4OEUA

Crystal structure of nikz from campylobacter jejuni in complex with ni(l-his)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
493
structure length
493
Chain Sequence
IPKDTLIIAVENEIARINPAYSEDHDAVINLVFSGLTRFDENMSLKPDLAKSWDISKDGLVYDIFLRDDVLWHDGVKFSADDVKFSIEAFKNPKNNSSIYVNFEDIKSVEILNPSHVKITLFKPYPAFLDALSIGMLPKHLLENENLNTSSFNQNPIGTGPYKFVKWKKGEYVEFKANEHFYLDKVKTPRLIIKHIFDPSIASAELKNGKIDAALIDVSLLNIFKNDENFGILREKSADYRALMFNLDNEFLKDLKVRQALNYAVDKESIVKNLLHDYAFVANHPLERSWANSKNFKIYKYDPKKAEDLLVSAGFKKNKDGNFEKDGKILEFEIWAMSNDPLRVSLAGILQSEFRKIGVVSKVVAKPAGSFDYSKVDSFLIGWGSPLDPDFHTFRVFESSQDSALNDEGWNFGHYHDKKVDIALQKARNTSNLEERKKYYKDFIDALYENPPFIFLAYLDFALVYNKDLKGIKTRTLGHHGVGFTWNVYEWSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative peptide ABC-transport system periplasmic peptide-bi
publication title Promiscuous nickel import in human pathogens: structure, thermodynamics, and evolution of extracytoplasmic nickel-binding proteins.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 160
structure length 493
sequence length 493
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4oeuA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oeuA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 4oeuA02
1US4A 4PE5B 1BP5A 1I6QA 4QF9A 4G68C 3C34A 2DWHA 3E4RA 2I0CA 1MDP1 1N76A 3LBSA 4IO2A 3IK6B 4PETA 5DVIA 2HZLA 1FQAA 1ZBMA 4P0IA 1Y1MA 2XXQA 2I4BA 2DSFA 1URSA 2PVUA 3FJMA 1S9TA 2ZMBA 3OSQA 3TFLA 4NF6B 3V83A 2B4MA 2DWIA 2ONKE 3UA8A 3O29A 1OIBA 1KWHA 3GBBA 3N6UA 3S9EA 4PFUA 2GHBA 3F11A 1HSLA 1FCKA 1FW0A 5L9SA 3MQ9A 4GD5A 4YICA 3FVGA 3GLBA 3CSBA 5AA4B 4YZZA 4OESA 3GZGA 1BLFA 1D4NA 2UYFA 2O7UA 3DRFA 2QS3A 3TTMA 1MXZA 4RK2A 5EYFA 4BDLA 1H76A 2E1SA 1URGA 3OEMA 4QRZA 2F7CA 1T0KA 4MFIA 1LBBA 2BJJX 4HCWA 3KG2A 1IQ7A 2F36A 3MW0A 1N04A 4AB6A 3O28A 3DRKA 2I49A 3DP6A 2Y7PA 4HW8A 2QL3A 2XX7A 4GVOA 2F5XA 4OHNA 4JWXA 3IL1B 1VR5A 3PPQA 5I58B 3M8UA 3IORA 1SYHA 1QVSA 2QS1A 4PQJA 4GQOA 4LA9A 3PPRA 3EQ1A 4IO6A 4KYSA 2DE3A 2AL4A 4GL8A 3DRGA 3PPPA 4NF5B 4JDFA 2WOKA 1RYOA 5H8QB 2I3WA 1P1WA 2RINA 1JNFA 3HV1A 3UIFA 3LSLA 1P99A 1B1XA 5H8HA 4H8IA 5CBRA 3PD9A 4IB2A 1A8EA 3K1PA 2NWJA 1JEVA 2Z8FA 3TQWA 2UVHA 3O6IA 1JW1A 2OJTA 3SEWA 2Q89A 2F35A 1NNTA 4C0RA 3U94A 3TELA 2XX9A 1N84A 3C36A 1VSOA 4O3CA 1QUKA 4YKKA 1JW5A 3CI8A 3PUXE 3FV2A 3L6HA 4U4XA 4PFYA 4U1ZA 3USDA 4U21A 4NF6A 3EN3A 3THIA 3VXBA 3IJOB 2UVJA 2X7QA 3T9HB 2DS9A 1HSJA 3LC8A 4MF3A 5ELVA 5F1QA 5IKBA 1JW4A 1B46A 3DRJA 1MPBA 1Y4CA 3N26A 3EHTA 5L9MA 4AQ4A 4DLDA 5I59B 3IAZA 4POXA 4FATA 1MH3A 3HPIA 3ZKLA 3KOTA 4GLIA 5I2NB 4QFOA 2P2AA 3RUMA 1IITA 5B70A 5ITPA 3O9PA 4THIA 3PPNA 3CR9A 4U1OA 1ANFA 3S9LC 1CB6A 3HHGA 1NKXA 1FTJA 3R6UA 2PYYA 4KI0E 2FNCA 3C4MA 3E13X 3RT8A 2QPQA 3MZ1A 2VOZA 1PC3A 4I8CA 4R74A 1P1NA 5F7VA 4F1UA 1GVCA 3HCQA 2ESNA 4R6YA 2X26A 2F78A 4KPTA 1QULA 2F7BA 4QFLA 3KJTA 3CFZA 4M1VA 4WEPA 4ZE8A 1DTZA 3W15C 3FV1A 5K2YA 1DPPA 3G3GA 3U8QA 3DP4A 1ZIUA 3PGFA 1UTBB 2Y7WA 3H03A 4R9GA 1MDQA 1A99A 3EHUA 3CFLA 1ATGA 1CE2A 1QUJA 3TKDA 3IB2A 4Z7EA 4G8MA 3UGWA 4KR5A 3MVZA 5JK4A 2XXPA 3HO7A 4U23A 2OK2A 5AA1A 4YKIA 4JBZA 3TODA 3G3KA 1TWYA 3K2DA 4Z0IA 2W7YA 2PT1A 3PMVA 3VV5A 4F3BA 1LBCA 3CFXA 3V5AA 5AA2A 4XKNA 4P0GA 3SETA 4HCYA 3RTWB 3LUYA 3RT6B 4LATA 2E0SA 2XXTA 1II5A 1MY0A 1EZOA 4JXIA 1MXUA 3IB1A 4F22A 1MS7A 4OWDA 1N0TA 3TEPA 4XKQA 5JTYB 1H3DA 2FYIA 2REJA 2DXRA 4F3SA 5I57B 1H43A 5I59A 2B65A 2A5TA 3MZBA 2DWAA 3Q29A 2OWSA 5I2NA 3KN7A 3V89B 2H9BA 1MG1A 4GIZA 3MP1A 4ECFA 4DZ1A 1XS5A 2O7IA 2IA4A 3T93B 4C1UA 4YB6A 1D9VA 4NMYA 4DXCA 1SW5A 1Y4TA 4OQOA 1JVYA 4GXSB 5FTIA 3S4UA 3PUWE 3K1MA 2V3TA 2NUVA 3EHSA 2V84A 5HM4B 1B4ZA 3C35A 3QYTA 1LGBC 2OZZA 3AXFA 1UIUA 2NXOA 5DEXB 3MZ9A 4TQUQ 5KDTA 1D3KA 3TUSA 2RF1A 2Q8JA 1Q1KA 4IO5A 3TZAA 4U4SA 1M5EA 1M5FA 3K0VA 1ZTYA 4BDRA 2F6GA 1MY1A 3FATA 4KYEA 4EF1A 3HSTA 3OO8A 1B58A 2HQ0A 3OELA 3QSLA 3T96B 1H45A 2ZNSA 3T9XB 4R6HA 1B5IA 4KCCA 4WKMA 1MPDA 4RY1A 2ALUA 2G29A 5J1DA 2I4CA 3OO9A 3FJGA 4L17A 4YMBA 5KCJB 3VVFA 2O51A 3RNNA 3T9VA 3TTKA 4ESXA 1XVYA 1O63A 1SBPA 3FVOA 4XKRA 4FJPA 5TP9B 5FTHA 1SW4A 4I9DA 5M2VA 1UTHB 2RKMA 3IX1A 3QK6A 2Z23A 3MP6A 1IXHA 4I62A 3U72A 3UK4A 3WAEA 3PMWA 5HPQA 2GFEA 3U93A 1MM7A 3R7XA 3FVKA 1ZKBA 2M8CA 3TTNA 3IB0A 5HBCA 3QUFA 2XXYA 5JTYA 4H0WA 1POY1 3BKIB 2DOJA 2XHDA 2CZLA 1Y3PA 3LSFB 3ILUB 4RPNA 2AIXA 2F6PA 3SEUA 3P7IA 3M3FA 5AE4A 1QW0A 2XXUA 3A09A 1I69A 4TOZA 5JEIA 2VP1A 1B5HA 1LAFE 1DOTA 4LZ5A 4DCYA 4YKJA 5I2KA 1Y1ZA 4YMAA 5FHMA 3VVDA 3IR1A 4RXLA 3M3KA 2H4IA 4EQ9A 1S7YA 4NEDA 3LR1A 4NF8B 2ZYMA 2OBGA 1MQGA 2PMSA 4ZEFA 1MQDA 1MY4A 3MAMA 4KFQA 2I3VA 3KZGA 2HZKA 5H8NA 4FEBA 2Z8DA 3UN6A 1WVJA 4OEVA 2KLFA 5A5XB 4U2RA 3EPEA 3D4GA 4G77A 3TTRA 1LFIA 3G7WA 3RY3A 1VE4A 2I6EA 4OENA 4R72A 1QKBA 4KCDA 3H6VA 3OSRA 3UORA 4G68A 3EF7A 3U92A 1F9BA 5KCJA 1P1UA 1B7ZA 3SEVA 4X1BA 2THIA 3DM0A 2QSXA 2Q2CA 1PDAA 3B6WA 4EQBA 3VVEA 2YPNA 3QXMA 5I56B 1FQBA 1MXYA 3Q25A 1Y3NA 4LZ8A 1FTLA 1DSNA 4R2BA 5AA2D 4WXJA 3D4CA 3TAJA 2F97A 3A3CA 4UA8A 4EXKA 1LB9A 4UACA 3SDFA 3CVGA 2O1MA 1ZU0A 5L9OA 5DVJA 1DMBA 4OEUA 4ND9A 3I5OA 3OEKA 1JETA 4FECA 1N7WA 1NH8A 4QSDA 3U1OA 4JSOA 1SW1A 3G3JA 3MC2A 4DDDA 4H1XA 2ZYKA 3R26A 1PB9A 3H4ZA 4MLVA 4YAHX 2WKYA 3B6TA 3L6GA 1GGGA 5CM6A 2AL5A 4F2QA 5ICQA 5DTBA 1XHYA 1FQEA 5AA4A 4X9TA 1QUIA 2R6GE 3KBRA 1FQDA 2DVCA 4RPOA 2UYEA 1SI1A 1IIWA 1YCJA 2Q9TA 2RCBA 4KYDA 2REGA 4IGTA 1PBQA 3FZVA 2RC8A 2O69A 1LSTA 1GTKA 1A8FA 3B6QA 4MH5A 3HHFA 1I6AA 4OVJA 4LUBA 5B7DA 3LSXA 4E0XA 1LCTA 3C32A 1GV8A 4LONB 3FASA 2H98A 5BWJA 4YKPA 2QS2A 2UVIA 2XXHA 4N07A 3H3GA 3PD8A 5I58A 1B3FA 4GFRA 3CG1A 3MUQA 3O6GA 4LP2B 1M5DA 3RTFB 5ITOA 1WODA 1I6BA 1B1HA 4QHQA 2XXVA 2DVZA 3O6PA 3TCGA 4LQ2A 3Q26A 4IO3A 3DRHA 2DXYA 4NF5A 5H8QA 3K02A 1A55A 1MPCA 3BBRA 2OCUA 3BFTA 2XD3A 1SDXA 4TLLB 1B40A 3PUZE 4Q8RA 4ISUA 5TPAB 1RYXA 1PBPA 1QJMA 1AL3A 4IO7A 4BLAA 1PB8A 2ZNUA 3RYAA 4I1DA 4DE8A 1B4HA 2ZYOA 4IY5A 2V3QA 2DWJA 1XC1A 1R9LA 1BIYA 5L8DA 1USYE 4Q5TA 3K6XA 4BDOA 3SKPA 5H8FB 3GXAA 1GR2A 2ONSA 3KN3A 2F7AA 3PUYE 1OQGA 4ZEIA 2QMWA 2XD2A 4JSDA 5KZTA 2DE2A 4H6DA 3IJXB 2DYXA 4DCXA 1LLSA 3FXQA 3C31A 2RC7A 4NTLA 1P1QA 3C9HA 4FEDA 4F3GA 1IUDA 1MXWA 2D21A 1SVXB 3FGSA 2X7PA 3W9WA 1DTGA 1XVXA 4Q0CA 4FE8A 4OETA 4MBPA 4RA1A 4KHZE 2ANJA 3IOVA 5CC2A 3ONMA 1NH7A 1UQWA 3MVYA 3K4UA 3TMGA 3RN8A 4F1VA 4G8HA 3H6TA 1ZJLA 4FAJA 2I58A 3VE1B 3PUVE 1XOCA 4WEDA 3MBPA 3JYRA 3E9XA 1B3GA 1Q35A 2CMOA 5CMMA 1RKMA 4YU0A 4LVQA 4R9FA 5CMKA 4ZS9A 1O7TA 1LAHE 1UTBA 2HAVA 4NWDA 3W9VA 1B7UA 1VFDA 3N94A 3T66A 4FORA 3VXCA 4H65A 3I6VA 1Z7NE 1AMFA 2A5SA 1BTJA 1EH3A 5TPAA 1JEUA 3K00A 3H06B 2UVGA 3FUZA 4Q30B 3KSJA 3KEIA 3VFJA 4RNSA 2Y84A 3PAMA 3HN0A 4EXLA 4F31B 2R71A 3CSGA 5H8HB 3QUJA 2H99A 4OFLA 1LFHA 5EHMA 4ELOA 4O3BA 3I3VA 3K6WA 1OVBA 2D3IA 1EU8A 4DIGA 1IZ1A 4K3FA 3T22A 3QIMA 2VD3A 1ZLQA 4GRKA 2NVUB 4HTGA 4QFNA 4EQ7A 4EDPA 1NNFA 4ZECA 3MPLA 1SI0A 2ONRA 3ZKKA 5EHSA 1B9JA 1Y9UA 3DELB 3IO6A 5I57A 4OTEA 2GH9A 4PP0A 2Q88A 1AOVA 3FIRA 4IGRA 1AIVA 3O2AA 4GOTA 3MWBA 2D5WA 4F3PA 3FVNA 3S2VA 3TTLA 1AH5A 4ZEDA 3FXRA 4RK9A 2XXIA 1MXXA 3FJ7A 3FTOA 3G3FA 2HXWA 2I48A 1R6ZA 3KGCA 1EZ9A 2QMXA 5TU0A 1FTOA 3K01A 5DEXA 2H5YA 4R2FA 4E0WA 2WOLA 4ZDMA 4ZEBA 4H67A 4F18A 3QAXA 4ONYA 1LCFA 3N6TA 2HCAA 2PBWA 2B3BA 2B4LA 4KQPA 4AB5A 4OERA 1MRPA 4EF2A 3IOWA 4G4PA 2ZYNA 1MY2A 2Y7KA 1R1NA 5LOMA 2FA7A 1O64A 3VLWA 4M4GA 5DVFA 3O66A 4OZ9A 2QJEA 1Y20A 4IO4A 2O1LA 1B0HA 4XXUA 2Y7RA 3ZSFA 1OLAA 1POTA 2GHAA 1N3XA 5BUUA 4ELQA 4U22A 4H5FA 2V3UA 3K6UA 1A7LA 1A40A 3OO7A 4YB7A 4ELRA 1YAEA 5TP9A 4QFKA 1UTHA 1FQFA 2LAOA 5DT6A 1SYIA 3VLVA 4P11A 2RC9A 2F8DA 3CHGA 1XT8A 1B51A 3LVUA 3DRIA 2R9JA 3MP8A 5CI5A 4FIMA 3IO4A 4ZZEA 3JZJA 1FTKA 4H8JA 2UXAA 2PT2A 1MQIA 5AA2B 1US5A 3JV9A 4JWOA 2WOPA 3TYHA 3RPWA 3FXUA 3PPOA 2Y7IA 2O68A 2RCAA 1VFEA 4OYVA 2DQVA 1TXFA 3ILTB 1LAXA 3A3UA 4KD5A 3OMBA 1LFGA 2YLNA 2VGQA 3UP9A 2GRVA 1IEJA 1YTVA 2P0SA 1LB8A 3LSWA 1SW2A 1IXIA 1FQCA 1FTMA 5FHOA 1IXGA 1TFDA 4F2OA 4X48A 4OFOA 1TFAA 2VD2A 2QS4A 3OO6A 4NWCA 4TLMB 3G3HA 4NE4A 4PFWA 2QRYA 2ZNTA 4ZE9A 3IOTA 4XTCQ 2A5TB 2Z22A 3H6WA 2DP8A 4IY6A 4G2ZA 2F34A 2O6AA 1D9YA 4NF8A 3E3KA 1M5BA 1OMPA 4X1DA 3C33A 3SERA 5ICTA 3S9MC 1S50A 2G93A 1OQHA 5CMBA 1NFTA 1PB7A 3KN8A 5CBSA 4PFTA 5A5XA 4YB5A 4EUOA 3MPKA 1B3LA 3H7MA 4F39A 3PV0E 1QKAA 3FD3A 2YJPA 3RYBA 3KOSA 3GBAA 3PU5A 4O3AA 1SQYA 5CMCA 1SD3A 5CRYA 5KDTB 3ECRA 3K6VA 2XXRA 4NF4B 4DXUA 4R73A 4LQ5A 1A54A 3OENA 1N7XA 3DLNA 3TCFA 2VHAA 1L5TA 3MVWA 2Q2AA 1OVTA 5K2XA 5AA3A 1MQHA 3VLUA 1HSEA 1URDA 3B7DA 5I56A 3KFMA 2O84X 1ZMGA 1P1OA 1NNPA 2PX1A 4BDQA 3TPAA 2I0BA 3CRBA 5IAIA 3SEXA 1USYH 4GF8A 1B3HA 4G8NA 4F1YA 2XX8A 3OOAA 1B0LA 2IEEA 1ELJA 3ZS6A 2Z8EA 4HS7A 3RGYA 2XXXA 1B05A 1MQJA 3OXNA 1B32A 2HEUA 3M3LA 3K1NA 4BDMA 3SESA 3Q28A 2H25A 1B52A 5I84A 4XIGQ 3T9UA 3OD7A 2HAUA 4RJZA 4MLQA 1NMUA 3O97A 4ZEKA 4POWA 1NL5A 1JQFA 1B3EA 4R75A 3PMXA 1B5JA 3N5LA 4F29A 4ESWA 2HFBA 4C1TA 1LAGE 2V93A 1MXVA 4N13A 1YPNA 3TDJA 3CG3A 1B6HA 2ABHA 1BKAA 1Y3QA 1J1NA 5FHNA 3VDFA 3IOUA 2V25A 3CIJA 2OLBA 1MY3A 3TQLA 4ZZAA 3ODBA 2DE4A 1OLCA 3WAFA 1UIVA 4N6PA 4LZ7A 1R9QA 4RYAA 3V8XB 5I2KB 1NNKA 3KSXA 4JB7A 4GL0A 2AYSA 4H5GA 4QFPA 5H8SA 1IXCA 2B3FA 2OWTA 1MM6A 3SEYA 4GWOA 1Z7ME 4QSCA 3H6UA 1JVXA 1WDNA 4JWYA 4NF4A 3MJNA 1B7HA 2NOOA 3G3IA 4OFJA 5H8NB 4OXVA 3RLFE 3RQTA 1EZPA 3KJ7A 5DYHA 3Q27A 4OMBA 1M5CA 4F19A 4QSEA 1DPEA 3MVXA 1MH4A 3O6HA 4XKPA 1H44A 3S9NC 3BFUA 1TT1A 4ELPA 2XXWA 1PEBA 4GXAA 1B2HA 4G68B 3DP8A 4R6KA 2ZXTA 2P1SA 5H8FA 1N3WA 4BDNA 4DXBA 5ISUA 3TCHA
chains in the Genus database with same CATH superfamily
4MNIA 1US4A 4PE5B 1BP5A 1I6QA 4QF9A 4G68C 3C34A 2DWHA 4O7MA 3E4RA 1NV1A 2I0CA 1MDP1 1N76A 3LBSA 4IO2A 3IK6B 4PETA 5DVIA 2HZLA 1FQAA 1ZBMA 4P0IA 1Y1MA 2XXQA 2I4BA 2DSFA 1URSA 2PVUA 3FJMA 1S9TA 2ZMBA 3OSQA 3TFLA 4NF6B 1LBVA 3V83A 2B4MA 2Q74A 2DWIA 2ONKE 3UA8A 3O29A 1OIBA 1KWHA 4QXDA 1LBYA 3GBBA 3N6UA 3S9EA 4PFUA 2GHBA 3F11A 1HSLA 2FIEA 1FBGA 2VT5A 1FCKA 1FW0A 5L9SA 3MQ9A 4GD5A 4YICA 3FVGA 3GLBA 1YZ0A 3CSBA 5AA4B 1EYKA 4YZZA 4OESA 2P3NA 3GZGA 1BLFA 1D4NA 2UYFA 5IZ3A 2O7UA 3DRFA 2QS3A 1AWBA 3TTMA 1MXZA 1XI6A 4RK2A 5EYFA 4BDLA 1H76A 3BIHA 2E1SA 1URGA 3OEMA 4QRZA 2F7CA 1T0KA 2L5VA 4MFIA 5IZ1A 3FBPA 1LBBA 2BJJX 3KC0A 4HCWA 3KG2A 1IQ7A 5A5LA 2F36A 3MW0A 1N04A 4P9KA 4AB6A 3O28A 3DRKA 2I49A 4PF8A 3DP6A 2Y7PA 4HW8A 2QL3A 2XX7A 4GVOA 2F5XA 4OHNA 4JWXA 3IL1B 1VR5A 3PPQA 5I58B 3M8UA 3IORA 1SYHA 1QVSA 2QS1A 3E78A 4PQJA 4GQOA 4LA9A 3PPRA 3EQ1A 4IO6A 4KYSA 2DE3A 4OVTA 2AL4A 3RPLB 4GL8A 4N17A 3DRGA 3PPPA 4NF5B 4JDFA 2WOKA 1RYOA 5H8QB 2I3WA 1P1WA 2RINA 1JNFA 3HV1A 3UIFA 3LSLA 1P99A 1B1XA 4MEVA 5H8HA 4H8IA 1IMDA 5CBRA 4NHBA 3PD9A 4IB2A 1A8EA 3K1PA 2NWJA 1JEVA 4GX6A 2Z8FA 3TQWA 2UVHA 2QVVA 3O6IA 2OX3A 1JW1A 2OJTA 2PCRA 3SEWA 2Q89A 3IFCA 2F35A 1NNTA 4C0RA 3U94A 3TELA 2XX9A 1N84A 3C36A 3U65A 1VSOA 4O3CA 1QUKA 4YKKA 1JW5A 3CI8A 3PUXE 3FV2A 3L6HA 4U4XA 4PFYA 4U1ZA 3USDA 4U21A 4NF6A 3EN3A 3THIA 3VXBA 3IJOB 2UVJA 2X7QA 3T9HB 2DS9A 1HSJA 3LC8A 4MF3A 5ELVA 5F1QA 5IKBA 1JW4A 1B46A 3DRJA 1MPBA 1Y4CA 3N26A 4MHFA 1NUXA 3EHTA 2Q8MA 5L9MA 4AQ4A 4DLDA 5I59B 3IAZA 4POXA 4FATA 2OWZA 1MH3A 3HPIA 3ZKLA 3KOTA 4GLIA 5I2NB 4QFOA 2P2AA 3RUMA 1IITA 5B70A 5ITPA 3O9PA 4THIA 3PPNA 3CR9A 1DK4A 4U1OA 1ANFA 3S9LC 1CB6A 2QFLA 3HHGA 1NKXA 4I40A 1FTJA 3R6UA 2WBBA 2PYYA 4KI0E 2FNCA 3C4MA 3E13X 3RT8A 2QPQA 3MZ1A 5LDZA 2VOZA 1PC3A 4I8CA 4R74A 1P1NA 5F7VA 4F1UA 1GVCA 3HCQA 1D9QA 2ESNA 4R6YA 2X26A 2F78A 4KPTA 1QULA 2F7BA 4QFLA 3KJTA 3CFZA 4M1VA 4WEPA 4XEQA 4HE0A 4ZE8A 1DTZA 3W15C 1G0HA 3FV1A 5K2YA 1DPPA 3G3GA 3U8QA 3DP4A 1ZIUA 4H45A 3PGFA 1UTBB 2Y7WA 3H03A 3RPLA 4R9GA 4O94A 1MDQA 1A99A 1FBEA 3EHUA 3CFLA 1ATGA 3B8BA 1CE2A 1QUJA 2FBPA 3TKDA 3IB2A 4Z7EA 4G8MA 3UGWA 4KR5A 3MVZA 5JK4A 2XXPA 3HO7A 4U23A 2OK2A 5AA1A 4YKIA 4JBZA 3TODA 4XF5A 3G3KA 1TWYA 3K2DA 4Z0IA 5IGAA 2W7YA 1LBWA 2PT1A 3PMVA 3VV5A 4F3BA 1LBCA 3CFXA 3V5AA 2Y5LA 5AA2A 4XKNA 2BJIA 4P0GA 3SETA 4HCYA 3RTWB 4GWUA 3LUYA 3RT6B 4LATA 2E0SA 2XXTA 1II5A 1MY0A 1EZOA 4JXIA 3A29A 1MXUA 3IB1A 4F22A 3E79A 1MS7A 5ET5A 1FPDA 4OWDA 1N0TA 2MKZA 2XWVA 3TEPA 4XKQA 5JTYB 1H3DA 2FYIA 2REJA 2DXRA 4F3SA 5I57B 1H43A 5I59A 2B65A 2A5TA 3MZBA 2DWAA 3Q29A 2OWSA 5I2NA 3KN7A 3V89B 2H9BA 1MG1A 2VPNA 4GIZA 3MP1A 4ECFA 4OA4A 4DZ1A 1XS5A 2O7IA 2IA4A 3T93B 4OVRA 4C1UA 4YB6A 1D9VA 4NMYA 4DXCA 2HPGA 1SW5A 4PFBA 1Y4TA 5ET7A 4OQOA 1JVYA 4GXSB 5FTIA 3S4UA 3PUWE 3K1MA 2V3TA 2NUVA 3EHSA 2V84A 5HM4B 1B4ZA 3C35A 3QYTA 1LGBC 1YXIA 2OZZA 3AXFA 1UIUA 2NXOA 4GX4A 5DEXB 3MZ9A 2CZKA 4TQUQ 2GQ1A 5KDTA 1D3KA 3TUSA 2RF1A 2Q8JA 1Q1KA 4IO5A 4NGUA 3TZAA 4U4SA 1M5EA 1M5FA 2HHMA 3K0VA 1ZTYA 4BDRA 2F6GA 4DI4B 1MY1A 3FATA 4KYEA 4EF1A 3HSTA 3OO8A 4P47A 1B58A 2HQ0A 2XWIA 3OELA 3QSLA 3T96B 1NUZA 3MSTA 1H45A 2JJKA 2ZNSA 3T9XB 1NUWA 4R6HA 1B5IA 2XA5A 4KCCA 4WKMA 1MPDA 2KQZA 4PDDA 4RY1A 2ALUA 2G29A 4N4UA 5J1DA 2I4CA 3OO9A 3FJGA 4L17A 4YMBA 5EYGA 5KCJB 3VVFA 2O51A 3RNNA 3T9VA 3TTKA 4ESXA 1XVYA 1O63A 1SBPA 3FVOA 4XKRA 4FJPA 5TP9B 5FTHA 1SW4A 4I9DA 5M2VA 1UTHB 2RKMA 3IX1A 1FRPA 1FPJA 3QK6A 1FBDA 2Z23A 3MP6A 1IXHA 4P1EA 4I62A 3U72A 3UK4A 3WAEA 3PMWA 5HPQA 2GFEA 3U93A 1MM7A 3R7XA 3FVKA 1ZKBA 1NV7A 2M8CA 3TTNA 2CZIA 4JVCA 3IB0A 4X8RA 1IMBA 5HBCA 3QUFA 2XXYA 1FJ6A 5JTYA 4H0WA 1POY1 3BKIB 2DOJA 2XHDA 2CZLA 1K9YA 1Y3PA 3LSFB 2VPOA 3PTYA 3ILUB 4PAIA 4RPNA 2AIXA 2F6PA 3SEUA 4PGNA 1BK4A 3P7IA 3M3FA 5ET6A 5AE4A 1QW0A 2XXUA 3A09A 1I69A 4TOZA 5JEIA 2VP1A 1B5HA 1LAFE 1DOTA 4LZ5A 4DCYA 4YKJA 5I2KA 1Y1ZA 4YMAA 5FHMA 2FHYA 1FPIA 3VVDA 3IR1A 4RXLA 3M3KA 2H4IA 4EQ9A 1S7YA 4NEDA 3LR1A 4NF8B 2ZYMA 4HXVA 2OBGA 4NN3A 1QGXA 1MQGA 2PMSA 4PFIA 1FPFA 4ZEFA 1RDYA 1MQDA 1MY4A 3MAMA 4KFQA 2I3VA 3KZGA 2HZKA 1NV0A 5H8NA 4FEBA 2Z8DA 3UN6A 1WVJA 4OEVA 2KLFA 5A5XB 4U2RA 3EPEA 3D4GA 4G77A 3NOHA 2FIXA 3TTRA 1LFIA 3G7WA 3RY3A 1VE4A 2I6EA 4OENA 4R72A 1QKBA 4KCDA 3H6VA 3OSRA 3UORA 4G68A 3EF7A 4PE3A 3U92A 1F9BA 2WBDA 5KCJA 4N91A 1P1UA 1B7ZA 3SEVA 4X1BA 2THIA 3DM0A 2QSXA 2Q2CA 1PDAA 3B6WA 4EQBA 3VVEA 2YPNA 3QXMA 4N6DA 5I56B 1FQBA 1IMFA 1MXYA 3Q25A 1Y3NA 4LZ8A 1FTLA 1DSNA 4R2BA 5AA2D 4WXJA 4GBWA 3D4CA 3TAJA 4N6KA 2F97A 3A3CA 4UA8A 4EXKA 1LB9A 4UACA 3SZPA 3SDFA 3CVGA 2O1MA 1ZU0A 5L9OA 5DVJA 1DMBA 4OEUA 4ND9A 3I5OA 3OEKA 1JETA 4FECA 1N7WA 1NH8A 4QSDA 3U1OA 4JSOA 1SW1A 3G3JA 3MC2A 4DDDA 1VDWA 4H1XA 2ZYKA 3R26A 1PB9A 1RDXA 3H4ZA 4MLVA 4YAHX 3LUZA 4OVSA 2WKYA 3B6TA 3L6GA 1GGGA 5CM6A 2AL5A 4F2QA 5ICQA 5DTBA 1XHYA 1FQEA 5AA4A 4X9TA 1QUIA 2R6GE 1DCUA 3QMFA 3KBRA 1FQDA 1DBZA 2DVCA 4RPOA 2UYEA 1SI1A 1IIWA 4MAGA 1YCJA 2Q9TA 2RCBA 4KYDA 2REGA 4IGTA 1PBQA 3FZVA 2RC8A 2O69A 1LSTA 1GTKA 1A8FA 3B6QA 4MH5A 3HHFA 1I6AA 4OVJA 4LUBA 5B7DA 3LSXA 4O8MA 4E0XA 1LCTA 3C32A 1GV8A 4LONB 4AS4A 2F3BA 2HXRA 3FASA 2H98A 3EKIA 5BWJA 4YKPA 2QS2A 2UVIA 3LV0A 2XXHA 4N07A 3H3GA 3PD8A 5I58A 1B3FA 4GFRA 3CG1A 3MUQA 3O6GA 4LP2B 4XFEA 4I3YA 1M5DA 1EYIA 4PFRA 3RTFB 5ITOA 1WODA 1I6BA 1G0IA 1B1HA 4QHQA 2XXVA 2DVZA 3O6PA 1NI9A 3TCGA 4LQ2A 3Q26A 4IO3A 3DRHA 2DXYA 5ESYA 4NF5A 4I3EA 4GX3A 5H8QA 3K02A 1KA0A 1A55A 1MPCA 3BBRA 2OCUA 3BFTA 2XD3A 1SDXA 4TLLB 1B40A 3PUZE 4Q8RA 4ISUA 5TPAB 1RYXA 1PBPA 1FPBA 1QJMA 5J16A 1AL3A 4IO7A 4BLAA 1PB8A 2ZNUA 3RYAA 4I1DA 4DE8A 1B4HA 2ZYOA 4IY5A 2V3QA 2DWJA 1XC1A 1R9LA 1BIYA 5L8DA 2XXKA 1USYE 4Q5TA 3K6XA 4BDOA 3SKPA 5H8FB 3GXAA 1GR2A 2ONSA 3KN3A 2F7AA 4P3LA 5EQ7A 3PUYE 1OQGA 3B50A 4ZEIA 2QMWA 2PFZA 2XD2A 4HE1A 4JSDA 5DW8A 5KZTA 2DE2A 4H6DA 3IJXB 2DYXA 4DCXA 1LLSA 2XWOA 4OVPA 3FXQA 3C31A 4X04A 2RC7A 4NTLA 2CEXA 1P1QA 3C9HA 4FEDA 3KC1A 4F3GA 1IUDA 1Q9DA 1MXWA 2D21A 1SVXB 3FGSA 2X7PA 5EYHA 3GYYA 2ZZWA 3W9WA 1DTGA 1XVXA 4Q0CA 4PAKA 4FE8A 4OETA 4MBPA 4RA1A 4KHZE 2ANJA 5T3JA 3IOVA 5CC2A 3ONMA 4P8BA 1NH7A 4MNPA 1UQWA 3MVYA 3K4UA 3TMGA 3RN8A 4F1VA 4G8HA 3H6TA 1ZJLA 4FAJA 2I58A 3VE1B 3PUVE 1XOCA 1IMAA 5IZ3B 4WEDA 3MBPA 3JYRA 3E9XA 4NF0A 1B3GA 4PAFA 1Q35A 1NV2A 2CMOA 5CMMA 1RKMA 4YU0A 1LBXA 4LVQA 5I3SA 4R9FA 5CMKA 4ZS9A 1O7TA 1LAHE 1UTBA 2HAVA 4NWDA 3W9VA 1NV4A 1NUYA 1B7UA 4NAPA 1VFDA 3N94A 3T66A 4FORA 3VXCA 4H65A 3I6VA 1Z7NE 1AMFA 4QBAA 2A5SA 1BTJA 1EH3A 5TPAA 1JEUA 3K00A 3H06B 2UVGA 3FUZA 4Q30B 3KSJA 3KEIA 3VFJA 4JVIA 4RNSA 2Y84A 3PAMA 4LN5A 3HN0A 4EXLA 4F31B 3IFAA 2DDKA 2R71A 3CSGA 1LEVA 5H8HB 3QUJA 5EQ9A 2H99A 4OFLA 1LFHA 4GWWA 5EHMA 4ELOA 4O3BA 3I3VA 4PTKA 1FBHA 3K6WA 1FSAA 1OVBA 2D3IA 1NV6A 1EU8A 1IZ1A 4K3FA 3T22A 4DIGA 3QIMA 2VD3A 1ZLQA 4GRKA 2NVUB 4HTGA 4QFNA 4EQ7A 4EDPA 1NNFA 4N8GA 4ZECA 3MPLA 2XWKA 1SI0A 4N15A 2V4CA 4P1LA 2ONRA 3ZKKA 5EHSA 1KA1A 1B9JA 1FBCA 1Y9UA 3DELB 3IO6A 5I57A 4OTEA 2GH9A 4PP0A 2Q88A 1AOVA 3FIRA 3KBZA 1FJ9A 4IGRA 1AIVA 3O2AA 4GOTA 3MWBA 2D5WA 4F3PA 3FVNA 3S2VA 3TTLA 1AH5A 4ZEDA 3FXRA 4RK9A 4FBPA 4KXPA 2XXIA 1MXXA 3FJ7A 3FTOA 5FBPA 3G3FA 2ZZXA 2ZZVA 5F24A 4MCOA 2HXWA 2I48A 1R6ZA 3KGCA 1EZ9A 2QMXA 5TU0A 1FTOA 3K01A 5DEXA 2H5YA 4R2FA 4E0WA 2WOLA 4IR8A 4ZDMA 4ZEBA 1CNQA 4H67A 4N81A 4F18A 3QAXA 4ONYA 1LCFA 3N6TA 2CZHA 2HCAA 2PBWA 2B3BA 4PC9A 2B4LA 4KQPA 4AB5A 4H46A 4OERA 1MRPA 4EF2A 3IOWA 4G4PA 4GBVA 1SPIA 2ZYNA 4AS5A 4GWYA 1MY2A 2Y7KA 5ET8A 1R1NA 3T1BA 5LOMA 2FA7A 1O64A 3VLWA 4M4GA 5DVFA 3O66A 4OZ9A 2QJEA 1Y20A 2QVRA 4IO4A 2O1LA 1B0HA 4XXUA 2Y7RA 3ZSFA 1OLAA 1POTA 2PFYA 2GHAA 1N3XA 5BUUA 4ELQA 4U22A 2F3DA 4H5FA 2V3UA 3K6UA 4OVQA 1A7LA 1A40A 2R8TA 3OO7A 4YB7A 4ELRA 1YAEA 5TP9A 4QFKA 1UTHA 1FQFA 2LAOA 5DT6A 1SYIA 3VLVA 4P11A 2RC9A 2F8DA 3CHGA 1XT8A 1B51A 3LVUA 3DRIA 2R9JA 3MP8A 5CI5A 4FIMA 4UABA 3IO4A 4ZZEA 3JZJA 5IM2A 1FTKA 4H8JA 4P56A 2UXAA 4MJOA 2PT2A 1MQIA 5AA2B 1US5A 3JV9A 4JWOA 2WOPA 2QVUA 3TYHA 3RPWA 3FXUA 3PPOA 4JVDA 2Y7IA 2O68A 2RCAA 1VFEA 4OYVA 2DQVA 1TXFA 3ILTB 1LAXA 3A3UA 4KD5A 3OMBA 1LFGA 2YLNA 3D1RA 2VGQA 3UP9A 4PBHA 2GRVA 1IEJA 1YTVA 2P0SA 1LB8A 3LSWA 1SW2A 1IXIA 1FQCA 1FTMA 5EQAA 5FHOA 1IXGA 1TFDA 4F2OA 4X48A 4OFOA 1TFAA 2VD2A 2QS4A 3OO6A 2WYPA 1FPLA 4NWCA 4GWZA 4TLMB 3G3HA 4NE4A 4PFWA 2QRYA 2ZNTA 4ZE9A 3IOTA 4XTCQ 2A5TB 2Z22A 3H6WA 2DP8A 4IY6A 4G2ZA 2F34A 2O6AA 1D9YA 4NF8A 3RYDA 3E3KA 4NQ8A 1M5BA 4PGPA 1OMPA 2Y5KA 4X1DA 3C33A 3SERA 5ICTA 1FBPA 3S9MC 1S50A 2G93A 1OQHA 5CMBA 4HE2A 1NFTA 1PB7A 3KN8A 5CBSA 4PFTA 5A5XA 4PDHA 4YB5A 4EUOA 3MPKA 4MNCA 1B3LA 3H7MA 4F39A 3PV0E 1QKAA 3FD3A 2YJPA 3RYBA 1FBFA 3KOSA 3GBAA 3PU5A 4O3AA 4GWSA 4N8YA 1SQYA 5CMCA 1SD3A 1LBZA 5CRYA 5KDTB 5I7IA 1IMCA 3ECRA 4NG7A 3K6VA 2XXRA 4NF4B 1FTAA 4DXUA 4PBQA 4R73A 4LQ5A 1A54A 3OENA 1N7XA 3DLNA 3TCFA 2VHAA 1L5TA 3MVWA 2Q2AA 1OVTA 5K2XA 5AA3A 1MQHA 3VLUA 1HSEA 1URDA 1JP4A 3B7DA 5I56A 3KFMA 2O84X 1ZMGA 1P1OA 1NNPA 5IZZA 2PX1A 4BDQA 3TPAA 2I0BA 3CRBA 5IAIA 3SEXA 1USYH 4GF8A 5I5PA 1B3HA 4G8NA 4F1YA 2XX8A 3OOAA 1B0LA 2WYKA 2IEEA 1NV3A 1ELJA 3ZS6A 2Z8EA 4HS7A 3RGYA 2XXXA 1B05A 1MQJA 3OXNA 1B32A 2HEUA 3M3LA 3K1NA 4GWXA 4BDMA 3SESA 1K9ZA 4DI3D 3Q28A 2H25A 1B52A 5I84A 1KZ8A 4XIGQ 3T9UA 3OD7A 2HAUA 4G61A 4RJZA 4MLQA 1NMUA 3O97A 4ZEKA 4POWA 1NL5A 1JQFA 1RDZA 1B3EA 4R75A 3PMXA 1B5JA 3N5LA 4F29A 4ESWA 2HFBA 4C1TA 2FVZA 4O7IA 1LAGE 2V93A 2KR0A 1MXVA 4N13A 1YPNA 3TDJA 3CG3A 1B6HA 2ABHA 1BKAA 4PF6A 3T0JA 1Y3QA 1J1NA 1FPKA 1NV5A 3ISPA 5FHNA 3IOUA 3ROJA 1IMEA 3VDFA 2V25A 3CIJA 1EYJA 2OLBA 1MY3A 3TQLA 4ZZAA 3HFUA 3ODBA 2DE4A 1OLCA 3WAFA 2WX9A 1UIVA 2P3VA 4N6PA 2CEYA 4LZ7A 3FXBA 1R9QA 4RYAA 3V8XB 5I2KB 1NNKA 3KSXA 4JB7A 4GL0A 2AYSA 4H5GA 4QFPA 5H8SA 1IXCA 2B3FA 4PCDA 2OWTA 1MM6A 3SEYA 4GWOA 1Z7ME 4QSCA 1FPEA 3H6UA 1JVXA 1INPA 1WDNA 4JWYA 4NF4A 3MJNA 1B7HA 2NOOA 3G3IA 4OFJA 5H8NB 4OXVA 3RLFE 3RQTA 1EZPA 3KJ7A 5DYHA 3Q27A 4OMBA 3BIGA 1M5CA 4F19A 4QSEA 1DPEA 3MVXA 4OANA 4MX6A 1MH4A 5LTCA 3O6HA 3MYUA 4XKPA 1H44A 3S9NC 3BFUA 1TT1A 4ELPA 1FPGA 2XXWA 1PEBA 4GXAA 1B2HA 4G68B 3DP8A 4R6KA 2ZXTA 4MMPA 1YYZA 2P1SA 5H8FA 4MIJA 2WEFA 1N3WA 4BDNA 4DXBA 4NX1A 5EQ8A 5ISUA 3TCHA
chains in the Genus database with same CATH topology
1US4A 4PE5B 1BP5A 1I6QA 4QF9A 4G68C 3C34A 2DWHA 3E4RA 2I0CA 1MDP1 1N76A 3LBSA 4IO2A 3IK6B 4PETA 5DVIA 2HZLA 1FQAA 1ZBMA 4P0IA 1Y1MA 2XXQA 2I4BA 2DSFA 1URSA 2PVUA 3FJMA 1S9TA 2ZMBA 3OSQA 3TFLA 4NF6B 3V83A 2B4MA 2DWIA 2ONKE 3UA8A 3O29A 1OIBA 1KWHA 3GBBA 3N6UA 3S9EA 4PFUA 2GHBA 3F11A 1HSLA 1FCKA 1FW0A 5L9SA 3MQ9A 4GD5A 4YICA 3FVGA 3GLBA 3CSBA 5AA4B 4YZZA 4OESA 3GZGA 1BLFA 1D4NA 2UYFA 2O7UA 3DRFA 2QS3A 3TTMA 1MXZA 4RK2A 5EYFA 4BDLA 1H76A 2E1SA 1URGA 3OEMA 4QRZA 2F7CA 1T0KA 4MFIA 1LBBA 2BJJX 4HCWA 3KG2A 1IQ7A 2F36A 3MW0A 1N04A 4AB6A 3O28A 3DRKA 2I49A 3DP6A 2Y7PA 4HW8A 2QL3A 2XX7A 4GVOA 2F5XA 4OHNA 4JWXA 3IL1B 1VR5A 3PPQA 5I58B 3M8UA 3IORA 1SYHA 1QVSA 2QS1A 4PQJA 4GQOA 4LA9A 3PPRA 3EQ1A 4IO6A 4KYSA 2DE3A 2AL4A 4GL8A 3DRGA 3PPPA 4NF5B 4JDFA 2WOKA 1RYOA 5H8QB 2I3WA 1P1WA 2RINA 1JNFA 3HV1A 3UIFA 3LSLA 1P99A 1B1XA 5H8HA 4H8IA 5CBRA 3PD9A 4IB2A 1A8EA 3K1PA 2NWJA 1JEVA 2Z8FA 3TQWA 2UVHA 3O6IA 1JW1A 2OJTA 3SEWA 2Q89A 2F35A 1NNTA 4C0RA 3U94A 3TELA 2XX9A 1N84A 3C36A 1VSOA 4O3CA 1QUKA 4YKKA 1JW5A 3CI8A 3PUXE 3FV2A 3L6HA 4U4XA 4PFYA 4U1ZA 3USDA 4U21A 4NF6A 3EN3A 3THIA 3VXBA 3IJOB 2UVJA 2X7QA 3T9HB 2DS9A 1HSJA 3LC8A 4MF3A 5ELVA 5F1QA 5IKBA 1JW4A 1B46A 3DRJA 1MPBA 1Y4CA 3N26A 3EHTA 5L9MA 4AQ4A 4DLDA 5I59B 3IAZA 4POXA 4FATA 1MH3A 3HPIA 3ZKLA 3KOTA 4GLIA 5I2NB 4QFOA 2P2AA 3RUMA 1IITA 5B70A 5ITPA 3O9PA 4THIA 3PPNA 3CR9A 4U1OA 1ANFA 3S9LC 1CB6A 3HHGA 1NKXA 1FTJA 3R6UA 2PYYA 4KI0E 2FNCA 3C4MA 3E13X 3RT8A 2QPQA 3MZ1A 2VOZA 1PC3A 4I8CA 4R74A 1P1NA 5F7VA 4F1UA 1GVCA 3HCQA 2ESNA 4R6YA 2X26A 2F78A 4KPTA 1QULA 2F7BA 4QFLA 3KJTA 3CFZA 4M1VA 4WEPA 4ZE8A 1DTZA 3W15C 3FV1A 5K2YA 1DPPA 3G3GA 3U8QA 3DP4A 1ZIUA 3PGFA 1UTBB 2Y7WA 3H03A 4R9GA 1MDQA 1A99A 3EHUA 3CFLA 1ATGA 1CE2A 1QUJA 3TKDA 3IB2A 4Z7EA 4G8MA 3UGWA 4KR5A 3MVZA 5JK4A 2XXPA 3HO7A 4U23A 2OK2A 5AA1A 4YKIA 4JBZA 3TODA 3G3KA 1TWYA 3K2DA 4Z0IA 2W7YA 2PT1A 3PMVA 3VV5A 4F3BA 1LBCA 3CFXA 3V5AA 5AA2A 4XKNA 4P0GA 3SETA 4HCYA 3RTWB 3LUYA 3RT6B 4LATA 2E0SA 2XXTA 1II5A 1MY0A 1EZOA 4JXIA 1MXUA 3IB1A 4F22A 1MS7A 4OWDA 1N0TA 3TEPA 4XKQA 5JTYB 1H3DA 2FYIA 2REJA 2DXRA 4F3SA 5I57B 1H43A 5I59A 2B65A 2A5TA 3MZBA 2DWAA 3Q29A 2OWSA 5I2NA 3KN7A 3V89B 2H9BA 1MG1A 4GIZA 3MP1A 4ECFA 4DZ1A 1XS5A 2O7IA 2IA4A 3T93B 4C1UA 4YB6A 1D9VA 4NMYA 4DXCA 1SW5A 1Y4TA 4OQOA 1JVYA 4GXSB 5FTIA 3S4UA 3PUWE 3K1MA 2V3TA 2NUVA 3EHSA 2V84A 5HM4B 1B4ZA 3C35A 3QYTA 1LGBC 2OZZA 3AXFA 1UIUA 2NXOA 5DEXB 3MZ9A 4TQUQ 5KDTA 1D3KA 3TUSA 2RF1A 2Q8JA 1Q1KA 4IO5A 3TZAA 4U4SA 1M5EA 1M5FA 3K0VA 1ZTYA 4BDRA 2F6GA 1MY1A 3FATA 4KYEA 4EF1A 3HSTA 3OO8A 1B58A 2HQ0A 3OELA 3QSLA 3T96B 1H45A 2ZNSA 3T9XB 4R6HA 1B5IA 4KCCA 4WKMA 1MPDA 4RY1A 2ALUA 2G29A 5J1DA 2I4CA 3OO9A 3FJGA 4L17A 4YMBA 5KCJB 3VVFA 2O51A 3RNNA 3T9VA 3TTKA 4ESXA 1XVYA 1O63A 1SBPA 3FVOA 4XKRA 4FJPA 5TP9B 5FTHA 1SW4A 4I9DA 5M2VA 1UTHB 2RKMA 3IX1A 3QK6A 2Z23A 3MP6A 1IXHA 4I62A 3U72A 3UK4A 3WAEA 3PMWA 5HPQA 2GFEA 3U93A 1MM7A 3R7XA 3FVKA 1ZKBA 2M8CA 3TTNA 3IB0A 5HBCA 3QUFA 2XXYA 5JTYA 4H0WA 1POY1 3BKIB 2DOJA 2XHDA 2CZLA 1Y3PA 3LSFB 3ILUB 4RPNA 2AIXA 2F6PA 3SEUA 3P7IA 3M3FA 5AE4A 1QW0A 2XXUA 3A09A 1I69A 4TOZA 5JEIA 2VP1A 1B5HA 1LAFE 1DOTA 4LZ5A 4DCYA 4YKJA 5I2KA 1Y1ZA 4YMAA 5FHMA 3VVDA 3IR1A 4RXLA 3M3KA 2H4IA 4EQ9A 1S7YA 4NEDA 3LR1A 4NF8B 2ZYMA 2OBGA 1MQGA 2PMSA 4ZEFA 1MQDA 1MY4A 3MAMA 4KFQA 2I3VA 3KZGA 2HZKA 5H8NA 4FEBA 2Z8DA 3UN6A 1WVJA 4OEVA 2KLFA 5A5XB 4U2RA 3EPEA 3D4GA 4G77A 3TTRA 1LFIA 3G7WA 3RY3A 1VE4A 2I6EA 4OENA 4R72A 1QKBA 4KCDA 3H6VA 3OSRA 3UORA 4G68A 3EF7A 3U92A 1F9BA 5KCJA 1P1UA 1B7ZA 3SEVA 4X1BA 2THIA 3DM0A 2QSXA 2Q2CA 1PDAA 3B6WA 4EQBA 3VVEA 2YPNA 3QXMA 5I56B 1FQBA 1MXYA 3Q25A 1Y3NA 4LZ8A 1FTLA 1DSNA 4R2BA 5AA2D 4WXJA 3D4CA 3TAJA 2F97A 3A3CA 4UA8A 4EXKA 1LB9A 4UACA 3SDFA 3CVGA 2O1MA 1ZU0A 5L9OA 5DVJA 1DMBA 4OEUA 4ND9A 3I5OA 3OEKA 1JETA 4FECA 1N7WA 1NH8A 4QSDA 3U1OA 4JSOA 1SW1A 3G3JA 3MC2A 4DDDA 4H1XA 2ZYKA 3R26A 1PB9A 3H4ZA 4MLVA 4YAHX 2WKYA 3B6TA 3L6GA 1GGGA 5CM6A 2AL5A 4F2QA 5ICQA 5DTBA 1XHYA 1FQEA 5AA4A 4X9TA 1QUIA 2R6GE 3KBRA 1FQDA 2DVCA 4RPOA 2UYEA 1SI1A 1IIWA 1YCJA 2Q9TA 2RCBA 4KYDA 2REGA 4IGTA 1PBQA 3FZVA 2RC8A 2O69A 1LSTA 1GTKA 1A8FA 3B6QA 4MH5A 3HHFA 1I6AA 4OVJA 4LUBA 5B7DA 3LSXA 4E0XA 1LCTA 3C32A 1GV8A 4LONB 3FASA 2H98A 5BWJA 4YKPA 2QS2A 2UVIA 2XXHA 4N07A 3H3GA 3PD8A 5I58A 1B3FA 4GFRA 3CG1A 3MUQA 3O6GA 4LP2B 1M5DA 3RTFB 5ITOA 1WODA 1I6BA 1B1HA 4QHQA 2XXVA 2DVZA 3O6PA 3TCGA 4LQ2A 3Q26A 4IO3A 3DRHA 2DXYA 4NF5A 5H8QA 3K02A 1A55A 1MPCA 3BBRA 2OCUA 3BFTA 2XD3A 1SDXA 4TLLB 1B40A 3PUZE 4Q8RA 4ISUA 5TPAB 1RYXA 1PBPA 1QJMA 1AL3A 4IO7A 4BLAA 1PB8A 2ZNUA 3RYAA 4I1DA 4DE8A 1B4HA 2ZYOA 4IY5A 2V3QA 2DWJA 1XC1A 1R9LA 1BIYA 5L8DA 1USYE 4Q5TA 3K6XA 4BDOA 3SKPA 5H8FB 3GXAA 1GR2A 2ONSA 3KN3A 2F7AA 3PUYE 1OQGA 4ZEIA 2QMWA 2XD2A 4JSDA 5KZTA 2DE2A 4H6DA 3IJXB 2DYXA 4DCXA 1LLSA 3FXQA 3C31A 2RC7A 4NTLA 1P1QA 3C9HA 4FEDA 4F3GA 1IUDA 1MXWA 2D21A 1SVXB 3FGSA 2X7PA 3W9WA 1DTGA 1XVXA 4Q0CA 4FE8A 4OETA 4MBPA 4RA1A 4KHZE 2ANJA 3IOVA 5CC2A 3ONMA 1NH7A 1UQWA 3MVYA 3K4UA 3TMGA 3RN8A 4F1VA 4G8HA 3H6TA 1ZJLA 4FAJA 2I58A 3VE1B 3PUVE 1XOCA 4WEDA 3MBPA 3JYRA 3E9XA 1B3GA 1Q35A 2CMOA 5CMMA 1RKMA 4YU0A 4LVQA 4R9FA 5CMKA 4ZS9A 1O7TA 1LAHE 1UTBA 2HAVA 4NWDA 3W9VA 1B7UA 1VFDA 3N94A 3T66A 4FORA 3VXCA 4H65A 3I6VA 1Z7NE 1AMFA 2A5SA 1BTJA 1EH3A 5TPAA 1JEUA 3K00A 3H06B 2UVGA 3FUZA 4Q30B 3KSJA 3KEIA 3VFJA 4RNSA 2Y84A 3PAMA 3HN0A 4EXLA 4F31B 2R71A 3CSGA 5H8HB 3QUJA 2H99A 4OFLA 1LFHA 5EHMA 4ELOA 4O3BA 3I3VA 3K6WA 1OVBA 2D3IA 1EU8A 4DIGA 1IZ1A 4K3FA 3T22A 3QIMA 2VD3A 1ZLQA 4GRKA 2NVUB 4HTGA 4QFNA 4EQ7A 4EDPA 1NNFA 4ZECA 3MPLA 1SI0A 2ONRA 3ZKKA 5EHSA 1B9JA 1Y9UA 3DELB 3IO6A 5I57A 4OTEA 2GH9A 4PP0A 2Q88A 1AOVA 3FIRA 4IGRA 1AIVA 3O2AA 4GOTA 3MWBA 2D5WA 4F3PA 3FVNA 3S2VA 3TTLA 1AH5A 4ZEDA 3FXRA 4RK9A 2XXIA 1MXXA 3FJ7A 3FTOA 3G3FA 2HXWA 2I48A 1R6ZA 3KGCA 1EZ9A 2QMXA 5TU0A 1FTOA 3K01A 5DEXA 2H5YA 4R2FA 4E0WA 2WOLA 4ZDMA 4ZEBA 4H67A 4F18A 3QAXA 4ONYA 1LCFA 3N6TA 2HCAA 2PBWA 2B3BA 2B4LA 4KQPA 4AB5A 4OERA 1MRPA 4EF2A 3IOWA 4G4PA 2ZYNA 1MY2A 2Y7KA 1R1NA 5LOMA 2FA7A 1O64A 3VLWA 4M4GA 5DVFA 3O66A 4OZ9A 2QJEA 1Y20A 4IO4A 2O1LA 1B0HA 4XXUA 2Y7RA 3ZSFA 1OLAA 1POTA 2GHAA 1N3XA 5BUUA 4ELQA 4U22A 4H5FA 2V3UA 3K6UA 1A7LA 1A40A 3OO7A 4YB7A 4ELRA 1YAEA 5TP9A 4QFKA 1UTHA 1FQFA 2LAOA 5DT6A 1SYIA 3VLVA 4P11A 2RC9A 2F8DA 3CHGA 1XT8A 1B51A 3LVUA 3DRIA 2R9JA 3MP8A 5CI5A 4FIMA 3IO4A 4ZZEA 3JZJA 1FTKA 4H8JA 2UXAA 2PT2A 1MQIA 5AA2B 1US5A 3JV9A 4JWOA 2WOPA 3TYHA 3RPWA 3FXUA 3PPOA 2Y7IA 2O68A 2RCAA 1VFEA 4OYVA 2DQVA 1TXFA 3ILTB 1LAXA 3A3UA 4KD5A 3OMBA 1LFGA 2YLNA 2VGQA 3UP9A 2GRVA 1IEJA 1YTVA 2P0SA 1LB8A 3LSWA 1SW2A 1IXIA 1FQCA 1FTMA 5FHOA 1IXGA 1TFDA 4F2OA 4X48A 4OFOA 1TFAA 2VD2A 2QS4A 3OO6A 4NWCA 4TLMB 3G3HA 4NE4A 4PFWA 2QRYA 2ZNTA 4ZE9A 3IOTA 4XTCQ 2A5TB 2Z22A 3H6WA 2DP8A 4IY6A 4G2ZA 2F34A 2O6AA 1D9YA 4NF8A 3E3KA 1M5BA 1OMPA 4X1DA 3C33A 3SERA 5ICTA 3S9MC 1S50A 2G93A 1OQHA 5CMBA 1NFTA 1PB7A 3KN8A 5CBSA 4PFTA 5A5XA 4YB5A 4EUOA 3MPKA 1B3LA 3H7MA 4F39A 3PV0E 1QKAA 3FD3A 2YJPA 3RYBA 3KOSA 3GBAA 3PU5A 4O3AA 1SQYA 5CMCA 1SD3A 5CRYA 5KDTB 3ECRA 3K6VA 2XXRA 4NF4B 4DXUA 4R73A 4LQ5A 1A54A 3OENA 1N7XA 3DLNA 3TCFA 2VHAA 1L5TA 3MVWA 2Q2AA 1OVTA 5K2XA 5AA3A 1MQHA 3VLUA 1HSEA 1URDA 3B7DA 5I56A 3KFMA 2O84X 1ZMGA 1P1OA 1NNPA 2PX1A 4BDQA 3TPAA 2I0BA 3CRBA 5IAIA 3SEXA 1USYH 4GF8A 1B3HA 4G8NA 4F1YA 2XX8A 3OOAA 1B0LA 2IEEA 1ELJA 3ZS6A 2Z8EA 4HS7A 3RGYA 2XXXA 1B05A 1MQJA 3OXNA 1B32A 2HEUA 3M3LA 3K1NA 4BDMA 3SESA 3Q28A 2H25A 1B52A 5I84A 4XIGQ 3T9UA 3OD7A 2HAUA 4RJZA 4MLQA 1NMUA 3O97A 4ZEKA 4POWA 1NL5A 1JQFA 1B3EA 4R75A 3PMXA 1B5JA 3N5LA 4F29A 4ESWA 2HFBA 4C1TA 1LAGE 2V93A 1MXVA 4N13A 1YPNA 3TDJA 3CG3A 1B6HA 2ABHA 1BKAA 1Y3QA 1J1NA 5FHNA 3VDFA 3IOUA 2V25A 3CIJA 2OLBA 1MY3A 3TQLA 4ZZAA 3ODBA 2DE4A 1OLCA 3WAFA 1UIVA 4N6PA 4LZ7A 1R9QA 4RYAA 3V8XB 5I2KB 1NNKA 3KSXA 4JB7A 4GL0A 2AYSA 4H5GA 4QFPA 5H8SA 1IXCA 2B3FA 2OWTA 1MM6A 3SEYA 4GWOA 1Z7ME 4QSCA 3H6UA 1JVXA 1WDNA 4JWYA 4NF4A 3MJNA 1B7HA 2NOOA 3G3IA 4OFJA 5H8NB 4OXVA 3RLFE 3RQTA 1EZPA 3KJ7A 5DYHA 3Q27A 4OMBA 1M5CA 4F19A 4QSEA 1DPEA 3MVXA 1MH4A 3O6HA 4XKPA 1H44A 3S9NC 3BFUA 1TT1A 4ELPA 2XXWA 1PEBA 4GXAA 1B2HA 4G68B 3DP8A 4R6KA 2ZXTA 2P1SA 5H8FA 1N3WA 4BDNA 4DXBA 5ISUA 3TCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US4 A;  4PE5 B;  1BP5 A;  1I6Q A;  4QF9 A;  4G68 C;  3C34 A;  2DWH A;  3E4R A;  2I0C A;  1MDP 1;  1N76 A;  3LBS A;  4IO2 A;  3IK6 B;  4PET A;  5DVI A;  2HZL A;  1FQA A;  1ZBM A;  4P0I A;  1Y1M A;  2XXQ A;  2I4B A;  2DSF A;  1URS A;  2PVU A;  3FJM A;  1S9T A;  2ZMB A;  3OSQ A;  3TFL A;  4NF6 B;  3V83 A;  2B4M A;  2DWI A;  2ONK E;  3UA8 A;  3O29 A;  1OIB A;  1KWH A;  3GBB A;  3N6U A;  3S9E A;  4PFU A;  2GHB A;  3F11 A;  1HSL A;  1FCK A;  1FW0 A;  5L9S A;  3MQ9 A;  4GD5 A;  4YIC A;  3FVG A;  3GLB A;  3CSB A;  5AA4 B;  4YZZ A;  4OES A;  3GZG A;  1BLF A;  1D4N A;  2UYF A;  2O7U A;  3DRF A;  2QS3 A;  3TTM A;  1MXZ A;  4RK2 A;  5EYF A;  4BDL A;  1H76 A;  2E1S A;  1URG A;  3OEM A;  4QRZ A;  2F7C A;  1T0K A;  4MFI A;  1LBB A;  2BJJ X;  4HCW A;  3KG2 A;  1IQ7 A;  2F36 A;  3MW0 A;  1N04 A;  4AB6 A;  3O28 A;  3DRK A;  2I49 A;  3DP6 A;  2Y7P A;  4HW8 A;  2QL3 A;  2XX7 A;  4GVO A;  2F5X A;  4OHN A;  4JWX A;  3IL1 B;  1VR5 A;  3PPQ A;  5I58 B;  3M8U A;  3IOR A;  1SYH A;  1QVS A;  2QS1 A;  4PQJ A;  4GQO A;  4LA9 A;  3PPR A;  3EQ1 A;  4IO6 A;  4KYS A;  2DE3 A;  2AL4 A;  4GL8 A;  3DRG A;  3PPP A;  4NF5 B;  4JDF A;  2WOK A;  1RYO A;  5H8Q B;  2I3W A;  1P1W A;  2RIN A;  1JNF A;  3HV1 A;  3UIF A;  3LSL A;  1P99 A;  1B1X A;  5H8H A;  4H8I A;  5CBR A;  3PD9 A;  4IB2 A;  1A8E A;  3K1P A;  2NWJ A;  1JEV A;  2Z8F A;  3TQW A;  2UVH A;  3O6I A;  1JW1 A;  2OJT A;  3SEW A;  2Q89 A;  2F35 A;  1NNT A;  4C0R A;  3U94 A;  3TEL A;  2XX9 A;  1N84 A;  3C36 A;  1VSO A;  4O3C A;  1QUK A;  4YKK A;  1JW5 A;  3CI8 A;  3PUX E;  3FV2 A;  3L6H A;  4U4X A;  4PFY A;  4U1Z A;  3USD A;  4U21 A;  4NF6 A;  3EN3 A;  3THI A;  3VXB A;  3IJO B;  2UVJ A;  2X7Q A;  3T9H B;  2DS9 A;  1HSJ A;  3LC8 A;  4MF3 A;  5ELV A;  5F1Q A;  5IKB A;  1JW4 A;  1B46 A;  3DRJ A;  1MPB A;  1Y4C A;  3N26 A;  3EHT A;  5L9M A;  4AQ4 A;  4DLD A;  5I59 B;  3IAZ A;  4POX A;  4FAT A;  1MH3 A;  3HPI A;  3ZKL A;  3KOT A;  4GLI A;  5I2N B;  4QFO A;  2P2A A;  3RUM A;  1IIT A;  5B70 A;  5ITP A;  3O9P A;  4THI A;  3PPN A;  3CR9 A;  4U1O A;  1ANF A;  3S9L C;  1CB6 A;  3HHG A;  1NKX A;  1FTJ A;  3R6U A;  2PYY A;  4KI0 E;  2FNC A;  3C4M A;  3E13 X;  3RT8 A;  2QPQ A;  3MZ1 A;  2VOZ A;  1PC3 A;  4I8C A;  4R74 A;  1P1N A;  5F7V A;  4F1U A;  1GVC A;  3HCQ A;  2ESN A;  4R6Y A;  2X26 A;  2F78 A;  4KPT A;  1QUL A;  2F7B A;  4QFL A;  3KJT A;  3CFZ A;  4M1V A;  4WEP A;  4ZE8 A;  1DTZ A;  3W15 C;  3FV1 A;  5K2Y A;  1DPP A;  3G3G A;  3U8Q A;  3DP4 A;  1ZIU A;  3PGF A;  1UTB B;  2Y7W A;  3H03 A;  4R9G A;  1MDQ A;  1A99 A;  3EHU A;  3CFL A;  1ATG A;  1CE2 A;  1QUJ A;  3TKD A;  3IB2 A;  4Z7E A;  4G8M A;  3UGW A;  4KR5 A;  3MVZ A;  5JK4 A;  2XXP A;  3HO7 A;  4U23 A;  2OK2 A;  5AA1 A;  4YKI A;  4JBZ A;  3TOD A;  3G3K A;  1TWY A;  3K2D A;  4Z0I A;  2W7Y A;  2PT1 A;  3PMV A;  3VV5 A;  4F3B A;  1LBC A;  3CFX A;  3V5A A;  5AA2 A;  4XKN A;  4P0G A;  3SET A;  4HCY A;  3RTW B;  3LUY A;  3RT6 B;  4LAT A;  2E0S A;  2XXT A;  1II5 A;  1MY0 A;  1EZO A;  4JXI A;  1MXU A;  3IB1 A;  4F22 A;  1MS7 A;  4OWD A;  1N0T A;  3TEP A;  4XKQ A;  5JTY B;  1H3D A;  2FYI A;  2REJ A;  2DXR A;  4F3S A;  5I57 B;  1H43 A;  5I59 A;  2B65 A;  2A5T A;  3MZB A;  2DWA A;  3Q29 A;  2OWS A;  5I2N A;  3KN7 A;  3V89 B;  2H9B A;  1MG1 A;  4GIZ A;  3MP1 A;  4ECF A;  4DZ1 A;  1XS5 A;  2O7I A;  2IA4 A;  3T93 B;  4C1U A;  4YB6 A;  1D9V A;  4NMY A;  4DXC A;  1SW5 A;  1Y4T A;  4OQO A;  1JVY A;  4GXS B;  5FTI A;  3S4U A;  3PUW E;  3K1M A;  2V3T A;  2NUV A;  3EHS A;  2V84 A;  5HM4 B;  1B4Z A;  3C35 A;  3QYT A;  1LGB C;  2OZZ A;  3AXF A;  1UIU A;  2NXO A;  5DEX B;  3MZ9 A;  4TQU Q;  5KDT A;  1D3K A;  3TUS A;  2RF1 A;  2Q8J A;  1Q1K A;  4IO5 A;  3TZA A;  4U4S A;  1M5E A;  1M5F A;  3K0V A;  1ZTY A;  4BDR A;  2F6G A;  1MY1 A;  3FAT A;  4KYE A;  4EF1 A;  3HST A;  3OO8 A;  1B58 A;  2HQ0 A;  3OEL A;  3QSL A;  3T96 B;  1H45 A;  2ZNS A;  3T9X B;  4R6H A;  1B5I A;  4KCC A;  4WKM A;  1MPD A;  4RY1 A;  2ALU A;  2G29 A;  5J1D A;  2I4C A;  3OO9 A;  3FJG A;  4L17 A;  4YMB A;  5KCJ B;  3VVF A;  2O51 A;  3RNN A;  3T9V A;  3TTK A;  4ESX A;  1XVY A;  1O63 A;  1SBP A;  3FVO A;  4XKR A;  4FJP A;  5TP9 B;  5FTH A;  1SW4 A;  4I9D A;  5M2V A;  1UTH B;  2RKM A;  3IX1 A;  3QK6 A;  2Z23 A;  3MP6 A;  1IXH A;  4I62 A;  3U72 A;  3UK4 A;  3WAE A;  3PMW A;  5HPQ A;  2GFE A;  3U93 A;  1MM7 A;  3R7X A;  3FVK A;  1ZKB A;  2M8C A;  3TTN A;  3IB0 A;  5HBC A;  3QUF A;  2XXY A;  5JTY A;  4H0W A;  1POY 1;  3BKI B;  2DOJ A;  2XHD A;  2CZL A;  1Y3P A;  3LSF B;  3ILU B;  4RPN A;  2AIX A;  2F6P A;  3SEU A;  3P7I A;  3M3F A;  5AE4 A;  1QW0 A;  2XXU A;  3A09 A;  1I69 A;  4TOZ A;  5JEI A;  2VP1 A;  1B5H A;  1LAF E;  1DOT A;  4LZ5 A;  4DCY A;  4YKJ A;  5I2K A;  1Y1Z A;  4YMA A;  5FHM A;  3VVD A;  3IR1 A;  4RXL A;  3M3K A;  2H4I A;  4EQ9 A;  1S7Y A;  4NED A;  3LR1 A;  4NF8 B;  2ZYM A;  2OBG A;  1MQG A;  2PMS A;  4ZEF A;  1MQD A;  1MY4 A;  3MAM A;  4KFQ A;  2I3V A;  3KZG A;  2HZK A;  5H8N A;  4FEB A;  2Z8D A;  3UN6 A;  1WVJ A;  4OEV A;  2KLF A;  5A5X B;  4U2R A;  3EPE A;  3D4G A;  4G77 A;  3TTR A;  1LFI A;  3G7W A;  3RY3 A;  1VE4 A;  2I6E A;  4OEN A;  4R72 A;  1QKB A;  4KCD A;  3H6V A;  3OSR A;  3UOR A;  4G68 A;  3EF7 A;  3U92 A;  1F9B A;  5KCJ A;  1P1U A;  1B7Z A;  3SEV A;  4X1B A;  2THI A;  3DM0 A;  2QSX A;  2Q2C A;  1PDA A;  3B6W A;  4EQB A;  3VVE A;  2YPN A;  3QXM A;  5I56 B;  1FQB A;  1MXY A;  3Q25 A;  1Y3N A;  4LZ8 A;  1FTL A;  1DSN A;  4R2B A;  5AA2 D;  4WXJ A;  3D4C A;  3TAJ A;  2F97 A;  3A3C A;  4UA8 A;  4EXK A;  1LB9 A;  4UAC A;  3SDF A;  3CVG A;  2O1M A;  1ZU0 A;  5L9O A;  5DVJ A;  1DMB A;  4OEU A;  4ND9 A;  3I5O A;  3OEK A;  1JET A;  4FEC A;  1N7W A;  1NH8 A;  4QSD A;  3U1O A;  4JSO A;  1SW1 A;  3G3J A;  3MC2 A;  4DDD A;  4H1X A;  2ZYK A;  3R26 A;  1PB9 A;  3H4Z A;  4MLV A;  4YAH X;  2WKY A;  3B6T A;  3L6G A;  1GGG A;  5CM6 A;  2AL5 A;  4F2Q A;  5ICQ A;  5DTB A;  1XHY A;  1FQE A;  5AA4 A;  4X9T A;  1QUI A;  2R6G E;  3KBR A;  1FQD A;  2DVC A;  4RPO A;  2UYE A;  1SI1 A;  1IIW A;  1YCJ A;  2Q9T A;  2RCB A;  4KYD A;  2REG A;  4IGT A;  1PBQ A;  3FZV A;  2RC8 A;  2O69 A;  1LST A;  1GTK A;  1A8F A;  3B6Q A;  4MH5 A;  3HHF A;  1I6A A;  4OVJ A;  4LUB A;  5B7D A;  3LSX A;  4E0X A;  1LCT A;  3C32 A;  1GV8 A;  4LON B;  3FAS A;  2H98 A;  5BWJ A;  4YKP A;  2QS2 A;  2UVI A;  2XXH A;  4N07 A;  3H3G A;  3PD8 A;  5I58 A;  1B3F A;  4GFR A;  3CG1 A;  3MUQ A;  3O6G A;  4LP2 B;  1M5D A;  3RTF B;  5ITO A;  1WOD A;  1I6B A;  1B1H A;  4QHQ A;  2XXV A;  2DVZ A;  3O6P A;  3TCG A;  4LQ2 A;  3Q26 A;  4IO3 A;  3DRH A;  2DXY A;  4NF5 A;  5H8Q A;  3K02 A;  1A55 A;  1MPC A;  3BBR A;  2OCU A;  3BFT A;  2XD3 A;  1SDX A;  4TLL B;  1B40 A;  3PUZ E;  4Q8R A;  4ISU A;  5TPA B;  1RYX A;  1PBP A;  1QJM A;  1AL3 A;  4IO7 A;  4BLA A;  1PB8 A;  2ZNU A;  3RYA A;  4I1D A;  4DE8 A;  1B4H A;  2ZYO A;  4IY5 A;  2V3Q A;  2DWJ A;  1XC1 A;  1R9L A;  1BIY A;  5L8D A;  1USY E;  4Q5T A;  3K6X A;  4BDO A;  3SKP A;  5H8F B;  3GXA A;  1GR2 A;  2ONS A;  3KN3 A;  2F7A A;  3PUY E;  1OQG A;  4ZEI A;  2QMW A;  2XD2 A;  4JSD A;  5KZT A;  2DE2 A;  4H6D A;  3IJX B;  2DYX A;  4DCX A;  1LLS A;  3FXQ A;  3C31 A;  2RC7 A;  4NTL A;  1P1Q A;  3C9H A;  4FED A;  4F3G A;  1IUD A;  1MXW A;  2D21 A;  1SVX B;  3FGS A;  2X7P A;  3W9W A;  1DTG A;  1XVX A;  4Q0C A;  4FE8 A;  4OET A;  4MBP A;  4RA1 A;  4KHZ E;  2ANJ A;  3IOV A;  5CC2 A;  3ONM A;  1NH7 A;  1UQW A;  3MVY A;  3K4U A;  3TMG A;  3RN8 A;  4F1V A;  4G8H A;  3H6T A;  1ZJL A;  4FAJ A;  2I58 A;  3VE1 B;  3PUV E;  1XOC A;  4WED A;  3MBP A;  3JYR A;  3E9X A;  1B3G A;  1Q35 A;  2CMO A;  5CMM A;  1RKM A;  4YU0 A;  4LVQ A;  4R9F A;  5CMK A;  4ZS9 A;  1O7T A;  1LAH E;  1UTB A;  2HAV A;  4NWD A;  3W9V A;  1B7U A;  1VFD A;  3N94 A;  3T66 A;  4FOR A;  3VXC A;  4H65 A;  3I6V A;  1Z7N E;  1AMF A;  2A5S A;  1BTJ A;  1EH3 A;  5TPA A;  1JEU A;  3K00 A;  3H06 B;  2UVG A;  3FUZ A;  4Q30 B;  3KSJ A;  3KEI A;  3VFJ A;  4RNS A;  2Y84 A;  3PAM A;  3HN0 A;  4EXL A;  4F31 B;  2R71 A;  3CSG A;  5H8H B;  3QUJ A;  2H99 A;  4OFL A;  1LFH A;  5EHM A;  4ELO A;  4O3B A;  3I3V A;  3K6W A;  1OVB A;  2D3I A;  1EU8 A;  4DIG A;  1IZ1 A;  4K3F A;  3T22 A;  3QIM A;  2VD3 A;  1ZLQ A;  4GRK A;  2NVU B;  4HTG A;  4QFN A;  4EQ7 A;  4EDP A;  1NNF A;  4ZEC A;  3MPL A;  1SI0 A;  2ONR A;  3ZKK A;  5EHS A;  1B9J A;  1Y9U A;  3DEL B;  3IO6 A;  5I57 A;  4OTE A;  2GH9 A;  4PP0 A;  2Q88 A;  1AOV A;  3FIR A;  4IGR A;  1AIV A;  3O2A A;  4GOT A;  3MWB A;  2D5W A;  4F3P A;  3FVN A;  3S2V A;  3TTL A;  1AH5 A;  4ZED A;  3FXR A;  4RK9 A;  2XXI A;  1MXX A;  3FJ7 A;  3FTO A;  3G3F A;  2HXW A;  2I48 A;  1R6Z A;  3KGC A;  1EZ9 A;  2QMX A;  5TU0 A;  1FTO A;  3K01 A;  5DEX A;  2H5Y A;  4R2F A;  4E0W A;  2WOL A;  4ZDM A;  4ZEB A;  4H67 A;  4F18 A;  3QAX A;  4ONY A;  1LCF A;  3N6T A;  2HCA A;  2PBW A;  2B3B A;  2B4L A;  4KQP A;  4AB5 A;  4OER A;  1MRP A;  4EF2 A;  3IOW A;  4G4P A;  2ZYN A;  1MY2 A;  2Y7K A;  1R1N A;  5LOM A;  2FA7 A;  1O64 A;  3VLW A;  4M4G A;  5DVF A;  3O66 A;  4OZ9 A;  2QJE A;  1Y20 A;  4IO4 A;  2O1L A;  1B0H A;  4XXU A;  2Y7R A;  3ZSF A;  1OLA A;  1POT A;  2GHA A;  1N3X A;  5BUU A;  4ELQ A;  4U22 A;  4H5F A;  2V3U A;  3K6U A;  1A7L A;  1A40 A;  3OO7 A;  4YB7 A;  4ELR A;  1YAE A;  5TP9 A;  4QFK A;  1UTH A;  1FQF A;  2LAO A;  5DT6 A;  1SYI A;  3VLV A;  4P11 A;  2RC9 A;  2F8D A;  3CHG A;  1XT8 A;  1B51 A;  3LVU A;  3DRI A;  2R9J A;  3MP8 A;  5CI5 A;  4FIM A;  3IO4 A;  4ZZE A;  3JZJ A;  1FTK A;  4H8J A;  2UXA A;  2PT2 A;  1MQI A;  5AA2 B;  1US5 A;  3JV9 A;  4JWO A;  2WOP A;  3TYH A;  3RPW A;  3FXU A;  3PPO A;  2Y7I A;  2O68 A;  2RCA A;  1VFE A;  4OYV A;  2DQV A;  1TXF A;  3ILT B;  1LAX A;  3A3U A;  4KD5 A;  3OMB A;  1LFG A;  2YLN A;  2VGQ A;  3UP9 A;  2GRV A;  1IEJ A;  1YTV A;  2P0S A;  1LB8 A;  3LSW A;  1SW2 A;  1IXI A;  1FQC A;  1FTM A;  5FHO A;  1IXG A;  1TFD A;  4F2O A;  4X48 A;  4OFO A;  1TFA A;  2VD2 A;  2QS4 A;  3OO6 A;  4NWC A;  4TLM B;  3G3H A;  4NE4 A;  4PFW A;  2QRY A;  2ZNT A;  4ZE9 A;  3IOT A;  4XTC Q;  2A5T B;  2Z22 A;  3H6W A;  2DP8 A;  4IY6 A;  4G2Z A;  2F34 A;  2O6A A;  1D9Y A;  4NF8 A;  3E3K A;  1M5B A;  1OMP A;  4X1D A;  3C33 A;  3SER A;  5ICT A;  3S9M C;  1S50 A;  2G93 A;  1OQH A;  5CMB A;  1NFT A;  1PB7 A;  3KN8 A;  5CBS A;  4PFT A;  5A5X A;  4YB5 A;  4EUO A;  3MPK A;  1B3L A;  3H7M A;  4F39 A;  3PV0 E;  1QKA A;  3FD3 A;  2YJP A;  3RYB A;  3KOS A;  3GBA A;  3PU5 A;  4O3A A;  1SQY A;  5CMC A;  1SD3 A;  5CRY A;  5KDT B;  3ECR A;  3K6V A;  2XXR A;  4NF4 B;  4DXU A;  4R73 A;  4LQ5 A;  1A54 A;  3OEN A;  1N7X A;  3DLN A;  3TCF A;  2VHA A;  1L5T A;  3MVW A;  2Q2A A;  1OVT A;  5K2X A;  5AA3 A;  1MQH A;  3VLU A;  1HSE A;  1URD A;  3B7D A;  5I56 A;  3KFM A;  2O84 X;  1ZMG A;  1P1O A;  1NNP A;  2PX1 A;  4BDQ A;  3TPA A;  2I0B A;  3CRB A;  5IAI A;  3SEX A;  1USY H;  4GF8 A;  1B3H A;  4G8N A;  4F1Y A;  2XX8 A;  3OOA A;  1B0L A;  2IEE A;  1ELJ A;  3ZS6 A;  2Z8E A;  4HS7 A;  3RGY A;  2XXX A;  1B05 A;  1MQJ A;  3OXN A;  1B32 A;  2HEU A;  3M3L A;  3K1N A;  4BDM A;  3SES A;  3Q28 A;  2H25 A;  1B52 A;  5I84 A;  4XIG Q;  3T9U A;  3OD7 A;  2HAU A;  4RJZ A;  4MLQ A;  1NMU A;  3O97 A;  4ZEK A;  4POW A;  1NL5 A;  1JQF A;  1B3E A;  4R75 A;  3PMX A;  1B5J A;  3N5L A;  4F29 A;  4ESW A;  2HFB A;  4C1T A;  1LAG E;  2V93 A;  1MXV A;  4N13 A;  1YPN A;  3TDJ A;  3CG3 A;  1B6H A;  2ABH A;  1BKA A;  1Y3Q A;  1J1N A;  5FHN A;  3VDF A;  3IOU A;  2V25 A;  3CIJ A;  2OLB A;  1MY3 A;  3TQL A;  4ZZA A;  3ODB A;  2DE4 A;  1OLC A;  3WAF A;  1UIV A;  4N6P A;  4LZ7 A;  1R9Q A;  4RYA A;  3V8X B;  5I2K B;  1NNK A;  3KSX A;  4JB7 A;  4GL0 A;  2AYS A;  4H5G A;  4QFP A;  5H8S A;  1IXC A;  2B3F A;  2OWT A;  1MM6 A;  3SEY A;  4GWO A;  1Z7M E;  4QSC A;  3H6U A;  1JVX A;  1WDN A;  4JWY A;  4NF4 A;  3MJN A;  1B7H A;  2NOO A;  3G3I A;  4OFJ A;  5H8N B;  4OXV A;  3RLF E;  3RQT A;  1EZP A;  3KJ7 A;  5DYH A;  3Q27 A;  4OMB A;  1M5C A;  4F19 A;  4QSE A;  1DPE A;  3MVX A;  1MH4 A;  3O6H A;  4XKP A;  1H44 A;  3S9N C;  3BFU A;  1TT1 A;  4ELP A;  2XXW A;  1PEB A;  4GXA A;  1B2H A;  4G68 B;  3DP8 A;  4R6K A;  2ZXT A;  2P1S A;  5H8F A;  1N3W A;  4BDN A;  4DXB A;  5ISU A;  3TCH A; 
#chains in the Genus database with same CATH topology
 4MNI A;  1US4 A;  4PE5 B;  1BP5 A;  1I6Q A;  4QF9 A;  4G68 C;  3C34 A;  2DWH A;  4O7M A;  3E4R A;  1NV1 A;  2I0C A;  1MDP 1;  1N76 A;  3LBS A;  4IO2 A;  3IK6 B;  4PET A;  5DVI A;  2HZL A;  1FQA A;  1ZBM A;  4P0I A;  1Y1M A;  2XXQ A;  2I4B A;  2DSF A;  1URS A;  2PVU A;  3FJM A;  1S9T A;  2ZMB A;  3OSQ A;  3TFL A;  4NF6 B;  1LBV A;  3V83 A;  2B4M A;  2Q74 A;  2DWI A;  2ONK E;  3UA8 A;  3O29 A;  1OIB A;  1KWH A;  4QXD A;  1LBY A;  3GBB A;  3N6U A;  3S9E A;  4PFU A;  2GHB A;  3F11 A;  1HSL A;  2FIE A;  1FBG A;  2VT5 A;  1FCK A;  1FW0 A;  5L9S A;  3MQ9 A;  4GD5 A;  4YIC A;  3FVG A;  3GLB A;  1YZ0 A;  3CSB A;  5AA4 B;  1EYK A;  4YZZ A;  4OES A;  2P3N A;  3GZG A;  1BLF A;  1D4N A;  2UYF A;  5IZ3 A;  2O7U A;  3DRF A;  2QS3 A;  1AWB A;  3TTM A;  1MXZ A;  1XI6 A;  4RK2 A;  5EYF A;  4BDL A;  1H76 A;  3BIH A;  2E1S A;  1URG A;  3OEM A;  4QRZ A;  2F7C A;  1T0K A;  2L5V A;  4MFI A;  5IZ1 A;  3FBP A;  1LBB A;  2BJJ X;  3KC0 A;  4HCW A;  3KG2 A;  1IQ7 A;  5A5L A;  2F36 A;  3MW0 A;  1N04 A;  4P9K A;  4AB6 A;  3O28 A;  3DRK A;  2I49 A;  4PF8 A;  3DP6 A;  2Y7P A;  4HW8 A;  2QL3 A;  2XX7 A;  4GVO A;  2F5X A;  4OHN A;  4JWX A;  3IL1 B;  1VR5 A;  3PPQ A;  5I58 B;  3M8U A;  3IOR A;  1SYH A;  1QVS A;  2QS1 A;  3E78 A;  4PQJ A;  4GQO A;  4LA9 A;  3PPR A;  3EQ1 A;  4IO6 A;  4KYS A;  2DE3 A;  4OVT A;  2AL4 A;  3RPL B;  4GL8 A;  4N17 A;  3DRG A;  3PPP A;  4NF5 B;  4JDF A;  2WOK A;  1RYO A;  5H8Q B;  2I3W A;  1P1W A;  2RIN A;  1JNF A;  3HV1 A;  3UIF A;  3LSL A;  1P99 A;  1B1X A;  4MEV A;  5H8H A;  4H8I A;  1IMD A;  5CBR A;  4NHB A;  3PD9 A;  4IB2 A;  1A8E A;  3K1P A;  2NWJ A;  1JEV A;  4GX6 A;  2Z8F A;  3TQW A;  2UVH A;  2QVV A;  3O6I A;  2OX3 A;  1JW1 A;  2OJT A;  2PCR A;  3SEW A;  2Q89 A;  3IFC A;  2F35 A;  1NNT A;  4C0R A;  3U94 A;  3TEL A;  2XX9 A;  1N84 A;  3C36 A;  3U65 A;  1VSO A;  4O3C A;  1QUK A;  4YKK A;  1JW5 A;  3CI8 A;  3PUX E;  3FV2 A;  3L6H A;  4U4X A;  4PFY A;  4U1Z A;  3USD A;  4U21 A;  4NF6 A;  3EN3 A;  3THI A;  3VXB A;  3IJO B;  2UVJ A;  2X7Q A;  3T9H B;  2DS9 A;  1HSJ A;  3LC8 A;  4MF3 A;  5ELV A;  5F1Q A;  5IKB A;  1JW4 A;  1B46 A;  3DRJ A;  1MPB A;  1Y4C A;  3N26 A;  4MHF A;  1NUX A;  3EHT A;  2Q8M A;  5L9M A;  4AQ4 A;  4DLD A;  5I59 B;  3IAZ A;  4POX A;  4FAT A;  2OWZ A;  1MH3 A;  3HPI A;  3ZKL A;  3KOT A;  4GLI A;  5I2N B;  4QFO A;  2P2A A;  3RUM A;  1IIT A;  5B70 A;  5ITP A;  3O9P A;  4THI A;  3PPN A;  3CR9 A;  1DK4 A;  4U1O A;  1ANF A;  3S9L C;  1CB6 A;  2QFL A;  3HHG A;  1NKX A;  4I40 A;  1FTJ A;  3R6U A;  2WBB A;  2PYY A;  4KI0 E;  2FNC A;  3C4M A;  3E13 X;  3RT8 A;  2QPQ A;  3MZ1 A;  5LDZ A;  2VOZ A;  1PC3 A;  4I8C A;  4R74 A;  1P1N A;  5F7V A;  4F1U A;  1GVC A;  3HCQ A;  1D9Q A;  2ESN A;  4R6Y A;  2X26 A;  2F78 A;  4KPT A;  1QUL A;  2F7B A;  4QFL A;  3KJT A;  3CFZ A;  4M1V A;  4WEP A;  4XEQ A;  4HE0 A;  4ZE8 A;  1DTZ A;  3W15 C;  1G0H A;  3FV1 A;  5K2Y A;  1DPP A;  3G3G A;  3U8Q A;  3DP4 A;  1ZIU A;  4H45 A;  3PGF A;  1UTB B;  2Y7W A;  3H03 A;  3RPL A;  4R9G A;  4O94 A;  1MDQ A;  1A99 A;  1FBE A;  3EHU A;  3CFL A;  1ATG A;  3B8B A;  1CE2 A;  1QUJ A;  2FBP A;  3TKD A;  3IB2 A;  4Z7E A;  4G8M A;  3UGW A;  4KR5 A;  3MVZ A;  5JK4 A;  2XXP A;  3HO7 A;  4U23 A;  2OK2 A;  5AA1 A;  4YKI A;  4JBZ A;  3TOD A;  4XF5 A;  3G3K A;  1TWY A;  3K2D A;  4Z0I A;  5IGA A;  2W7Y A;  1LBW A;  2PT1 A;  3PMV A;  3VV5 A;  4F3B A;  1LBC A;  3CFX A;  3V5A A;  2Y5L A;  5AA2 A;  4XKN A;  2BJI A;  4P0G A;  3SET A;  4HCY A;  3RTW B;  4GWU A;  3LUY A;  3RT6 B;  4LAT A;  2E0S A;  2XXT A;  1II5 A;  1MY0 A;  1EZO A;  4JXI A;  3A29 A;  1MXU A;  3IB1 A;  4F22 A;  3E79 A;  1MS7 A;  5ET5 A;  1FPD A;  4OWD A;  1N0T A;  2MKZ A;  2XWV A;  3TEP A;  4XKQ A;  5JTY B;  1H3D A;  2FYI A;  2REJ A;  2DXR A;  4F3S A;  5I57 B;  1H43 A;  5I59 A;  2B65 A;  2A5T A;  3MZB A;  2DWA A;  3Q29 A;  2OWS A;  5I2N A;  3KN7 A;  3V89 B;  2H9B A;  1MG1 A;  2VPN A;  4GIZ A;  3MP1 A;  4ECF A;  4OA4 A;  4DZ1 A;  1XS5 A;  2O7I A;  2IA4 A;  3T93 B;  4OVR A;  4C1U A;  4YB6 A;  1D9V A;  4NMY A;  4DXC A;  2HPG A;  1SW5 A;  4PFB A;  1Y4T A;  5ET7 A;  4OQO A;  1JVY A;  4GXS B;  5FTI A;  3S4U A;  3PUW E;  3K1M A;  2V3T A;  2NUV A;  3EHS A;  2V84 A;  5HM4 B;  1B4Z A;  3C35 A;  3QYT A;  1LGB C;  1YXI A;  2OZZ A;  3AXF A;  1UIU A;  2NXO A;  4GX4 A;  5DEX B;  3MZ9 A;  2CZK A;  4TQU Q;  2GQ1 A;  5KDT A;  1D3K A;  3TUS A;  2RF1 A;  2Q8J A;  1Q1K A;  4IO5 A;  4NGU A;  3TZA A;  4U4S A;  1M5E A;  1M5F A;  2HHM A;  3K0V A;  1ZTY A;  4BDR A;  2F6G A;  4DI4 B;  1MY1 A;  3FAT A;  4KYE A;  4EF1 A;  3HST A;  3OO8 A;  4P47 A;  1B58 A;  2HQ0 A;  2XWI A;  3OEL A;  3QSL A;  3T96 B;  1NUZ A;  3MST A;  1H45 A;  2JJK A;  2ZNS A;  3T9X B;  1NUW A;  4R6H A;  1B5I A;  2XA5 A;  4KCC A;  4WKM A;  1MPD A;  2KQZ A;  4PDD A;  4RY1 A;  2ALU A;  2G29 A;  4N4U A;  5J1D A;  2I4C A;  3OO9 A;  3FJG A;  4L17 A;  4YMB A;  5EYG A;  5KCJ B;  3VVF A;  2O51 A;  3RNN A;  3T9V A;  3TTK A;  4ESX A;  1XVY A;  1O63 A;  1SBP A;  3FVO A;  4XKR A;  4FJP A;  5TP9 B;  5FTH A;  1SW4 A;  4I9D A;  5M2V A;  1UTH B;  2RKM A;  3IX1 A;  1FRP A;  1FPJ A;  3QK6 A;  1FBD A;  2Z23 A;  3MP6 A;  1IXH A;  4P1E A;  4I62 A;  3U72 A;  3UK4 A;  3WAE A;  3PMW A;  5HPQ A;  2GFE A;  3U93 A;  1MM7 A;  3R7X A;  3FVK A;  1ZKB A;  1NV7 A;  2M8C A;  3TTN A;  2CZI A;  4JVC A;  3IB0 A;  4X8R A;  1IMB A;  5HBC A;  3QUF A;  2XXY A;  1FJ6 A;  5JTY A;  4H0W A;  1POY 1;  3BKI B;  2DOJ A;  2XHD A;  2CZL A;  1K9Y A;  1Y3P A;  3LSF B;  2VPO A;  3PTY A;  3ILU B;  4PAI A;  4RPN A;  2AIX A;  2F6P A;  3SEU A;  4PGN A;  1BK4 A;  3P7I A;  3M3F A;  5ET6 A;  5AE4 A;  1QW0 A;  2XXU A;  3A09 A;  1I69 A;  4TOZ A;  5JEI A;  2VP1 A;  1B5H A;  1LAF E;  1DOT A;  4LZ5 A;  4DCY A;  4YKJ A;  5I2K A;  1Y1Z A;  4YMA A;  5FHM A;  2FHY A;  1FPI A;  3VVD A;  3IR1 A;  4RXL A;  3M3K A;  2H4I A;  4EQ9 A;  1S7Y A;  4NED A;  3LR1 A;  4NF8 B;  2ZYM A;  4HXV A;  2OBG A;  4NN3 A;  1QGX A;  1MQG A;  2PMS A;  4PFI A;  1FPF A;  4ZEF A;  1RDY A;  1MQD A;  1MY4 A;  3MAM A;  4KFQ A;  2I3V A;  3KZG A;  2HZK A;  1NV0 A;  5H8N A;  4FEB A;  2Z8D A;  3UN6 A;  1WVJ A;  4OEV A;  2KLF A;  5A5X B;  4U2R A;  3EPE A;  3D4G A;  4G77 A;  3NOH A;  2FIX A;  3TTR A;  1LFI A;  3G7W A;  3RY3 A;  1VE4 A;  2I6E A;  4OEN A;  4R72 A;  1QKB A;  4KCD A;  3H6V A;  3OSR A;  3UOR A;  4G68 A;  3EF7 A;  4PE3 A;  3U92 A;  1F9B A;  2WBD A;  5KCJ A;  4N91 A;  1P1U A;  1B7Z A;  3SEV A;  4X1B A;  2THI A;  3DM0 A;  2QSX A;  2Q2C A;  1PDA A;  3B6W A;  4EQB A;  3VVE A;  2YPN A;  3QXM A;  4N6D A;  5I56 B;  1FQB A;  1IMF A;  1MXY A;  3Q25 A;  1Y3N A;  4LZ8 A;  1FTL A;  1DSN A;  4R2B A;  5AA2 D;  4WXJ A;  4GBW A;  3D4C A;  3TAJ A;  4N6K A;  2F97 A;  3A3C A;  4UA8 A;  4EXK A;  1LB9 A;  4UAC A;  3SZP A;  3SDF A;  3CVG A;  2O1M A;  1ZU0 A;  5L9O A;  5DVJ A;  1DMB A;  4OEU A;  4ND9 A;  3I5O A;  3OEK A;  1JET A;  4FEC A;  1N7W A;  1NH8 A;  4QSD A;  3U1O A;  4JSO A;  1SW1 A;  3G3J A;  3MC2 A;  4DDD A;  1VDW A;  4H1X A;  2ZYK A;  3R26 A;  1PB9 A;  1RDX A;  3H4Z A;  4MLV A;  4YAH X;  3LUZ A;  4OVS A;  2WKY A;  3B6T A;  3L6G A;  1GGG A;  5CM6 A;  2AL5 A;  4F2Q A;  5ICQ A;  5DTB A;  1XHY A;  1FQE A;  5AA4 A;  4X9T A;  1QUI A;  2R6G E;  1DCU A;  3QMF A;  3KBR A;  1FQD A;  1DBZ A;  2DVC A;  4RPO A;  2UYE A;  1SI1 A;  1IIW A;  4MAG A;  1YCJ A;  2Q9T A;  2RCB A;  4KYD A;  2REG A;  4IGT A;  1PBQ A;  3FZV A;  2RC8 A;  2O69 A;  1LST A;  1GTK A;  1A8F A;  3B6Q A;  4MH5 A;  3HHF A;  1I6A A;  4OVJ A;  4LUB A;  5B7D A;  3LSX A;  4O8M A;  4E0X A;  1LCT A;  3C32 A;  1GV8 A;  4LON B;  4AS4 A;  2F3B A;  2HXR A;  3FAS A;  2H98 A;  3EKI A;  5BWJ A;  4YKP A;  2QS2 A;  2UVI A;  3LV0 A;  2XXH A;  4N07 A;  3H3G A;  3PD8 A;  5I58 A;  1B3F A;  4GFR A;  3CG1 A;  3MUQ A;  3O6G A;  4LP2 B;  4XFE A;  4I3Y A;  1M5D A;  1EYI A;  4PFR A;  3RTF B;  5ITO A;  1WOD A;  1I6B A;  1G0I A;  1B1H A;  4QHQ A;  2XXV A;  2DVZ A;  3O6P A;  1NI9 A;  3TCG A;  4LQ2 A;  3Q26 A;  4IO3 A;  3DRH A;  2DXY A;  5ESY A;  4NF5 A;  4I3E A;  4GX3 A;  5H8Q A;  3K02 A;  1KA0 A;  1A55 A;  1MPC A;  3BBR A;  2OCU A;  3BFT A;  2XD3 A;  1SDX A;  4TLL B;  1B40 A;  3PUZ E;  4Q8R A;  4ISU A;  5TPA B;  1RYX A;  1PBP A;  1FPB A;  1QJM A;  5J16 A;  1AL3 A;  4IO7 A;  4BLA A;  1PB8 A;  2ZNU A;  3RYA A;  4I1D A;  4DE8 A;  1B4H A;  2ZYO A;  4IY5 A;  2V3Q A;  2DWJ A;  1XC1 A;  1R9L A;  1BIY A;  5L8D A;  2XXK A;  1USY E;  4Q5T A;  3K6X A;  4BDO A;  3SKP A;  5H8F B;  3GXA A;  1GR2 A;  2ONS A;  3KN3 A;  2F7A A;  4P3L A;  5EQ7 A;  3PUY E;  1OQG A;  3B50 A;  4ZEI A;  2QMW A;  2PFZ A;  2XD2 A;  4HE1 A;  4JSD A;  5DW8 A;  5KZT A;  2DE2 A;  4H6D A;  3IJX B;  2DYX A;  4DCX A;  1LLS A;  2XWO A;  4OVP A;  3FXQ A;  3C31 A;  4X04 A;  2RC7 A;  4NTL A;  2CEX A;  1P1Q A;  3C9H A;  4FED A;  3KC1 A;  4F3G A;  1IUD A;  1Q9D A;  1MXW A;  2D21 A;  1SVX B;  3FGS A;  2X7P A;  5EYH A;  3GYY A;  2ZZW A;  3W9W A;  1DTG A;  1XVX A;  4Q0C A;  4PAK A;  4FE8 A;  4OET A;  4MBP A;  4RA1 A;  4KHZ E;  2ANJ A;  5T3J A;  3IOV A;  5CC2 A;  3ONM A;  4P8B A;  1NH7 A;  4MNP A;  1UQW A;  3MVY A;  3K4U A;  3TMG A;  3RN8 A;  4F1V A;  4G8H A;  3H6T A;  1ZJL A;  4FAJ A;  2I58 A;  3VE1 B;  3PUV E;  1XOC A;  1IMA A;  5IZ3 B;  4WED A;  3MBP A;  3JYR A;  3E9X A;  4NF0 A;  1B3G A;  4PAF A;  1Q35 A;  1NV2 A;  2CMO A;  5CMM A;  1RKM A;  4YU0 A;  1LBX A;  4LVQ A;  5I3S A;  4R9F A;  5CMK A;  4ZS9 A;  1O7T A;  1LAH E;  1UTB A;  2HAV A;  4NWD A;  3W9V A;  1NV4 A;  1NUY A;  1B7U A;  4NAP A;  1VFD A;  3N94 A;  3T66 A;  4FOR A;  3VXC A;  4H65 A;  3I6V A;  1Z7N E;  1AMF A;  4QBA A;  2A5S A;  1BTJ A;  1EH3 A;  5TPA A;  1JEU A;  3K00 A;  3H06 B;  2UVG A;  3FUZ A;  4Q30 B;  3KSJ A;  3KEI A;  3VFJ A;  4JVI A;  4RNS A;  2Y84 A;  3PAM A;  4LN5 A;  3HN0 A;  4EXL A;  4F31 B;  3IFA A;  2DDK A;  2R71 A;  3CSG A;  1LEV A;  5H8H B;  3QUJ A;  5EQ9 A;  2H99 A;  4OFL A;  1LFH A;  4GWW A;  5EHM A;  4ELO A;  4O3B A;  3I3V A;  4PTK A;  1FBH A;  3K6W A;  1FSA A;  1OVB A;  2D3I A;  1NV6 A;  1EU8 A;  1IZ1 A;  4K3F A;  3T22 A;  4DIG A;  3QIM A;  2VD3 A;  1ZLQ A;  4GRK A;  2NVU B;  4HTG A;  4QFN A;  4EQ7 A;  4EDP A;  1NNF A;  4N8G A;  4ZEC A;  3MPL A;  2XWK A;  1SI0 A;  4N15 A;  2V4C A;  4P1L A;  2ONR A;  3ZKK A;  5EHS A;  1KA1 A;  1B9J A;  1FBC A;  1Y9U A;  3DEL B;  3IO6 A;  5I57 A;  4OTE A;  2GH9 A;  4PP0 A;  2Q88 A;  1AOV A;  3FIR A;  3KBZ A;  1FJ9 A;  4IGR A;  1AIV A;  3O2A A;  4GOT A;  3MWB A;  2D5W A;  4F3P A;  3FVN A;  3S2V A;  3TTL A;  1AH5 A;  4ZED A;  3FXR A;  4RK9 A;  4FBP A;  4KXP A;  2XXI A;  1MXX A;  3FJ7 A;  3FTO A;  5FBP A;  3G3F A;  2ZZX A;  2ZZV A;  5F24 A;  4MCO A;  2HXW A;  2I48 A;  1R6Z A;  3KGC A;  1EZ9 A;  2QMX A;  5TU0 A;  1FTO A;  3K01 A;  5DEX A;  2H5Y A;  4R2F A;  4E0W A;  2WOL A;  4IR8 A;  4ZDM A;  4ZEB A;  1CNQ A;  4H67 A;  4N81 A;  4F18 A;  3QAX A;  4ONY A;  1LCF A;  3N6T A;  2CZH A;  2HCA A;  2PBW A;  2B3B A;  4PC9 A;  2B4L A;  4KQP A;  4AB5 A;  4H46 A;  4OER A;  1MRP A;  4EF2 A;  3IOW A;  4G4P A;  4GBV A;  1SPI A;  2ZYN A;  4AS5 A;  4GWY A;  1MY2 A;  2Y7K A;  5ET8 A;  1R1N A;  3T1B A;  5LOM A;  2FA7 A;  1O64 A;  3VLW A;  4M4G A;  5DVF A;  3O66 A;  4OZ9 A;  2QJE A;  1Y20 A;  2QVR A;  4IO4 A;  2O1L A;  1B0H A;  4XXU A;  2Y7R A;  3ZSF A;  1OLA A;  1POT A;  2PFY A;  2GHA A;  1N3X A;  5BUU A;  4ELQ A;  4U22 A;  2F3D A;  4H5F A;  2V3U A;  3K6U A;  4OVQ A;  1A7L A;  1A40 A;  2R8T A;  3OO7 A;  4YB7 A;  4ELR A;  1YAE A;  5TP9 A;  4QFK A;  1UTH A;  1FQF A;  2LAO A;  5DT6 A;  1SYI A;  3VLV A;  4P11 A;  2RC9 A;  2F8D A;  3CHG A;  1XT8 A;  1B51 A;  3LVU A;  3DRI A;  2R9J A;  3MP8 A;  5CI5 A;  4FIM A;  4UAB A;  3IO4 A;  4ZZE A;  3JZJ A;  5IM2 A;  1FTK A;  4H8J A;  4P56 A;  2UXA A;  4MJO A;  2PT2 A;  1MQI A;  5AA2 B;  1US5 A;  3JV9 A;  4JWO A;  2WOP A;  2QVU A;  3TYH A;  3RPW A;  3FXU A;  3PPO A;  4JVD A;  2Y7I A;  2O68 A;  2RCA A;  1VFE A;  4OYV A;  2DQV A;  1TXF A;  3ILT B;  1LAX A;  3A3U A;  4KD5 A;  3OMB A;  1LFG A;  2YLN A;  3D1R A;  2VGQ A;  3UP9 A;  4PBH A;  2GRV A;  1IEJ A;  1YTV A;  2P0S A;  1LB8 A;  3LSW A;  1SW2 A;  1IXI A;  1FQC A;  1FTM A;  5EQA A;  5FHO A;  1IXG A;  1TFD A;  4F2O A;  4X48 A;  4OFO A;  1TFA A;  2VD2 A;  2QS4 A;  3OO6 A;  2WYP A;  1FPL A;  4NWC A;  4GWZ A;  4TLM B;  3G3H A;  4NE4 A;  4PFW A;  2QRY A;  2ZNT A;  4ZE9 A;  3IOT A;  4XTC Q;  2A5T B;  2Z22 A;  3H6W A;  2DP8 A;  4IY6 A;  4G2Z A;  2F34 A;  2O6A A;  1D9Y A;  4NF8 A;  3RYD A;  3E3K A;  4NQ8 A;  1M5B A;  4PGP A;  1OMP A;  2Y5K A;  4X1D A;  3C33 A;  3SER A;  5ICT A;  1FBP A;  3S9M C;  1S50 A;  2G93 A;  1OQH A;  5CMB A;  4HE2 A;  1NFT A;  1PB7 A;  3KN8 A;  5CBS A;  4PFT A;  5A5X A;  4PDH A;  4YB5 A;  4EUO A;  3MPK A;  4MNC A;  1B3L A;  3H7M A;  4F39 A;  3PV0 E;  1QKA A;  3FD3 A;  2YJP A;  3RYB A;  1FBF A;  3KOS A;  3GBA A;  3PU5 A;  4O3A A;  4GWS A;  4N8Y A;  1SQY A;  5CMC A;  1SD3 A;  1LBZ A;  5CRY A;  5KDT B;  5I7I A;  1IMC A;  3ECR A;  4NG7 A;  3K6V A;  2XXR A;  4NF4 B;  1FTA A;  4DXU A;  4PBQ A;  4R73 A;  4LQ5 A;  1A54 A;  3OEN A;  1N7X A;  3DLN A;  3TCF A;  2VHA A;  1L5T A;  3MVW A;  2Q2A A;  1OVT A;  5K2X A;  5AA3 A;  1MQH A;  3VLU A;  1HSE A;  1URD A;  1JP4 A;  3B7D A;  5I56 A;  3KFM A;  2O84 X;  1ZMG A;  1P1O A;  1NNP A;  5IZZ A;  2PX1 A;  4BDQ A;  3TPA A;  2I0B A;  3CRB A;  5IAI A;  3SEX A;  1USY H;  4GF8 A;  5I5P A;  1B3H A;  4G8N A;  4F1Y A;  2XX8 A;  3OOA A;  1B0L A;  2WYK A;  2IEE A;  1NV3 A;  1ELJ A;  3ZS6 A;  2Z8E A;  4HS7 A;  3RGY A;  2XXX A;  1B05 A;  1MQJ A;  3OXN A;  1B32 A;  2HEU A;  3M3L A;  3K1N A;  4GWX A;  4BDM A;  3SES A;  1K9Z A;  4DI3 D;  3Q28 A;  2H25 A;  1B52 A;  5I84 A;  1KZ8 A;  4XIG Q;  3T9U A;  3OD7 A;  2HAU A;  4G61 A;  4RJZ A;  4MLQ A;  1NMU A;  3O97 A;  4ZEK A;  4POW A;  1NL5 A;  1JQF A;  1RDZ A;  1B3E A;  4R75 A;  3PMX A;  1B5J A;  3N5L A;  4F29 A;  4ESW A;  2HFB A;  4C1T A;  2FVZ A;  4O7I A;  1LAG E;  2V93 A;  2KR0 A;  1MXV A;  4N13 A;  1YPN A;  3TDJ A;  3CG3 A;  1B6H A;  2ABH A;  1BKA A;  4PF6 A;  3T0J A;  1Y3Q A;  1J1N A;  1FPK A;  1NV5 A;  3ISP A;  5FHN A;  3IOU A;  3ROJ A;  1IME A;  3VDF A;  2V25 A;  3CIJ A;  1EYJ A;  2OLB A;  1MY3 A;  3TQL A;  4ZZA A;  3HFU A;  3ODB A;  2DE4 A;  1OLC A;  3WAF A;  2WX9 A;  1UIV A;  2P3V A;  4N6P A;  2CEY A;  4LZ7 A;  3FXB A;  1R9Q A;  4RYA A;  3V8X B;  5I2K B;  1NNK A;  3KSX A;  4JB7 A;  4GL0 A;  2AYS A;  4H5G A;  4QFP A;  5H8S A;  1IXC A;  2B3F A;  4PCD A;  2OWT A;  1MM6 A;  3SEY A;  4GWO A;  1Z7M E;  4QSC A;  1FPE A;  3H6U A;  1JVX A;  1INP A;  1WDN A;  4JWY A;  4NF4 A;  3MJN A;  1B7H A;  2NOO A;  3G3I A;  4OFJ A;  5H8N B;  4OXV A;  3RLF E;  3RQT A;  1EZP A;  3KJ7 A;  5DYH A;  3Q27 A;  4OMB A;  3BIG A;  1M5C A;  4F19 A;  4QSE A;  1DPE A;  3MVX A;  4OAN A;  4MX6 A;  1MH4 A;  5LTC A;  3O6H A;  3MYU A;  4XKP A;  1H44 A;  3S9N C;  3BFU A;  1TT1 A;  4ELP A;  1FPG A;  2XXW A;  1PEB A;  4GXA A;  1B2H A;  4G68 B;  3DP8 A;  4R6K A;  2ZXT A;  4MMP A;  1YYZ A;  2P1S A;  5H8F A;  4MIJ A;  2WEF A;  1N3W A;  4BDN A;  4DXB A;  4NX1 A;  5EQ8 A;  5ISU A;  3TCH A; 
#chains in the Genus database with same CATH homology
 1US4 A;  4PE5 B;  1BP5 A;  1I6Q A;  4QF9 A;  4G68 C;  3C34 A;  2DWH A;  3E4R A;  2I0C A;  1MDP 1;  1N76 A;  3LBS A;  4IO2 A;  3IK6 B;  4PET A;  5DVI A;  2HZL A;  1FQA A;  1ZBM A;  4P0I A;  1Y1M A;  2XXQ A;  2I4B A;  2DSF A;  1URS A;  2PVU A;  3FJM A;  1S9T A;  2ZMB A;  3OSQ A;  3TFL A;  4NF6 B;  3V83 A;  2B4M A;  2DWI A;  2ONK E;  3UA8 A;  3O29 A;  1OIB A;  1KWH A;  3GBB A;  3N6U A;  3S9E A;  4PFU A;  2GHB A;  3F11 A;  1HSL A;  1FCK A;  1FW0 A;  5L9S A;  3MQ9 A;  4GD5 A;  4YIC A;  3FVG A;  3GLB A;  3CSB A;  5AA4 B;  4YZZ A;  4OES A;  3GZG A;  1BLF A;  1D4N A;  2UYF A;  2O7U A;  3DRF A;  2QS3 A;  3TTM A;  1MXZ A;  4RK2 A;  5EYF A;  4BDL A;  1H76 A;  2E1S A;  1URG A;  3OEM A;  4QRZ A;  2F7C A;  1T0K A;  4MFI A;  1LBB A;  2BJJ X;  4HCW A;  3KG2 A;  1IQ7 A;  2F36 A;  3MW0 A;  1N04 A;  4AB6 A;  3O28 A;  3DRK A;  2I49 A;  3DP6 A;  2Y7P A;  4HW8 A;  2QL3 A;  2XX7 A;  4GVO A;  2F5X A;  4OHN A;  4JWX A;  3IL1 B;  1VR5 A;  3PPQ A;  5I58 B;  3M8U A;  3IOR A;  1SYH A;  1QVS A;  2QS1 A;  4PQJ A;  4GQO A;  4LA9 A;  3PPR A;  3EQ1 A;  4IO6 A;  4KYS A;  2DE3 A;  2AL4 A;  4GL8 A;  3DRG A;  3PPP A;  4NF5 B;  4JDF A;  2WOK A;  1RYO A;  5H8Q B;  2I3W A;  1P1W A;  2RIN A;  1JNF A;  3HV1 A;  3UIF A;  3LSL A;  1P99 A;  1B1X A;  5H8H A;  4H8I A;  5CBR A;  3PD9 A;  4IB2 A;  1A8E A;  3K1P A;  2NWJ A;  1JEV A;  2Z8F A;  3TQW A;  2UVH A;  3O6I A;  1JW1 A;  2OJT A;  3SEW A;  2Q89 A;  2F35 A;  1NNT A;  4C0R A;  3U94 A;  3TEL A;  2XX9 A;  1N84 A;  3C36 A;  1VSO A;  4O3C A;  1QUK A;  4YKK A;  1JW5 A;  3CI8 A;  3PUX E;  3FV2 A;  3L6H A;  4U4X A;  4PFY A;  4U1Z A;  3USD A;  4U21 A;  4NF6 A;  3EN3 A;  3THI A;  3VXB A;  3IJO B;  2UVJ A;  2X7Q A;  3T9H B;  2DS9 A;  1HSJ A;  3LC8 A;  4MF3 A;  5ELV A;  5F1Q A;  5IKB A;  1JW4 A;  1B46 A;  3DRJ A;  1MPB A;  1Y4C A;  3N26 A;  3EHT A;  5L9M A;  4AQ4 A;  4DLD A;  5I59 B;  3IAZ A;  4POX A;  4FAT A;  1MH3 A;  3HPI A;  3ZKL A;  3KOT A;  4GLI A;  5I2N B;  4QFO A;  2P2A A;  3RUM A;  1IIT A;  5B70 A;  5ITP A;  3O9P A;  4THI A;  3PPN A;  3CR9 A;  4U1O A;  1ANF A;  3S9L C;  1CB6 A;  3HHG A;  1NKX A;  1FTJ A;  3R6U A;  2PYY A;  4KI0 E;  2FNC A;  3C4M A;  3E13 X;  3RT8 A;  2QPQ A;  3MZ1 A;  2VOZ A;  1PC3 A;  4I8C A;  4R74 A;  1P1N A;  5F7V A;  4F1U A;  1GVC A;  3HCQ A;  2ESN A;  4R6Y A;  2X26 A;  2F78 A;  4KPT A;  1QUL A;  2F7B A;  4QFL A;  3KJT A;  3CFZ A;  4M1V A;  4WEP A;  4ZE8 A;  1DTZ A;  3W15 C;  3FV1 A;  5K2Y A;  1DPP A;  3G3G A;  3U8Q A;  3DP4 A;  1ZIU A;  3PGF A;  1UTB B;  2Y7W A;  3H03 A;  4R9G A;  1MDQ A;  1A99 A;  3EHU A;  3CFL A;  1ATG A;  1CE2 A;  1QUJ A;  3TKD A;  3IB2 A;  4Z7E A;  4G8M A;  3UGW A;  4KR5 A;  3MVZ A;  5JK4 A;  2XXP A;  3HO7 A;  4U23 A;  2OK2 A;  5AA1 A;  4YKI A;  4JBZ A;  3TOD A;  3G3K A;  1TWY A;  3K2D A;  4Z0I A;  2W7Y A;  2PT1 A;  3PMV A;  3VV5 A;  4F3B A;  1LBC A;  3CFX A;  3V5A A;  5AA2 A;  4XKN A;  4P0G A;  3SET A;  4HCY A;  3RTW B;  3LUY A;  3RT6 B;  4LAT A;  2E0S A;  2XXT A;  1II5 A;  1MY0 A;  1EZO A;  4JXI A;  1MXU A;  3IB1 A;  4F22 A;  1MS7 A;  4OWD A;  1N0T A;  3TEP A;  4XKQ A;  5JTY B;  1H3D A;  2FYI A;  2REJ A;  2DXR A;  4F3S A;  5I57 B;  1H43 A;  5I59 A;  2B65 A;  2A5T A;  3MZB A;  2DWA A;  3Q29 A;  2OWS A;  5I2N A;  3KN7 A;  3V89 B;  2H9B A;  1MG1 A;  4GIZ A;  3MP1 A;  4ECF A;  4DZ1 A;  1XS5 A;  2O7I A;  2IA4 A;  3T93 B;  4C1U A;  4YB6 A;  1D9V A;  4NMY A;  4DXC A;  1SW5 A;  1Y4T A;  4OQO A;  1JVY A;  4GXS B;  5FTI A;  3S4U A;  3PUW E;  3K1M A;  2V3T A;  2NUV A;  3EHS A;  2V84 A;  5HM4 B;  1B4Z A;  3C35 A;  3QYT A;  1LGB C;  2OZZ A;  3AXF A;  1UIU A;  2NXO A;  5DEX B;  3MZ9 A;  4TQU Q;  5KDT A;  1D3K A;  3TUS A;  2RF1 A;  2Q8J A;  1Q1K A;  4IO5 A;  3TZA A;  4U4S A;  1M5E A;  1M5F A;  3K0V A;  1ZTY A;  4BDR A;  2F6G A;  1MY1 A;  3FAT A;  4KYE A;  4EF1 A;  3HST A;  3OO8 A;  1B58 A;  2HQ0 A;  3OEL A;  3QSL A;  3T96 B;  1H45 A;  2ZNS A;  3T9X B;  4R6H A;  1B5I A;  4KCC A;  4WKM A;  1MPD A;  4RY1 A;  2ALU A;  2G29 A;  5J1D A;  2I4C A;  3OO9 A;  3FJG A;  4L17 A;  4YMB A;  5KCJ B;  3VVF A;  2O51 A;  3RNN A;  3T9V A;  3TTK A;  4ESX A;  1XVY A;  1O63 A;  1SBP A;  3FVO A;  4XKR A;  4FJP A;  5TP9 B;  5FTH A;  1SW4 A;  4I9D A;  5M2V A;  1UTH B;  2RKM A;  3IX1 A;  3QK6 A;  2Z23 A;  3MP6 A;  1IXH A;  4I62 A;  3U72 A;  3UK4 A;  3WAE A;  3PMW A;  5HPQ A;  2GFE A;  3U93 A;  1MM7 A;  3R7X A;  3FVK A;  1ZKB A;  2M8C A;  3TTN A;  3IB0 A;  5HBC A;  3QUF A;  2XXY A;  5JTY A;  4H0W A;  1POY 1;  3BKI B;  2DOJ A;  2XHD A;  2CZL A;  1Y3P A;  3LSF B;  3ILU B;  4RPN A;  2AIX A;  2F6P A;  3SEU A;  3P7I A;  3M3F A;  5AE4 A;  1QW0 A;  2XXU A;  3A09 A;  1I69 A;  4TOZ A;  5JEI A;  2VP1 A;  1B5H A;  1LAF E;  1DOT A;  4LZ5 A;  4DCY A;  4YKJ A;  5I2K A;  1Y1Z A;  4YMA A;  5FHM A;  3VVD A;  3IR1 A;  4RXL A;  3M3K A;  2H4I A;  4EQ9 A;  1S7Y A;  4NED A;  3LR1 A;  4NF8 B;  2ZYM A;  2OBG A;  1MQG A;  2PMS A;  4ZEF A;  1MQD A;  1MY4 A;  3MAM A;  4KFQ A;  2I3V A;  3KZG A;  2HZK A;  5H8N A;  4FEB A;  2Z8D A;  3UN6 A;  1WVJ A;  4OEV A;  2KLF A;  5A5X B;  4U2R A;  3EPE A;  3D4G A;  4G77 A;  3TTR A;  1LFI A;  3G7W A;  3RY3 A;  1VE4 A;  2I6E A;  4OEN A;  4R72 A;  1QKB A;  4KCD A;  3H6V A;  3OSR A;  3UOR A;  4G68 A;  3EF7 A;  3U92 A;  1F9B A;  5KCJ A;  1P1U A;  1B7Z A;  3SEV A;  4X1B A;  2THI A;  3DM0 A;  2QSX A;  2Q2C A;  1PDA A;  3B6W A;  4EQB A;  3VVE A;  2YPN A;  3QXM A;  5I56 B;  1FQB A;  1MXY A;  3Q25 A;  1Y3N A;  4LZ8 A;  1FTL A;  1DSN A;  4R2B A;  5AA2 D;  4WXJ A;  3D4C A;  3TAJ A;  2F97 A;  3A3C A;  4UA8 A;  4EXK A;  1LB9 A;  4UAC A;  3SDF A;  3CVG A;  2O1M A;  1ZU0 A;  5L9O A;  5DVJ A;  1DMB A;  4OEU A;  4ND9 A;  3I5O A;  3OEK A;  1JET A;  4FEC A;  1N7W A;  1NH8 A;  4QSD A;  3U1O A;  4JSO A;  1SW1 A;  3G3J A;  3MC2 A;  4DDD A;  4H1X A;  2ZYK A;  3R26 A;  1PB9 A;  3H4Z A;  4MLV A;  4YAH X;  2WKY A;  3B6T A;  3L6G A;  1GGG A;  5CM6 A;  2AL5 A;  4F2Q A;  5ICQ A;  5DTB A;  1XHY A;  1FQE A;  5AA4 A;  4X9T A;  1QUI A;  2R6G E;  3KBR A;  1FQD A;  2DVC A;  4RPO A;  2UYE A;  1SI1 A;  1IIW A;  1YCJ A;  2Q9T A;  2RCB A;  4KYD A;  2REG A;  4IGT A;  1PBQ A;  3FZV A;  2RC8 A;  2O69 A;  1LST A;  1GTK A;  1A8F A;  3B6Q A;  4MH5 A;  3HHF A;  1I6A A;  4OVJ A;  4LUB A;  5B7D A;  3LSX A;  4E0X A;  1LCT A;  3C32 A;  1GV8 A;  4LON B;  3FAS A;  2H98 A;  5BWJ A;  4YKP A;  2QS2 A;  2UVI A;  2XXH A;  4N07 A;  3H3G A;  3PD8 A;  5I58 A;  1B3F A;  4GFR A;  3CG1 A;  3MUQ A;  3O6G A;  4LP2 B;  1M5D A;  3RTF B;  5ITO A;  1WOD A;  1I6B A;  1B1H A;  4QHQ A;  2XXV A;  2DVZ A;  3O6P A;  3TCG A;  4LQ2 A;  3Q26 A;  4IO3 A;  3DRH A;  2DXY A;  4NF5 A;  5H8Q A;  3K02 A;  1A55 A;  1MPC A;  3BBR A;  2OCU A;  3BFT A;  2XD3 A;  1SDX A;  4TLL B;  1B40 A;  3PUZ E;  4Q8R A;  4ISU A;  5TPA B;  1RYX A;  1PBP A;  1QJM A;  1AL3 A;  4IO7 A;  4BLA A;  1PB8 A;  2ZNU A;  3RYA A;  4I1D A;  4DE8 A;  1B4H A;  2ZYO A;  4IY5 A;  2V3Q A;  2DWJ A;  1XC1 A;  1R9L A;  1BIY A;  5L8D A;  1USY E;  4Q5T A;  3K6X A;  4BDO A;  3SKP A;  5H8F B;  3GXA A;  1GR2 A;  2ONS A;  3KN3 A;  2F7A A;  3PUY E;  1OQG A;  4ZEI A;  2QMW A;  2XD2 A;  4JSD A;  5KZT A;  2DE2 A;  4H6D A;  3IJX B;  2DYX A;  4DCX A;  1LLS A;  3FXQ A;  3C31 A;  2RC7 A;  4NTL A;  1P1Q A;  3C9H A;  4FED A;  4F3G A;  1IUD A;  1MXW A;  2D21 A;  1SVX B;  3FGS A;  2X7P A;  3W9W A;  1DTG A;  1XVX A;  4Q0C A;  4FE8 A;  4OET A;  4MBP A;  4RA1 A;  4KHZ E;  2ANJ A;  3IOV A;  5CC2 A;  3ONM A;  1NH7 A;  1UQW A;  3MVY A;  3K4U A;  3TMG A;  3RN8 A;  4F1V A;  4G8H A;  3H6T A;  1ZJL A;  4FAJ A;  2I58 A;  3VE1 B;  3PUV E;  1XOC A;  4WED A;  3MBP A;  3JYR A;  3E9X A;  1B3G A;  1Q35 A;  2CMO A;  5CMM A;  1RKM A;  4YU0 A;  4LVQ A;  4R9F A;  5CMK A;  4ZS9 A;  1O7T A;  1LAH E;  1UTB A;  2HAV A;  4NWD A;  3W9V A;  1B7U A;  1VFD A;  3N94 A;  3T66 A;  4FOR A;  3VXC A;  4H65 A;  3I6V A;  1Z7N E;  1AMF A;  2A5S A;  1BTJ A;  1EH3 A;  5TPA A;  1JEU A;  3K00 A;  3H06 B;  2UVG A;  3FUZ A;  4Q30 B;  3KSJ A;  3KEI A;  3VFJ A;  4RNS A;  2Y84 A;  3PAM A;  3HN0 A;  4EXL A;  4F31 B;  2R71 A;  3CSG A;  5H8H B;  3QUJ A;  2H99 A;  4OFL A;  1LFH A;  5EHM A;  4ELO A;  4O3B A;  3I3V A;  3K6W A;  1OVB A;  2D3I A;  1EU8 A;  4DIG A;  1IZ1 A;  4K3F A;  3T22 A;  3QIM A;  2VD3 A;  1ZLQ A;  4GRK A;  2NVU B;  4HTG A;  4QFN A;  4EQ7 A;  4EDP A;  1NNF A;  4ZEC A;  3MPL A;  1SI0 A;  2ONR A;  3ZKK A;  5EHS A;  1B9J A;  1Y9U A;  3DEL B;  3IO6 A;  5I57 A;  4OTE A;  2GH9 A;  4PP0 A;  2Q88 A;  1AOV A;  3FIR A;  4IGR A;  1AIV A;  3O2A A;  4GOT A;  3MWB A;  2D5W A;  4F3P A;  3FVN A;  3S2V A;  3TTL A;  1AH5 A;  4ZED A;  3FXR A;  4RK9 A;  2XXI A;  1MXX A;  3FJ7 A;  3FTO A;  3G3F A;  2HXW A;  2I48 A;  1R6Z A;  3KGC A;  1EZ9 A;  2QMX A;  5TU0 A;  1FTO A;  3K01 A;  5DEX A;  2H5Y A;  4R2F A;  4E0W A;  2WOL A;  4ZDM A;  4ZEB A;  4H67 A;  4F18 A;  3QAX A;  4ONY A;  1LCF A;  3N6T A;  2HCA A;  2PBW A;  2B3B A;  2B4L A;  4KQP A;  4AB5 A;  4OER A;  1MRP A;  4EF2 A;  3IOW A;  4G4P A;  2ZYN A;  1MY2 A;  2Y7K A;  1R1N A;  5LOM A;  2FA7 A;  1O64 A;  3VLW A;  4M4G A;  5DVF A;  3O66 A;  4OZ9 A;  2QJE A;  1Y20 A;  4IO4 A;  2O1L A;  1B0H A;  4XXU A;  2Y7R A;  3ZSF A;  1OLA A;  1POT A;  2GHA A;  1N3X A;  5BUU A;  4ELQ A;  4U22 A;  4H5F A;  2V3U A;  3K6U A;  1A7L A;  1A40 A;  3OO7 A;  4YB7 A;  4ELR A;  1YAE A;  5TP9 A;  4QFK A;  1UTH A;  1FQF A;  2LAO A;  5DT6 A;  1SYI A;  3VLV A;  4P11 A;  2RC9 A;  2F8D A;  3CHG A;  1XT8 A;  1B51 A;  3LVU A;  3DRI A;  2R9J A;  3MP8 A;  5CI5 A;  4FIM A;  3IO4 A;  4ZZE A;  3JZJ A;  1FTK A;  4H8J A;  2UXA A;  2PT2 A;  1MQI A;  5AA2 B;  1US5 A;  3JV9 A;  4JWO A;  2WOP A;  3TYH A;  3RPW A;  3FXU A;  3PPO A;  2Y7I A;  2O68 A;  2RCA A;  1VFE A;  4OYV A;  2DQV A;  1TXF A;  3ILT B;  1LAX A;  3A3U A;  4KD5 A;  3OMB A;  1LFG A;  2YLN A;  2VGQ A;  3UP9 A;  2GRV A;  1IEJ A;  1YTV A;  2P0S A;  1LB8 A;  3LSW A;  1SW2 A;  1IXI A;  1FQC A;  1FTM A;  5FHO A;  1IXG A;  1TFD A;  4F2O A;  4X48 A;  4OFO A;  1TFA A;  2VD2 A;  2QS4 A;  3OO6 A;  4NWC A;  4TLM B;  3G3H A;  4NE4 A;  4PFW A;  2QRY A;  2ZNT A;  4ZE9 A;  3IOT A;  4XTC Q;  2A5T B;  2Z22 A;  3H6W A;  2DP8 A;  4IY6 A;  4G2Z A;  2F34 A;  2O6A A;  1D9Y A;  4NF8 A;  3E3K A;  1M5B A;  1OMP A;  4X1D A;  3C33 A;  3SER A;  5ICT A;  3S9M C;  1S50 A;  2G93 A;  1OQH A;  5CMB A;  1NFT A;  1PB7 A;  3KN8 A;  5CBS A;  4PFT A;  5A5X A;  4YB5 A;  4EUO A;  3MPK A;  1B3L A;  3H7M A;  4F39 A;  3PV0 E;  1QKA A;  3FD3 A;  2YJP A;  3RYB A;  3KOS A;  3GBA A;  3PU5 A;  4O3A A;  1SQY A;  5CMC A;  1SD3 A;  5CRY A;  5KDT B;  3ECR A;  3K6V A;  2XXR A;  4NF4 B;  4DXU A;  4R73 A;  4LQ5 A;  1A54 A;  3OEN A;  1N7X A;  3DLN A;  3TCF A;  2VHA A;  1L5T A;  3MVW A;  2Q2A A;  1OVT A;  5K2X A;  5AA3 A;  1MQH A;  3VLU A;  1HSE A;  1URD A;  3B7D A;  5I56 A;  3KFM A;  2O84 X;  1ZMG A;  1P1O A;  1NNP A;  2PX1 A;  4BDQ A;  3TPA A;  2I0B A;  3CRB A;  5IAI A;  3SEX A;  1USY H;  4GF8 A;  1B3H A;  4G8N A;  4F1Y A;  2XX8 A;  3OOA A;  1B0L A;  2IEE A;  1ELJ A;  3ZS6 A;  2Z8E A;  4HS7 A;  3RGY A;  2XXX A;  1B05 A;  1MQJ A;  3OXN A;  1B32 A;  2HEU A;  3M3L A;  3K1N A;  4BDM A;  3SES A;  3Q28 A;  2H25 A;  1B52 A;  5I84 A;  4XIG Q;  3T9U A;  3OD7 A;  2HAU A;  4RJZ A;  4MLQ A;  1NMU A;  3O97 A;  4ZEK A;  4POW A;  1NL5 A;  1JQF A;  1B3E A;  4R75 A;  3PMX A;  1B5J A;  3N5L A;  4F29 A;  4ESW A;  2HFB A;  4C1T A;  1LAG E;  2V93 A;  1MXV A;  4N13 A;  1YPN A;  3TDJ A;  3CG3 A;  1B6H A;  2ABH A;  1BKA A;  1Y3Q A;  1J1N A;  5FHN A;  3VDF A;  3IOU A;  2V25 A;  3CIJ A;  2OLB A;  1MY3 A;  3TQL A;  4ZZA A;  3ODB A;  2DE4 A;  1OLC A;  3WAF A;  1UIV A;  4N6P A;  4LZ7 A;  1R9Q A;  4RYA A;  3V8X B;  5I2K B;  1NNK A;  3KSX A;  4JB7 A;  4GL0 A;  2AYS A;  4H5G A;  4QFP A;  5H8S A;  1IXC A;  2B3F A;  2OWT A;  1MM6 A;  3SEY A;  4GWO A;  1Z7M E;  4QSC A;  3H6U A;  1JVX A;  1WDN A;  4JWY A;  4NF4 A;  3MJN A;  1B7H A;  2NOO A;  3G3I A;  4OFJ A;  5H8N B;  4OXV A;  3RLF E;  3RQT A;  1EZP A;  3KJ7 A;  5DYH A;  3Q27 A;  4OMB A;  1M5C A;  4F19 A;  4QSE A;  1DPE A;  3MVX A;  1MH4 A;  3O6H A;  4XKP A;  1H44 A;  3S9N C;  3BFU A;  1TT1 A;  4ELP A;  2XXW A;  1PEB A;  4GXA A;  1B2H A;  4G68 B;  3DP8 A;  4R6K A;  2ZXT A;  2P1S A;  5H8F A;  1N3W A;  4BDN A;  4DXB A;  5ISU A;  3TCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...