4OENA

Crystal structure of the second substrate binding domain of a putative amino acid abc transporter from streptococcus pneumoniae canada mdr_19a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
220
Chain Sequence
KYIIASDSSFAPFVFQNSSNQYTGIDMELIKAIAKDQGFEIEITNPGFDAAISAVQAGQADGIIAGMSVTDARKATFDFSESYYTANTILGVKESSNIASYEDLKGKTVGVKNGTASQTFLTENQSKYGYKIKTFADGSSMYDSLNTGAIDAVMDDEPVLKYSISQGQKLKTPISGTPIGETAFAVKKGANPELIEMFNNGLANLKANGEFQKILDKYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the second substrate binding domain of a putative amino acid ABC transporter from Streptococcus pneumoniae Canada MDR_19A
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords Second substrate binding domain of putative amino acid ABC t
total genus 75
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oenA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oenA02
1LCTA 1MG1A 2XX7A 1DPPA 3GLBA 5TP9B 4ZS9A 5CI5A 2DWJA 4THIA 3RT6B 1NKXA 1QUIA 1AIVA 1B32A 3DP6A 4MBPA 3VVDA 1LLSA 2GFEA 3IB2A 3K0VA 1Q1KA 3O6IA 3PPQA 4IO5A 5H8FA 5I2NB 1H76A 4KD5A 1B5HA 3PUYE 1MRPA 3FJMA 3OXNA 4H5FA 4XTCQ 3K02A 2GHAA 3K6XA 1ANFA 2Y7IA 1FTJA 1IITA 2ONSA 4RPNA 4TQUQ 4YAHX 1SD3A 2RKMA 1B5IA 5EHSA 5K2YA 4E0WA 1ZBMA 3OO6A 1DTZA 3TODA 4EDPA 1Z7NE 4LZ7A 3KGCA 1Y20A 1B4HA 1B0LA 1PEBA 2Z22A 2V3UA 4JSOA 1NL5A 3M3KA 4OFLA 2F35A 2QRYA 3MP6A 3O9PA 4BDLA 1POY1 1FW0A 3KBRA 3E4RA 5H8NB 3UN6A 2Z8DA 4JXIA 3IAZA 5K2XA 5TPAA 3TCHA 5I56B 3LSXA 4R9GA 2E1SA 3FUZA 3QXMA 1TFAA 3SESA 3H6WA 4NF8B 3TFLA 3C36A 2P0SA 2PT1A 1JNFA 2YJPA 5AA1A 1OLAA 1B7UA 1IIWA 3CVGA 1UTBA 2HZKA 3CFLA 3MUQA 4H6DA 2DE3A 4JBZA 3CFXA 3OELA 3TEPA 1RYXA 4DXBA 3H6TA 2DWHA 1P1QA 1BTJA 5AA2A 2D3IA 4DE8A 1P1UA 1UQWA 3QK6A 3QUFA 4E0XA 3EQ1A 1GV8A 4KYDA 2I4BA 4ZEDA 2HQ0A 3CI8A 5CMCA 4Z0IA 1B05A 4PE5B 3C4MA 2QL3A 1TFDA 3K00A 3MZBA 1OVTA 4FORA 1JEUA 4I1DA 3DP8A 3BBRA 1JW4A 3PMVA 1URDA 4PQJA 4YB7A 4R72A 4YKPA 1MY0A 1P1OA 1SW2A 3MP1A 4KPTA 1FTOA 1Y1ZA 4H1XA 4LA9A 4QSDA 5F7VA 3KOSA 2NVUB 2GH9A 5LOMA 1NH8A 2XD2A 4ESWA 2GHBA 5DYHA 2XXWA 1M5CA 3M8UA 4ZEKA 2DQVA 2HFBA 2OCUA 1SW5A 4TOZA 4RYAA 4G8MA 3SERA 3C31A 4GF8A 4OWDA 4ECFA 2AL5A 4Q0CA 1EZ9A 5I57A 5CMMA 5CRYA 1JETA 2RC8A 3EN3A 4FATA 1B7ZA 1FQBA 2Z8FA 4RY1A 2PT2A 2I58A 4LATA 3TCFA 4ZEBA 1POTA 3KZGA 1MQHA 5DEXB 2PX1A 4PFWA 4EF2A 2DXYA 2XX8A 1AMFA 2UYEA 5H8QA 2LAOA 2QJEA 1L5TA 3V83A 1OQGA 3OENA 3IO4A 2DSFA 2XXUA 3FJ7A 4X1DA 3CSGA 4H8JA 2HAUA 2ALUA 2V3QA 5FTHA 2RC9A 4BLAA 5B70A 3ONMA 5I58A 5IAIA 1II5A 2V93A 4DIGA 2HCAA 4IO4A 1LAXA 4R6HA 2XXPA 4F3SA 3OO9A 2R71A 2NWJA 1N7WA 5L9OA 4IO7A 3FIRA 3FXQA 4IY5A 1WDNA 4OQOA 1FCKA 4RA1A 2DOJA 2F8DA 3FATA 1MH3A 1SVXB 5I57B 3BFUA 4GVOA 1YPNA 1FQAA 3O6GA 1JEVA 2OBGA 3LUYA 4G8HA 4GL0A 2F6GA 5DVJA 3KOTA 4IB2A 2XXQA 1R1NA 5FHMA 1AH5A 3SETA 1MH4A 3PPOA 4KYEA 4HS7A 4RK9A 4ND9A 3RT8A 3IB0A 2THIA 1N3XA 1MY1A 2P1SA 1FQFA 3OO7A 4OMBA 2B3FA 1NNFA 2REGA 1J1NA 2VOZA 4QHQA 3R7XA 4DXCA 1BKAA 4YMAA 2XD3A 1XHYA 3D4GA 4PP0A 1EZPA 1MY3A 2ONKE 3MZ1A 3UIFA 3U1OA 1KWHA 3PGFA 4G8NA 4ELOA 3N94A 3TAJA 1HSEA 4WEPA 3EPEA 4QFPA 4RK2A 4KFQA 3U8QA 3QIMA 2XX9A 3RQTA 3IOUA 4LP2B 4F1UA 1M5EA 4Z7EA 4LVQA 4ZE8A 3WAEA 2ZYNA 2FA7A 4BDNA 1XVYA 2O1MA 4G68B 4XKNA 5I84A 1VE4A 1JQFA 2H98A 2UXAA 3HO7A 4EXKA 5ITPA 3HPIA 5KDTB 3FJGA 3OEKA 4TLMB 2I48A 2O84X 1FTMA 5I59B 1JVXA 1NNTA 2XXXA 4FEDA 5AA4B 5H8HA 4BDQA 4MLQA 3SEVA 1YAEA 1B5JA 3ZKLA 1A40A 3PD8A 3THIA 4P11A 1R9LA 3K6VA 2F7AA 2ZYKA 3T22A 1F9BA 3W15C 2X26A 3HSTA 4YB6A 3S9LC 4O3AA 4YMBA 1YCJA 2HEUA 4UACA 2ESNA 2RC7A 4X48A 2PVUA 3WAFA 4ZE9A 5A5XA 2F78A 2H9BA 2DP8A 3EHUA 3N6UA 4F3BA 4F31B 2Q9TA 4OVJA 2I49A 1MPCA 3CG3A 5FHNA 4G2ZA 3UGWA 4F3GA 1QULA 2UVIA 5FHOA 1MS7A 4P0IA 1DTGA 1B2HA 5CM6A 1NH7A 2P2AA 2PMSA 4DDDA 3UK4A 2B65A 4NF4B 3DP4A 1Y4CA 4POXA 4ELQA 5AA2D 1I6BA 1IEJA 1LFIA 2VD2A 4NEDA 1MM7A 1BP5A 4H67A 1NMUA 2A5TB 5JK4A 1B46A 1AOVA 4OEVA 3VV5A 2Y7PA 3TTLA 1PB9A 2B3BA 3KJ7A 3UORA 3U93A 3KSJA 5DTBA 3BKIB 2OJTA 3EF7A 2V3TA 4WXJA 3CIJA 3VDFA 2XXRA 3T9VA 1A7LA 4ELPA 1FQCA 1LAHE 2Y84A 2NOOA 1MXYA 4R2FA 1ZMGA 1VFEA 5BWJA 3FGSA 5L8DA 1S50A 1JVYA 3O97A 4F3PA 1M5FA 3MVYA 1I6QA 2F6PA 1N7XA 4RJZA 3BFTA 2UYFA 4RXLA 5M2VA 2ANJA 2OZZA 5KZTA 2ZNUA 4I9DA 3LSFB 4JWXA 1N04A 3MQ9A 3O2AA 1US5A 4M4GA 3VE1B 2FYIA 2BJJX 4NF8A 3FASA 3H6UA 4KHZE 3V89B 2DE2A 2X7QA 5JEIA 3I3VA 3L6GA 2QSXA 2OK2A 3KFMA 2WKYA 2ZYMA 4L17A 3U72A 4IO3A 4F18A 4KYSA 3A3UA 5H8SA 4U2RA 3B6TA 3K1NA 3SEYA 4ZDMA 5I56A 2DS9A 3H3GA 3KJTA 3C34A 4QSEA 3MC2A 2E0SA 2Z8EA 4GXAA 3I5OA 3MZ9A 3W9WA 2DYXA 1B7HA 1MDP1 4HTGA 3H03A 3S9NC 5H8QB 2VD3A 1CE2A 3QAXA 4F2OA 4GQOA 4H65A 3Q27A 4LQ2A 2H99A 1H44A 3IOVA 1B9JA 2I6EA 3EHTA 5L9SA 4ZZEA 2CMOA 4NF5B 4NF6A 4BDRA 3B6QA 3IL1B 4BDMA 4U4XA 3ODBA 1FTKA 1DOTA 3PV0E 1Q35A 1GVCA 4DCXA 3Q28A 2M8CA 5KDTA 1QW0A 3VVFA 4JB7A 1SYHA 4H0WA 1QUKA 2G29A 4R6YA 4FAJA 4YKKA 2XXVA 2Q2AA 4NMYA 1OQHA 1RYOA 5H8HB 1XC1A 1B51A 3TMGA 1MXWA 2AL4A 1N0TA 2Y7KA 1USYE 3OMBA 4ISUA 3AXFA 3C32A 1M5DA 3V8XB 5AA2B 3MPLA 5DEXA 4OERA 3F11A 3FD3A 3VXCA 3S9EA 3P7IA 1MXZA 4YKJA 1N76A 2H5YA 1A54A 1JW5A 3OD7A 1VFDA 4FJPA 4G68C 1WODA 1VSOA 2I4CA 4PFYA 2O51A 1S7YA 4U1ZA 1B0HA 2PYYA 3RNNA 1YTVA 2Y7WA 3EHSA 3H7MA 2UVGA 4LZ8A 4YICA 3IJOB 3N6TA 4YZZA 3VLWA 2IA4A 1UIUA 1D9YA 3SDFA 1EU8A 3TTMA 1HSLA 4GXSB 2F5XA 4ZEFA 4N13A 1URSA 4OETA 1TT1A 3DELB 1MQJA 3K6UA 1PBPA 3KSXA 4EXLA 3HHFA 3JYRA 4AQ4A 3QUJA 3KG2A 4GLIA 4JDFA 2ZXTA 3FVKA 1ZKBA 4DZ1A 3TYHA 3IX1A 4DXUA 1B3FA 1LFGA 1EH3A 1LBCA 3E9XA 1A99A 3PMXA 4MFIA 4QFKA 1OLCA 2I0CA 1Y9UA 3TTRA 3TCGA 3FV2A 1CB6A 5B7DA 4XKRA 5JTYB 3RGYA 4F1YA 1DPEA 3C33A 1SDXA 1XT8A 1UTBB 2F36A 1NNKA 1H43A 2QS2A 5DVFA 4C0RA 5CMKA 4FE8A 5DVIA 4U1OA 3TQLA 1MXXA 3MVZA 3C35A 4MF3A 1M5BA 2VP1A 1ZTYA 3OEMA 4F1VA 3GBAA 3IOTA 2ZYOA 5H8FB 3UA8A 2D5WA 3R6UA 4PETA 3FVOA 3D4CA 3CFZA 1H3DA 4ZEIA 4IO2A 2Y7RA 3LBSA 3K2DA 5JTYA 4C1TA 1T0KA 4WEDA 1XVXA 2FNCA 2XXTA 3H06B 3SKPA 4EQ7A 3OOAA 5EHMA 3Q29A 1B3GA 4MLVA 4NWCA 5ELVA 1MPDA 3IR1A 4U23A 4ZZAA 2NUVA 4QF9A 5ITOA 3VLUA 3LR1A 3V5AA 4YKIA 4EUOA 4F29A 4F22A 5CC2A 1PC3A 1Y4TA 1RKMA 1IXIA 3PU5A 5I2KA 5CBSA 1FTLA 4WKMA 3VVEA 2A5TA 3N26A 3PPNA 1Z7ME 4LONB 3H4ZA 4NF5A 1SBPA 3K1MA 1D9VA 1FQDA 1B3LA 2AYSA 2R6GE 2UVHA 3FXRA 1WVJA 1GR2A 2O7IA 3GZGA 3ILUB 3K01A 1URGA 4GD5A 4JSDA 3W9VA 3TPAA 3HV1A 3SEXA 3PPRA 3TDJA 1LBBA 2RCBA 3JZJA 4FECA 1Y3NA 4EF1A 4YB5A 1SW1A 3FXUA 3RN8A 3O29A 2G93A 3IJXB 2O6AA 3CG1A 3TUSA 5ISUA 4C1UA 1PDAA 3IOWA 4G4PA 4KCDA 1P1WA 1OMPA 1LAFE 3MVXA 4P0GA 4UA8A 3G3JA 4MH5A 3U92A 4PFTA 4PFUA 4EQBA 1OVBA 3MP8A 1MQDA 5ICQA 5ICTA 4OFOA 1OIBA 1QKAA 3MW0A 4EQ9A 2O69A 4LQ5A 4OTEA 1LB9A 2XXIA 3T96B 3LSLA 3O28A 3MPKA 3OSQA 3TQWA 3VLVA 5I59A 5KCJA 1XS5A 4F2QA 3T93B 2RINA 5AA3A 1B40A 4NWDA 1TWYA 3FV1A 4LUBA 1LFHA 3A3CA 5TPAB 4GOTA 4DLDA 1S9TA 2V84A 2HZLA 1A8EA 3G3IA 1B1XA 3C9HA 4OXVA 1DSNA 3M3LA 1UTHB 2F7BA 4O3BA 3R26A 3SEUA 1H45A 2RCAA 5J1DA 1MQIA 4K3FA 3O66A 3E13X 1O7TA 2F7CA 1ELJA 2Q89A 1PB8A 3DLNA 3ECRA 2F34A 3HN0A 3Q26A 4HCYA 4NTLA 5F1QA 1MXUA 2Q2CA 5A5XB 4ESXA 4KI0E 4KCCA 1SI1A 1MXVA 2KLFA 4AB6A 3T9XB 4NF6B 2DWAA 4N6PA 4Q30B 3RUMA 1QJMA 3SEWA 1IQ7A 1US4A 4HCWA 1GTKA 1LSTA 3PUXE 3I6VA 4POWA 2DVZA 4RPOA 3T9UA 2D21A 3PMWA 4ZECA 5I2NA 3MJNA 1I69A 1N84A 4N07A 2X7PA 4FIMA 3G3HA 4QFLA 3TZAA 4F39A 3M3FA 3RTWB 2O7UA 4U22A 1O63A 1ZU0A 4G68A 4X1BA 4OYVA 1MY2A 3UP9A 4IGRA 1XOCA 1A8FA 1LAGE 2DVCA 4QFOA 4JWOA 4U21A 1O64A 2W7YA 3HHGA 2HAVA 3IORA 3KN8A 1ATGA 1LGBC 1MM6A 4NF4A 4OHNA 2Z23A 3MVWA 3K1PA 4R6KA 3QYTA 1DMBA 1MDQA 1IZ1A 3U94A 2Q88A 4OENA 2IEEA 1ZLQA 5H8NA 1IXGA 4H5GA 2QS4A 3LSWA 3RPWA 1VR5A 1Y3QA 4IO6A 4R73A 1ZJLA 2YLNA 2QMWA 4FEBA 3MWBA 3CSBA 1USYH 2I3WA 4XKQA 4ELRA 4ONYA 3G3GA 1QVSA 5DT6A 1P1NA 1SW4A 2NXOA 1HSJA 3CRBA 3S2VA 4I8CA 3E3KA 1LB8A 3T66A 1BIYA 4IGTA 4YU0A 4GWOA 2CZLA 2VHAA 5EYFA 4XXUA 4KQPA 5FTIA 1MY4A 3TKDA 1MQGA 4GIZA 3K4UA 1D4NA 3KN3A 4QSCA 3RY3A 4AB5A 3N5LA 3HCQA 3O6HA 1B4ZA 3ZKKA 1B3HA 3ZS6A 2ABHA 1SI0A 3G7WA 3TELA 3L6HA 3LC8A 4JWYA 3GBBA 4R2BA 4LZ5A 1P99A 2OLBA 3FVNA 3PUZE 3VFJA 2XXYA 4GRKA 1TXFA 2I0BA 4OFJA 5CBRA 4GFRA 5HBCA 2QS3A 4M1VA 3B7DA 2V25A 4Q8RA 5HPQA 4R9FA 3G3KA 2F97A 1IXCA 1LCFA 1R9QA 4X9TA 3H6VA 3PD9A 1UIVA 4DCYA 2H25A 3A09A 5AA4A 5AE4A 2DE4A 1IUDA 2QS1A 1D3KA 4U4SA 3RTFB 3USDA 4HW8A 1B52A 3G3FA 1R6ZA 3ZSFA 3IK6B 1Y3PA 4G77A 2XHDA 4TLLB 4F19A 2A5SA 1B58A 1Y1MA 2ONRA 4XKPA 5L9MA 4QFNA 3GXAA 3IB1A 4R74A 1B1HA 4OESA 2AIXA 2REJA 4QRZA 3S4UA 1A55A 2VGQA 1B3EA 3DM0A 4O3CA 4BDOA 1EZOA 5I58B 2R9JA 2PBWA 4RNSA 1NNPA 3IO6A 5BUUA 1PBQA 3B6WA 5HM4B 2ZNTA 1SQYA 2UVJA 4GL8A 3CR9A 2OWSA 3PUVE 3QSLA 1PB7A 2GRVA 4Q5TA 4IY6A 3JV9A 5IKBA 2XXHA 3TTNA 1MPBA 4KR5A 2H4IA 3FVGA 3S9MC 2DWIA 5CMBA 1QUJA 3OSRA 1JW1A 3KEIA 2I3VA 1SYIA 3MBPA 2DXRA 2O68A 2QMXA 3PPPA 2YPNA 1AL3A 2OWTA 3OO8A 2HXWA 1I6AA 2ZNSA 1N3WA 1BLFA 2O1LA 3Q25A 4NE4A 1NFTA 4H8IA 4R75A 2Q8JA 5TU0A 5TP9A 2QPQA 1B6HA 1IXHA 3PUWE 1ZIUA 5I2KB 3T9HB 3MAMA 4I62A 3RLFE 3K6WA 4XIGQ 2ZMBA 1FQEA 3FZVA 1UTHA 3VXBA 4OEUA 3KN7A 5KCJB 1QKBA 3ILTB 2RF1A 3TTKA 1GGGA 4OZ9A
chains in the Genus database with same CATH superfamily
1LCTA 4PFBA 1MG1A 2FHYA 4THIA 4NAPA 4MBPA 3IB2A 5H8FA 1Q1KA 4IO5A 4NGUA 5EYHA 4MX6A 1MRPA 3OXNA 2GHAA 5IZ3B 1CNQA 5I57A 1FTJA 4OANA 4YAHX 3HFUA 1SD3A 2RKMA 1KZ8A 3OO6A 1DTZA 1NL5A 1POY1 3E4RA 3IAZA 3FUZA 1TFAA 3C36A 2P0SA 1JNFA 1UTBA 3CFLA 4H6DA 1KA1A 3ISPA 3CFXA 4DXBA 3H6TA 2DWHA 5AA2A 2D3IA 1P1UA 1UQWA 3CI8A 3MZBA 1OVTA 4FORA 4YKPA 1URDA 3MP1A 4QSDA 4H1XA 1NH8A 3M8UA 4N6KA 2DQVA 2HFBA 4X04A 3C31A 5EYGA 4Q0CA 5CMMA 5CRYA 2RC8A 4O7MA 1FQBA 4LATA 4ZEBA 5DEXB 4PFWA 2DXYA 2LAOA 1L5TA 4GWXA 2XXUA 3FJ7A 4X1DA 2HAUA 2ALUA 1II5A 4IO4A 4R6HA 1N7WA 1WDNA 1FCKA 4GVOA 3O6GA 2OBGA 4G8HA 2F6GA 5DVJA 2XXQA 1FSAA 5FHMA 1AH5A 3SETA 4RK9A 4ND9A 1N3XA 2P1SA 3OO7A 1NNFA 4QHQA 4YMAA 2MKZA 4DXCA 1XHYA 3D4GA 3UIFA 4FBPA 3U1OA 3TAJA 1FPJA 4RK2A 4F1UA 3IOUA 1M5EA 2FA7A 2O1MA 3HPIA 2QFLA 2I48A 3GYYA 1NNTA 1B5JA 5IZ3A 4JVCA 1LEVA 2ZYKA 3T22A 1F9BA 4YB6A 3S9LC 1YCJA 2RC7A 3WAFA 5A5XA 3CG3A 4P0IA 4PFIA 1DTGA 2PMSA 4MAGA 3DP4A 4ELQA 2VD2A 4NEDA 1LFIA 2A5TB 1PB9A 2B3BA 2V3TA 1LBVA 3T9VA 2Y84A 3VVFA 3MVYA 1I6QA 4RXLA 2B4MA 3BFTA 2ANJA 1INPA 1N04A 1US5A 3VE1B 4NF8A 4PBQA 3FASA 4KHZE 2X7QA 2QSXA 2ZYMA 3U72A 4F18A 5LDZA 3A3UA 1NV0A 4ZDMA 2DS9A 3H3GA 4QSEA 1FPDA 5H8QB 4H65A 2H99A 1H44A 3IOVA 1B9JA 2CMOA 4BDRA 1FTKA 1DOTA 2F3DA 1QUKA 1MXWA 1N0TA 1M5DA 3MPLA 4OERA 3P7IA 1N76A 1JW5A 1VSOA 4PFYA 4U1ZA 1S7YA 1YYZA 1YTVA 3IJOB 1UIUA 4GXSB 1JP4A 4N13A 5EQAA 1URSA 1TT1A 1MQJA 3K6UA 2JJKA 3KG2A 2ZXTA 1ZKBA 5DW8A 1B3FA 1CB6A 5JTYB 1DPEA 2F36A 1NNKA 1H43A 3TQLA 3C35A 4F3PA 1ZTYA 3OEMA 3IOTA 2ZYOA 3R6UA 3FVOA 3K2DA 1AWBA 1T0KA 1B3GA 2PCRA 4EUOA 3V5AA 4YKIA 5CC2A 1Y4TA 5I2KA 1Z7ME 3H4ZA 4NF5A 1SBPA 1D9VA 2UVHA 2P3VA 3FXRA 2O7IA 3TPAA 3TDJA 3PPRA 1Y3NA 3FXUA 3RN8A 3CG1A 4N8GA 3MP8A 3MW0A 1LB9A 3LSLA 5I59A 3MPKA 3TQWA 1XS5A 4F2QA 2RINA 1LFHA 3FV1A 4LUBA 1A8EA 4MCOA 3M3LA 5J1DA 3O66A 2F7CA 2Q89A 5F1QA 2F34A 4ESXA 4KI0E 2D21A 5EQ8A 4ZECA 4N07A 4U22A 1O63A 4G68A 2PFYA 3FXBA 4X1BA 3UP9A 2W7YA 2HAVA 4PDHA 3MVWA 3QYTA 4NG7A 3ROJA 3LSWA 4R73A 1RDXA 4MNCA 2NXOA 2P3NA 1LB8A 3T66A 1BIYA 4YU0A 4GWOA 2VHAA 3TKDA 3RY3A 3K4UA 1D4NA 3KN3A 2FVZA 3HCQA 3O6HA 1B4ZA 3LC8A 4JWYA 1P99A 3KBZA 1TXFA 4DCYA 1LCFA 3H6VA 2H25A 1NV6A 5AE4A 1IUDA 1DBZA 3ZSFA 4F19A 4TLLB 1B58A 3IB1A 4OESA 2AIXA 4QRZA 1B3EA 2PBWA 1MPBA 4KR5A 2H4IA 3OSRA 3KEIA 3MBPA 3OO8A 2HXWA 1I6AA 2ZNSA 3T9HB 1ZIUA 3LUZA 1YZ0A 3FZVA 4OEUA 3KN7A 1NUZA 5B70A 1GGGA 2XXKA 3GLBA 5TP9B 4ZS9A 2DWJA 1NKXA 4HXVA 3PPQA 4KD5A 3PUYE 2Y7IA 4RPNA 5I56A 5K2YA 5EHSA 1B5IA 4E0WA 1ZBMA 3TODA 1Y20A 1PEBA 2Z22A 4OFLA 1Q9DA 1FW0A 2Z8DA 5K2XA 5TPAA 3TCHA 2E1SA 3SESA 2QVVA 5AA1A 1OLAA 3CVGA 3TEPA 2DE3A 1BTJA 4DE8A 3QK6A 5T3JA 3EQ1A 4KYDA 2HQ0A 5CMCA 4Z0IA 1JW4A 3PMVA 5F7VA 5LOMA 3KOSA 2GH9A 2XD2A 4ESWA 4N91A 5DYHA 2XXWA 4P47A 4TOZA 2OWZA 3E79A 4G8MA 5FBPA 4OWDA 1LBZA 4FATA 3EN3A 1B7ZA 2I58A 3TCFA 2WBBA 1POTA 4H45A 3OENA 3IO4A 5IKBA 4H8JA 3IFCA 4BLAA 3ONMA 2V93A 4F3SA 3OO9A 2R71A 2NWJA 3FXQA 4RA1A 4GWWA 3FATA 1MH3A 4NN3A 3LUYA 3KOTA 4KYEA 4HS7A 2THIA 4OMBA 3R7XA 2REGA 1BKAA 2XD3A 1EZPA 2ONKE 3MZ1A 1KWHA 4ELOA 3N94A 4WEPA 3QIMA 4ZE8A 3WAEA 2ZYNA 1XVYA 4XKNA 2H98A 1JQFA 2UXAA 5ITPA 2F3BA 5AA4B 1NV5A 5H8HA 4BDQA 1A40A 3PD8A 4IR8A 4P11A 2F7AA 4X48A 2ESNA 4ZE9A 2DP8A 3EHUA 3N6UA 4F31B 4OVJA 3UGWA 4F3GA 5FHOA 1MS7A 4AS5A 1B2HA 2P2AA 2B65A 4NF4B 1I6BA 1BP5A 1NMUA 5JK4A 3VV5A 5DTBA 4WXJA 2OJTA 1LAHE 4R2FA 2NOOA 1ZMGA 1NV7A 5L8DA 1S50A 1JVYA 2F6PA 5M2VA 4RJZA 2UYFA 4NQ8A 2OZZA 3LSFB 2BJJX 3H6UA 3V89B 5JEIA 3KFMA 4L17A 4KYSA 2V4CA 2HXRA 4X8RA 3KJTA 3MC2A 3MZ9A 1B7HA 3H03A 2VD3A 1CE2A 4GQOA 3Q27A 4BDMA 4U4XA 3PV0E 5EQ7A 1Q35A 4DCXA 5LTCA 1QW0A 4N17A 4H0WA 4GWZA 1RYOA 5H8HB 1B51A 3OMBA 4ISUA 3AXFA 3V8XB 5AA2B 3FD3A 5ET6A 3VXCA 3S9EA 1MXZA 2H5YA 2PYYA 5IZZA 3EHSA 3H7MA 1D9YA 1EU8A 1HSLA 2F5XA 4GWSA 4EXLA 3JYRA 3FVKA 3IX1A 4QFKA 1LBCA 4MFIA 1A99A 1SDXA 1MXXA 3MVZA 2VP1A 3GBAA 3UA8A 3CFZA 1H3DA 4ZEIA 2Y7RA 5JTYA 4C1TA 4EQ7A 3H06B 3SKPA 1IMCA 4MLVA 4U23A 4EQ9A 2NUVA 3LR1A 1FPGA 4PTKA 3PU5A 4LONB 1EYJA 4OTEA 1WVJA 3K01A 1URGA 4GD5A 4PGPA 3W9VA 1FPLA 3JZJA 5ISUA 3IJXB 3TUSA 4G4PA 4KCDA 1P1WA 1OMPA 3G3JA 3D1RA 1FBEA 5ICTA 1OVBA 1MQDA 1QKAA 2XA5A 4PAKA 2XXIA 3T93B 5AA3A 4DLDA 2V84A 3G3IA 1VDWA 1H45A 2RCAA 1O7TA 1ELJA 3Q26A 1MXVA 2DWAA 1QJMA 4HCWA 4RPOA 4POWA 3I6VA 3PMWA 5I2NA 1I69A 3G3HA 4QFLA 3TZAA 2O7UA 1MY2A 1XOCA 3HHGA 1LGBC 3K1PA 4R6KA 1MDQA 1ZLQA 4XF5A 2QS4A 2B4LA 1VR5A 4IO6A 2QMWA 3MWBA 4XKQA 4ELRA 1SW4A 5FTIA 1IMDA 4QSCA 4GWYA 3MSTA 4XFEA 3G7WA 3TELA 4LZ5A 2XXYA 4OFJA 4GFRA 2QS3A 5HPQA 4R9FA 1R9QA 4X9TA 5AA4A 3RTFB 3G3FA 1DCUA 4G77A 2XHDA 2A5SA 1Y1MA 5L9MA 3GXAA 4R74A 3S4UA 2REJA 4P9KA 1DK4A 1EZOA 5J16A 1PBQA 2ZNTA 1GVCA 3CR9A 2OWSA 2GRVA 4IY6A 3TTNA 3S9MC 3FVGA 5CMBA 1JW1A 1SYIA 2DXRA 2QMXA 1AL3A 2R8TA 1N3WA 2O1LA 4H8IA 4R75A 2Q8JA 1B6HA 5I2KB 4I62A 2XWVA 4XIGQ 1FQEA 2CZIA 1QKBA 3TTKA 2XX7A 1DPPA 5CI5A 1AIVA 1B32A 3DP6A 3VVDA 1LLSA 2GFEA 3O6IA 3K0VA 5I2NB 1H76A 4H5FA 2ZZVA 5TPAB 4OVSA 2WBDA 3LV0A 4EDPA 1Z7NE 4LZ7A 2V3UA 4JSOA 2QRYA 3T0JA 3O9PA 4BDLA 4GX4A 3KBRA 3UN6A 5I56B 3LSXA 4R9GA 4GBVA 2PT1A 2YJPA 4DI3D 1B7UA 1IIWA 4JBZA 2HZKA 3MUQA 4OVQA 4E0XA 1GV8A 2I4BA 2Y5KA 1YXIA 1B05A 3RPLA 1JEUA 3DP8A 1MY0A 1P1OA 1SW2A 4KPTA 1FTOA 1Y1ZA 1K9YA 1M5CA 1SW5A 4RYAA 1IMEA 4PF6A 4GF8A 1EZ9A 4RY1A 2PT2A 3KZGA 2PX1A 2XX8A 1AMFA 5H8QA 4MJOA 5FTHA 2RC9A 4DIGA 4I3EA 3FIRA 4IY5A 4OQOA 2FIEA 5I7IA 1SVXB 5I57B 3BFUA 1FQAA 4GL0A 4IB2A 3IB0A 1MY1A 1RDYA 4PP0A 4QBAA 1MY3A 3B8BA 3PGFA 4G8NA 4JVDA 3EPEA 4QFPA 4KFQA 3RQTA 4LP2B 4Z7EA 2HHMA 4PBHA 4O94A 4LVQA 4G68B 3HO7A 4EXKA 3FJGA 3OEKA 4TLMB 3RPLB 1JVXA 2XXXA 3KC0A 1YAEA 2Q74A 1LBYA 3THIA 3W15C 1R9LA 4UACA 2FIXA 4N6DA 2F78A 4F3BA 2Q9TA 1MPCA 5FHNA 4G2ZA 1QULA 5I3SA 5CM6A 1NH7A 1LBWA 1NI9A 4DDDA 1IEJA 1MM7A 1FBFA 4OEVA 2Y7PA 1IMAA 3U93A 3KSJA 3BKIB 3CIJA 2XXRA 1A7LA 4ELPA 1MXYA 3FGSA 3A29A 5KZTA 2ZNUA 3MQ9A 3E78A 3I3VA 3L6GA 4MNIA 5H8SA 4U2RA 3B6TA 1BK4A 4MIJA 3C34A 2E0SA 4GXAA 3I5OA 2DYXA 1MDP1 4HTGA 3S9NC 4UABA 3QAXA 4F2OA 1RDZA 2I6EA 4ZZEA 4NF5B 4NF6A 3IL1B 3ODBA 3Q28A 4JB7A 2G29A 4R6YA 1XC1A 4PGNA 2AL4A 1USYE 1FBCA 3C32A 4PC9A 3F11A 4PE3A 2ZZXA 1WODA 2I4CA 1B0HA 4GBWA 3RNNA 1FPEA 1FPFA 2Y7WA 4YICA 4LZ8A 2QVRA 3N6TA 2IA4A 3SDFA 2VT5A 4GX3A 4ZEFA 4DI4B 1PBPA 3HHFA 4HE1A 2L5VA 3QUJA 4JDFA 4DZ1A 3TYHA 4DXUA 4GWUA 1LFGA 1EH3A 3E9XA 1OLCA 2I0CA 1Y9UA 3TCGA 5ET8A 4XKRA 3RGYA 4F1YA 1XT8A 2QS2A 4FE8A 5DVIA 4U1OA 4MF3A 1M5BA 5H8FB 4PETA 1LBXA 3OOAA 5ELVA 3VLUA 5ESYA 4F22A 4F29A 1PC3A 1RKMA 4PFRA 2A5TA 3PPNA 2R6GE 3GZGA 3ILUB 1GR2A 1LBBA 4P8BA 4YB5A 1SW1A 3O29A 2G93A 3IOWA 3MVXA 4UA8A 3U92A 4PFUA 1OIBA 2O69A 4LQ5A 3O28A 3VLVA 1TWYA 4GOTA 1B1XA 1DSNA 1UTHB 2F7BA 4O3BA 3R26A 3SEUA 1MQIA 4K3FA 3DLNA 1PB8A 3HN0A 2ZZWA 1NV1A 1MXUA 2Q2CA 1SI1A 4AB6A 1IMFA 3T9XB 4NF6B 3SEWA 1IQ7A 1US4A 1LSTA 3PUXE 3T9UA 2DVZA 4MNPA 3MJNA 1N84A 3PTYA 4FIMA 4F39A 3M3FA 2PFZA 4H46A 4OYVA 1A8FA 2DVCA 4QFOA 4U21A 3KN8A 1MM6A 4NF4A 2Z23A 1DMBA 3U94A 5F24A 2IEEA 5H8NA 1ZJLA 1G0IA 3CSBA 2I3WA 4ONYA 3CRBA 3S2VA 1FPIA 3E3KA 4IGTA 2CZLA 5EYFA 4KQPA 2XWOA 4GIZA 4XEQA 4KXPA 3U65A 3ZS6A 3L6HA 4PF8A 3GBBA 4R2BA 3SZPA 2I0BA 5CBRA 3B7DA 3G3KA 1IXCA 3A09A 5IGAA 1D3KA 3IK6B 4NX1A 4XKPA 4QXDA 1B1HA 1A55A 2VGQA 4O3CA 5I58B 1NNPA 3IO6A 3B6WA 1D9QA 1SQYA 2UVJA 2CZHA 3PUVE 3NOHA 3QSLA 1NV3A 2DWIA 2I3VA 3EKIA 1EYKA 2O68A 2YPNA 2OWTA 3Q25A 4NE4A 4O8MA 1NFTA 3RLFE 3K6WA 2ZMBA 1UTHA 3MYUA 5ET7A 3RT6B 1QUIA 4AS4A 1B5HA 3FJMA 4XTCQ 3K02A 3K6XA 1ANFA 2ONSA 1IITA 4TQUQ 5IM2A 3KGCA 1B4HA 1B0LA 3M3KA 2F35A 3MP6A 5H8NB 4JXIA 2Q8MA 3QXMA 3H6WA 4NF8B 3TFLA 4MMPA 2WYKA 3OELA 1RYXA 1P1QA 4HE0A 3QUFA 2WX9A 4ZEDA 4PE5B 1NUXA 3C4MA 2QL3A 1TFDA 3K00A 4I1DA 4PQJA 3BBRA 4YB7A 4N8YA 4R72A 4LA9A 2NVUB 1K9ZA 2GHBA 4ZEKA 2OCUA 3SERA 4ECFA 4P3LA 2AL5A 3BIGA 1JETA 2VPNA 2Z8FA 1MQHA 4EF2A 2UYEA 2QJEA 3V83A 4O7IA 4OVRA 1OQGA 2DSFA 3BIHA 3CSGA 5I58A 2V3QA 3T1BA 5IAIA 2HCAA 1LAXA 2XXPA 5L9OA 4IO7A 3KC1A 2DOJA 4G61A 2F8DA 5A5LA 1YPNA 1JEVA 1R1NA 4NF0A 1MH4A 3PPOA 3RT8A 1FQFA 1FRPA 2B3FA 2VOZA 5EQ9A 1J1NA 1HSEA 3U8QA 2XX9A 5I5PA 4BDNA 5I84A 1VE4A 1QGXA 5KDTB 5I59B 2O84X 1FTMA 4FEDA 4MLQA 3SEVA 3ZKLA 3K6VA 2X26A 3HSTA 4O3AA 4YMBA 2HEUA 2PVUA 3FBPA 4N81A 4P1EA 2H9BA 2I49A 1IMBA 2UVIA 1NV2A 3UK4A 1Y4CA 4POXA 5AA2D 4H67A 2HPGA 1B46A 1AOVA 3TTLA 2QVUA 3KJ7A 3UORA 3VDFA 3EF7A 3B50A 1FQCA 4P1LA 1VFEA 3O97A 1M5FA 1N7XA 2DDKA 2VPOA 4I9DA 4JWXA 3O2AA 4M4GA 2FYIA 2DE2A 2Y5LA 2OK2A 2WKYA 2OX3A 4IO3A 2KR0A 3K1NA 5IZ1A 3SEYA 1FJ9A 2Z8EA 3W9WA 1G0HA 1FBDA 4LQ2A 2XWIA 3EHTA 4GX6A 5L9SA 3B6QA 4I3YA 5KDTA 4LN5A 2M8CA 1SYHA 4FAJA 4YKKA 2XXVA 2Q2AA 4NMYA 5ET5A 1OQHA 3TMGA 2Y7KA 2FBPA 1KA0A 5DEXA 4YKJA 1A54A 1VFDA 4FJPA 4G68C 2O51A 2CEYA 2UVGA 4YZZA 3VLWA 3TTMA 1NUWA 4OETA 3DELB 3KSXA 4AQ4A 4OVTA 4GLIA 4I40A 3PMXA 3TTRA 2XWKA 3FV2A 5B7DA 5DVFA 3C33A 1FPKA 1FPBA 1UTBB 4C0RA 5CMKA 4F1VA 4PAIA 2D5WA 4P56A 3D4CA 1FBHA 2KQZA 4IO2A 3LBSA 4PAFA 1XVXA 2FNCA 2XXTA 4WEDA 5EHMA 4PDDA 3Q29A 4NWCA 1MPDA 3IR1A 4ZZAA 4QF9A 5ITOA 1IXIA 1FTLA 4WKMA 3VVEA 3N26A 1EYIA 3K1MA 3OD7A 1B3LA 1FQDA 2AYSA 5CBSA 4JSDA 3HV1A 3SEXA 4OVPA 2RCBA 4FECA 2CEXA 4EF1A 2O6AA 4C1UA 1PDAA 4P0GA 1LAFE 2GQ1A 4MH5A 4PFTA 4EQBA 5ICQA 4OFOA 3T96B 2WEFA 3OSQA 5KCJA 1FBPA 1B40A 4NWDA 3A3CA 1S9TA 2HZLA 3C9HA 4OXVA 2BJIA 3E13X 3ECRA 4NTLA 4HCYA 3QMFA 5A5XB 1NV4A 4KCCA 2KLFA 4PCDA 4Q30B 4N6PA 3RUMA 5BWJA 1GTKA 4N4UA 2X7PA 1FTAA 3RTWB 1ZU0A 4IGRA 1LAGE 4JWOA 1O64A 3IORA 1ATGA 4OHNA 1IZ1A 2Q88A 4OENA 3RPWA 1IXGA 4H5GA 1SPIA 1Y3QA 2YLNA 4FEBA 4MHFA 3IFAA 1USYH 3G3GA 4JVIA 1QVSA 5DT6A 1P1NA 1HSJA 4I8CA 4XXUA 1MY4A 1MQGA 4AB5A 3N5LA 3ZKKA 1B3HA 2ABHA 1SI0A 4OA4A 4N15A 2OLBA 3FVNA 3PUZE 3VFJA 2WYPA 4GRKA 5HBCA 4M1VA 2V25A 4Q8RA 2F97A 3PD9A 1UIVA 2DE4A 2QS1A 3USDA 4U4SA 4HW8A 1B52A 1R6ZA 1Y3PA 2ONRA 4QFNA 1FJ6A 3DM0A 4BDOA 2R9JA 4RNSA 5BUUA 5HM4B 2CZKA 4GL8A 4Q5TA 3RYDA 1PB7A 3JV9A 1FBGA 2XXHA 1QUJA 4HE2A 3PPPA 1NUYA 1BLFA 3CHGA 4NHBA 1XI6A 5TP9A 5TU0A 2QPQA 1IXHA 3PUWE 3MAMA 3VXBA 4MEVA 5KCJB 3ILTB 2RF1A 4OZ9A
chains in the Genus database with same CATH topology
1LCTA 1MG1A 2XX7A 1DPPA 3GLBA 5TP9B 4ZS9A 5CI5A 2DWJA 4THIA 3RT6B 1NKXA 1QUIA 1AIVA 1B32A 3DP6A 4MBPA 3VVDA 1LLSA 2GFEA 3IB2A 3K0VA 1Q1KA 3O6IA 3PPQA 4IO5A 5H8FA 5I2NB 1H76A 4KD5A 1B5HA 3PUYE 1MRPA 3FJMA 3OXNA 4H5FA 4XTCQ 3K02A 2GHAA 3K6XA 1ANFA 2Y7IA 1FTJA 1IITA 2ONSA 4RPNA 4TQUQ 4YAHX 1SD3A 2RKMA 1B5IA 5EHSA 5K2YA 4E0WA 1ZBMA 3OO6A 1DTZA 3TODA 4EDPA 1Z7NE 4LZ7A 3KGCA 1Y20A 1B4HA 1B0LA 1PEBA 2Z22A 2V3UA 4JSOA 1NL5A 3M3KA 4OFLA 2F35A 2QRYA 3MP6A 3O9PA 4BDLA 1POY1 1FW0A 3KBRA 3E4RA 5H8NB 3UN6A 2Z8DA 4JXIA 3IAZA 5K2XA 5TPAA 3TCHA 5I56B 3LSXA 4R9GA 2E1SA 3FUZA 3QXMA 1TFAA 3SESA 3H6WA 4NF8B 3TFLA 3C36A 2P0SA 2PT1A 1JNFA 2YJPA 5AA1A 1OLAA 1B7UA 1IIWA 3CVGA 1UTBA 2HZKA 3CFLA 3MUQA 4H6DA 2DE3A 4JBZA 3CFXA 3OELA 3TEPA 1RYXA 4DXBA 3H6TA 2DWHA 1P1QA 1BTJA 5AA2A 2D3IA 4DE8A 1P1UA 1UQWA 3QK6A 3QUFA 4E0XA 3EQ1A 1GV8A 4KYDA 2I4BA 4ZEDA 2HQ0A 3CI8A 5CMCA 4Z0IA 1B05A 4PE5B 3C4MA 2QL3A 1TFDA 3K00A 3MZBA 1OVTA 4FORA 1JEUA 4I1DA 3DP8A 3BBRA 1JW4A 3PMVA 1URDA 4PQJA 4YB7A 4R72A 4YKPA 1MY0A 1P1OA 1SW2A 3MP1A 4KPTA 1FTOA 1Y1ZA 4H1XA 4LA9A 4QSDA 5F7VA 3KOSA 2NVUB 2GH9A 5LOMA 1NH8A 2XD2A 4ESWA 2GHBA 5DYHA 2XXWA 1M5CA 3M8UA 4ZEKA 2DQVA 2HFBA 2OCUA 1SW5A 4TOZA 4RYAA 4G8MA 3SERA 3C31A 4GF8A 4OWDA 4ECFA 2AL5A 4Q0CA 1EZ9A 5I57A 5CMMA 5CRYA 1JETA 2RC8A 3EN3A 4FATA 1B7ZA 1FQBA 2Z8FA 4RY1A 2PT2A 2I58A 4LATA 3TCFA 4ZEBA 1POTA 3KZGA 1MQHA 5DEXB 2PX1A 4PFWA 4EF2A 2DXYA 2XX8A 1AMFA 2UYEA 5H8QA 2LAOA 2QJEA 1L5TA 3V83A 1OQGA 3OENA 3IO4A 2DSFA 2XXUA 3FJ7A 4X1DA 3CSGA 4H8JA 2HAUA 2ALUA 2V3QA 5FTHA 2RC9A 4BLAA 5B70A 3ONMA 5I58A 5IAIA 1II5A 2V93A 4DIGA 2HCAA 4IO4A 1LAXA 4R6HA 2XXPA 4F3SA 3OO9A 2R71A 2NWJA 1N7WA 5L9OA 4IO7A 3FIRA 3FXQA 4IY5A 1WDNA 4OQOA 1FCKA 4RA1A 2DOJA 2F8DA 3FATA 1MH3A 1SVXB 5I57B 3BFUA 4GVOA 1YPNA 1FQAA 3O6GA 1JEVA 2OBGA 3LUYA 4G8HA 4GL0A 2F6GA 5DVJA 3KOTA 4IB2A 2XXQA 1R1NA 5FHMA 1AH5A 3SETA 1MH4A 3PPOA 4KYEA 4HS7A 4RK9A 4ND9A 3RT8A 3IB0A 2THIA 1N3XA 1MY1A 2P1SA 1FQFA 3OO7A 4OMBA 2B3FA 1NNFA 2REGA 1J1NA 2VOZA 4QHQA 3R7XA 4DXCA 1BKAA 4YMAA 2XD3A 1XHYA 3D4GA 4PP0A 1EZPA 1MY3A 2ONKE 3MZ1A 3UIFA 3U1OA 1KWHA 3PGFA 4G8NA 4ELOA 3N94A 3TAJA 1HSEA 4WEPA 3EPEA 4QFPA 4RK2A 4KFQA 3U8QA 3QIMA 2XX9A 3RQTA 3IOUA 4LP2B 4F1UA 1M5EA 4Z7EA 4LVQA 4ZE8A 3WAEA 2ZYNA 2FA7A 4BDNA 1XVYA 2O1MA 4G68B 4XKNA 5I84A 1VE4A 1JQFA 2H98A 2UXAA 3HO7A 4EXKA 5ITPA 3HPIA 5KDTB 3FJGA 3OEKA 4TLMB 2I48A 2O84X 1FTMA 5I59B 1JVXA 1NNTA 2XXXA 4FEDA 5AA4B 5H8HA 4BDQA 4MLQA 3SEVA 1YAEA 1B5JA 3ZKLA 1A40A 3PD8A 3THIA 4P11A 1R9LA 3K6VA 2F7AA 2ZYKA 3T22A 1F9BA 3W15C 2X26A 3HSTA 4YB6A 3S9LC 4O3AA 4YMBA 1YCJA 2HEUA 4UACA 2ESNA 2RC7A 4X48A 2PVUA 3WAFA 4ZE9A 5A5XA 2F78A 2H9BA 2DP8A 3EHUA 3N6UA 4F3BA 4F31B 2Q9TA 4OVJA 2I49A 1MPCA 3CG3A 5FHNA 4G2ZA 3UGWA 4F3GA 1QULA 2UVIA 5FHOA 1MS7A 4P0IA 1DTGA 1B2HA 5CM6A 1NH7A 2P2AA 2PMSA 4DDDA 3UK4A 2B65A 4NF4B 3DP4A 1Y4CA 4POXA 4ELQA 5AA2D 1I6BA 1IEJA 1LFIA 2VD2A 4NEDA 1MM7A 1BP5A 4H67A 1NMUA 2A5TB 5JK4A 1B46A 1AOVA 4OEVA 3VV5A 2Y7PA 3TTLA 1PB9A 2B3BA 3KJ7A 3UORA 3U93A 3KSJA 5DTBA 3BKIB 2OJTA 3EF7A 2V3TA 4WXJA 3CIJA 3VDFA 2XXRA 3T9VA 1A7LA 4ELPA 1FQCA 1LAHE 2Y84A 2NOOA 1MXYA 4R2FA 1ZMGA 1VFEA 5BWJA 3FGSA 5L8DA 1S50A 1JVYA 3O97A 4F3PA 1M5FA 3MVYA 1I6QA 2F6PA 1N7XA 4RJZA 3BFTA 2UYFA 4RXLA 5M2VA 2ANJA 2OZZA 5KZTA 2ZNUA 4I9DA 3LSFB 4JWXA 1N04A 3MQ9A 3O2AA 1US5A 4M4GA 3VE1B 2FYIA 2BJJX 4NF8A 3FASA 3H6UA 4KHZE 3V89B 2DE2A 2X7QA 5JEIA 3I3VA 3L6GA 2QSXA 2OK2A 3KFMA 2WKYA 2ZYMA 4L17A 3U72A 4IO3A 4F18A 4KYSA 3A3UA 5H8SA 4U2RA 3B6TA 3K1NA 3SEYA 4ZDMA 5I56A 2DS9A 3H3GA 3KJTA 3C34A 4QSEA 3MC2A 2E0SA 2Z8EA 4GXAA 3I5OA 3MZ9A 3W9WA 2DYXA 1B7HA 1MDP1 4HTGA 3H03A 3S9NC 5H8QB 2VD3A 1CE2A 3QAXA 4F2OA 4GQOA 4H65A 3Q27A 4LQ2A 2H99A 1H44A 3IOVA 1B9JA 2I6EA 3EHTA 5L9SA 4ZZEA 2CMOA 4NF5B 4NF6A 4BDRA 3B6QA 3IL1B 4BDMA 4U4XA 3ODBA 1FTKA 1DOTA 3PV0E 1Q35A 1GVCA 4DCXA 3Q28A 2M8CA 5KDTA 1QW0A 3VVFA 4JB7A 1SYHA 4H0WA 1QUKA 2G29A 4R6YA 4FAJA 4YKKA 2XXVA 2Q2AA 4NMYA 1OQHA 1RYOA 5H8HB 1XC1A 1B51A 3TMGA 1MXWA 2AL4A 1N0TA 2Y7KA 1USYE 3OMBA 4ISUA 3AXFA 3C32A 1M5DA 3V8XB 5AA2B 3MPLA 5DEXA 4OERA 3F11A 3FD3A 3VXCA 3S9EA 3P7IA 1MXZA 4YKJA 1N76A 2H5YA 1A54A 1JW5A 3OD7A 1VFDA 4FJPA 4G68C 1WODA 1VSOA 2I4CA 4PFYA 2O51A 1S7YA 4U1ZA 1B0HA 2PYYA 3RNNA 1YTVA 2Y7WA 3EHSA 3H7MA 2UVGA 4LZ8A 4YICA 3IJOB 3N6TA 4YZZA 3VLWA 2IA4A 1UIUA 1D9YA 3SDFA 1EU8A 3TTMA 1HSLA 4GXSB 2F5XA 4ZEFA 4N13A 1URSA 4OETA 1TT1A 3DELB 1MQJA 3K6UA 1PBPA 3KSXA 4EXLA 3HHFA 3JYRA 4AQ4A 3QUJA 3KG2A 4GLIA 4JDFA 2ZXTA 3FVKA 1ZKBA 4DZ1A 3TYHA 3IX1A 4DXUA 1B3FA 1LFGA 1EH3A 1LBCA 3E9XA 1A99A 3PMXA 4MFIA 4QFKA 1OLCA 2I0CA 1Y9UA 3TTRA 3TCGA 3FV2A 1CB6A 5B7DA 4XKRA 5JTYB 3RGYA 4F1YA 1DPEA 3C33A 1SDXA 1XT8A 1UTBB 2F36A 1NNKA 1H43A 2QS2A 5DVFA 4C0RA 5CMKA 4FE8A 5DVIA 4U1OA 3TQLA 1MXXA 3MVZA 3C35A 4MF3A 1M5BA 2VP1A 1ZTYA 3OEMA 4F1VA 3GBAA 3IOTA 2ZYOA 5H8FB 3UA8A 2D5WA 3R6UA 4PETA 3FVOA 3D4CA 3CFZA 1H3DA 4ZEIA 4IO2A 2Y7RA 3LBSA 3K2DA 5JTYA 4C1TA 1T0KA 4WEDA 1XVXA 2FNCA 2XXTA 3H06B 3SKPA 4EQ7A 3OOAA 5EHMA 3Q29A 1B3GA 4MLVA 4NWCA 5ELVA 1MPDA 3IR1A 4U23A 4ZZAA 2NUVA 4QF9A 5ITOA 3VLUA 3LR1A 3V5AA 4YKIA 4EUOA 4F29A 4F22A 5CC2A 1PC3A 1Y4TA 1RKMA 1IXIA 3PU5A 5I2KA 5CBSA 1FTLA 4WKMA 3VVEA 2A5TA 3N26A 3PPNA 1Z7ME 4LONB 3H4ZA 4NF5A 1SBPA 3K1MA 1D9VA 1FQDA 1B3LA 2AYSA 2R6GE 2UVHA 3FXRA 1WVJA 1GR2A 2O7IA 3GZGA 3ILUB 3K01A 1URGA 4GD5A 4JSDA 3W9VA 3TPAA 3HV1A 3SEXA 3PPRA 3TDJA 1LBBA 2RCBA 3JZJA 4FECA 1Y3NA 4EF1A 4YB5A 1SW1A 3FXUA 3RN8A 3O29A 2G93A 3IJXB 2O6AA 3CG1A 3TUSA 5ISUA 4C1UA 1PDAA 3IOWA 4G4PA 4KCDA 1P1WA 1OMPA 1LAFE 3MVXA 4P0GA 4UA8A 3G3JA 4MH5A 3U92A 4PFTA 4PFUA 4EQBA 1OVBA 3MP8A 1MQDA 5ICQA 5ICTA 4OFOA 1OIBA 1QKAA 3MW0A 4EQ9A 2O69A 4LQ5A 4OTEA 1LB9A 2XXIA 3T96B 3LSLA 3O28A 3MPKA 3OSQA 3TQWA 3VLVA 5I59A 5KCJA 1XS5A 4F2QA 3T93B 2RINA 5AA3A 1B40A 4NWDA 1TWYA 3FV1A 4LUBA 1LFHA 3A3CA 5TPAB 4GOTA 4DLDA 1S9TA 2V84A 2HZLA 1A8EA 3G3IA 1B1XA 3C9HA 4OXVA 1DSNA 3M3LA 1UTHB 2F7BA 4O3BA 3R26A 3SEUA 1H45A 2RCAA 5J1DA 1MQIA 4K3FA 3O66A 3E13X 1O7TA 2F7CA 1ELJA 2Q89A 1PB8A 3DLNA 3ECRA 2F34A 3HN0A 3Q26A 4HCYA 4NTLA 5F1QA 1MXUA 2Q2CA 5A5XB 4ESXA 4KI0E 4KCCA 1SI1A 1MXVA 2KLFA 4AB6A 3T9XB 4NF6B 2DWAA 4N6PA 4Q30B 3RUMA 1QJMA 3SEWA 1IQ7A 1US4A 4HCWA 1GTKA 1LSTA 3PUXE 3I6VA 4POWA 2DVZA 4RPOA 3T9UA 2D21A 3PMWA 4ZECA 5I2NA 3MJNA 1I69A 1N84A 4N07A 2X7PA 4FIMA 3G3HA 4QFLA 3TZAA 4F39A 3M3FA 3RTWB 2O7UA 4U22A 1O63A 1ZU0A 4G68A 4X1BA 4OYVA 1MY2A 3UP9A 4IGRA 1XOCA 1A8FA 1LAGE 2DVCA 4QFOA 4JWOA 4U21A 1O64A 2W7YA 3HHGA 2HAVA 3IORA 3KN8A 1ATGA 1LGBC 1MM6A 4NF4A 4OHNA 2Z23A 3MVWA 3K1PA 4R6KA 3QYTA 1DMBA 1MDQA 1IZ1A 3U94A 2Q88A 4OENA 2IEEA 1ZLQA 5H8NA 1IXGA 4H5GA 2QS4A 3LSWA 3RPWA 1VR5A 1Y3QA 4IO6A 4R73A 1ZJLA 2YLNA 2QMWA 4FEBA 3MWBA 3CSBA 1USYH 2I3WA 4XKQA 4ELRA 4ONYA 3G3GA 1QVSA 5DT6A 1P1NA 1SW4A 2NXOA 1HSJA 3CRBA 3S2VA 4I8CA 3E3KA 1LB8A 3T66A 1BIYA 4IGTA 4YU0A 4GWOA 2CZLA 2VHAA 5EYFA 4XXUA 4KQPA 5FTIA 1MY4A 3TKDA 1MQGA 4GIZA 3K4UA 1D4NA 3KN3A 4QSCA 3RY3A 4AB5A 3N5LA 3HCQA 3O6HA 1B4ZA 3ZKKA 1B3HA 3ZS6A 2ABHA 1SI0A 3G7WA 3TELA 3L6HA 3LC8A 4JWYA 3GBBA 4R2BA 4LZ5A 1P99A 2OLBA 3FVNA 3PUZE 3VFJA 2XXYA 4GRKA 1TXFA 2I0BA 4OFJA 5CBRA 4GFRA 5HBCA 2QS3A 4M1VA 3B7DA 2V25A 4Q8RA 5HPQA 4R9FA 3G3KA 2F97A 1IXCA 1LCFA 1R9QA 4X9TA 3H6VA 3PD9A 1UIVA 4DCYA 2H25A 3A09A 5AA4A 5AE4A 2DE4A 1IUDA 2QS1A 1D3KA 4U4SA 3RTFB 3USDA 4HW8A 1B52A 3G3FA 1R6ZA 3ZSFA 3IK6B 1Y3PA 4G77A 2XHDA 4TLLB 4F19A 2A5SA 1B58A 1Y1MA 2ONRA 4XKPA 5L9MA 4QFNA 3GXAA 3IB1A 4R74A 1B1HA 4OESA 2AIXA 2REJA 4QRZA 3S4UA 1A55A 2VGQA 1B3EA 3DM0A 4O3CA 4BDOA 1EZOA 5I58B 2R9JA 2PBWA 4RNSA 1NNPA 3IO6A 5BUUA 1PBQA 3B6WA 5HM4B 2ZNTA 1SQYA 2UVJA 4GL8A 3CR9A 2OWSA 3PUVE 3QSLA 1PB7A 2GRVA 4Q5TA 4IY6A 3JV9A 5IKBA 2XXHA 3TTNA 1MPBA 4KR5A 2H4IA 3FVGA 3S9MC 2DWIA 5CMBA 1QUJA 3OSRA 1JW1A 3KEIA 2I3VA 1SYIA 3MBPA 2DXRA 2O68A 2QMXA 3PPPA 2YPNA 1AL3A 2OWTA 3OO8A 2HXWA 1I6AA 2ZNSA 1N3WA 1BLFA 2O1LA 3Q25A 4NE4A 1NFTA 4H8IA 4R75A 2Q8JA 5TU0A 5TP9A 2QPQA 1B6HA 1IXHA 3PUWE 1ZIUA 5I2KB 3T9HB 3MAMA 4I62A 3RLFE 3K6WA 4XIGQ 2ZMBA 1FQEA 3FZVA 1UTHA 3VXBA 4OEUA 3KN7A 5KCJB 1QKBA 3ILTB 2RF1A 3TTKA 1GGGA 4OZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCT A;  1MG1 A;  2XX7 A;  1DPP A;  3GLB A;  5TP9 B;  4ZS9 A;  5CI5 A;  2DWJ A;  4THI A;  3RT6 B;  1NKX A;  1QUI A;  1AIV A;  1B32 A;  3DP6 A;  4MBP A;  3VVD A;  1LLS A;  2GFE A;  3IB2 A;  3K0V A;  1Q1K A;  3O6I A;  3PPQ A;  4IO5 A;  5H8F A;  5I2N B;  1H76 A;  4KD5 A;  1B5H A;  3PUY E;  1MRP A;  3FJM A;  3OXN A;  4H5F A;  4XTC Q;  3K02 A;  2GHA A;  3K6X A;  1ANF A;  2Y7I A;  1FTJ A;  1IIT A;  2ONS A;  4RPN A;  4TQU Q;  4YAH X;  1SD3 A;  2RKM A;  1B5I A;  5EHS A;  5K2Y A;  4E0W A;  1ZBM A;  3OO6 A;  1DTZ A;  3TOD A;  4EDP A;  1Z7N E;  4LZ7 A;  3KGC A;  1Y20 A;  1B4H A;  1B0L A;  1PEB A;  2Z22 A;  2V3U A;  4JSO A;  1NL5 A;  3M3K A;  4OFL A;  2F35 A;  2QRY A;  3MP6 A;  3O9P A;  4BDL A;  1POY 1;  1FW0 A;  3KBR A;  3E4R A;  5H8N B;  3UN6 A;  2Z8D A;  4JXI A;  3IAZ A;  5K2X A;  5TPA A;  3TCH A;  5I56 B;  3LSX A;  4R9G A;  2E1S A;  3FUZ A;  3QXM A;  1TFA A;  3SES A;  3H6W A;  4NF8 B;  3TFL A;  3C36 A;  2P0S A;  2PT1 A;  1JNF A;  2YJP A;  5AA1 A;  1OLA A;  1B7U A;  1IIW A;  3CVG A;  1UTB A;  2HZK A;  3CFL A;  3MUQ A;  4H6D A;  2DE3 A;  4JBZ A;  3CFX A;  3OEL A;  3TEP A;  1RYX A;  4DXB A;  3H6T A;  2DWH A;  1P1Q A;  1BTJ A;  5AA2 A;  2D3I A;  4DE8 A;  1P1U A;  1UQW A;  3QK6 A;  3QUF A;  4E0X A;  3EQ1 A;  1GV8 A;  4KYD A;  2I4B A;  4ZED A;  2HQ0 A;  3CI8 A;  5CMC A;  4Z0I A;  1B05 A;  4PE5 B;  3C4M A;  2QL3 A;  1TFD A;  3K00 A;  3MZB A;  1OVT A;  4FOR A;  1JEU A;  4I1D A;  3DP8 A;  3BBR A;  1JW4 A;  3PMV A;  1URD A;  4PQJ A;  4YB7 A;  4R72 A;  4YKP A;  1MY0 A;  1P1O A;  1SW2 A;  3MP1 A;  4KPT A;  1FTO A;  1Y1Z A;  4H1X A;  4LA9 A;  4QSD A;  5F7V A;  3KOS A;  2NVU B;  2GH9 A;  5LOM A;  1NH8 A;  2XD2 A;  4ESW A;  2GHB A;  5DYH A;  2XXW A;  1M5C A;  3M8U A;  4ZEK A;  2DQV A;  2HFB A;  2OCU A;  1SW5 A;  4TOZ A;  4RYA A;  4G8M A;  3SER A;  3C31 A;  4GF8 A;  4OWD A;  4ECF A;  2AL5 A;  4Q0C A;  1EZ9 A;  5I57 A;  5CMM A;  5CRY A;  1JET A;  2RC8 A;  3EN3 A;  4FAT A;  1B7Z A;  1FQB A;  2Z8F A;  4RY1 A;  2PT2 A;  2I58 A;  4LAT A;  3TCF A;  4ZEB A;  1POT A;  3KZG A;  1MQH A;  5DEX B;  2PX1 A;  4PFW A;  4EF2 A;  2DXY A;  2XX8 A;  1AMF A;  2UYE A;  5H8Q A;  2LAO A;  2QJE A;  1L5T A;  3V83 A;  1OQG A;  3OEN A;  3IO4 A;  2DSF A;  2XXU A;  3FJ7 A;  4X1D A;  3CSG A;  4H8J A;  2HAU A;  2ALU A;  2V3Q A;  5FTH A;  2RC9 A;  4BLA A;  5B70 A;  3ONM A;  5I58 A;  5IAI A;  1II5 A;  2V93 A;  4DIG A;  2HCA A;  4IO4 A;  1LAX A;  4R6H A;  2XXP A;  4F3S A;  3OO9 A;  2R71 A;  2NWJ A;  1N7W A;  5L9O A;  4IO7 A;  3FIR A;  3FXQ A;  4IY5 A;  1WDN A;  4OQO A;  1FCK A;  4RA1 A;  2DOJ A;  2F8D A;  3FAT A;  1MH3 A;  1SVX B;  5I57 B;  3BFU A;  4GVO A;  1YPN A;  1FQA A;  3O6G A;  1JEV A;  2OBG A;  3LUY A;  4G8H A;  4GL0 A;  2F6G A;  5DVJ A;  3KOT A;  4IB2 A;  2XXQ A;  1R1N A;  5FHM A;  1AH5 A;  3SET A;  1MH4 A;  3PPO A;  4KYE A;  4HS7 A;  4RK9 A;  4ND9 A;  3RT8 A;  3IB0 A;  2THI A;  1N3X A;  1MY1 A;  2P1S A;  1FQF A;  3OO7 A;  4OMB A;  2B3F A;  1NNF A;  2REG A;  1J1N A;  2VOZ A;  4QHQ A;  3R7X A;  4DXC A;  1BKA A;  4YMA A;  2XD3 A;  1XHY A;  3D4G A;  4PP0 A;  1EZP A;  1MY3 A;  2ONK E;  3MZ1 A;  3UIF A;  3U1O A;  1KWH A;  3PGF A;  4G8N A;  4ELO A;  3N94 A;  3TAJ A;  1HSE A;  4WEP A;  3EPE A;  4QFP A;  4RK2 A;  4KFQ A;  3U8Q A;  3QIM A;  2XX9 A;  3RQT A;  3IOU A;  4LP2 B;  4F1U A;  1M5E A;  4Z7E A;  4LVQ A;  4ZE8 A;  3WAE A;  2ZYN A;  2FA7 A;  4BDN A;  1XVY A;  2O1M A;  4G68 B;  4XKN A;  5I84 A;  1VE4 A;  1JQF A;  2H98 A;  2UXA A;  3HO7 A;  4EXK A;  5ITP A;  3HPI A;  5KDT B;  3FJG A;  3OEK A;  4TLM B;  2I48 A;  2O84 X;  1FTM A;  5I59 B;  1JVX A;  1NNT A;  2XXX A;  4FED A;  5AA4 B;  5H8H A;  4BDQ A;  4MLQ A;  3SEV A;  1YAE A;  1B5J A;  3ZKL A;  1A40 A;  3PD8 A;  3THI A;  4P11 A;  1R9L A;  3K6V A;  2F7A A;  2ZYK A;  3T22 A;  1F9B A;  3W15 C;  2X26 A;  3HST A;  4YB6 A;  3S9L C;  4O3A A;  4YMB A;  1YCJ A;  2HEU A;  4UAC A;  2ESN A;  2RC7 A;  4X48 A;  2PVU A;  3WAF A;  4ZE9 A;  5A5X A;  2F78 A;  2H9B A;  2DP8 A;  3EHU A;  3N6U A;  4F3B A;  4F31 B;  2Q9T A;  4OVJ A;  2I49 A;  1MPC A;  3CG3 A;  5FHN A;  4G2Z A;  3UGW A;  4F3G A;  1QUL A;  2UVI A;  5FHO A;  1MS7 A;  4P0I A;  1DTG A;  1B2H A;  5CM6 A;  1NH7 A;  2P2A A;  2PMS A;  4DDD A;  3UK4 A;  2B65 A;  4NF4 B;  3DP4 A;  1Y4C A;  4POX A;  4ELQ A;  5AA2 D;  1I6B A;  1IEJ A;  1LFI A;  2VD2 A;  4NED A;  1MM7 A;  1BP5 A;  4H67 A;  1NMU A;  2A5T B;  5JK4 A;  1B46 A;  1AOV A;  4OEV A;  3VV5 A;  2Y7P A;  3TTL A;  1PB9 A;  2B3B A;  3KJ7 A;  3UOR A;  3U93 A;  3KSJ A;  5DTB A;  3BKI B;  2OJT A;  3EF7 A;  2V3T A;  4WXJ A;  3CIJ A;  3VDF A;  2XXR A;  3T9V A;  1A7L A;  4ELP A;  1FQC A;  1LAH E;  2Y84 A;  2NOO A;  1MXY A;  4R2F A;  1ZMG A;  1VFE A;  5BWJ A;  3FGS A;  5L8D A;  1S50 A;  1JVY A;  3O97 A;  4F3P A;  1M5F A;  3MVY A;  1I6Q A;  2F6P A;  1N7X A;  4RJZ A;  3BFT A;  2UYF A;  4RXL A;  5M2V A;  2ANJ A;  2OZZ A;  5KZT A;  2ZNU A;  4I9D A;  3LSF B;  4JWX A;  1N04 A;  3MQ9 A;  3O2A A;  1US5 A;  4M4G A;  3VE1 B;  2FYI A;  2BJJ X;  4NF8 A;  3FAS A;  3H6U A;  4KHZ E;  3V89 B;  2DE2 A;  2X7Q A;  5JEI A;  3I3V A;  3L6G A;  2QSX A;  2OK2 A;  3KFM A;  2WKY A;  2ZYM A;  4L17 A;  3U72 A;  4IO3 A;  4F18 A;  4KYS A;  3A3U A;  5H8S A;  4U2R A;  3B6T A;  3K1N A;  3SEY A;  4ZDM A;  5I56 A;  2DS9 A;  3H3G A;  3KJT A;  3C34 A;  4QSE A;  3MC2 A;  2E0S A;  2Z8E A;  4GXA A;  3I5O A;  3MZ9 A;  3W9W A;  2DYX A;  1B7H A;  1MDP 1;  4HTG A;  3H03 A;  3S9N C;  5H8Q B;  2VD3 A;  1CE2 A;  3QAX A;  4F2O A;  4GQO A;  4H65 A;  3Q27 A;  4LQ2 A;  2H99 A;  1H44 A;  3IOV A;  1B9J A;  2I6E A;  3EHT A;  5L9S A;  4ZZE A;  2CMO A;  4NF5 B;  4NF6 A;  4BDR A;  3B6Q A;  3IL1 B;  4BDM A;  4U4X A;  3ODB A;  1FTK A;  1DOT A;  3PV0 E;  1Q35 A;  1GVC A;  4DCX A;  3Q28 A;  2M8C A;  5KDT A;  1QW0 A;  3VVF A;  4JB7 A;  1SYH A;  4H0W A;  1QUK A;  2G29 A;  4R6Y A;  4FAJ A;  4YKK A;  2XXV A;  2Q2A A;  4NMY A;  1OQH A;  1RYO A;  5H8H B;  1XC1 A;  1B51 A;  3TMG A;  1MXW A;  2AL4 A;  1N0T A;  2Y7K A;  1USY E;  3OMB A;  4ISU A;  3AXF A;  3C32 A;  1M5D A;  3V8X B;  5AA2 B;  3MPL A;  5DEX A;  4OER A;  3F11 A;  3FD3 A;  3VXC A;  3S9E A;  3P7I A;  1MXZ A;  4YKJ A;  1N76 A;  2H5Y A;  1A54 A;  1JW5 A;  3OD7 A;  1VFD A;  4FJP A;  4G68 C;  1WOD A;  1VSO A;  2I4C A;  4PFY A;  2O51 A;  1S7Y A;  4U1Z A;  1B0H A;  2PYY A;  3RNN A;  1YTV A;  2Y7W A;  3EHS A;  3H7M A;  2UVG A;  4LZ8 A;  4YIC A;  3IJO B;  3N6T A;  4YZZ A;  3VLW A;  2IA4 A;  1UIU A;  1D9Y A;  3SDF A;  1EU8 A;  3TTM A;  1HSL A;  4GXS B;  2F5X A;  4ZEF A;  4N13 A;  1URS A;  4OET A;  1TT1 A;  3DEL B;  1MQJ A;  3K6U A;  1PBP A;  3KSX A;  4EXL A;  3HHF A;  3JYR A;  4AQ4 A;  3QUJ A;  3KG2 A;  4GLI A;  4JDF A;  2ZXT A;  3FVK A;  1ZKB A;  4DZ1 A;  3TYH A;  3IX1 A;  4DXU A;  1B3F A;  1LFG A;  1EH3 A;  1LBC A;  3E9X A;  1A99 A;  3PMX A;  4MFI A;  4QFK A;  1OLC A;  2I0C A;  1Y9U A;  3TTR A;  3TCG A;  3FV2 A;  1CB6 A;  5B7D A;  4XKR A;  5JTY B;  3RGY A;  4F1Y A;  1DPE A;  3C33 A;  1SDX A;  1XT8 A;  1UTB B;  2F36 A;  1NNK A;  1H43 A;  2QS2 A;  5DVF A;  4C0R A;  5CMK A;  4FE8 A;  5DVI A;  4U1O A;  3TQL A;  1MXX A;  3MVZ A;  3C35 A;  4MF3 A;  1M5B A;  2VP1 A;  1ZTY A;  3OEM A;  4F1V A;  3GBA A;  3IOT A;  2ZYO A;  5H8F B;  3UA8 A;  2D5W A;  3R6U A;  4PET A;  3FVO A;  3D4C A;  3CFZ A;  1H3D A;  4ZEI A;  4IO2 A;  2Y7R A;  3LBS A;  3K2D A;  5JTY A;  4C1T A;  1T0K A;  4WED A;  1XVX A;  2FNC A;  2XXT A;  3H06 B;  3SKP A;  4EQ7 A;  3OOA A;  5EHM A;  3Q29 A;  1B3G A;  4MLV A;  4NWC A;  5ELV A;  1MPD A;  3IR1 A;  4U23 A;  4ZZA A;  2NUV A;  4QF9 A;  5ITO A;  3VLU A;  3LR1 A;  3V5A A;  4YKI A;  4EUO A;  4F29 A;  4F22 A;  5CC2 A;  1PC3 A;  1Y4T A;  1RKM A;  1IXI A;  3PU5 A;  5I2K A;  5CBS A;  1FTL A;  4WKM A;  3VVE A;  2A5T A;  3N26 A;  3PPN A;  1Z7M E;  4LON B;  3H4Z A;  4NF5 A;  1SBP A;  3K1M A;  1D9V A;  1FQD A;  1B3L A;  2AYS A;  2R6G E;  2UVH A;  3FXR A;  1WVJ A;  1GR2 A;  2O7I A;  3GZG A;  3ILU B;  3K01 A;  1URG A;  4GD5 A;  4JSD A;  3W9V A;  3TPA A;  3HV1 A;  3SEX A;  3PPR A;  3TDJ A;  1LBB A;  2RCB A;  3JZJ A;  4FEC A;  1Y3N A;  4EF1 A;  4YB5 A;  1SW1 A;  3FXU A;  3RN8 A;  3O29 A;  2G93 A;  3IJX B;  2O6A A;  3CG1 A;  3TUS A;  5ISU A;  4C1U A;  1PDA A;  3IOW A;  4G4P A;  4KCD A;  1P1W A;  1OMP A;  1LAF E;  3MVX A;  4P0G A;  4UA8 A;  3G3J A;  4MH5 A;  3U92 A;  4PFT A;  4PFU A;  4EQB A;  1OVB A;  3MP8 A;  1MQD A;  5ICQ A;  5ICT A;  4OFO A;  1OIB A;  1QKA A;  3MW0 A;  4EQ9 A;  2O69 A;  4LQ5 A;  4OTE A;  1LB9 A;  2XXI A;  3T96 B;  3LSL A;  3O28 A;  3MPK A;  3OSQ A;  3TQW A;  3VLV A;  5I59 A;  5KCJ A;  1XS5 A;  4F2Q A;  3T93 B;  2RIN A;  5AA3 A;  1B40 A;  4NWD A;  1TWY A;  3FV1 A;  4LUB A;  1LFH A;  3A3C A;  5TPA B;  4GOT A;  4DLD A;  1S9T A;  2V84 A;  2HZL A;  1A8E A;  3G3I A;  1B1X A;  3C9H A;  4OXV A;  1DSN A;  3M3L A;  1UTH B;  2F7B A;  4O3B A;  3R26 A;  3SEU A;  1H45 A;  2RCA A;  5J1D A;  1MQI A;  4K3F A;  3O66 A;  3E13 X;  1O7T A;  2F7C A;  1ELJ A;  2Q89 A;  1PB8 A;  3DLN A;  3ECR A;  2F34 A;  3HN0 A;  3Q26 A;  4HCY A;  4NTL A;  5F1Q A;  1MXU A;  2Q2C A;  5A5X B;  4ESX A;  4KI0 E;  4KCC A;  1SI1 A;  1MXV A;  2KLF A;  4AB6 A;  3T9X B;  4NF6 B;  2DWA A;  4N6P A;  4Q30 B;  3RUM A;  1QJM A;  3SEW A;  1IQ7 A;  1US4 A;  4HCW A;  1GTK A;  1LST A;  3PUX E;  3I6V A;  4POW A;  2DVZ A;  4RPO A;  3T9U A;  2D21 A;  3PMW A;  4ZEC A;  5I2N A;  3MJN A;  1I69 A;  1N84 A;  4N07 A;  2X7P A;  4FIM A;  3G3H A;  4QFL A;  3TZA A;  4F39 A;  3M3F A;  3RTW B;  2O7U A;  4U22 A;  1O63 A;  1ZU0 A;  4G68 A;  4X1B A;  4OYV A;  1MY2 A;  3UP9 A;  4IGR A;  1XOC A;  1A8F A;  1LAG E;  2DVC A;  4QFO A;  4JWO A;  4U21 A;  1O64 A;  2W7Y A;  3HHG A;  2HAV A;  3IOR A;  3KN8 A;  1ATG A;  1LGB C;  1MM6 A;  4NF4 A;  4OHN A;  2Z23 A;  3MVW A;  3K1P A;  4R6K A;  3QYT A;  1DMB A;  1MDQ A;  1IZ1 A;  3U94 A;  2Q88 A;  4OEN A;  2IEE A;  1ZLQ A;  5H8N A;  1IXG A;  4H5G A;  2QS4 A;  3LSW A;  3RPW A;  1VR5 A;  1Y3Q A;  4IO6 A;  4R73 A;  1ZJL A;  2YLN A;  2QMW A;  4FEB A;  3MWB A;  3CSB A;  1USY H;  2I3W A;  4XKQ A;  4ELR A;  4ONY A;  3G3G A;  1QVS A;  5DT6 A;  1P1N A;  1SW4 A;  2NXO A;  1HSJ A;  3CRB A;  3S2V A;  4I8C A;  3E3K A;  1LB8 A;  3T66 A;  1BIY A;  4IGT A;  4YU0 A;  4GWO A;  2CZL A;  2VHA A;  5EYF A;  4XXU A;  4KQP A;  5FTI A;  1MY4 A;  3TKD A;  1MQG A;  4GIZ A;  3K4U A;  1D4N A;  3KN3 A;  4QSC A;  3RY3 A;  4AB5 A;  3N5L A;  3HCQ A;  3O6H A;  1B4Z A;  3ZKK A;  1B3H A;  3ZS6 A;  2ABH A;  1SI0 A;  3G7W A;  3TEL A;  3L6H A;  3LC8 A;  4JWY A;  3GBB A;  4R2B A;  4LZ5 A;  1P99 A;  2OLB A;  3FVN A;  3PUZ E;  3VFJ A;  2XXY A;  4GRK A;  1TXF A;  2I0B A;  4OFJ A;  5CBR A;  4GFR A;  5HBC A;  2QS3 A;  4M1V A;  3B7D A;  2V25 A;  4Q8R A;  5HPQ A;  4R9F A;  3G3K A;  2F97 A;  1IXC A;  1LCF A;  1R9Q A;  4X9T A;  3H6V A;  3PD9 A;  1UIV A;  4DCY A;  2H25 A;  3A09 A;  5AA4 A;  5AE4 A;  2DE4 A;  1IUD A;  2QS1 A;  1D3K A;  4U4S A;  3RTF B;  3USD A;  4HW8 A;  1B52 A;  3G3F A;  1R6Z A;  3ZSF A;  3IK6 B;  1Y3P A;  4G77 A;  2XHD A;  4TLL B;  4F19 A;  2A5S A;  1B58 A;  1Y1M A;  2ONR A;  4XKP A;  5L9M A;  4QFN A;  3GXA A;  3IB1 A;  4R74 A;  1B1H A;  4OES A;  2AIX A;  2REJ A;  4QRZ A;  3S4U A;  1A55 A;  2VGQ A;  1B3E A;  3DM0 A;  4O3C A;  4BDO A;  1EZO A;  5I58 B;  2R9J A;  2PBW A;  4RNS A;  1NNP A;  3IO6 A;  5BUU A;  1PBQ A;  3B6W A;  5HM4 B;  2ZNT A;  1SQY A;  2UVJ A;  4GL8 A;  3CR9 A;  2OWS A;  3PUV E;  3QSL A;  1PB7 A;  2GRV A;  4Q5T A;  4IY6 A;  3JV9 A;  5IKB A;  2XXH A;  3TTN A;  1MPB A;  4KR5 A;  2H4I A;  3FVG A;  3S9M C;  2DWI A;  5CMB A;  1QUJ A;  3OSR A;  1JW1 A;  3KEI A;  2I3V A;  1SYI A;  3MBP A;  2DXR A;  2O68 A;  2QMX A;  3PPP A;  2YPN A;  1AL3 A;  2OWT A;  3OO8 A;  2HXW A;  1I6A A;  2ZNS A;  1N3W A;  1BLF A;  2O1L A;  3Q25 A;  4NE4 A;  1NFT A;  4H8I A;  4R75 A;  2Q8J A;  5TU0 A;  5TP9 A;  2QPQ A;  1B6H A;  1IXH A;  3PUW E;  1ZIU A;  5I2K B;  3T9H B;  3MAM A;  4I62 A;  3RLF E;  3K6W A;  4XIG Q;  2ZMB A;  1FQE A;  3FZV A;  1UTH A;  3VXB A;  4OEU A;  3KN7 A;  5KCJ B;  1QKB A;  3ILT B;  2RF1 A;  3TTK A;  1GGG A;  4OZ9 A; 
#chains in the Genus database with same CATH topology
 1LCT A;  4PFB A;  1MG1 A;  2FHY A;  4THI A;  4NAP A;  4MBP A;  3IB2 A;  5H8F A;  1Q1K A;  4IO5 A;  4NGU A;  5EYH A;  4MX6 A;  1MRP A;  3OXN A;  2GHA A;  5IZ3 B;  1CNQ A;  5I57 A;  1FTJ A;  4OAN A;  4YAH X;  3HFU A;  1SD3 A;  2RKM A;  1KZ8 A;  3OO6 A;  1DTZ A;  1NL5 A;  1POY 1;  3E4R A;  3IAZ A;  3FUZ A;  1TFA A;  3C36 A;  2P0S A;  1JNF A;  1UTB A;  3CFL A;  4H6D A;  1KA1 A;  3ISP A;  3CFX A;  4DXB A;  3H6T A;  2DWH A;  5AA2 A;  2D3I A;  1P1U A;  1UQW A;  3CI8 A;  3MZB A;  1OVT A;  4FOR A;  4YKP A;  1URD A;  3MP1 A;  4QSD A;  4H1X A;  1NH8 A;  3M8U A;  4N6K A;  2DQV A;  2HFB A;  4X04 A;  3C31 A;  5EYG A;  4Q0C A;  5CMM A;  5CRY A;  2RC8 A;  4O7M A;  1FQB A;  4LAT A;  4ZEB A;  5DEX B;  4PFW A;  2DXY A;  2LAO A;  1L5T A;  4GWX A;  2XXU A;  3FJ7 A;  4X1D A;  2HAU A;  2ALU A;  1II5 A;  4IO4 A;  4R6H A;  1N7W A;  1WDN A;  1FCK A;  4GVO A;  3O6G A;  2OBG A;  4G8H A;  2F6G A;  5DVJ A;  2XXQ A;  1FSA A;  5FHM A;  1AH5 A;  3SET A;  4RK9 A;  4ND9 A;  1N3X A;  2P1S A;  3OO7 A;  1NNF A;  4QHQ A;  4YMA A;  2MKZ A;  4DXC A;  1XHY A;  3D4G A;  3UIF A;  4FBP A;  3U1O A;  3TAJ A;  1FPJ A;  4RK2 A;  4F1U A;  3IOU A;  1M5E A;  2FA7 A;  2O1M A;  3HPI A;  2QFL A;  2I48 A;  3GYY A;  1NNT A;  1B5J A;  5IZ3 A;  4JVC A;  1LEV A;  2ZYK A;  3T22 A;  1F9B A;  4YB6 A;  3S9L C;  1YCJ A;  2RC7 A;  3WAF A;  5A5X A;  3CG3 A;  4P0I A;  4PFI A;  1DTG A;  2PMS A;  4MAG A;  3DP4 A;  4ELQ A;  2VD2 A;  4NED A;  1LFI A;  2A5T B;  1PB9 A;  2B3B A;  2V3T A;  1LBV A;  3T9V A;  2Y84 A;  3VVF A;  3MVY A;  1I6Q A;  4RXL A;  2B4M A;  3BFT A;  2ANJ A;  1INP A;  1N04 A;  1US5 A;  3VE1 B;  4NF8 A;  4PBQ A;  3FAS A;  4KHZ E;  2X7Q A;  2QSX A;  2ZYM A;  3U72 A;  4F18 A;  5LDZ A;  3A3U A;  1NV0 A;  4ZDM A;  2DS9 A;  3H3G A;  4QSE A;  1FPD A;  5H8Q B;  4H65 A;  2H99 A;  1H44 A;  3IOV A;  1B9J A;  2CMO A;  4BDR A;  1FTK A;  1DOT A;  2F3D A;  1QUK A;  1MXW A;  1N0T A;  1M5D A;  3MPL A;  4OER A;  3P7I A;  1N76 A;  1JW5 A;  1VSO A;  4PFY A;  4U1Z A;  1S7Y A;  1YYZ A;  1YTV A;  3IJO B;  1UIU A;  4GXS B;  1JP4 A;  4N13 A;  5EQA A;  1URS A;  1TT1 A;  1MQJ A;  3K6U A;  2JJK A;  3KG2 A;  2ZXT A;  1ZKB A;  5DW8 A;  1B3F A;  1CB6 A;  5JTY B;  1DPE A;  2F36 A;  1NNK A;  1H43 A;  3TQL A;  3C35 A;  4F3P A;  1ZTY A;  3OEM A;  3IOT A;  2ZYO A;  3R6U A;  3FVO A;  3K2D A;  1AWB A;  1T0K A;  1B3G A;  2PCR A;  4EUO A;  3V5A A;  4YKI A;  5CC2 A;  1Y4T A;  5I2K A;  1Z7M E;  3H4Z A;  4NF5 A;  1SBP A;  1D9V A;  2UVH A;  2P3V A;  3FXR A;  2O7I A;  3TPA A;  3TDJ A;  3PPR A;  1Y3N A;  3FXU A;  3RN8 A;  3CG1 A;  4N8G A;  3MP8 A;  3MW0 A;  1LB9 A;  3LSL A;  5I59 A;  3MPK A;  3TQW A;  1XS5 A;  4F2Q A;  2RIN A;  1LFH A;  3FV1 A;  4LUB A;  1A8E A;  4MCO A;  3M3L A;  5J1D A;  3O66 A;  2F7C A;  2Q89 A;  5F1Q A;  2F34 A;  4ESX A;  4KI0 E;  2D21 A;  5EQ8 A;  4ZEC A;  4N07 A;  4U22 A;  1O63 A;  4G68 A;  2PFY A;  3FXB A;  4X1B A;  3UP9 A;  2W7Y A;  2HAV A;  4PDH A;  3MVW A;  3QYT A;  4NG7 A;  3ROJ A;  3LSW A;  4R73 A;  1RDX A;  4MNC A;  2NXO A;  2P3N A;  1LB8 A;  3T66 A;  1BIY A;  4YU0 A;  4GWO A;  2VHA A;  3TKD A;  3RY3 A;  3K4U A;  1D4N A;  3KN3 A;  2FVZ A;  3HCQ A;  3O6H A;  1B4Z A;  3LC8 A;  4JWY A;  1P99 A;  3KBZ A;  1TXF A;  4DCY A;  1LCF A;  3H6V A;  2H25 A;  1NV6 A;  5AE4 A;  1IUD A;  1DBZ A;  3ZSF A;  4F19 A;  4TLL B;  1B58 A;  3IB1 A;  4OES A;  2AIX A;  4QRZ A;  1B3E A;  2PBW A;  1MPB A;  4KR5 A;  2H4I A;  3OSR A;  3KEI A;  3MBP A;  3OO8 A;  2HXW A;  1I6A A;  2ZNS A;  3T9H B;  1ZIU A;  3LUZ A;  1YZ0 A;  3FZV A;  4OEU A;  3KN7 A;  1NUZ A;  5B70 A;  1GGG A;  2XXK A;  3GLB A;  5TP9 B;  4ZS9 A;  2DWJ A;  1NKX A;  4HXV A;  3PPQ A;  4KD5 A;  3PUY E;  2Y7I A;  4RPN A;  5I56 A;  5K2Y A;  5EHS A;  1B5I A;  4E0W A;  1ZBM A;  3TOD A;  1Y20 A;  1PEB A;  2Z22 A;  4OFL A;  1Q9D A;  1FW0 A;  2Z8D A;  5K2X A;  5TPA A;  3TCH A;  2E1S A;  3SES A;  2QVV A;  5AA1 A;  1OLA A;  3CVG A;  3TEP A;  2DE3 A;  1BTJ A;  4DE8 A;  3QK6 A;  5T3J A;  3EQ1 A;  4KYD A;  2HQ0 A;  5CMC A;  4Z0I A;  1JW4 A;  3PMV A;  5F7V A;  5LOM A;  3KOS A;  2GH9 A;  2XD2 A;  4ESW A;  4N91 A;  5DYH A;  2XXW A;  4P47 A;  4TOZ A;  2OWZ A;  3E79 A;  4G8M A;  5FBP A;  4OWD A;  1LBZ A;  4FAT A;  3EN3 A;  1B7Z A;  2I58 A;  3TCF A;  2WBB A;  1POT A;  4H45 A;  3OEN A;  3IO4 A;  5IKB A;  4H8J A;  3IFC A;  4BLA A;  3ONM A;  2V93 A;  4F3S A;  3OO9 A;  2R71 A;  2NWJ A;  3FXQ A;  4RA1 A;  4GWW A;  3FAT A;  1MH3 A;  4NN3 A;  3LUY A;  3KOT A;  4KYE A;  4HS7 A;  2THI A;  4OMB A;  3R7X A;  2REG A;  1BKA A;  2XD3 A;  1EZP A;  2ONK E;  3MZ1 A;  1KWH A;  4ELO A;  3N94 A;  4WEP A;  3QIM A;  4ZE8 A;  3WAE A;  2ZYN A;  1XVY A;  4XKN A;  2H98 A;  1JQF A;  2UXA A;  5ITP A;  2F3B A;  5AA4 B;  1NV5 A;  5H8H A;  4BDQ A;  1A40 A;  3PD8 A;  4IR8 A;  4P11 A;  2F7A A;  4X48 A;  2ESN A;  4ZE9 A;  2DP8 A;  3EHU A;  3N6U A;  4F31 B;  4OVJ A;  3UGW A;  4F3G A;  5FHO A;  1MS7 A;  4AS5 A;  1B2H A;  2P2A A;  2B65 A;  4NF4 B;  1I6B A;  1BP5 A;  1NMU A;  5JK4 A;  3VV5 A;  5DTB A;  4WXJ A;  2OJT A;  1LAH E;  4R2F A;  2NOO A;  1ZMG A;  1NV7 A;  5L8D A;  1S50 A;  1JVY A;  2F6P A;  5M2V A;  4RJZ A;  2UYF A;  4NQ8 A;  2OZZ A;  3LSF B;  2BJJ X;  3H6U A;  3V89 B;  5JEI A;  3KFM A;  4L17 A;  4KYS A;  2V4C A;  2HXR A;  4X8R A;  3KJT A;  3MC2 A;  3MZ9 A;  1B7H A;  3H03 A;  2VD3 A;  1CE2 A;  4GQO A;  3Q27 A;  4BDM A;  4U4X A;  3PV0 E;  5EQ7 A;  1Q35 A;  4DCX A;  5LTC A;  1QW0 A;  4N17 A;  4H0W A;  4GWZ A;  1RYO A;  5H8H B;  1B51 A;  3OMB A;  4ISU A;  3AXF A;  3V8X B;  5AA2 B;  3FD3 A;  5ET6 A;  3VXC A;  3S9E A;  1MXZ A;  2H5Y A;  2PYY A;  5IZZ A;  3EHS A;  3H7M A;  1D9Y A;  1EU8 A;  1HSL A;  2F5X A;  4GWS A;  4EXL A;  3JYR A;  3FVK A;  3IX1 A;  4QFK A;  1LBC A;  4MFI A;  1A99 A;  1SDX A;  1MXX A;  3MVZ A;  2VP1 A;  3GBA A;  3UA8 A;  3CFZ A;  1H3D A;  4ZEI A;  2Y7R A;  5JTY A;  4C1T A;  4EQ7 A;  3H06 B;  3SKP A;  1IMC A;  4MLV A;  4U23 A;  4EQ9 A;  2NUV A;  3LR1 A;  1FPG A;  4PTK A;  3PU5 A;  4LON B;  1EYJ A;  4OTE A;  1WVJ A;  3K01 A;  1URG A;  4GD5 A;  4PGP A;  3W9V A;  1FPL A;  3JZJ A;  5ISU A;  3IJX B;  3TUS A;  4G4P A;  4KCD A;  1P1W A;  1OMP A;  3G3J A;  3D1R A;  1FBE A;  5ICT A;  1OVB A;  1MQD A;  1QKA A;  2XA5 A;  4PAK A;  2XXI A;  3T93 B;  5AA3 A;  4DLD A;  2V84 A;  3G3I A;  1VDW A;  1H45 A;  2RCA A;  1O7T A;  1ELJ A;  3Q26 A;  1MXV A;  2DWA A;  1QJM A;  4HCW A;  4RPO A;  4POW A;  3I6V A;  3PMW A;  5I2N A;  1I69 A;  3G3H A;  4QFL A;  3TZA A;  2O7U A;  1MY2 A;  1XOC A;  3HHG A;  1LGB C;  3K1P A;  4R6K A;  1MDQ A;  1ZLQ A;  4XF5 A;  2QS4 A;  2B4L A;  1VR5 A;  4IO6 A;  2QMW A;  3MWB A;  4XKQ A;  4ELR A;  1SW4 A;  5FTI A;  1IMD A;  4QSC A;  4GWY A;  3MST A;  4XFE A;  3G7W A;  3TEL A;  4LZ5 A;  2XXY A;  4OFJ A;  4GFR A;  2QS3 A;  5HPQ A;  4R9F A;  1R9Q A;  4X9T A;  5AA4 A;  3RTF B;  3G3F A;  1DCU A;  4G77 A;  2XHD A;  2A5S A;  1Y1M A;  5L9M A;  3GXA A;  4R74 A;  3S4U A;  2REJ A;  4P9K A;  1DK4 A;  1EZO A;  5J16 A;  1PBQ A;  2ZNT A;  1GVC A;  3CR9 A;  2OWS A;  2GRV A;  4IY6 A;  3TTN A;  3S9M C;  3FVG A;  5CMB A;  1JW1 A;  1SYI A;  2DXR A;  2QMX A;  1AL3 A;  2R8T A;  1N3W A;  2O1L A;  4H8I A;  4R75 A;  2Q8J A;  1B6H A;  5I2K B;  4I62 A;  2XWV A;  4XIG Q;  1FQE A;  2CZI A;  1QKB A;  3TTK A;  2XX7 A;  1DPP A;  5CI5 A;  1AIV A;  1B32 A;  3DP6 A;  3VVD A;  1LLS A;  2GFE A;  3O6I A;  3K0V A;  5I2N B;  1H76 A;  4H5F A;  2ZZV A;  5TPA B;  4OVS A;  2WBD A;  3LV0 A;  4EDP A;  1Z7N E;  4LZ7 A;  2V3U A;  4JSO A;  2QRY A;  3T0J A;  3O9P A;  4BDL A;  4GX4 A;  3KBR A;  3UN6 A;  5I56 B;  3LSX A;  4R9G A;  4GBV A;  2PT1 A;  2YJP A;  4DI3 D;  1B7U A;  1IIW A;  4JBZ A;  2HZK A;  3MUQ A;  4OVQ A;  4E0X A;  1GV8 A;  2I4B A;  2Y5K A;  1YXI A;  1B05 A;  3RPL A;  1JEU A;  3DP8 A;  1MY0 A;  1P1O A;  1SW2 A;  4KPT A;  1FTO A;  1Y1Z A;  1K9Y A;  1M5C A;  1SW5 A;  4RYA A;  1IME A;  4PF6 A;  4GF8 A;  1EZ9 A;  4RY1 A;  2PT2 A;  3KZG A;  2PX1 A;  2XX8 A;  1AMF A;  5H8Q A;  4MJO A;  5FTH A;  2RC9 A;  4DIG A;  4I3E A;  3FIR A;  4IY5 A;  4OQO A;  2FIE A;  5I7I A;  1SVX B;  5I57 B;  3BFU A;  1FQA A;  4GL0 A;  4IB2 A;  3IB0 A;  1MY1 A;  1RDY A;  4PP0 A;  4QBA A;  1MY3 A;  3B8B A;  3PGF A;  4G8N A;  4JVD A;  3EPE A;  4QFP A;  4KFQ A;  3RQT A;  4LP2 B;  4Z7E A;  2HHM A;  4PBH A;  4O94 A;  4LVQ A;  4G68 B;  3HO7 A;  4EXK A;  3FJG A;  3OEK A;  4TLM B;  3RPL B;  1JVX A;  2XXX A;  3KC0 A;  1YAE A;  2Q74 A;  1LBY A;  3THI A;  3W15 C;  1R9L A;  4UAC A;  2FIX A;  4N6D A;  2F78 A;  4F3B A;  2Q9T A;  1MPC A;  5FHN A;  4G2Z A;  1QUL A;  5I3S A;  5CM6 A;  1NH7 A;  1LBW A;  1NI9 A;  4DDD A;  1IEJ A;  1MM7 A;  1FBF A;  4OEV A;  2Y7P A;  1IMA A;  3U93 A;  3KSJ A;  3BKI B;  3CIJ A;  2XXR A;  1A7L A;  4ELP A;  1MXY A;  3FGS A;  3A29 A;  5KZT A;  2ZNU A;  3MQ9 A;  3E78 A;  3I3V A;  3L6G A;  4MNI A;  5H8S A;  4U2R A;  3B6T A;  1BK4 A;  4MIJ A;  3C34 A;  2E0S A;  4GXA A;  3I5O A;  2DYX A;  1MDP 1;  4HTG A;  3S9N C;  4UAB A;  3QAX A;  4F2O A;  1RDZ A;  2I6E A;  4ZZE A;  4NF5 B;  4NF6 A;  3IL1 B;  3ODB A;  3Q28 A;  4JB7 A;  2G29 A;  4R6Y A;  1XC1 A;  4PGN A;  2AL4 A;  1USY E;  1FBC A;  3C32 A;  4PC9 A;  3F11 A;  4PE3 A;  2ZZX A;  1WOD A;  2I4C A;  1B0H A;  4GBW A;  3RNN A;  1FPE A;  1FPF A;  2Y7W A;  4YIC A;  4LZ8 A;  2QVR A;  3N6T A;  2IA4 A;  3SDF A;  2VT5 A;  4GX3 A;  4ZEF A;  4DI4 B;  1PBP A;  3HHF A;  4HE1 A;  2L5V A;  3QUJ A;  4JDF A;  4DZ1 A;  3TYH A;  4DXU A;  4GWU A;  1LFG A;  1EH3 A;  3E9X A;  1OLC A;  2I0C A;  1Y9U A;  3TCG A;  5ET8 A;  4XKR A;  3RGY A;  4F1Y A;  1XT8 A;  2QS2 A;  4FE8 A;  5DVI A;  4U1O A;  4MF3 A;  1M5B A;  5H8F B;  4PET A;  1LBX A;  3OOA A;  5ELV A;  3VLU A;  5ESY A;  4F22 A;  4F29 A;  1PC3 A;  1RKM A;  4PFR A;  2A5T A;  3PPN A;  2R6G E;  3GZG A;  3ILU B;  1GR2 A;  1LBB A;  4P8B A;  4YB5 A;  1SW1 A;  3O29 A;  2G93 A;  3IOW A;  3MVX A;  4UA8 A;  3U92 A;  4PFU A;  1OIB A;  2O69 A;  4LQ5 A;  3O28 A;  3VLV A;  1TWY A;  4GOT A;  1B1X A;  1DSN A;  1UTH B;  2F7B A;  4O3B A;  3R26 A;  3SEU A;  1MQI A;  4K3F A;  3DLN A;  1PB8 A;  3HN0 A;  2ZZW A;  1NV1 A;  1MXU A;  2Q2C A;  1SI1 A;  4AB6 A;  1IMF A;  3T9X B;  4NF6 B;  3SEW A;  1IQ7 A;  1US4 A;  1LST A;  3PUX E;  3T9U A;  2DVZ A;  4MNP A;  3MJN A;  1N84 A;  3PTY A;  4FIM A;  4F39 A;  3M3F A;  2PFZ A;  4H46 A;  4OYV A;  1A8F A;  2DVC A;  4QFO A;  4U21 A;  3KN8 A;  1MM6 A;  4NF4 A;  2Z23 A;  1DMB A;  3U94 A;  5F24 A;  2IEE A;  5H8N A;  1ZJL A;  1G0I A;  3CSB A;  2I3W A;  4ONY A;  3CRB A;  3S2V A;  1FPI A;  3E3K A;  4IGT A;  2CZL A;  5EYF A;  4KQP A;  2XWO A;  4GIZ A;  4XEQ A;  4KXP A;  3U65 A;  3ZS6 A;  3L6H A;  4PF8 A;  3GBB A;  4R2B A;  3SZP A;  2I0B A;  5CBR A;  3B7D A;  3G3K A;  1IXC A;  3A09 A;  5IGA A;  1D3K A;  3IK6 B;  4NX1 A;  4XKP A;  4QXD A;  1B1H A;  1A55 A;  2VGQ A;  4O3C A;  5I58 B;  1NNP A;  3IO6 A;  3B6W A;  1D9Q A;  1SQY A;  2UVJ A;  2CZH A;  3PUV E;  3NOH A;  3QSL A;  1NV3 A;  2DWI A;  2I3V A;  3EKI A;  1EYK A;  2O68 A;  2YPN A;  2OWT A;  3Q25 A;  4NE4 A;  4O8M A;  1NFT A;  3RLF E;  3K6W A;  2ZMB A;  1UTH A;  3MYU A;  5ET7 A;  3RT6 B;  1QUI A;  4AS4 A;  1B5H A;  3FJM A;  4XTC Q;  3K02 A;  3K6X A;  1ANF A;  2ONS A;  1IIT A;  4TQU Q;  5IM2 A;  3KGC A;  1B4H A;  1B0L A;  3M3K A;  2F35 A;  3MP6 A;  5H8N B;  4JXI A;  2Q8M A;  3QXM A;  3H6W A;  4NF8 B;  3TFL A;  4MMP A;  2WYK A;  3OEL A;  1RYX A;  1P1Q A;  4HE0 A;  3QUF A;  2WX9 A;  4ZED A;  4PE5 B;  1NUX A;  3C4M A;  2QL3 A;  1TFD A;  3K00 A;  4I1D A;  4PQJ A;  3BBR A;  4YB7 A;  4N8Y A;  4R72 A;  4LA9 A;  2NVU B;  1K9Z A;  2GHB A;  4ZEK A;  2OCU A;  3SER A;  4ECF A;  4P3L A;  2AL5 A;  3BIG A;  1JET A;  2VPN A;  2Z8F A;  1MQH A;  4EF2 A;  2UYE A;  2QJE A;  3V83 A;  4O7I A;  4OVR A;  1OQG A;  2DSF A;  3BIH A;  3CSG A;  5I58 A;  2V3Q A;  3T1B A;  5IAI A;  2HCA A;  1LAX A;  2XXP A;  5L9O A;  4IO7 A;  3KC1 A;  2DOJ A;  4G61 A;  2F8D A;  5A5L A;  1YPN A;  1JEV A;  1R1N A;  4NF0 A;  1MH4 A;  3PPO A;  3RT8 A;  1FQF A;  1FRP A;  2B3F A;  2VOZ A;  5EQ9 A;  1J1N A;  1HSE A;  3U8Q A;  2XX9 A;  5I5P A;  4BDN A;  5I84 A;  1VE4 A;  1QGX A;  5KDT B;  5I59 B;  2O84 X;  1FTM A;  4FED A;  4MLQ A;  3SEV A;  3ZKL A;  3K6V A;  2X26 A;  3HST A;  4O3A A;  4YMB A;  2HEU A;  2PVU A;  3FBP A;  4N81 A;  4P1E A;  2H9B A;  2I49 A;  1IMB A;  2UVI A;  1NV2 A;  3UK4 A;  1Y4C A;  4POX A;  5AA2 D;  4H67 A;  2HPG A;  1B46 A;  1AOV A;  3TTL A;  2QVU A;  3KJ7 A;  3UOR A;  3VDF A;  3EF7 A;  3B50 A;  1FQC A;  4P1L A;  1VFE A;  3O97 A;  1M5F A;  1N7X A;  2DDK A;  2VPO A;  4I9D A;  4JWX A;  3O2A A;  4M4G A;  2FYI A;  2DE2 A;  2Y5L A;  2OK2 A;  2WKY A;  2OX3 A;  4IO3 A;  2KR0 A;  3K1N A;  5IZ1 A;  3SEY A;  1FJ9 A;  2Z8E A;  3W9W A;  1G0H A;  1FBD A;  4LQ2 A;  2XWI A;  3EHT A;  4GX6 A;  5L9S A;  3B6Q A;  4I3Y A;  5KDT A;  4LN5 A;  2M8C A;  1SYH A;  4FAJ A;  4YKK A;  2XXV A;  2Q2A A;  4NMY A;  5ET5 A;  1OQH A;  3TMG A;  2Y7K A;  2FBP A;  1KA0 A;  5DEX A;  4YKJ A;  1A54 A;  1VFD A;  4FJP A;  4G68 C;  2O51 A;  2CEY A;  2UVG A;  4YZZ A;  3VLW A;  3TTM A;  1NUW A;  4OET A;  3DEL B;  3KSX A;  4AQ4 A;  4OVT A;  4GLI A;  4I40 A;  3PMX A;  3TTR A;  2XWK A;  3FV2 A;  5B7D A;  5DVF A;  3C33 A;  1FPK A;  1FPB A;  1UTB B;  4C0R A;  5CMK A;  4F1V A;  4PAI A;  2D5W A;  4P56 A;  3D4C A;  1FBH A;  2KQZ A;  4IO2 A;  3LBS A;  4PAF A;  1XVX A;  2FNC A;  2XXT A;  4WED A;  5EHM A;  4PDD A;  3Q29 A;  4NWC A;  1MPD A;  3IR1 A;  4ZZA A;  4QF9 A;  5ITO A;  1IXI A;  1FTL A;  4WKM A;  3VVE A;  3N26 A;  1EYI A;  3K1M A;  3OD7 A;  1B3L A;  1FQD A;  2AYS A;  5CBS A;  4JSD A;  3HV1 A;  3SEX A;  4OVP A;  2RCB A;  4FEC A;  2CEX A;  4EF1 A;  2O6A A;  4C1U A;  1PDA A;  4P0G A;  1LAF E;  2GQ1 A;  4MH5 A;  4PFT A;  4EQB A;  5ICQ A;  4OFO A;  3T96 B;  2WEF A;  3OSQ A;  5KCJ A;  1FBP A;  1B40 A;  4NWD A;  3A3C A;  1S9T A;  2HZL A;  3C9H A;  4OXV A;  2BJI A;  3E13 X;  3ECR A;  4NTL A;  4HCY A;  3QMF A;  5A5X B;  1NV4 A;  4KCC A;  2KLF A;  4PCD A;  4Q30 B;  4N6P A;  3RUM A;  5BWJ A;  1GTK A;  4N4U A;  2X7P A;  1FTA A;  3RTW B;  1ZU0 A;  4IGR A;  1LAG E;  4JWO A;  1O64 A;  3IOR A;  1ATG A;  4OHN A;  1IZ1 A;  2Q88 A;  4OEN A;  3RPW A;  1IXG A;  4H5G A;  1SPI A;  1Y3Q A;  2YLN A;  4FEB A;  4MHF A;  3IFA A;  1USY H;  3G3G A;  4JVI A;  1QVS A;  5DT6 A;  1P1N A;  1HSJ A;  4I8C A;  4XXU A;  1MY4 A;  1MQG A;  4AB5 A;  3N5L A;  3ZKK A;  1B3H A;  2ABH A;  1SI0 A;  4OA4 A;  4N15 A;  2OLB A;  3FVN A;  3PUZ E;  3VFJ A;  2WYP A;  4GRK A;  5HBC A;  4M1V A;  2V25 A;  4Q8R A;  2F97 A;  3PD9 A;  1UIV A;  2DE4 A;  2QS1 A;  3USD A;  4U4S A;  4HW8 A;  1B52 A;  1R6Z A;  1Y3P A;  2ONR A;  4QFN A;  1FJ6 A;  3DM0 A;  4BDO A;  2R9J A;  4RNS A;  5BUU A;  5HM4 B;  2CZK A;  4GL8 A;  4Q5T A;  3RYD A;  1PB7 A;  3JV9 A;  1FBG A;  2XXH A;  1QUJ A;  4HE2 A;  3PPP A;  1NUY A;  1BLF A;  3CHG A;  4NHB A;  1XI6 A;  5TP9 A;  5TU0 A;  2QPQ A;  1IXH A;  3PUW E;  3MAM A;  3VXB A;  4MEV A;  5KCJ B;  3ILT B;  2RF1 A;  4OZ9 A; 
#chains in the Genus database with same CATH homology
 1LCT A;  1MG1 A;  2XX7 A;  1DPP A;  3GLB A;  5TP9 B;  4ZS9 A;  5CI5 A;  2DWJ A;  4THI A;  3RT6 B;  1NKX A;  1QUI A;  1AIV A;  1B32 A;  3DP6 A;  4MBP A;  3VVD A;  1LLS A;  2GFE A;  3IB2 A;  3K0V A;  1Q1K A;  3O6I A;  3PPQ A;  4IO5 A;  5H8F A;  5I2N B;  1H76 A;  4KD5 A;  1B5H A;  3PUY E;  1MRP A;  3FJM A;  3OXN A;  4H5F A;  4XTC Q;  3K02 A;  2GHA A;  3K6X A;  1ANF A;  2Y7I A;  1FTJ A;  1IIT A;  2ONS A;  4RPN A;  4TQU Q;  4YAH X;  1SD3 A;  2RKM A;  1B5I A;  5EHS A;  5K2Y A;  4E0W A;  1ZBM A;  3OO6 A;  1DTZ A;  3TOD A;  4EDP A;  1Z7N E;  4LZ7 A;  3KGC A;  1Y20 A;  1B4H A;  1B0L A;  1PEB A;  2Z22 A;  2V3U A;  4JSO A;  1NL5 A;  3M3K A;  4OFL A;  2F35 A;  2QRY A;  3MP6 A;  3O9P A;  4BDL A;  1POY 1;  1FW0 A;  3KBR A;  3E4R A;  5H8N B;  3UN6 A;  2Z8D A;  4JXI A;  3IAZ A;  5K2X A;  5TPA A;  3TCH A;  5I56 B;  3LSX A;  4R9G A;  2E1S A;  3FUZ A;  3QXM A;  1TFA A;  3SES A;  3H6W A;  4NF8 B;  3TFL A;  3C36 A;  2P0S A;  2PT1 A;  1JNF A;  2YJP A;  5AA1 A;  1OLA A;  1B7U A;  1IIW A;  3CVG A;  1UTB A;  2HZK A;  3CFL A;  3MUQ A;  4H6D A;  2DE3 A;  4JBZ A;  3CFX A;  3OEL A;  3TEP A;  1RYX A;  4DXB A;  3H6T A;  2DWH A;  1P1Q A;  1BTJ A;  5AA2 A;  2D3I A;  4DE8 A;  1P1U A;  1UQW A;  3QK6 A;  3QUF A;  4E0X A;  3EQ1 A;  1GV8 A;  4KYD A;  2I4B A;  4ZED A;  2HQ0 A;  3CI8 A;  5CMC A;  4Z0I A;  1B05 A;  4PE5 B;  3C4M A;  2QL3 A;  1TFD A;  3K00 A;  3MZB A;  1OVT A;  4FOR A;  1JEU A;  4I1D A;  3DP8 A;  3BBR A;  1JW4 A;  3PMV A;  1URD A;  4PQJ A;  4YB7 A;  4R72 A;  4YKP A;  1MY0 A;  1P1O A;  1SW2 A;  3MP1 A;  4KPT A;  1FTO A;  1Y1Z A;  4H1X A;  4LA9 A;  4QSD A;  5F7V A;  3KOS A;  2NVU B;  2GH9 A;  5LOM A;  1NH8 A;  2XD2 A;  4ESW A;  2GHB A;  5DYH A;  2XXW A;  1M5C A;  3M8U A;  4ZEK A;  2DQV A;  2HFB A;  2OCU A;  1SW5 A;  4TOZ A;  4RYA A;  4G8M A;  3SER A;  3C31 A;  4GF8 A;  4OWD A;  4ECF A;  2AL5 A;  4Q0C A;  1EZ9 A;  5I57 A;  5CMM A;  5CRY A;  1JET A;  2RC8 A;  3EN3 A;  4FAT A;  1B7Z A;  1FQB A;  2Z8F A;  4RY1 A;  2PT2 A;  2I58 A;  4LAT A;  3TCF A;  4ZEB A;  1POT A;  3KZG A;  1MQH A;  5DEX B;  2PX1 A;  4PFW A;  4EF2 A;  2DXY A;  2XX8 A;  1AMF A;  2UYE A;  5H8Q A;  2LAO A;  2QJE A;  1L5T A;  3V83 A;  1OQG A;  3OEN A;  3IO4 A;  2DSF A;  2XXU A;  3FJ7 A;  4X1D A;  3CSG A;  4H8J A;  2HAU A;  2ALU A;  2V3Q A;  5FTH A;  2RC9 A;  4BLA A;  5B70 A;  3ONM A;  5I58 A;  5IAI A;  1II5 A;  2V93 A;  4DIG A;  2HCA A;  4IO4 A;  1LAX A;  4R6H A;  2XXP A;  4F3S A;  3OO9 A;  2R71 A;  2NWJ A;  1N7W A;  5L9O A;  4IO7 A;  3FIR A;  3FXQ A;  4IY5 A;  1WDN A;  4OQO A;  1FCK A;  4RA1 A;  2DOJ A;  2F8D A;  3FAT A;  1MH3 A;  1SVX B;  5I57 B;  3BFU A;  4GVO A;  1YPN A;  1FQA A;  3O6G A;  1JEV A;  2OBG A;  3LUY A;  4G8H A;  4GL0 A;  2F6G A;  5DVJ A;  3KOT A;  4IB2 A;  2XXQ A;  1R1N A;  5FHM A;  1AH5 A;  3SET A;  1MH4 A;  3PPO A;  4KYE A;  4HS7 A;  4RK9 A;  4ND9 A;  3RT8 A;  3IB0 A;  2THI A;  1N3X A;  1MY1 A;  2P1S A;  1FQF A;  3OO7 A;  4OMB A;  2B3F A;  1NNF A;  2REG A;  1J1N A;  2VOZ A;  4QHQ A;  3R7X A;  4DXC A;  1BKA A;  4YMA A;  2XD3 A;  1XHY A;  3D4G A;  4PP0 A;  1EZP A;  1MY3 A;  2ONK E;  3MZ1 A;  3UIF A;  3U1O A;  1KWH A;  3PGF A;  4G8N A;  4ELO A;  3N94 A;  3TAJ A;  1HSE A;  4WEP A;  3EPE A;  4QFP A;  4RK2 A;  4KFQ A;  3U8Q A;  3QIM A;  2XX9 A;  3RQT A;  3IOU A;  4LP2 B;  4F1U A;  1M5E A;  4Z7E A;  4LVQ A;  4ZE8 A;  3WAE A;  2ZYN A;  2FA7 A;  4BDN A;  1XVY A;  2O1M A;  4G68 B;  4XKN A;  5I84 A;  1VE4 A;  1JQF A;  2H98 A;  2UXA A;  3HO7 A;  4EXK A;  5ITP A;  3HPI A;  5KDT B;  3FJG A;  3OEK A;  4TLM B;  2I48 A;  2O84 X;  1FTM A;  5I59 B;  1JVX A;  1NNT A;  2XXX A;  4FED A;  5AA4 B;  5H8H A;  4BDQ A;  4MLQ A;  3SEV A;  1YAE A;  1B5J A;  3ZKL A;  1A40 A;  3PD8 A;  3THI A;  4P11 A;  1R9L A;  3K6V A;  2F7A A;  2ZYK A;  3T22 A;  1F9B A;  3W15 C;  2X26 A;  3HST A;  4YB6 A;  3S9L C;  4O3A A;  4YMB A;  1YCJ A;  2HEU A;  4UAC A;  2ESN A;  2RC7 A;  4X48 A;  2PVU A;  3WAF A;  4ZE9 A;  5A5X A;  2F78 A;  2H9B A;  2DP8 A;  3EHU A;  3N6U A;  4F3B A;  4F31 B;  2Q9T A;  4OVJ A;  2I49 A;  1MPC A;  3CG3 A;  5FHN A;  4G2Z A;  3UGW A;  4F3G A;  1QUL A;  2UVI A;  5FHO A;  1MS7 A;  4P0I A;  1DTG A;  1B2H A;  5CM6 A;  1NH7 A;  2P2A A;  2PMS A;  4DDD A;  3UK4 A;  2B65 A;  4NF4 B;  3DP4 A;  1Y4C A;  4POX A;  4ELQ A;  5AA2 D;  1I6B A;  1IEJ A;  1LFI A;  2VD2 A;  4NED A;  1MM7 A;  1BP5 A;  4H67 A;  1NMU A;  2A5T B;  5JK4 A;  1B46 A;  1AOV A;  4OEV A;  3VV5 A;  2Y7P A;  3TTL A;  1PB9 A;  2B3B A;  3KJ7 A;  3UOR A;  3U93 A;  3KSJ A;  5DTB A;  3BKI B;  2OJT A;  3EF7 A;  2V3T A;  4WXJ A;  3CIJ A;  3VDF A;  2XXR A;  3T9V A;  1A7L A;  4ELP A;  1FQC A;  1LAH E;  2Y84 A;  2NOO A;  1MXY A;  4R2F A;  1ZMG A;  1VFE A;  5BWJ A;  3FGS A;  5L8D A;  1S50 A;  1JVY A;  3O97 A;  4F3P A;  1M5F A;  3MVY A;  1I6Q A;  2F6P A;  1N7X A;  4RJZ A;  3BFT A;  2UYF A;  4RXL A;  5M2V A;  2ANJ A;  2OZZ A;  5KZT A;  2ZNU A;  4I9D A;  3LSF B;  4JWX A;  1N04 A;  3MQ9 A;  3O2A A;  1US5 A;  4M4G A;  3VE1 B;  2FYI A;  2BJJ X;  4NF8 A;  3FAS A;  3H6U A;  4KHZ E;  3V89 B;  2DE2 A;  2X7Q A;  5JEI A;  3I3V A;  3L6G A;  2QSX A;  2OK2 A;  3KFM A;  2WKY A;  2ZYM A;  4L17 A;  3U72 A;  4IO3 A;  4F18 A;  4KYS A;  3A3U A;  5H8S A;  4U2R A;  3B6T A;  3K1N A;  3SEY A;  4ZDM A;  5I56 A;  2DS9 A;  3H3G A;  3KJT A;  3C34 A;  4QSE A;  3MC2 A;  2E0S A;  2Z8E A;  4GXA A;  3I5O A;  3MZ9 A;  3W9W A;  2DYX A;  1B7H A;  1MDP 1;  4HTG A;  3H03 A;  3S9N C;  5H8Q B;  2VD3 A;  1CE2 A;  3QAX A;  4F2O A;  4GQO A;  4H65 A;  3Q27 A;  4LQ2 A;  2H99 A;  1H44 A;  3IOV A;  1B9J A;  2I6E A;  3EHT A;  5L9S A;  4ZZE A;  2CMO A;  4NF5 B;  4NF6 A;  4BDR A;  3B6Q A;  3IL1 B;  4BDM A;  4U4X A;  3ODB A;  1FTK A;  1DOT A;  3PV0 E;  1Q35 A;  1GVC A;  4DCX A;  3Q28 A;  2M8C A;  5KDT A;  1QW0 A;  3VVF A;  4JB7 A;  1SYH A;  4H0W A;  1QUK A;  2G29 A;  4R6Y A;  4FAJ A;  4YKK A;  2XXV A;  2Q2A A;  4NMY A;  1OQH A;  1RYO A;  5H8H B;  1XC1 A;  1B51 A;  3TMG A;  1MXW A;  2AL4 A;  1N0T A;  2Y7K A;  1USY E;  3OMB A;  4ISU A;  3AXF A;  3C32 A;  1M5D A;  3V8X B;  5AA2 B;  3MPL A;  5DEX A;  4OER A;  3F11 A;  3FD3 A;  3VXC A;  3S9E A;  3P7I A;  1MXZ A;  4YKJ A;  1N76 A;  2H5Y A;  1A54 A;  1JW5 A;  3OD7 A;  1VFD A;  4FJP A;  4G68 C;  1WOD A;  1VSO A;  2I4C A;  4PFY A;  2O51 A;  1S7Y A;  4U1Z A;  1B0H A;  2PYY A;  3RNN A;  1YTV A;  2Y7W A;  3EHS A;  3H7M A;  2UVG A;  4LZ8 A;  4YIC A;  3IJO B;  3N6T A;  4YZZ A;  3VLW A;  2IA4 A;  1UIU A;  1D9Y A;  3SDF A;  1EU8 A;  3TTM A;  1HSL A;  4GXS B;  2F5X A;  4ZEF A;  4N13 A;  1URS A;  4OET A;  1TT1 A;  3DEL B;  1MQJ A;  3K6U A;  1PBP A;  3KSX A;  4EXL A;  3HHF A;  3JYR A;  4AQ4 A;  3QUJ A;  3KG2 A;  4GLI A;  4JDF A;  2ZXT A;  3FVK A;  1ZKB A;  4DZ1 A;  3TYH A;  3IX1 A;  4DXU A;  1B3F A;  1LFG A;  1EH3 A;  1LBC A;  3E9X A;  1A99 A;  3PMX A;  4MFI A;  4QFK A;  1OLC A;  2I0C A;  1Y9U A;  3TTR A;  3TCG A;  3FV2 A;  1CB6 A;  5B7D A;  4XKR A;  5JTY B;  3RGY A;  4F1Y A;  1DPE A;  3C33 A;  1SDX A;  1XT8 A;  1UTB B;  2F36 A;  1NNK A;  1H43 A;  2QS2 A;  5DVF A;  4C0R A;  5CMK A;  4FE8 A;  5DVI A;  4U1O A;  3TQL A;  1MXX A;  3MVZ A;  3C35 A;  4MF3 A;  1M5B A;  2VP1 A;  1ZTY A;  3OEM A;  4F1V A;  3GBA A;  3IOT A;  2ZYO A;  5H8F B;  3UA8 A;  2D5W A;  3R6U A;  4PET A;  3FVO A;  3D4C A;  3CFZ A;  1H3D A;  4ZEI A;  4IO2 A;  2Y7R A;  3LBS A;  3K2D A;  5JTY A;  4C1T A;  1T0K A;  4WED A;  1XVX A;  2FNC A;  2XXT A;  3H06 B;  3SKP A;  4EQ7 A;  3OOA A;  5EHM A;  3Q29 A;  1B3G A;  4MLV A;  4NWC A;  5ELV A;  1MPD A;  3IR1 A;  4U23 A;  4ZZA A;  2NUV A;  4QF9 A;  5ITO A;  3VLU A;  3LR1 A;  3V5A A;  4YKI A;  4EUO A;  4F29 A;  4F22 A;  5CC2 A;  1PC3 A;  1Y4T A;  1RKM A;  1IXI A;  3PU5 A;  5I2K A;  5CBS A;  1FTL A;  4WKM A;  3VVE A;  2A5T A;  3N26 A;  3PPN A;  1Z7M E;  4LON B;  3H4Z A;  4NF5 A;  1SBP A;  3K1M A;  1D9V A;  1FQD A;  1B3L A;  2AYS A;  2R6G E;  2UVH A;  3FXR A;  1WVJ A;  1GR2 A;  2O7I A;  3GZG A;  3ILU B;  3K01 A;  1URG A;  4GD5 A;  4JSD A;  3W9V A;  3TPA A;  3HV1 A;  3SEX A;  3PPR A;  3TDJ A;  1LBB A;  2RCB A;  3JZJ A;  4FEC A;  1Y3N A;  4EF1 A;  4YB5 A;  1SW1 A;  3FXU A;  3RN8 A;  3O29 A;  2G93 A;  3IJX B;  2O6A A;  3CG1 A;  3TUS A;  5ISU A;  4C1U A;  1PDA A;  3IOW A;  4G4P A;  4KCD A;  1P1W A;  1OMP A;  1LAF E;  3MVX A;  4P0G A;  4UA8 A;  3G3J A;  4MH5 A;  3U92 A;  4PFT A;  4PFU A;  4EQB A;  1OVB A;  3MP8 A;  1MQD A;  5ICQ A;  5ICT A;  4OFO A;  1OIB A;  1QKA A;  3MW0 A;  4EQ9 A;  2O69 A;  4LQ5 A;  4OTE A;  1LB9 A;  2XXI A;  3T96 B;  3LSL A;  3O28 A;  3MPK A;  3OSQ A;  3TQW A;  3VLV A;  5I59 A;  5KCJ A;  1XS5 A;  4F2Q A;  3T93 B;  2RIN A;  5AA3 A;  1B40 A;  4NWD A;  1TWY A;  3FV1 A;  4LUB A;  1LFH A;  3A3C A;  5TPA B;  4GOT A;  4DLD A;  1S9T A;  2V84 A;  2HZL A;  1A8E A;  3G3I A;  1B1X A;  3C9H A;  4OXV A;  1DSN A;  3M3L A;  1UTH B;  2F7B A;  4O3B A;  3R26 A;  3SEU A;  1H45 A;  2RCA A;  5J1D A;  1MQI A;  4K3F A;  3O66 A;  3E13 X;  1O7T A;  2F7C A;  1ELJ A;  2Q89 A;  1PB8 A;  3DLN A;  3ECR A;  2F34 A;  3HN0 A;  3Q26 A;  4HCY A;  4NTL A;  5F1Q A;  1MXU A;  2Q2C A;  5A5X B;  4ESX A;  4KI0 E;  4KCC A;  1SI1 A;  1MXV A;  2KLF A;  4AB6 A;  3T9X B;  4NF6 B;  2DWA A;  4N6P A;  4Q30 B;  3RUM A;  1QJM A;  3SEW A;  1IQ7 A;  1US4 A;  4HCW A;  1GTK A;  1LST A;  3PUX E;  3I6V A;  4POW A;  2DVZ A;  4RPO A;  3T9U A;  2D21 A;  3PMW A;  4ZEC A;  5I2N A;  3MJN A;  1I69 A;  1N84 A;  4N07 A;  2X7P A;  4FIM A;  3G3H A;  4QFL A;  3TZA A;  4F39 A;  3M3F A;  3RTW B;  2O7U A;  4U22 A;  1O63 A;  1ZU0 A;  4G68 A;  4X1B A;  4OYV A;  1MY2 A;  3UP9 A;  4IGR A;  1XOC A;  1A8F A;  1LAG E;  2DVC A;  4QFO A;  4JWO A;  4U21 A;  1O64 A;  2W7Y A;  3HHG A;  2HAV A;  3IOR A;  3KN8 A;  1ATG A;  1LGB C;  1MM6 A;  4NF4 A;  4OHN A;  2Z23 A;  3MVW A;  3K1P A;  4R6K A;  3QYT A;  1DMB A;  1MDQ A;  1IZ1 A;  3U94 A;  2Q88 A;  4OEN A;  2IEE A;  1ZLQ A;  5H8N A;  1IXG A;  4H5G A;  2QS4 A;  3LSW A;  3RPW A;  1VR5 A;  1Y3Q A;  4IO6 A;  4R73 A;  1ZJL A;  2YLN A;  2QMW A;  4FEB A;  3MWB A;  3CSB A;  1USY H;  2I3W A;  4XKQ A;  4ELR A;  4ONY A;  3G3G A;  1QVS A;  5DT6 A;  1P1N A;  1SW4 A;  2NXO A;  1HSJ A;  3CRB A;  3S2V A;  4I8C A;  3E3K A;  1LB8 A;  3T66 A;  1BIY A;  4IGT A;  4YU0 A;  4GWO A;  2CZL A;  2VHA A;  5EYF A;  4XXU A;  4KQP A;  5FTI A;  1MY4 A;  3TKD A;  1MQG A;  4GIZ A;  3K4U A;  1D4N A;  3KN3 A;  4QSC A;  3RY3 A;  4AB5 A;  3N5L A;  3HCQ A;  3O6H A;  1B4Z A;  3ZKK A;  1B3H A;  3ZS6 A;  2ABH A;  1SI0 A;  3G7W A;  3TEL A;  3L6H A;  3LC8 A;  4JWY A;  3GBB A;  4R2B A;  4LZ5 A;  1P99 A;  2OLB A;  3FVN A;  3PUZ E;  3VFJ A;  2XXY A;  4GRK A;  1TXF A;  2I0B A;  4OFJ A;  5CBR A;  4GFR A;  5HBC A;  2QS3 A;  4M1V A;  3B7D A;  2V25 A;  4Q8R A;  5HPQ A;  4R9F A;  3G3K A;  2F97 A;  1IXC A;  1LCF A;  1R9Q A;  4X9T A;  3H6V A;  3PD9 A;  1UIV A;  4DCY A;  2H25 A;  3A09 A;  5AA4 A;  5AE4 A;  2DE4 A;  1IUD A;  2QS1 A;  1D3K A;  4U4S A;  3RTF B;  3USD A;  4HW8 A;  1B52 A;  3G3F A;  1R6Z A;  3ZSF A;  3IK6 B;  1Y3P A;  4G77 A;  2XHD A;  4TLL B;  4F19 A;  2A5S A;  1B58 A;  1Y1M A;  2ONR A;  4XKP A;  5L9M A;  4QFN A;  3GXA A;  3IB1 A;  4R74 A;  1B1H A;  4OES A;  2AIX A;  2REJ A;  4QRZ A;  3S4U A;  1A55 A;  2VGQ A;  1B3E A;  3DM0 A;  4O3C A;  4BDO A;  1EZO A;  5I58 B;  2R9J A;  2PBW A;  4RNS A;  1NNP A;  3IO6 A;  5BUU A;  1PBQ A;  3B6W A;  5HM4 B;  2ZNT A;  1SQY A;  2UVJ A;  4GL8 A;  3CR9 A;  2OWS A;  3PUV E;  3QSL A;  1PB7 A;  2GRV A;  4Q5T A;  4IY6 A;  3JV9 A;  5IKB A;  2XXH A;  3TTN A;  1MPB A;  4KR5 A;  2H4I A;  3FVG A;  3S9M C;  2DWI A;  5CMB A;  1QUJ A;  3OSR A;  1JW1 A;  3KEI A;  2I3V A;  1SYI A;  3MBP A;  2DXR A;  2O68 A;  2QMX A;  3PPP A;  2YPN A;  1AL3 A;  2OWT A;  3OO8 A;  2HXW A;  1I6A A;  2ZNS A;  1N3W A;  1BLF A;  2O1L A;  3Q25 A;  4NE4 A;  1NFT A;  4H8I A;  4R75 A;  2Q8J A;  5TU0 A;  5TP9 A;  2QPQ A;  1B6H A;  1IXH A;  3PUW E;  1ZIU A;  5I2K B;  3T9H B;  3MAM A;  4I62 A;  3RLF E;  3K6W A;  4XIG Q;  2ZMB A;  1FQE A;  3FZV A;  1UTH A;  3VXB A;  4OEU A;  3KN7 A;  5KCJ B;  1QKB A;  3ILT B;  2RF1 A;  3TTK A;  1GGG A;  4OZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...