0A 1LLSA 2F8DA 2F36A 3TTNA 4HTGA 2HEUA 4KI0E 5H8FA 4PQJA 4Q5TA 1ZMGA 4C1UA 1AOVA 1UIUA 1XT8A 3H4ZA 4I1DA 4IO4A 3T9XB 3OO7A 3IB2A 2P0SA 5KDTB 1H3DA 4Q8RA 3N6UA 3H6UA 1GTKA 2O68A 1PB8A 3SEUA 4RPOA 4OZ9A 3OSQA 2OBGA 2ALUA 2BJJX 1B9JA 1B58A 3Q28A 2ZYNA 3OOAA 2P1SA 4OETA 3VDFA 3L6HA 3KBRA 3TTMA 4EF1A 1MQGA 3V5AA 3OEMA 4O3AA 4F3GA 1D4NA 1FQAA 1Y20A 3KN3A 1PC3A 5JK4A 4GL8A 5FHMA 2F6GA 3Q26A 5DT6A 1URGA 2F34A 1ZIUA 3O66A 4X1DA 4MF3A 1IIWA 5CC2A 2REJA 5JTYB 5BWJA 3G3IA 4YKKA 2KLFA 2XD3A 4LONB 4PFUA 5DVJA 2YJPA 3G3GA 2E1SA 2OK2A 1II5A 3RY3A 3VVDA 4GXAA 3RGYA 5I2KA 1IITA 3OXNA 5I59A 5KCJB 1LSTA 2XXHA 4G68A 4ND9A 3CFLA 4GRKA 3OO8A 3W9WA 1XVXA 3MWBA 3RT6B 2RF1A 3QXMA 1MXVA 2UVHA 2XXUA 2GRVA 1SYIA 1Q35A 1Z7NE 2QMXA 3N6TA 4EXLA 2F78A 4YB7A 3PUYE 1GV8A 3PUZE 1VFDA 3W9VA 3HV1A 4ZECA 3IOUA 3CG1A 3VLVA 4EXKA 2F7BA 1UTHA 4MH5A 1TFDA 4G4PA 3VXBA 3FV2A 4H67A 4R9GA 2Y7WA 1SQYA 1SW1A 4MBPA 1FW0A 4POXA 4N07A 3TCHA 4BDOA 4I8CA 4XKQA 4HCYA 2ZYKA 4H6DA 4H5FA 3FIRA 4DXCA 2Y7KA 1IQ7A 3EHSA 4F3PA 2P2AA 4O3BA 3TMGA 3K6WA 5K2YA 4Q0CA 4YB6A 1H45A 5ICQA 5TP9A 4THIA 4KCCA 4KR5A 3AXFA 1IXCA 2XD2A 2Q9TA 1JW1A 3VV5A 3CIJA 3K6XA 1EZOA 4GD5A 4GXSB 4QSDA 3JZJA 1Y3NA 3B6WA 5KZTA 4OYVA 1MS7A 2HZKA 2XXVA 1MXWA 3RQTA 2XX8A 3LSWA 5I58A 1N3WA 4YKJA 3ZS6A 1URDA 2H98A 3O9PA 4ESWA 2ZNUA 1Y9UA 3D4CA 4IO5A 3U8QA 3O6GA 1FTLA 3CI8A 1H44A 1R6ZA 3USDA 3MPLA 4G8HA 3T22A 2DP8A 3CRBA 1M5BA 2QS4A 2X26A 3VLUA 4WXJA 5CMKA 3FUZA 2O1LA 3T9UA 3KJTA 2PMSA 2ABHA 3ILTB 2ZMBA 2ZNTA 4XKNA 4IY6A 1URSA 2W7YA 1MPDA 3M3LA 2PT1A 2Z22A 2V93A 3IK6B 4PFTA 3K4UA 4NF6B 4BDQA 4HS7A 2ZXTA 4QFNA 4YU0A 3MZ9A 3FJGA 1FTMA 1TWYA 3O28A 1LB8A 2ONRA 1S7YA 1GR2A 5FTHA 4DDDA 3W15C 2Z23A 3U92A 4FATA 1N3XA 4U21A 4BDLA 4ZEFA 2ANJA 3A09A 4F3BA 4R6YA 3FJMA 1ZLQA 1MRPA 2H99A 5HPQA 4R6KA 5A5XA 4KD5A 4UA8A 1MY2A 3T96B 3SEWA 2YLNA 1MY4A 3PPOA 4JSOA 4XTCQ 5DYHA 2QL3A 4OVJA 3T93B 2RCBA 4C1TA 3S9EA 3IO4A 5ICTA 2YPNA 2CMOA 2Q89A 3TTKA 3VFJA 2XX9A 4NF4B 1A7LA 2GH9A 4EDPA 4JWXA 2H25A 1BP5A 4PFWA 3SKPA 3H06B 2QS3A 4LATA 4ISUA 5AA3A 1CE2A 3S9LC 4QSCA 5F7VA 4NMYA 3PMXA 4GLIA 3QAXA 2D5WA 4ZEBA 2UVGA 1BTJA 3MC2A 1B4HA 1B32A 3RTWB 1SDXA 4F18A 1LBCA 4HW8A 3QK6A 5KDTA 3WAEA 3O6HA 5ITPA 3RT8A 1LGBC 2FA7A 4ONYA 2RC9A 4LUBA 3R7XA 1NNKA 4RJZA 5CRYA 1NH7A 3TCGA 4NTLA 1EH3A 1LAGE 1DPPA 3K0VA 3IL1B 4H1XA 3TTRA 3GBBA 5CBSA 3R6UA 1MM7A 3V83A 4RY1A 1ZJLA 1JEUA 3SERA 3E9XA 2G29A 4MLVA 1IUDA 1SBPA 1Y3PA 4YB5A 2I49A 2B3FA 3HHGA 3TAJA 1N7XA 2ZYMA 4G2ZA 4QRZA 2O84X 5JTYA 3SEXA 3T66A 4XXUA 5I84A 3TYHA 2HCAA 4N13A 1N7WA 4RA1A 4C0RA 4EQ7A 2V25A 5CM6A 4NEDA 4NF8A 4OFJA 1SW4A 2NXOA 5CMCA 1T0KA 5KCJA 3IAZA 4DE8A 1JVYA 1BLFA 1BKAA 3FGSA 4P0IA 1XHYA 2O7IA 3S2VA 3C33A 4U22A 1XOCA 3TTLA 1QULA 2Y7IA 3CG3A 5I56B 3IB0A 4Z7EA 1JQFA 4NF8B 3OEKA 1A40A 2R9JA 4U4SA 4F2OA 1LCTA 1BIYA 2X7QA 1LAXA 3JYRA 3B6TA 3GZGA 3VLWA 1Y4CA 1AH5A 1MY0A 3GXAA 4QSEA 3T9HB 5ISUA 1B52A 2R71A 1J1NA 3QYTA 4KCDA 3C34A 2V84A 1NNTA 3IJOB 3MW0A 5ELVA 1B3EA 3M3FA 1LFGA 2RC8A 3UN6A 4RXLA 1FQFA 2R6GE 1TFAA 3CSBA 4P11A 3HCQA 2DYXA 5AE4A 2PX1A 4F19A 3C36A 4R75A 1JVXA 3FJ7A 3P7IA 2XXPA 4JB7A 1EZ9A 4JXIA 1LAFE 4U23A 1YTVA 1HSLA 1US4A 1MY1A 4KYDA 5L8DA 3N26A 4NWCA 1OQHA 4EQBA 4BLAA 3V89B 4FORA 3K1NA 2WKYA 4U4XA 1B0HA 2O1MA 1MXYA 1QKBA 2I4BA 4GQOA 2ONKE 2XXYA 1OQGA 3E13X 3IOTA 4DCXA 1A99A 2F5XA 4IO2A 5AA2D 5K2XA 2I4CA 5H8FB 3MPKA 5H8NB 4LQ2A 3O29A 1LAHE 2A5TA 4NF5B 3LUYA 5AA2B 1M5FA 4AB5A 4H0WA 5AA1A 2Q2CA 3QIMA 1ZTYA 1RYXA 2DWJA 3MP1A 4AB6A 4RK9A 3H7MA 1B1HA 3I6VA 2V3TA 4U2RA 1B46A 1M5CA 4ZZAA 5I57B 2NWJA 1B51A 1H76A 3KGCA 3OENA 4HCWA 3RPWA 2Z8DA 4POWA 5H8HB 3U94A 3TKDA 3TQWA 3KZGA 1VE4A 3TCFA 3LBSA 4E0XA 4F39A 4KHZE 4IO6A 1FCKA 4IO3A 2PYYA 1VSOA 3EHUA 4TQUQ 1HSEA 1D3KA 1OIBA 2HZLA 1PB7A 4NF6A 1ZU0A 1OMPA 3G3JA 3G3KA 3IOWA 4ZZEA 4AQ4A 3A3UA 1O63A 4FEBA 1QJMA 1MH4A 4FEDA 4G68C 1PDAA 2XXQA 4OEVA 3UK4A 3FVNA 2O7UA 3KSJA 4LP2B 2B65A 3RNNA 2OWTA 3RTFB 1XC1A 3I3VA 5TPAB 1N0TA 3LSFB 3M3KA 4U1ZA 4ECFA 3KJ7A 3MQ9A 2V3QA 1PBPA 5I2NB 4EUOA 4R74A 3FATA 5DVFA 5EYFA 5LOMA 3HSTA 4G68B 3C31A 3DELB 2VD2A 2NUVA 1I6BA 4TLLB 3CFZA 5FTIA 3EPEA 4NF4A 3U93A 4ELOA 3VE1B 4IGRA 2DVCA 4M1VA 2H9BA 3THIA 1M5DA 4PP0A 3VXCA 2G93A 3VVEA 1A8EA 2Q2AA 2UVIA 3EHTA 1OVBA 4RK2A 3U1OA 2AIXA 2QS1A 1NMUA 4LZ5A 1Y4TA 3CSGA 4R6HA 2NVUB 1B40A 4X1BA 4M4GA 3MJNA 2OZZA 4KYEA 5DEXB 2RKMA 5AA4B 4FECA 1AL3A 3FVKA 4YICA 4OFLA 4N6PA 1SVXB 2IA4A 1SW2A 4OHNA 2HAVA 4RNSA 2DOJA 4JSDA 3MAMA 3K00A 3HO7A 2PBWA 1QVSA 1CB6A 2I6EA 2PVUA 1WVJA 3B7DA 4JDFA 4G8NA 4F29A 3MP8A 3S9MC 3TUSA 2PT2A 1YPNA 4IGTA 4RYAA 4GIZA 3UGWA 5DVIA 3LSXA 1SI1A 2VOZA 2XXTA 4LZ7A 1P99A 4R9FA 4QF9A 3PD9A 1A54A 4WEDA 1QUKA 4R2BA 4H8IA 4XKPA 1I6AA 4FAJA 3DLNA 3K2DA 4YKIA 4IB2A 2RINA 1USYH 2XXWA 2THIA 1OVTA 1P1UA 1IZ1A 2X7PA 3EF7A 4YMAA 1FTOA 3PD8A 2XXXA 5B7DA 2D21A 2DSFA 3LR1A 3MVXA 3L6GA 4KQPA 1FQBA 2F35A 2OJTA 3WAFA 4OFOA 2DWIA 2GHBA 1ATGA 3JV9A 1UQWA 4H5GA 3MZ1A 2QSXA 5I56A 4WEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ILU B;  5TU0 A;  4OWD A;  1FQE A;  5FHN A;  1H43 A;  3UA8 A;  2I3V A;  3IB1 A;  1SW5 A;  1MDQ A;  1P1N A;  2Z8E A;  1LB9 A;  4G8M A;  4EF2 A;  1Y3Q A;  3KOS A;  3FVG A;  2AYS A;  3PGF A;  1LBB A;  2I0C A;  4LA9 A;  5CI5 A;  3RUM A;  2UYE A;  4ZE8 A;  2DWA A;  4FIM A;  3MBP A;  4Q30 B;  3U72 A;  3H6W A;  2Y7P A;  3C4M A;  1ZKB A;  1MQH A;  1DTG A;  3ZSF A;  2OLB A;  1MG1 A;  4BDM A;  3I5O A;  2CZL A;  3IX1 A;  1QUI A;  1B3L A;  3DM0 A;  3TEL A;  1NL5 A;  3UIF A;  2QPQ A;  3Q29 A;  2FYI A;  2O6A A;  4DZ1 A;  2I58 A;  2UXA A;  5H8Q B;  4QFP A;  5L9S A;  3TDJ A;  2E0S A;  4OEU A;  1B7Z A;  4DLD A;  4ELR A;  3GLB A;  4OTE A;  4ZDM A;  4PFY A;  4KYS A;  4G77 A;  2RCA A;  5H8N A;  3UP9 A;  4NF5 A;  4O3C A;  3M8U A;  3UOR A;  2DE4 A;  5AA2 A;  3K1M A;  1S9T A;  1P1Q A;  2NOO A;  1B3G A;  3BKI B;  3Q27 A;  1OLC A;  3HHF A;  5I57 A;  1LFI A;  2GFE A;  4R72 A;  1AMF A;  3PMW A;  2ONS A;  1NNF A;  3LC8 A;  3TEP A;  1B2H A;  2REG A;  3V8X B;  2F6P A;  2Q88 A;  2HXW A;  5H8H A;  3PPQ A;  1KWH A;  1EZP A;  1DTZ A;  3BFU A;  3K02 A;  4XKR A;  1ZBM A;  3G7W A;  3PUX E;  1UTB B;  4WKM A;  4F31 B;  3EQ1 A;  1MH3 A;  4E0W A;  2XX7 A;  1B3F A;  3OMB A;  4X9T A;  1GGG A;  5HBC A;  1N04 A;  3O2A A;  1SI0 A;  3SEY A;  1LFH A;  3D4G A;  3MVY A;  4RPN A;  1R9L A;  5EHM A;  2XXI A;  3MUQ A;  3FV1 A;  3KEI A;  4LVQ A;  3TOD A;  3CFX A;  2A5S A;  4IY5 A;  3OO9 A;  4I62 A;  4F2Q A;  1NNP A;  5IAI A;  5TPA A;  1NFT A;  3TQL A;  5L9O A;  3K01 A;  5I2N A;  1TXF A;  4FE8 A;  1TT1 A;  2ESN A;  5F1Q A;  3N5L A;  5ITO A;  5FHO A;  1D9V A;  3MZB A;  4NE4 A;  1MXZ A;  2QMW A;  4EQ9 A;  4JBZ A;  4YAH X;  5B70 A;  1DMB A;  2OCU A;  2Q8J A;  3E4R A;  3QSL A;  4ZEI A;  2RC7 A;  3O6I A;  1RYO A;  2M8C A;  4OES A;  1IXI A;  1NKX A;  1XVY A;  4YMB A;  3KFM A;  4P0G A;  3CVG A;  2ZNS A;  2VHA A;  4TOZ A;  3IJX B;  4U1O A;  1DOT A;  3FXR A;  3FD3 A;  1WOD A;  4K3F A;  1Y1Z A;  1DSN A;  1POY 1;  1PB9 A;  1QW0 A;  4QFO A;  1JET A;  1A55 A;  1ELJ A;  3KN7 A;  3OEL A;  3BBR A;  1PEB A;  4BDR A;  3K6U A;  3N94 A;  1POT A;  3K1P A;  4UAC A;  1YCJ A;  4KFQ A;  1N76 A;  1P1O A;  1R1N A;  4QHQ A;  4LQ5 A;  4PE5 B;  1FTK A;  1B4Z A;  5DEX A;  5AA4 A;  3DP6 A;  1UIV A;  3H3G A;  4FJP A;  3SDF A;  5IKB A;  4IO7 A;  3OO6 A;  4DXU A;  4TLM B;  1F9B A;  4JWY A;  1JW5 A;  2UYF A;  4ZEK A;  3RLF E;  3KG2 A;  3RN8 A;  5HM4 B;  1QUJ A;  1B5J A;  5JEI A;  5J1D A;  3QUF A;  1XS5 A;  1L5T A;  1NH8 A;  3FVO A;  1YAE A;  1OLA A;  5I2K B;  1Z7M E;  3G3H A;  4PET A;  2LAO A;  3Q25 A;  5I59 B;  1HSJ A;  2I3W A;  3C9H A;  1S50 A;  3FAS A;  2QJE A;  2F7C A;  1SYH A;  2DE3 A;  3IO6 A;  1FQD A;  3IR1 A;  3SES A;  2FNC A;  3EN3 A;  4KPT A;  2I0B A;  3MP6 A;  2A5T B;  4R73 A;  4XIG Q;  1ANF A;  5EHS A;  2H5Y A;  3IOR A;  3LSL A;  3H6T A;  1JNF A;  2AL4 A;  3MVW A;  2Y7R A;  1MDP 1;  3ONM A;  4GL0 A;  4OEN A;  1UTH B;  4OQO A;  3MVZ A;  3H6V A;  5H8S A;  4ELQ A;  1JEV A;  3HN0 A;  3G3F A;  3KSX A;  3PPR A;  3TZA A;  1B05 A;  4X48 A;  2QS2 A;  3E3K A;  3DP8 A;  4YZZ A;  3IOV A;  4DXB A;  4BDN A;  4NWD A;  4MFI A;  5DTB A;  3K6V A;  4H8J A;  4R2F A;  1Q1K A;  2H4I A;  3PUV E;  2Z8F A;  1PBQ A;  4I9D A;  1MPC A;  3SET A;  1MQI A;  1I69 A;  2I48 A;  1D9Y A;  3ECR A;  2DVZ A;  1MM6 A;  2HFB A;  2V3U A;  1O7T A;  4F1U A;  3KN8 A;  5TP9 B;  1Y1M A;  2AL5 A;  4OER A;  4GVO A;  1LCF A;  4MLQ A;  4DIG A;  3A3C A;  3PV0 E;  2XHD A;  4OXV A;  3O97 A;  5M2V A;  3QUJ A;  2B3B A;  2O69 A;  3T9V A;  3SEV A;  3DP4 A;  3CR9 A;  4YKP A;  5CMB A;  4L17 A;  2IEE A;  1MY3 A;  4H65 A;  2O51 A;  1I6Q A;  4OMB A;  1QKA A;  2Y84 A;  1O64 A;  2UVJ A;  4GFR A;  3ZKK A;  3R26 A;  2DWH A;  3FXQ A;  2DXY A;  4JWO A;  5I58 B;  3HPI A;  3PU5 A;  2F7A A;  3KOT A;  3S9N C;  3S4U A;  3ZKL A;  5H8Q A;  4GOT A;  4ESX A;  2VGQ A;  3C35 A;  4ZE9 A;  3TPA A;  1B1X A;  1USY E;  1WDN A;  3PPN A;  3VVF A;  3OD7 A;  2GHA A;  1VFE A;  3H03 A;  1MXX A;  1RKM A;  2F97 A;  2HAU A;  1B5H A;  4QFK A;  1B7H A;  1B7U A;  5BUU A;  3OSR A;  3FXU A;  2VP1 A;  1B3H A;  1B0L A;  2D3I A;  2ZYO A;  2DS9 A;  3PUW E;  2DE2 A;  1SD3 A;  4F1Y A;  4F3S A;  1N84 A;  4Z0I A;  3C32 A;  1MPB A;  1FQC A;  3PPP A;  1AIV A;  4LZ8 A;  1MQJ A;  3FZV A;  3BFT A;  5L9M A;  4F1V A;  2XXR A;  4GF8 A;  1R9Q A;  1FTJ A;  4QFL A;  5CBR A;  1UTB A;  3F11 A;  1JW4 A;  1M5E A;  1DPE A;  2QRY A;  3GBA A;  1VR5 A;  2OWS A;  1IEJ A;  1US5 A;  3B6Q A;  5CMM A;  4DCY A;  3TFL A;  4ZS9 A;  1GVC A;  1B6H A;  1B5I A;  3ODB A;  4ELP A;  1IXH A;  1EU8 A;  1A8F A;  3PMV A;  1P1W A;  1IXG A;  2DQV A;  4ZED A;  1MQD A;  5A5X B;  2VD3 A;  1MXU A;  4F22 A;  4GWO A;  2DXR A;  2HQ0 A;  1LLS A;  2F8D A;  2F36 A;  3TTN A;  4HTG A;  2HEU A;  4KI0 E;  5H8F A;  4PQJ A;  4Q5T A;  1ZMG A;  4C1U A;  1AOV A;  1UIU A;  1XT8 A;  3H4Z A;  4I1D A;  4IO4 A;  3T9X B;  3OO7 A;  3IB2 A;  2P0S A;  5KDT B;  1H3D A;  4Q8R A;  3N6U A;  3H6U A;  1GTK A;  2O68 A;  1PB8 A;  3SEU A;  4RPO A;  4OZ9 A;  3OSQ A;  2OBG A;  2ALU A;  2BJJ X;  1B9J A;  1B58 A;  3Q28 A;  2ZYN A;  3OOA A;  2P1S A;  4OET A;  3VDF A;  3L6H A;  3KBR A;  3TTM A;  4EF1 A;  1MQG A;  3V5A A;  3OEM A;  4O3A A;  4F3G A;  1D4N A;  1FQA A;  1Y20 A;  3KN3 A;  1PC3 A;  5JK4 A;  4GL8 A;  5FHM A;  2F6G A;  3Q26 A;  5DT6 A;  1URG A;  2F34 A;  1ZIU A;  3O66 A;  4X1D A;  4MF3 A;  1IIW A;  5CC2 A;  2REJ A;  5JTY B;  5BWJ A;  3G3I A;  4YKK A;  2KLF A;  2XD3 A;  4LON B;  4PFU A;  5DVJ A;  2YJP A;  3G3G A;  2E1S A;  2OK2 A;  1II5 A;  3RY3 A;  3VVD A;  4GXA A;  3RGY A;  5I2K A;  1IIT A;  3OXN A;  5I59 A;  5KCJ B;  1LST A;  2XXH A;  4G68 A;  4ND9 A;  3CFL A;  4GRK A;  3OO8 A;  3W9W A;  1XVX A;  3MWB A;  3RT6 B;  2RF1 A;  3QXM A;  1MXV A;  2UVH A;  2XXU A;  2GRV A;  1SYI A;  1Q35 A;  1Z7N E;  2QMX A;  3N6T A;  4EXL A;  2F78 A;  4YB7 A;  3PUY E;  1GV8 A;  3PUZ E;  1VFD A;  3W9V A;  3HV1 A;  4ZEC A;  3IOU A;  3CG1 A;  3VLV A;  4EXK A;  2F7B A;  1UTH A;  4MH5 A;  1TFD A;  4G4P A;  3VXB A;  3FV2 A;  4H67 A;  4R9G A;  2Y7W A;  1SQY A;  1SW1 A;  4MBP A;  1FW0 A;  4POX A;  4N07 A;  3TCH A;  4BDO A;  4I8C A;  4XKQ A;  4HCY A;  2ZYK A;  4H6D A;  4H5F A;  3FIR A;  4DXC A;  2Y7K A;  1IQ7 A;  3EHS A;  4F3P A;  2P2A A;  4O3B A;  3TMG A;  3K6W A;  5K2Y A;  4Q0C A;  4YB6 A;  1H45 A;  5ICQ A;  5TP9 A;  4THI A;  4KCC A;  4KR5 A;  3AXF A;  1IXC A;  2XD2 A;  2Q9T A;  1JW1 A;  3VV5 A;  3CIJ A;  3K6X A;  1EZO A;  4GD5 A;  4GXS B;  4QSD A;  3JZJ A;  1Y3N A;  3B6W A;  5KZT A;  4OYV A;  1MS7 A;  2HZK A;  2XXV A;  1MXW A;  3RQT A;  2XX8 A;  3LSW A;  5I58 A;  1N3W A;  4YKJ A;  3ZS6 A;  1URD A;  2H98 A;  3O9P A;  4ESW A;  2ZNU A;  1Y9U A;  3D4C A;  4IO5 A;  3U8Q A;  3O6G A;  1FTL A;  3CI8 A;  1H44 A;  1R6Z A;  3USD A;  3MPL A;  4G8H A;  3T22 A;  2DP8 A;  3CRB A;  1M5B A;  2QS4 A;  2X26 A;  3VLU A;  4WXJ A;  5CMK A;  3FUZ A;  2O1L A;  3T9U A;  3KJT A;  2PMS A;  2ABH A;  3ILT B;  2ZMB A;  2ZNT A;  4XKN A;  4IY6 A;  1URS A;  2W7Y A;  1MPD A;  3M3L A;  2PT1 A;  2Z22 A;  2V93 A;  3IK6 B;  4PFT A;  3K4U A;  4NF6 B;  4BDQ A;  4HS7 A;  2ZXT A;  4QFN A;  4YU0 A;  3MZ9 A;  3FJG A;  1FTM A;  1TWY A;  3O28 A;  1LB8 A;  2ONR A;  1S7Y A;  1GR2 A;  5FTH A;  4DDD A;  3W15 C;  2Z23 A;  3U92 A;  4FAT A;  1N3X A;  4U21 A;  4BDL A;  4ZEF A;  2ANJ A;  3A09 A;  4F3B A;  4R6Y A;  3FJM A;  1ZLQ A;  1MRP A;  2H99 A;  5HPQ A;  4R6K A;  5A5X A;  4KD5 A;  4UA8 A;  1MY2 A;  3T96 B;  3SEW A;  2YLN A;  1MY4 A;  3PPO A;  4JSO A;  4XTC Q;  5DYH A;  2QL3 A;  4OVJ A;  3T93 B;  2RCB A;  4C1T A;  3S9E A;  3IO4 A;  5ICT A;  2YPN A;  2CMO A;  2Q89 A;  3TTK A;  3VFJ A;  2XX9 A;  4NF4 B;  1A7L A;  2GH9 A;  4EDP A;  4JWX A;  2H25 A;  1BP5 A;  4PFW A;  3SKP A;  3H06 B;  2QS3 A;  4LAT A;  4ISU A;  5AA3 A;  1CE2 A;  3S9L C;  4QSC A;  5F7V A;  4NMY A;  3PMX A;  4GLI A;  3QAX A;  2D5W A;  4ZEB A;  2UVG A;  1BTJ A;  3MC2 A;  1B4H A;  1B32 A;  3RTW B;  1SDX A;  4F18 A;  1LBC A;  4HW8 A;  3QK6 A;  5KDT A;  3WAE A;  3O6H A;  5ITP A;  3RT8 A;  1LGB C;  2FA7 A;  4ONY A;  2RC9 A;  4LUB A;  3R7X A;  1NNK A;  4RJZ A;  5CRY A;  1NH7 A;  3TCG A;  4NTL A;  1EH3 A;  1LAG E;  1DPP A;  3K0V A;  3IL1 B;  4H1X A;  3TTR A;  3GBB A;  5CBS A;  3R6U A;  1MM7 A;  3V83 A;  4RY1 A;  1ZJL A;  1JEU A;  3SER A;  3E9X A;  2G29 A;  4MLV A;  1IUD A;  1SBP A;  1Y3P A;  4YB5 A;  2I49 A;  2B3F A;  3HHG A;  3TAJ A;  1N7X A;  2ZYM A;  4G2Z A;  4QRZ A;  2O84 X;  5JTY A;  3SEX A;  3T66 A;  4XXU A;  5I84 A;  3TYH A;  2HCA A;  4N13 A;  1N7W A;  4RA1 A;  4C0R A;  4EQ7 A;  2V25 A;  5CM6 A;  4NED A;  4NF8 A;  4OFJ A;  1SW4 A;  2NXO A;  5CMC A;  1T0K A;  5KCJ A;  3IAZ A;  4DE8 A;  1JVY A;  1BLF A;  1BKA A;  3FGS A;  4P0I A;  1XHY A;  2O7I A;  3S2V A;  3C33 A;  4U22 A;  1XOC A;  3TTL A;  1QUL A;  2Y7I A;  3CG3 A;  5I56 B;  3IB0 A;  4Z7E A;  1JQF A;  4NF8 B;  3OEK A;  1A40 A;  2R9J A;  4U4S A;  4F2O A;  1LCT A;  1BIY A;  2X7Q A;  1LAX A;  3JYR A;  3B6T A;  3GZG A;  3VLW A;  1Y4C A;  1AH5 A;  1MY0 A;  3GXA A;  4QSE A;  3T9H B;  5ISU A;  1B52 A;  2R71 A;  1J1N A;  3QYT A;  4KCD A;  3C34 A;  2V84 A;  1NNT A;  3IJO B;  3MW0 A;  5ELV A;  1B3E A;  3M3F A;  1LFG A;  2RC8 A;  3UN6 A;  4RXL A;  1FQF A;  2R6G E;  1TFA A;  3CSB A;  4P11 A;  3HCQ A;  2DYX A;  5AE4 A;  2PX1 A;  4F19 A;  3C36 A;  4R75 A;  1JVX A;  3FJ7 A;  3P7I A;  2XXP A;  4JB7 A;  1EZ9 A;  4JXI A;  1LAF E;  4U23 A;  1YTV A;  1HSL A;  1US4 A;  1MY1 A;  4KYD A;  5L8D A;  3N26 A;  4NWC A;  1OQH A;  4EQB A;  4BLA A;  3V89 B;  4FOR A;  3K1N A;  2WKY A;  4U4X A;  1B0H A;  2O1M A;  1MXY A;  1QKB A;  2I4B A;  4GQO A;  2ONK E;  2XXY A;  1OQG A;  3E13 X;  3IOT A;  4DCX A;  1A99 A;  2F5X A;  4IO2 A;  5AA2 D;  5K2X A;  2I4C A;  5H8F B;  3MPK A;  5H8N B;  4LQ2 A;  3O29 A;  1LAH E;  2A5T A;  4NF5 B;  3LUY A;  5AA2 B;  1M5F A;  4AB5 A;  4H0W A;  5AA1 A;  2Q2C A;  3QIM A;  1ZTY A;  1RYX A;  2DWJ A;  3MP1 A;  4AB6 A;  4RK9 A;  3H7M A;  1B1H A;  3I6V A;  2V3T A;  4U2R A;  1B46 A;  1M5C A;  4ZZA A;  5I57 B;  2NWJ A;  1B51 A;  1H76 A;  3KGC A;  3OEN A;  4HCW A;  3RPW A;  2Z8D A;  4POW A;  5H8H B;  3U94 A;  3TKD A;  3TQW A;  3KZG A;  1VE4 A;  3TCF A;  3LBS A;  4E0X A;  4F39 A;  4KHZ E;  4IO6 A;  1FCK A;  4IO3 A;  2PYY A;  1VSO A;  3EHU A;  4TQU Q;  1HSE A;  1D3K A;  1OIB A;  2HZL A;  1PB7 A;  4NF6 A;  1ZU0 A;  1OMP A;  3G3J A;  3G3K A;  3IOW A;  4ZZE A;  4AQ4 A;  3A3U A;  1O63 A;  4FEB A;  1QJM A;  1MH4 A;  4FED A;  4G68 C;  1PDA A;  2XXQ A;  4OEV A;  3UK4 A;  3FVN A;  2O7U A;  3KSJ A;  4LP2 B;  2B65 A;  3RNN A;  2OWT A;  3RTF B;  1XC1 A;  3I3V A;  5TPA B;  1N0T A;  3LSF B;  3M3K A;  4U1Z A;  4ECF A;  3KJ7 A;  3MQ9 A;  2V3Q A;  1PBP A;  5I2N B;  4EUO A;  4R74 A;  3FAT A;  5DVF A;  5EYF A;  5LOM A;  3HST A;  4G68 B;  3C31 A;  3DEL B;  2VD2 A;  2NUV A;  1I6B A;  4TLL B;  3CFZ A;  5FTI A;  3EPE A;  4NF4 A;  3U93 A;  4ELO A;  3VE1 B;  4IGR A;  2DVC A;  4M1V A;  2H9B A;  3THI A;  1M5D A;  4PP0 A;  3VXC A;  2G93 A;  3VVE A;  1A8E A;  2Q2A A;  2UVI A;  3EHT A;  1OVB A;  4RK2 A;  3U1O A;  2AIX A;  2QS1 A;  1NMU A;  4LZ5 A;  1Y4T A;  3CSG A;  4R6H A;  2NVU B;  1B40 A;  4X1B A;  4M4G A;  3MJN A;  2OZZ A;  4KYE A;  5DEX B;  2RKM A;  5AA4 B;  4FEC A;  1AL3 A;  3FVK A;  4YIC A;  4OFL A;  4N6P A;  1SVX B;  2IA4 A;  1SW2 A;  4OHN A;  2HAV A;  4RNS A;  2DOJ A;  4JSD A;  3MAM A;  3K00 A;  3HO7 A;  2PBW A;  1QVS A;  1CB6 A;  2I6E A;  2PVU A;  1WVJ A;  3B7D A;  4JDF A;  4G8N A;  4F29 A;  3MP8 A;  3S9M C;  3TUS A;  2PT2 A;  1YPN A;  4IGT A;  4RYA A;  4GIZ A;  3UGW A;  5DVI A;  3LSX A;  1SI1 A;  2VOZ A;  2XXT A;  4LZ7 A;  1P99 A;  4R9F A;  4QF9 A;  3PD9 A;  1A54 A;  4WED A;  1QUK A;  4R2B A;  4H8I A;  4XKP A;  1I6A A;  4FAJ A;  3DLN A;  3K2D A;  4YKI A;  4IB2 A;  2RIN A;  1USY H;  2XXW A;  2THI A;  1OVT A;  1P1U A;  1IZ1 A;  2X7P A;  3EF7 A;  4YMA A;  1FTO A;  3PD8 A;  2XXX A;  5B7D A;  2D21 A;  2DSF A;  3LR1 A;  3MVX A;  3L6G A;  4KQP A;  1FQB A;  2F35 A;  2OJT A;  3WAF A;  4OFO A;  2DWI A;  2GHB A;  1ATG A;  3JV9 A;  1UQW A;  4H5G A;  3MZ1 A;  2QSX A;  5I56 A;  4WEP A; 
#chains in the Genus database with same CATH topology
 3ILU B;  5TU0 A;  4OWD A;  5LDZ A;  1FQE A;  5FHN A;  1H43 A;  3UA8 A;  2I3V A;  3IB1 A;  1SW5 A;  1MDQ A;  1P1N A;  2Z8E A;  1LB9 A;  4G8M A;  4EF2 A;  1Y3Q A;  3KOS A;  4DI4 B;  1IMB A;  3FVG A;  2AYS A;  3PGF A;  1LBB A;  2I0C A;  4LA9 A;  1YYZ A;  5CI5 A;  3RUM A;  2UYE A;  4ZE8 A;  2DWA A;  4FIM A;  3MBP A;  4Q30 B;  4PFI A;  3U72 A;  3H6W A;  2Y7P A;  3C4M A;  1ZKB A;  1MQH A;  1DTG A;  4G61 A;  4PAF A;  1DBZ A;  3ZSF A;  2OLB A;  1MG1 A;  4BDM A;  3I5O A;  2CZL A;  4HE1 A;  3IX1 A;  4H46 A;  1QUI A;  1D9Q A;  2HPG A;  1B3L A;  1NV2 A;  3DM0 A;  1NL5 A;  3TEL A;  3UIF A;  2QPQ A;  3Q29 A;  2FYI A;  2O6A A;  4DZ1 A;  2I58 A;  2UXA A;  5H8Q B;  4QFP A;  5L9S A;  3TDJ A;  2E0S A;  4MEV A;  4OEU A;  1B7Z A;  4PF8 A;  4DLD A;  4ELR A;  3GLB A;  4OTE A;  4MNI A;  4ZDM A;  4PFY A;  4KYS A;  4G77 A;  4N4U A;  2RCA A;  2WX9 A;  5H8N A;  3UP9 A;  4NF5 A;  4O3C A;  3M8U A;  3UOR A;  3IFC A;  2DE4 A;  5AA2 A;  3K1M A;  1S9T A;  1P1Q A;  2NOO A;  1B3G A;  3BKI B;  3Q27 A;  5IZ3 B;  4X04 A;  1OLC A;  3HHF A;  5I57 A;  1LFI A;  2GFE A;  4R72 A;  1AMF A;  3PMW A;  2ONS A;  1NNF A;  3LC8 A;  3TEP A;  1B2H A;  2REG A;  3V8X B;  2F6P A;  2Q88 A;  5EQA A;  2HXW A;  5H8H A;  3PPQ A;  1KWH A;  1EZP A;  1DTZ A;  3LUZ A;  3BFU A;  3K02 A;  4XKR A;  2CZI A;  1ZBM A;  3G7W A;  3PUX E;  1FJ9 A;  1UTB B;  4MJO A;  4WKM A;  4F31 B;  3EQ1 A;  1MH3 A;  4E0W A;  2XX7 A;  1B3F A;  3OMB A;  2HHM A;  4X9T A;  1QGX A;  1GGG A;  3A29 A;  5HBC A;  1N04 A;  3O2A A;  1SI0 A;  3SEY A;  1LFH A;  3D4G A;  3MVY A;  4RPN A;  1R9L A;  5EHM A;  2XXI A;  3MUQ A;  2ZZW A;  4PGN A;  3FV1 A;  3KEI A;  4LVQ A;  3TOD A;  3CFX A;  4PAK A;  2A5S A;  3BIH A;  4IY5 A;  1FPF A;  3OO9 A;  4I62 A;  4F2Q A;  1FBE A;  1NNP A;  4P3L A;  5IAI A;  5TPA A;  1NFT A;  4PC9 A;  3TQL A;  1SPI A;  4I3Y A;  5L9O A;  1YXI A;  3K01 A;  5I2N A;  1TXF A;  4FE8 A;  1TT1 A;  2ESN A;  5F1Q A;  3N5L A;  5ITO A;  5FHO A;  1D9V A;  3MZB A;  4NE4 A;  1MXZ A;  2QMW A;  4EQ9 A;  4JBZ A;  4YAH X;  1DMB A;  2OCU A;  5B70 A;  2Q8J A;  3E4R A;  3QSL A;  4ZEI A;  2RC7 A;  4GX6 A;  3O6I A;  1RYO A;  2M8C A;  3GYY A;  4OES A;  1IXI A;  1NKX A;  1XVY A;  4YMB A;  4N6D A;  3KFM A;  4P0G A;  3CVG A;  2ZNS A;  2VHA A;  4TOZ A;  3IJX B;  4U1O A;  1DOT A;  4GWZ A;  3FXR A;  4K3F A;  1FBH A;  1WOD A;  3FD3 A;  1Y1Z A;  1DSN A;  1POY 1;  1PB9 A;  1QW0 A;  4QFO A;  1JET A;  1A55 A;  1ELJ A;  5ESY A;  1FPE A;  3KN7 A;  3OEL A;  2CEY A;  3BBR A;  1PEB A;  4BDR A;  3K6U A;  3N94 A;  1POT A;  3K1P A;  4UAC A;  1YCJ A;  4KFQ A;  1N76 A;  1P1O A;  1R1N A;  4QHQ A;  4LQ5 A;  4O8M A;  4PE5 B;  1FTK A;  1B4Z A;  5DEX A;  5AA4 A;  4N6K A;  3DP6 A;  1UIV A;  3H3G A;  5EQ9 A;  4FJP A;  3SDF A;  5IKB A;  4NF0 A;  4IO7 A;  1IMD A;  3OO6 A;  4DXU A;  4TLM B;  2VPO A;  1F9B A;  4JWY A;  1JW5 A;  2UYF A;  5T3J A;  4ZEK A;  3RLF E;  1AWB A;  1NUW A;  3KG2 A;  3RN8 A;  4MIJ A;  5HM4 B;  1QUJ A;  1B5J A;  5JEI A;  5J1D A;  3QUF A;  1XS5 A;  1L5T A;  1NH8 A;  3FVO A;  1YAE A;  1OLA A;  5I2K B;  1Z7M E;  3G3H A;  4PET A;  2LAO A;  4KXP A;  3Q25 A;  5I59 B;  1HSJ A;  2I3W A;  3C9H A;  1S50 A;  3FAS A;  2QJE A;  2F7C A;  4IR8 A;  1SYH A;  2DE3 A;  3IO6 A;  4PAI A;  1FQD A;  2P3N A;  3IR1 A;  3SES A;  2FNC A;  3EN3 A;  4KPT A;  2I0B A;  3MP6 A;  2A5T B;  4R73 A;  4XIG Q;  1ANF A;  5EHS A;  2H5Y A;  2B4L A;  3IOR A;  2R8T A;  3LSL A;  3H6T A;  1JNF A;  2WEF A;  2AL4 A;  2OWZ A;  3MVW A;  2Y7R A;  4PGP A;  1VDW A;  1MDP 1;  3ONM A;  4GL0 A;  4OEN A;  1UTH B;  4OQO A;  3MVZ A;  3H6V A;  5H8S A;  4I40 A;  4ELQ A;  5IM2 A;  1IME A;  1JEV A;  3HN0 A;  3G3F A;  3KSX A;  3PPR A;  3TZA A;  1B05 A;  4X48 A;  2QS2 A;  3E3K A;  3DP8 A;  4YZZ A;  3IOV A;  4DXB A;  4BDN A;  4NWD A;  4MFI A;  5DTB A;  3K6V A;  4H8J A;  1XI6 A;  4O94 A;  4R2F A;  1Q1K A;  2H4I A;  3PUV E;  2Z8F A;  1PBQ A;  4I9D A;  1MPC A;  3SET A;  4N91 A;  1MQI A;  1I69 A;  2I48 A;  1D9Y A;  3ECR A;  2DVZ A;  1MM6 A;  2HFB A;  2V3U A;  2Y5L A;  1O7T A;  4F1U A;  3KN8 A;  4PTK A;  5TP9 B;  1Y1M A;  2AL5 A;  4OER A;  4GVO A;  1LCF A;  4MLQ A;  4DIG A;  3A3C A;  3PV0 E;  2XHD A;  4OXV A;  3O97 A;  5M2V A;  3QUJ A;  2B3B A;  2O69 A;  4JVC A;  3T9V A;  3SEV A;  5IGA A;  3DP4 A;  4HE2 A;  3CR9 A;  4YKP A;  5CMB A;  4L17 A;  2IEE A;  1MY3 A;  4H65 A;  2O51 A;  1INP A;  1I6Q A;  4OMB A;  1QKA A;  2Y84 A;  1O64 A;  1LBZ A;  2UVJ A;  4GFR A;  3ZKK A;  3R26 A;  2DWH A;  3FXQ A;  2DXY A;  4JWO A;  5I58 B;  1Q9D A;  3HPI A;  3PU5 A;  2F7A A;  4MCO A;  2HXR A;  3KOT A;  3S9N C;  3S4U A;  3ZKL A;  5H8Q A;  4GOT A;  4OVT A;  4ESX A;  2VGQ A;  3C35 A;  4ZE9 A;  1RDZ A;  3TPA A;  1B1X A;  1USY E;  4QXD A;  1WDN A;  3PPN A;  3VVF A;  3OD7 A;  4XF5 A;  2PFY A;  2GHA A;  1VFE A;  3H03 A;  1MXX A;  1RKM A;  2F97 A;  2DDK A;  2HAU A;  1B5H A;  4QFK A;  1B7H A;  1B7U A;  4H45 A;  2WBD A;  5BUU A;  3OSR A;  3FXU A;  2VP1 A;  2ZZV A;  1B3H A;  5IZ3 A;  1B0L A;  2D3I A;  2ZYO A;  2DS9 A;  3PUW E;  2DE2 A;  1SD3 A;  4F1Y A;  4F3S A;  1FPI A;  1N84 A;  4Z0I A;  3C32 A;  5EYG A;  1MPB A;  1FQC A;  3PPP A;  1FRP A;  1AIV A;  4LZ8 A;  3MST A;  1MQJ A;  3FZV A;  3QMF A;  3BFT A;  5L9M A;  4F1V A;  4GWU A;  2XXR A;  4GF8 A;  1R9Q A;  1FTJ A;  4QFL A;  3U65 A;  4NN3 A;  5CBR A;  1UTB A;  3F11 A;  1JW4 A;  1M5E A;  1DPE A;  2QRY A;  3GBA A;  4JVI A;  1VR5 A;  2OWS A;  1IEJ A;  1NV3 A;  1US5 A;  2CZH A;  3B6Q A;  2CZK A;  5CMM A;  4DCY A;  3TFL A;  4ZS9 A;  1GVC A;  1B6H A;  1B5I A;  3ODB A;  4ELP A;  1IXH A;  1EU8 A;  1A8F A;  3PMV A;  1P1W A;  1IXG A;  2DQV A;  4ZED A;  1MQD A;  2ZZX A;  5A5X B;  2VD3 A;  4PCD A;  1MXU A;  4F22 A;  4MMP A;  4GWO A;  2DXR A;  2HQ0 A;  1LLS A;  2F8D A;  2F36 A;  3B8B A;  1FBC A;  3TTN A;  4HTG A;  2HEU A;  4KI0 E;  5H8F A;  4PQJ A;  4Q5T A;  4O7M A;  1ZMG A;  4C1U A;  1AOV A;  1UIU A;  1XT8 A;  3H4Z A;  3ISP A;  4I1D A;  4OVR A;  4IO4 A;  5FBP A;  3T9X B;  1DK4 A;  3OO7 A;  3IB2 A;  2JJK A;  5ET7 A;  2P0S A;  4GBV A;  5KDT B;  1H3D A;  4Q8R A;  3N6U A;  4GWY A;  3H6U A;  5I7I A;  1GTK A;  2O68 A;  1PB8 A;  3SEU A;  4N8G A;  4RPO A;  4OZ9 A;  3OSQ A;  2OBG A;  2ALU A;  2BJJ X;  1B9J A;  1B58 A;  3Q28 A;  2ZYN A;  3OOA A;  2P1S A;  4OET A;  3VDF A;  3L6H A;  3KBR A;  3TTM A;  4EF1 A;  1MQG A;  2V4C A;  4OVS A;  3V5A A;  1NV1 A;  3OEM A;  4O3A A;  4F3G A;  1D4N A;  1FBD A;  1FQA A;  1Y20 A;  3KN3 A;  1PC3 A;  5JK4 A;  2FIE A;  4GL8 A;  5FHM A;  2F6G A;  3Q26 A;  5DT6 A;  1URG A;  2F34 A;  1ZIU A;  3O66 A;  4X1D A;  4MF3 A;  1IIW A;  1KA1 A;  5CC2 A;  2XWO A;  2REJ A;  5JTY B;  5BWJ A;  3G3I A;  4YKK A;  5ET5 A;  2KLF A;  1IMA A;  2XD3 A;  4LON B;  4PFU A;  5DVJ A;  2Q8M A;  2YJP A;  3G3G A;  2E1S A;  2OK2 A;  4DI3 D;  1II5 A;  2XWI A;  3B50 A;  3RY3 A;  3VVD A;  4GXA A;  3RGY A;  5I2K A;  1IIT A;  3OXN A;  3E78 A;  2F3B A;  5I59 A;  5KCJ B;  1FBG A;  3PTY A;  1LST A;  2QVU A;  2XXH A;  4G68 A;  4ND9 A;  3CFL A;  4GRK A;  3OO8 A;  3W9W A;  1XVX A;  3MWB A;  3RT6 B;  3BIG A;  2RF1 A;  3QXM A;  1MXV A;  2UVH A;  5IZ1 A;  2MKZ A;  2XXU A;  2GRV A;  1SYI A;  1Q35 A;  1Z7N E;  2QMX A;  3N6T A;  4EXL A;  2F78 A;  4YB7 A;  3PUY E;  1GV8 A;  3PUZ E;  1VFD A;  3HV1 A;  4XEQ A;  3W9V A;  4ZEC A;  1NV5 A;  3IOU A;  3CG1 A;  3VLV A;  4EXK A;  2F7B A;  1UTH A;  4MH5 A;  4UAB A;  1TFD A;  4G4P A;  3VXB A;  1RDY A;  3FV2 A;  4H67 A;  4R9G A;  1FPL A;  2KR0 A;  2Y7W A;  1SQY A;  1SW1 A;  4MBP A;  1FW0 A;  4POX A;  3RYD A;  4N07 A;  3TCH A;  4BDO A;  4I8C A;  4XKQ A;  1FPB A;  4I3E A;  4HCY A;  3FBP A;  2ZYK A;  4H6D A;  4H5F A;  3FIR A;  4DXC A;  2Y7K A;  5A5L A;  1IQ7 A;  3EHS A;  4F3P A;  2P2A A;  4FBP A;  4O3B A;  3TMG A;  3K6W A;  5K2Y A;  1RDX A;  4Q0C A;  4YB6 A;  1H45 A;  5ICQ A;  5TP9 A;  1NI9 A;  4THI A;  4KCC A;  4KR5 A;  3AXF A;  1IXC A;  2XD2 A;  2Q9T A;  2FIX A;  1JW1 A;  3VV5 A;  3CIJ A;  2XXK A;  3K6X A;  4GD5 A;  1EZO A;  1CNQ A;  4GXS B;  4OA4 A;  3EKI A;  4QSD A;  3JZJ A;  3RPL A;  1Y3N A;  5I5P A;  3B6W A;  2FVZ A;  1NV6 A;  2WYK A;  5KZT A;  4OYV A;  1MS7 A;  2HZK A;  2XXV A;  1MXW A;  3RQT A;  2XX8 A;  3LSW A;  5I58 A;  1N3W A;  4YKJ A;  3ZS6 A;  1URD A;  2H98 A;  3O9P A;  1FPK A;  4ESW A;  2ZNU A;  1Y9U A;  3D4C A;  4IO5 A;  3U8Q A;  3O6G A;  1FTL A;  3CI8 A;  1H44 A;  1R6Z A;  3USD A;  3MPL A;  4G8H A;  2BJI A;  3T22 A;  2DP8 A;  3CRB A;  1M5B A;  4N8Y A;  2QS4 A;  2X26 A;  4PBH A;  3VLU A;  1FPG A;  4WXJ A;  5CMK A;  3FUZ A;  2F3D A;  2O1L A;  3T9U A;  3KJT A;  2PMS A;  5F24 A;  2ABH A;  3ILT B;  2ZMB A;  2ZNT A;  4XKN A;  4IY6 A;  1URS A;  2W7Y A;  1MPD A;  3M3L A;  2PT1 A;  2Z22 A;  2V93 A;  3IK6 B;  4PFT A;  3K4U A;  4NF6 B;  4BDQ A;  4HS7 A;  2ZXT A;  1EYK A;  4QFN A;  4YU0 A;  3MZ9 A;  3FJG A;  1FTM A;  1TWY A;  3O28 A;  1LB8 A;  2ONR A;  1NUZ A;  1S7Y A;  1GR2 A;  2XWK A;  5FTH A;  1LBX A;  1YZ0 A;  4DDD A;  3W15 C;  2Z23 A;  3U92 A;  4FAT A;  1N3X A;  4U21 A;  3HFU A;  4BDL A;  4ZEF A;  2ANJ A;  4X8R A;  3A09 A;  4F3B A;  5EQ8 A;  4R6Y A;  3FJM A;  1ZLQ A;  1MRP A;  2H99 A;  4GWX A;  5HPQ A;  2Q74 A;  4R6K A;  5A5X A;  4KD5 A;  4UA8 A;  1MY2 A;  3T96 B;  3SEW A;  2YLN A;  1MY4 A;  4N81 A;  3PPO A;  4JSO A;  4XTC Q;  5DYH A;  2QL3 A;  4OVJ A;  3T93 B;  2RCB A;  4C1T A;  3S9E A;  3IO4 A;  5ICT A;  2YPN A;  2CMO A;  2Q89 A;  3TTK A;  3VFJ A;  2XX9 A;  4NF4 B;  1A7L A;  2GH9 A;  4EDP A;  4PFB A;  1LBY A;  4JWX A;  5EYH A;  2H25 A;  1BP5 A;  4PFW A;  3SKP A;  3H06 B;  2QS3 A;  4LAT A;  4ISU A;  5AA3 A;  1NUY A;  1CE2 A;  5J16 A;  4QSC A;  5F7V A;  4NMY A;  3S9L C;  3PMX A;  4GLI A;  3QAX A;  2D5W A;  4ZEB A;  2UVG A;  1BTJ A;  3MC2 A;  1B4H A;  1B32 A;  3RTW B;  4MHF A;  1SDX A;  1LBV A;  2WYP A;  4F18 A;  1LBC A;  4HW8 A;  4PE3 A;  3QK6 A;  5KDT A;  3WAE A;  3O6H A;  5ITP A;  3RT8 A;  1LGB C;  2FA7 A;  1KA0 A;  4ONY A;  2RC9 A;  4LUB A;  3R7X A;  1NNK A;  4RJZ A;  5CRY A;  1NH7 A;  3TCG A;  4NTL A;  1EH3 A;  1LAG E;  1DPP A;  4MX6 A;  3K0V A;  3IL1 B;  4H1X A;  1K9Y A;  2WBB A;  3TTR A;  4MNP A;  3GBB A;  5CBS A;  3R6U A;  1MM7 A;  4GWW A;  3V83 A;  4RY1 A;  1ZJL A;  1JEU A;  3SER A;  3IFA A;  3E9X A;  2G29 A;  4MLV A;  1IUD A;  1SBP A;  1Y3P A;  4YB5 A;  2I49 A;  2B3F A;  3HHG A;  4OAN A;  3TAJ A;  1N7X A;  2ZYM A;  4P47 A;  4G2Z A;  4NG7 A;  4P9K A;  4QRZ A;  3SZP A;  2O84 X;  5JTY A;  3SEX A;  3T66 A;  4XXU A;  5I84 A;  3TYH A;  2PCR A;  3MYU A;  2XWV A;  2HCA A;  4N13 A;  1N7W A;  4RA1 A;  4C0R A;  4EQ7 A;  1NV4 A;  2V25 A;  5CM6 A;  4NED A;  4NF8 A;  4OFJ A;  1SW4 A;  2NXO A;  5CMC A;  1T0K A;  5KCJ A;  3IAZ A;  4NGU A;  2QVR A;  1NUX A;  2QVV A;  4DE8 A;  1JVY A;  1BLF A;  3FGS A;  1BKA A;  4OVP A;  4P0I A;  1XHY A;  2QFL A;  2O7I A;  3S2V A;  3C33 A;  4N17 A;  4LN5 A;  4U22 A;  1XOC A;  3TTL A;  1QUL A;  2Y7I A;  3CG3 A;  5I56 B;  3IB0 A;  4PDD A;  4Z7E A;  1JQF A;  4NF8 B;  3OEK A;  1A40 A;  2R9J A;  4U4S A;  4F2O A;  1LCT A;  1BIY A;  2X7Q A;  1LEV A;  2PFZ A;  1LAX A;  3JYR A;  3B6T A;  3GZG A;  3VLW A;  1Y4C A;  1AH5 A;  1MY0 A;  3GXA A;  4QSE A;  3T9H B;  5ISU A;  1B52 A;  2R71 A;  1J1N A;  4OVQ A;  3QYT A;  4KCD A;  3C34 A;  2V84 A;  1NNT A;  3IJO B;  1KZ8 A;  5DW8 A;  3MW0 A;  5ELV A;  1B3E A;  3CHG A;  3M3F A;  1LFG A;  5ET8 A;  2RC8 A;  3UN6 A;  4RXL A;  3T0J A;  2GQ1 A;  1FQF A;  2R6G E;  1TFA A;  3CSB A;  4P11 A;  3HCQ A;  2DYX A;  4P56 A;  5AE4 A;  3T1B A;  2PX1 A;  4F19 A;  3C36 A;  5LTC A;  4R75 A;  1JVX A;  3FJ7 A;  3P7I A;  2XXP A;  4JB7 A;  1EZ9 A;  4JXI A;  1LAF E;  4U23 A;  1YTV A;  3FXB A;  1HSL A;  1US4 A;  1MY1 A;  4KYD A;  4HXV A;  4P1L A;  5L8D A;  4MAG A;  1G0H A;  3N26 A;  4NWC A;  1OQH A;  4EQB A;  2L5V A;  4BLA A;  3V89 B;  4FOR A;  3K1N A;  2WKY A;  4U4X A;  1B0H A;  2O1M A;  1MXY A;  1QKB A;  2I4B A;  4GQO A;  2ONK E;  2XXY A;  1OQG A;  2B4M A;  3E13 X;  3IOT A;  4DCX A;  1A99 A;  2F5X A;  1FTA A;  4IO2 A;  5AA2 D;  4HE0 A;  5K2X A;  2I4C A;  5H8F B;  4NX1 A;  1FJ6 A;  4O7I A;  3MPK A;  1BK4 A;  5H8N B;  4LQ2 A;  5ET6 A;  3O29 A;  4P1E A;  1LAH E;  2A5T A;  4NF5 B;  3LUY A;  1FPJ A;  5AA2 B;  1M5F A;  4AB5 A;  4H0W A;  5AA1 A;  1IMF A;  2Q2C A;  3QIM A;  1ZTY A;  1RYX A;  2DWJ A;  3MP1 A;  4AB6 A;  4RK9 A;  3H7M A;  3LV0 A;  4P8B A;  1B1H A;  3I6V A;  2V3T A;  4U2R A;  1B46 A;  1M5C A;  4ZZA A;  5I57 B;  2NWJ A;  1B51 A;  1H76 A;  3KGC A;  3OEN A;  4HCW A;  3RPW A;  2Z8D A;  4POW A;  5H8H B;  3U94 A;  4PBQ A;  3TKD A;  4GWS A;  3TQW A;  3KZG A;  4NAP A;  4NHB A;  1VE4 A;  3TCF A;  3LBS A;  4E0X A;  4F39 A;  4KHZ E;  4IO6 A;  1FCK A;  1LBW A;  4IO3 A;  4XFE A;  2PYY A;  1VSO A;  3EHU A;  4TQU Q;  1HSE A;  1D3K A;  2CEX A;  1OIB A;  2HZL A;  3NOH A;  1PB7 A;  4NF6 A;  1ZU0 A;  1OMP A;  3G3J A;  3G3K A;  4N15 A;  3IOW A;  4ZZE A;  4AQ4 A;  3A3U A;  1O63 A;  4FEB A;  1QJM A;  1MH4 A;  4FED A;  4G68 C;  1PDA A;  2XXQ A;  4OEV A;  3UK4 A;  1NV7 A;  3FVN A;  1FBF A;  3KC0 A;  3KC1 A;  2O7U A;  3KSJ A;  1FBP A;  4LP2 B;  2B65 A;  3RNN A;  2OX3 A;  2OWT A;  3RTF B;  1XC1 A;  3I3V A;  4GX3 A;  2Y5K A;  5TPA B;  1N0T A;  3LSF B;  3M3K A;  4U1Z A;  4ECF A;  3KJ7 A;  3MQ9 A;  2V3Q A;  1PBP A;  5I2N B;  4EUO A;  4R74 A;  3FAT A;  5DVF A;  5EYF A;  5LOM A;  5EQ7 A;  3HST A;  4G68 B;  3C31 A;  2FHY A;  3DEL B;  2VD2 A;  2NUV A;  1I6B A;  4TLL B;  4PFR A;  3CFZ A;  5FTI A;  3EPE A;  4NF4 A;  3U93 A;  4ELO A;  3VE1 B;  4IGR A;  2DVC A;  4M1V A;  2H9B A;  3THI A;  1M5D A;  1EYI A;  4PDH A;  4PP0 A;  3VXC A;  2G93 A;  1EYJ A;  3VVE A;  1A8E A;  2Q2A A;  2UVI A;  3EHT A;  4PF6 A;  1OVB A;  4RK2 A;  3U1O A;  2AIX A;  2QS1 A;  2FBP A;  1NMU A;  4LZ5 A;  1Y4T A;  3CSG A;  4R6H A;  2NVU B;  4QBA A;  1B40 A;  4X1B A;  4M4G A;  1IMC A;  1FPD A;  3MJN A;  2OZZ A;  3KBZ A;  4KYE A;  5DEX B;  2RKM A;  5AA4 B;  4FEC A;  1AL3 A;  3FVK A;  1G0I A;  4YIC A;  4GX4 A;  4OFL A;  4N6P A;  1SVX B;  2VT5 A;  2IA4 A;  1SW2 A;  4OHN A;  3D1R A;  2HAV A;  4RNS A;  2DOJ A;  1NV0 A;  4JSD A;  3MAM A;  3K00 A;  3HO7 A;  2PBW A;  4MNC A;  1QVS A;  1CB6 A;  2I6E A;  2PVU A;  1WVJ A;  4NQ8 A;  3B7D A;  5I3S A;  4JDF A;  4G8N A;  2XA5 A;  4F29 A;  3MP8 A;  3E79 A;  4AS4 A;  3S9M C;  3TUS A;  2PT2 A;  1YPN A;  4IGT A;  4RYA A;  4GIZ A;  3UGW A;  2P3V A;  5DVI A;  3LSX A;  1SI1 A;  2VOZ A;  2VPN A;  3RPL B;  2XXT A;  1K9Z A;  4LZ7 A;  1P99 A;  4R9F A;  4QF9 A;  3PD9 A;  1A54 A;  4GBW A;  4WED A;  1QUK A;  4R2B A;  4H8I A;  4XKP A;  1I6A A;  4FAJ A;  3DLN A;  3K2D A;  4YKI A;  4JVD A;  4IB2 A;  4AS5 A;  2RIN A;  1USY H;  2XXW A;  1FSA A;  2THI A;  1OVT A;  1P1U A;  1IZ1 A;  2X7P A;  3EF7 A;  4YMA A;  1FTO A;  3PD8 A;  2XXX A;  5B7D A;  2D21 A;  2DSF A;  3LR1 A;  3MVX A;  5IZZ A;  1JP4 A;  3L6G A;  4KQP A;  1FQB A;  2F35 A;  2OJT A;  3WAF A;  4OFO A;  2DWI A;  2GHB A;  1ATG A;  3ROJ A;  3JV9 A;  1DCU A;  1UQW A;  4H5G A;  3MZ1 A;  2QSX A;  5I56 A;  2KQZ A;  4WEP A; 
#chains in the Genus database with same CATH homology
 3ILU B;  5TU0 A;  4OWD A;  1FQE A;  5FHN A;  1H43 A;  3UA8 A;  2I3V A;  3IB1 A;  1SW5 A;  1MDQ A;  1P1N A;  2Z8E A;  1LB9 A;  4G8M A;  4EF2 A;  1Y3Q A;  3KOS A;  3FVG A;  2AYS A;  3PGF A;  1LBB A;  2I0C A;  4LA9 A;  5CI5 A;  3RUM A;  2UYE A;  4ZE8 A;  2DWA A;  4FIM A;  3MBP A;  4Q30 B;  3U72 A;  3H6W A;  2Y7P A;  3C4M A;  1ZKB A;  1MQH A;  1DTG A;  3ZSF A;  2OLB A;  1MG1 A;  4BDM A;  3I5O A;  2CZL A;  3IX1 A;  1QUI A;  1B3L A;  3DM0 A;  3TEL A;  1NL5 A;  3UIF A;  2QPQ A;  3Q29 A;  2FYI A;  2O6A A;  4DZ1 A;  2I58 A;  2UXA A;  5H8Q B;  4QFP A;  5L9S A;  3TDJ A;  2E0S A;  4OEU A;  1B7Z A;  4DLD A;  4ELR A;  3GLB A;  4OTE A;  4ZDM A;  4PFY A;  4KYS A;  4G77 A;  2RCA A;  5H8N A;  3UP9 A;  4NF5 A;  4O3C A;  3M8U A;  3UOR A;  2DE4 A;  5AA2 A;  3K1M A;  1S9T A;  1P1Q A;  2NOO A;  1B3G A;  3BKI B;  3Q27 A;  1OLC A;  3HHF A;  5I57 A;  1LFI A;  2GFE A;  4R72 A;  1AMF A;  3PMW A;  2ONS A;  1NNF A;  3LC8 A;  3TEP A;  1B2H A;  2REG A;  3V8X B;  2F6P A;  2Q88 A;  2HXW A;  5H8H A;  3PPQ A;  1KWH A;  1EZP A;  1DTZ A;  3BFU A;  3K02 A;  4XKR A;  1ZBM A;  3G7W A;  3PUX E;  1UTB B;  4WKM A;  4F31 B;  3EQ1 A;  1MH3 A;  4E0W A;  2XX7 A;  1B3F A;  3OMB A;  4X9T A;  1GGG A;  5HBC A;  1N04 A;  3O2A A;  1SI0 A;  3SEY A;  1LFH A;  3D4G A;  3MVY A;  4RPN A;  1R9L A;  5EHM A;  2XXI A;  3MUQ A;  3FV1 A;  3KEI A;  4LVQ A;  3TOD A;  3CFX A;  2A5S A;  4IY5 A;  3OO9 A;  4I62 A;  4F2Q A;  1NNP A;  5IAI A;  5TPA A;  1NFT A;  3TQL A;  5L9O A;  3K01 A;  5I2N A;  1TXF A;  4FE8 A;  1TT1 A;  2ESN A;  5F1Q A;  3N5L A;  5ITO A;  5FHO A;  1D9V A;  3MZB A;  4NE4 A;  1MXZ A;  2QMW A;  4EQ9 A;  4JBZ A;  4YAH X;  5B70 A;  1DMB A;  2OCU A;  2Q8J A;  3E4R A;  3QSL A;  4ZEI A;  2RC7 A;  3O6I A;  1RYO A;  2M8C A;  4OES A;  1IXI A;  1NKX A;  1XVY A;  4YMB A;  3KFM A;  4P0G A;  3CVG A;  2ZNS A;  2VHA A;  4TOZ A;  3IJX B;  4U1O A;  1DOT A;  3FXR A;  3FD3 A;  1WOD A;  4K3F A;  1Y1Z A;  1DSN A;  1POY 1;  1PB9 A;  1QW0 A;  4QFO A;  1JET A;  1A55 A;  1ELJ A;  3KN7 A;  3OEL A;  3BBR A;  1PEB A;  4BDR A;  3K6U A;  3N94 A;  1POT A;  3K1P A;  4UAC A;  1YCJ A;  4KFQ A;  1N76 A;  1P1O A;  1R1N A;  4QHQ A;  4LQ5 A;  4PE5 B;  1FTK A;  1B4Z A;  5DEX A;  5AA4 A;  3DP6 A;  1UIV A;  3H3G A;  4FJP A;  3SDF A;  5IKB A;  4IO7 A;  3OO6 A;  4DXU A;  4TLM B;  1F9B A;  4JWY A;  1JW5 A;  2UYF A;  4ZEK A;  3RLF E;  3KG2 A;  3RN8 A;  5HM4 B;  1QUJ A;  1B5J A;  5JEI A;  5J1D A;  3QUF A;  1XS5 A;  1L5T A;  1NH8 A;  3FVO A;  1YAE A;  1OLA A;  5I2K B;  1Z7M E;  3G3H A;  4PET A;  2LAO A;  3Q25 A;  5I59 B;  1HSJ A;  2I3W A;  3C9H A;  1S50 A;  3FAS A;  2QJE A;  2F7C A;  1SYH A;  2DE3 A;  3IO6 A;  1FQD A;  3IR1 A;  3SES A;  2FNC A;  3EN3 A;  4KPT A;  2I0B A;  3MP6 A;  2A5T B;  4R73 A;  4XIG Q;  1ANF A;  5EHS A;  2H5Y A;  3IOR A;  3LSL A;  3H6T A;  1JNF A;  2AL4 A;  3MVW A;  2Y7R A;  1MDP 1;  3ONM A;  4GL0 A;  4OEN A;  1UTH B;  4OQO A;  3MVZ A;  3H6V A;  5H8S A;  4ELQ A;  1JEV A;  3HN0 A;  3G3F A;  3KSX A;  3PPR A;  3TZA A;  1B05 A;  4X48 A;  2QS2 A;  3E3K A;  3DP8 A;  4YZZ A;  3IOV A;  4DXB A;  4BDN A;  4NWD A;  4MFI A;  5DTB A;  3K6V A;  4H8J A;  4R2F A;  1Q1K A;  2H4I A;  3PUV E;  2Z8F A;  1PBQ A;  4I9D A;  1MPC A;  3SET A;  1MQI A;  1I69 A;  2I48 A;  1D9Y A;  3ECR A;  2DVZ A;  1MM6 A;  2HFB A;  2V3U A;  1O7T A;  4F1U A;  3KN8 A;  5TP9 B;  1Y1M A;  2AL5 A;  4OER A;  4GVO A;  1LCF A;  4MLQ A;  4DIG A;  3A3C A;  3PV0 E;  2XHD A;  4OXV A;  3O97 A;  5M2V A;  3QUJ A;  2B3B A;  2O69 A;  3T9V A;  3SEV A;  3DP4 A;  3CR9 A;  4YKP A;  5CMB A;  4L17 A;  2IEE A;  1MY3 A;  4H65 A;  2O51 A;  1I6Q A;  4OMB A;  1QKA A;  2Y84 A;  1O64 A;  2UVJ A;  4GFR A;  3ZKK A;  3R26 A;  2DWH A;  3FXQ A;  2DXY A;  4JWO A;  5I58 B;  3HPI A;  3PU5 A;  2F7A A;  3KOT A;  3S9N C;  3S4U A;  3ZKL A;  5H8Q A;  4GOT A;  4ESX A;  2VGQ A;  3C35 A;  4ZE9 A;  3TPA A;  1B1X A;  1USY E;  1WDN A;  3PPN A;  3VVF A;  3OD7 A;  2GHA A;  1VFE A;  3H03 A;  1MXX A;  1RKM A;  2F97 A;  2HAU A;  1B5H A;  4QFK A;  1B7H A;  1B7U A;  5BUU A;  3OSR A;  3FXU A;  2VP1 A;  1B3H A;  1B0L A;  2D3I A;  2ZYO A;  2DS9 A;  3PUW E;  2DE2 A;  1SD3 A;  4F1Y A;  4F3S A;  1N84 A;  4Z0I A;  3C32 A;  1MPB A;  1FQC A;  3PPP A;  1AIV A;  4LZ8 A;  1MQJ A;  3FZV A;  3BFT A;  5L9M A;  4F1V A;  2XXR A;  4GF8 A;  1R9Q A;  1FTJ A;  4QFL A;  5CBR A;  1UTB A;  3F11 A;  1JW4 A;  1M5E A;  1DPE A;  2QRY A;  3GBA A;  1VR5 A;  2OWS A;  1IEJ A;  1US5 A;  3B6Q A;  5CMM A;  4DCY A;  3TFL A;  4ZS9 A;  1GVC A;  1B6H A;  1B5I A;  3ODB A;  4ELP A;  1IXH A;  1EU8 A;  1A8F A;  3PMV A;  1P1W A;  1IXG A;  2DQV A;  4ZED A;  1MQD A;  5A5X B;  2VD3 A;  1MXU A;  4F22 A;  4GWO A;  2DXR A;  2HQ0 A;  1LLS A;  2F8D A;  2F36 A;  3TTN A;  4HTG A;  2HEU A;  4KI0 E;  5H8F A;  4PQJ A;  4Q5T A;  1ZMG A;  4C1U A;  1AOV A;  1UIU A;  1XT8 A;  3H4Z A;  4I1D A;  4IO4 A;  3T9X B;  3OO7 A;  3IB2 A;  2P0S A;  5KDT B;  1H3D A;  4Q8R A;  3N6U A;  3H6U A;  1GTK A;  2O68 A;  1PB8 A;  3SEU A;  4RPO A;  4OZ9 A;  3OSQ A;  2OBG A;  2ALU A;  2BJJ X;  1B9J A;  1B58 A;  3Q28 A;  2ZYN A;  3OOA A;  2P1S A;  4OET A;  3VDF A;  3L6H A;  3KBR A;  3TTM A;  4EF1 A;  1MQG A;  3V5A A;  3OEM A;  4O3A A;  4F3G A;  1D4N A;  1FQA A;  1Y20 A;  3KN3 A;  1PC3 A;  5JK4 A;  4GL8 A;  5FHM A;  2F6G A;  3Q26 A;  5DT6 A;  1URG A;  2F34 A;  1ZIU A;  3O66 A;  4X1D A;  4MF3 A;  1IIW A;  5CC2 A;  2REJ A;  5JTY B;  5BWJ A;  3G3I A;  4YKK A;  2KLF A;  2XD3 A;  4LON B;  4PFU A;  5DVJ A;  2YJP A;  3G3G A;  2E1S A;  2OK2 A;  1II5 A;  3RY3 A;  3VVD A;  4GXA A;  3RGY A;  5I2K A;  1IIT A;  3OXN A;  5I59 A;  5KCJ B;  1LST A;  2XXH A;  4G68 A;  4ND9 A;  3CFL A;  4GRK A;  3OO8 A;  3W9W A;  1XVX A;  3MWB A;  3RT6 B;  2RF1 A;  3QXM A;  1MXV A;  2UVH A;  2XXU A;  2GRV A;  1SYI A;  1Q35 A;  1Z7N E;  2QMX A;  3N6T A;  4EXL A;  2F78 A;  4YB7 A;  3PUY E;  1GV8 A;  3PUZ E;  1VFD A;  3W9V A;  3HV1 A;  4ZEC A;  3IOU A;  3CG1 A;  3VLV A;  4EXK A;  2F7B A;  1UTH A;  4MH5 A;  1TFD A;  4G4P A;  3VXB A;  3FV2 A;  4H67 A;  4R9G A;  2Y7W A;  1SQY A;  1SW1 A;  4MBP A;  1FW0 A;  4POX A;  4N07 A;  3TCH A;  4BDO A;  4I8C A;  4XKQ A;  4HCY A;  2ZYK A;  4H6D A;  4H5F A;  3FIR A;  4DXC A;  2Y7K A;  1IQ7 A;  3EHS A;  4F3P A;  2P2A A;  4O3B A;  3TMG A;  3K6W A;  5K2Y A;  4Q0C A;  4YB6 A;  1H45 A;  5ICQ A;  5TP9 A;  4THI A;  4KCC A;  4KR5 A;  3AXF A;  1IXC A;  2XD2 A;  2Q9T A;  1JW1 A;  3VV5 A;  3CIJ A;  3K6X A;  1EZO A;  4GD5 A;  4GXS B;  4QSD A;  3JZJ A;  1Y3N A;  3B6W A;  5KZT A;  4OYV A;  1MS7 A;  2HZK A;  2XXV A;  1MXW A;  3RQT A;  2XX8 A;  3LSW A;  5I58 A;  1N3W A;  4YKJ A;  3ZS6 A;  1URD A;  2H98 A;  3O9P A;  4ESW A;  2ZNU A;  1Y9U A;  3D4C A;  4IO5 A;  3U8Q A;  3O6G A;  1FTL A;  3CI8 A;  1H44 A;  1R6Z A;  3USD A;  3MPL A;  4G8H A;  3T22 A;  2DP8 A;  3CRB A;  1M5B A;  2QS4 A;  2X26 A;  3VLU A;  4WXJ A;  5CMK A;  3FUZ A;  2O1L A;  3T9U A;  3KJT A;  2PMS A;  2ABH A;  3ILT B;  2ZMB A;  2ZNT A;  4XKN A;  4IY6 A;  1URS A;  2W7Y A;  1MPD A;  3M3L A;  2PT1 A;  2Z22 A;  2V93 A;  3IK6 B;  4PFT A;  3K4U A;  4NF6 B;  4BDQ A;  4HS7 A;  2ZXT A;  4QFN A;  4YU0 A;  3MZ9 A;  3FJG A;  1FTM A;  1TWY A;  3O28 A;  1LB8 A;  2ONR A;  1S7Y A;  1GR2 A;  5FTH A;  4DDD A;  3W15 C;  2Z23 A;  3U92 A;  4FAT A;  1N3X A;  4U21 A;  4BDL A;  4ZEF A;  2ANJ A;  3A09 A;  4F3B A;  4R6Y A;  3FJM A;  1ZLQ A;  1MRP A;  2H99 A;  5HPQ A;  4R6K A;  5A5X A;  4KD5 A;  4UA8 A;  1MY2 A;  3T96 B;  3SEW A;  2YLN A;  1MY4 A;  3PPO A;  4JSO A;  4XTC Q;  5DYH A;  2QL3 A;  4OVJ A;  3T93 B;  2RCB A;  4C1T A;  3S9E A;  3IO4 A;  5ICT A;  2YPN A;  2CMO A;  2Q89 A;  3TTK A;  3VFJ A;  2XX9 A;  4NF4 B;  1A7L A;  2GH9 A;  4EDP A;  4JWX A;  2H25 A;  1BP5 A;  4PFW A;  3SKP A;  3H06 B;  2QS3 A;  4LAT A;  4ISU A;  5AA3 A;  1CE2 A;  3S9L C;  4QSC A;  5F7V A;  4NMY A;  3PMX A;  4GLI A;  3QAX A;  2D5W A;  4ZEB A;  2UVG A;  1BTJ A;  3MC2 A;  1B4H A;  1B32 A;  3RTW B;  1SDX A;  4F18 A;  1LBC A;  4HW8 A;  3QK6 A;  5KDT A;  3WAE A;  3O6H A;  5ITP A;  3RT8 A;  1LGB C;  2FA7 A;  4ONY A;  2RC9 A;  4LUB A;  3R7X A;  1NNK A;  4RJZ A;  5CRY A;  1NH7 A;  3TCG A;  4NTL A;  1EH3 A;  1LAG E;  1DPP A;  3K0V A;  3IL1 B;  4H1X A;  3TTR A;  3GBB A;  5CBS A;  3R6U A;  1MM7 A;  3V83 A;  4RY1 A;  1ZJL A;  1JEU A;  3SER A;  3E9X A;  2G29 A;  4MLV A;  1IUD A;  1SBP A;  1Y3P A;  4YB5 A;  2I49 A;  2B3F A;  3HHG A;  3TAJ A;  1N7X A;  2ZYM A;  4G2Z A;  4QRZ A;  2O84 X;  5JTY A;  3SEX A;  3T66 A;  4XXU A;  5I84 A;  3TYH A;  2HCA A;  4N13 A;  1N7W A;  4RA1 A;  4C0R A;  4EQ7 A;  2V25 A;  5CM6 A;  4NED A;  4NF8 A;  4OFJ A;  1SW4 A;  2NXO A;  5CMC A;  1T0K A;  5KCJ A;  3IAZ A;  4DE8 A;  1JVY A;  1BLF A;  1BKA A;  3FGS A;  4P0I A;  1XHY A;  2O7I A;  3S2V A;  3C33 A;  4U22 A;  1XOC A;  3TTL A;  1QUL A;  2Y7I A;  3CG3 A;  5I56 B;  3IB0 A;  4Z7E A;  1JQF A;  4NF8 B;  3OEK A;  1A40 A;  2R9J A;  4U4S A;  4F2O A;  1LCT A;  1BIY A;  2X7Q A;  1LAX A;  3JYR A;  3B6T A;  3GZG A;  3VLW A;  1Y4C A;  1AH5 A;  1MY0 A;  3GXA A;  4QSE A;  3T9H B;  5ISU A;  1B52 A;  2R71 A;  1J1N A;  3QYT A;  4KCD A;  3C34 A;  2V84 A;  1NNT A;  3IJO B;  3MW0 A;  5ELV A;  1B3E A;  3M3F A;  1LFG A;  2RC8 A;  3UN6 A;  4RXL A;  1FQF A;  2R6G E;  1TFA A;  3CSB A;  4P11 A;  3HCQ A;  2DYX A;  5AE4 A;  2PX1 A;  4F19 A;  3C36 A;  4R75 A;  1JVX A;  3FJ7 A;  3P7I A;  2XXP A;  4JB7 A;  1EZ9 A;  4JXI A;  1LAF E;  4U23 A;  1YTV A;  1HSL A;  1US4 A;  1MY1 A;  4KYD A;  5L8D A;  3N26 A;  4NWC A;  1OQH A;  4EQB A;  4BLA A;  3V89 B;  4FOR A;  3K1N A;  2WKY A;  4U4X A;  1B0H A;  2O1M A;  1MXY A;  1QKB A;  2I4B A;  4GQO A;  2ONK E;  2XXY A;  1OQG A;  3E13 X;  3IOT A;  4DCX A;  1A99 A;  2F5X A;  4IO2 A;  5AA2 D;  5K2X A;  2I4C A;  5H8F B;  3MPK A;  5H8N B;  4LQ2 A;  3O29 A;  1LAH E;  2A5T A;  4NF5 B;  3LUY A;  5AA2 B;  1M5F A;  4AB5 A;  4H0W A;  5AA1 A;  2Q2C A;  3QIM A;  1ZTY A;  1RYX A;  2DWJ A;  3MP1 A;  4AB6 A;  4RK9 A;  3H7M A;  1B1H A;  3I6V A;  2V3T A;  4U2R A;  1B46 A;  1M5C A;  4ZZA A;  5I57 B;  2NWJ A;  1B51 A;  1H76 A;  3KGC A;  3OEN A;  4HCW A;  3RPW A;  2Z8D A;  4POW A;  5H8H B;  3U94 A;  3TKD A;  3TQW A;  3KZG A;  1VE4 A;  3TCF A;  3LBS A;  4E0X A;  4F39 A;  4KHZ E;  4IO6 A;  1FCK A;  4IO3 A;  2PYY A;  1VSO A;  3EHU A;  4TQU Q;  1HSE A;  1D3K A;  1OIB A;  2HZL A;  1PB7 A;  4NF6 A;  1ZU0 A;  1OMP A;  3G3J A;  3G3K A;  3IOW A;  4ZZE A;  4AQ4 A;  3A3U A;  1O63 A;  4FEB A;  1QJM A;  1MH4 A;  4FED A;  4G68 C;  1PDA A;  2XXQ A;  4OEV A;  3UK4 A;  3FVN A;  2O7U A;  3KSJ A;  4LP2 B;  2B65 A;  3RNN A;  2OWT A;  3RTF B;  1XC1 A;  3I3V A;  5TPA B;  1N0T A;  3LSF B;  3M3K A;  4U1Z A;  4ECF A;  3KJ7 A;  3MQ9 A;  2V3Q A;  1PBP A;  5I2N B;  4EUO A;  4R74 A;  3FAT A;  5DVF A;  5EYF A;  5LOM A;  3HST A;  4G68 B;  3C31 A;  3DEL B;  2VD2 A;  2NUV A;  1I6B A;  4TLL B;  3CFZ A;  5FTI A;  3EPE A;  4NF4 A;  3U93 A;  4ELO A;  3VE1 B;  4IGR A;  2DVC A;  4M1V A;  2H9B A;  3THI A;  1M5D A;  4PP0 A;  3VXC A;  2G93 A;  3VVE A;  1A8E A;  2Q2A A;  2UVI A;  3EHT A;  1OVB A;  4RK2 A;  3U1O A;  2AIX A;  2QS1 A;  1NMU A;  4LZ5 A;  1Y4T A;  3CSG A;  4R6H A;  2NVU B;  1B40 A;  4X1B A;  4M4G A;  3MJN A;  2OZZ A;  4KYE A;  5DEX B;  2RKM A;  5AA4 B;  4FEC A;  1AL3 A;  3FVK A;  4YIC A;  4OFL A;  4N6P A;  1SVX B;  2IA4 A;  1SW2 A;  4OHN A;  2HAV A;  4RNS A;  2DOJ A;  4JSD A;  3MAM A;  3K00 A;  3HO7 A;  2PBW A;  1QVS A;  1CB6 A;  2I6E A;  2PVU A;  1WVJ A;  3B7D A;  4JDF A;  4G8N A;  4F29 A;  3MP8 A;  3S9M C;  3TUS A;  2PT2 A;  1YPN A;  4IGT A;  4RYA A;  4GIZ A;  3UGW A;  5DVI A;  3LSX A;  1SI1 A;  2VOZ A;  2XXT A;  4LZ7 A;  1P99 A;  4R9F A;  4QF9 A;  3PD9 A;  1A54 A;  4WED A;  1QUK A;  4R2B A;  4H8I A;  4XKP A;  1I6A A;  4FAJ A;  3DLN A;  3K2D A;  4YKI A;  4IB2 A;  2RIN A;  1USY H;  2XXW A;  2THI A;  1OVT A;  1P1U A;  1IZ1 A;  2X7P A;  3EF7 A;  4YMA A;  1FTO A;  3PD8 A;  2XXX A;  5B7D A;  2D21 A;  2DSF A;  3LR1 A;  3MVX A;  3L6G A;  4KQP A;  1FQB A;  2F35 A;  2OJT A;  3WAF A;  4OFO A;  2DWI A;  2GHB A;  1ATG A;  3JV9 A;  1UQW A;  4H5G A;  3MZ1 A;  2QSX A;  5I56 A;  4WEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...