4OEVA

Crystal structure of nikz from campylobacter jejuni in complex with ni(ii) ion
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
494
structure length
494
Chain Sequence
KIPKDTLIIAVENEIARINPAYSEDHDAVINLVFSGLTRFDENMSLKPDLAKSWDISKDGLVYDIFLRDDVLWHDGVKFSADDVKFSIEAFKNPKNNSSIYVNFEDIKSVEILNPSHVKITLFKPYPAFLDALSIGMLPKHLLENENLNTSSFNQNPIGTGPYKFVKWKKGEYVEFKANEHFYLDKVKTPRLIIKHIFDPSIASAELKNGKIDAALIDVSLLNIFKNDENFGILREKSADYRALMFNLDNEFLKDLKVRQALNYAVDKESIVKNLLHDYAFVANHPLERSWANSKNFKIYKYDPKKAEDLLVSAGFKKNKDGNFEKDGKILEFEIWAMSNDPLRVSLAGILQSEFRKIGVVSKVVAKPAGSFDYSKVDSFLIGWGSPLDPDFHTFRVFESSQDSALNDEGWNFGHYHDKKVDIALQKARNTSNLEERKKYYKDFIDALYENPPFIFLAYLDFALVYNKDLKGIKTRTLGHHGVGFTWNVYEWSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Promiscuous nickel import in human pathogens: structure, thermodynamics, and evolution of extracytoplasmic nickel-binding proteins.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords Putative peptide ABC-transport system periplasmic peptide-bi
total genus 172
structure length 494
sequence length 494
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4oevA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oevA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 4oevA02
3EN3A 3K6XA 1FCKA 3T9VA 5CRYA 1LB8A 4YU0A 3TCFA 4OEUA 2RCBA 2ZMBA 3DP8A 1WDNA 1SI0A 1XVYA 3CR9A 5ISUA 1BKAA 3R26A 1MY0A 1SVXB 5DVFA 2F97A 1RYXA 3LUYA 3DRIA 4BDRA 3TTNA 1YTVA 4FE8A 3KGCA 2XXUA 3IOTA 3PUVE 2XX9A 4HCYA 4NMYA 4R9GA 3EF7A 3FTOA 3S9MC 2VP1A 4X9TA 3RYAA 2DP8A 2D5WA 5KCJB 1JVXA 1B58A 4H5FA 3UA8A 4N07A 4QRZA 4U2RA 3DRKA 1JQFA 3E9XA 3DRJA 1ZKBA 4GF8A 2DWJA 2ZYOA 1CE2A 2YJPA 3MZBA 1UTHB 5H8QB 2O1LA 4QFPA 4YZZA 5EYFA 1B3HA 1A54A 3O6HA 1NMUA 1LAXA 5CBSA 5I58B 2Z23A 1FTJA 3SETA 5I57A 1URSA 4DE8A 2OZZA 4OENA 3PUXE 1B5JA 5KZTA 5TPAB 3Q29A 1USYE 2OWSA 3CFZA 3ODBA 1B7HA 2ALUA 2YLNA 2DE4A 4GVOA 4JWXA 5I58A 2O7UA 4M4GA 4EXKA 4HW8A 1MXXA 3FXRA 1N04A 3Q28A 4GWOA 2QPQA 3BBRA 1YCJA 1Y20A 3C31A 1B40A 4U1ZA 3FZVA 3K6UA 1R6ZA 5I56A 1OMPA 3ZKKA 5CMCA 1QW0A 2AL4A 1MY2A 4IGRA 2HZLA 4JWYA 5H8NB 3AXFA 4OEVA 1R9LA 2Z8EA 2ANJA 2P1SA 4Q8RA 1I69A 4KI0E 3IB0A 3U94A 2F7CA 3LSLA 1P1OA 3RPWA 1M5DA 1JVYA 2HXWA 3PMVA 3T22A 2O6AA 2P2AA 3FASA 3UIFA 3K6VA 2HQ0A 1M5CA 2RINA 3I3VA 3OMBA 4ECFA 1D3KA 4FORA 4E0WA 4WEDA 3TKDA 2OJTA 3ZSFA 3KBRA 3PUZE 1AIVA 1MQIA 4YKPA 1N3XA 4F1UA 4F19A 3JZJA 3GLBA 3RGYA 3QUJA 4RY1A 1M5BA 4G68C 1AL3A 1US4A 3GXAA 3HO7A 4IO6A 3VLUA 1FTLA 3H03A 1BIYA 1MDP1 5TP9A 5I2KB 2ABHA 5H8QA 1B6HA 4EXLA 3EQ1A 2ZXTA 3RY3A 2FYIA 1EU8A 3PMXA 3PPOA 3SDFA 4ELOA 4IO3A 1NFTA 5I57B 4H1XA 2ONRA 2Y7KA 4EF1A 4P11A 1B9JA 1I6AA 2FA7A 3T9HB 4DZ1A 1LBCA 3PD8A 3QYTA 3SEVA 3VXBA 3W15C 3TAJA 1Y1MA 5BUUA 1AOVA 3TUSA 3D4GA 4YMBA 4F3SA 2A5TB 1FQAA 1UIUA 3OO7A 3LSXA 3TCGA 2ONSA 5DEXB 2Y84A 3T66A 3PD9A 4NF6B 4KPTA 2QMXA 4LATA 1WODA 2Q8JA 4AB6A 4F22A 2XXYA 4KQPA 1LCFA 1ELJA 1B46A 3EPEA 3OSQA 3TZAA 2DXYA 4LONB 3MP6A 1A55A 2E1SA 1SW5A 1B3GA 2Y7WA 4PP0A 1LFGA 4ZS9A 3W9VA 1PDAA 3JV9A 1GGGA 2F34A 3MZ9A 1B1XA 1H45A 3PUYE 3T93B 1O63A 4EUOA 4P0GA 2WOLA 3K00A 1WVJA 2O51A 3K1MA 1Q1KA 1B3LA 3LR1A 2UYEA 3MC2A 3Q26A 4ZEKA 3UN6A 3DELB 4E0XA 5TU0A 5JEIA 3TTLA 1KWHA 3MP1A 4O3BA 2Q2AA 2VGQA 1MXUA 3CI8A 4ZZAA 4RA1A 3IOVA 1Y3PA 1DMBA 4RK2A 1MH3A 1TFAA 1QKAA 4NF8A 4NF4B 1TFDA 3GZGA 2A5SA 3C33A 5M2VA 2O84X 3OSRA 4H0WA 4U1OA 4BDNA 4I1DA 1MH4A 3CSGA 4RK9A 3MVWA 5I2KA 4R73A 3IK6B 1A8FA 3RT6B 5KDTB 3GBBA 3IB2A 2F6PA 3IORA 3S4UA 5K2XA 3KN7A 4GIZA 4X1BA 5ICTA 5LOMA 5L9MA 4OERA 1J1NA 3K0VA 3HSTA 3IAZA 3VXCA 3CFXA 3FD3A 3C36A 4MFIA 2F5XA 4YKIA 1L5TA 3OXNA 1NH8A 1MQJA 1MXZA 1SYIA 3O97A 1SDXA 3O9PA 1B4HA 1JW4A 1B7UA 1Y9UA 3B6WA 4JB7A 3G3HA 3IOUA 4RXLA 1I6BA 1MM7A 5DEXA 4THIA 5H8HA 3CRBA 3KG2A 4JBZA 3L6HA 5HM4B 2ZYNA 2R6GE 1DPPA 3C4MA 3KOSA 4LZ5A 3SKPA 4YMAA 4QF9A 2REJA 2XD2A 1JEUA 2I3VA 3A3CA 5CBRA 1H44A 1MG1A 2RC7A 3FGSA 1N7XA 2PX1A 4F29A 3M3KA 3IR1A 1AH5A 1SYHA 4KD5A 1POTA 3C34A 4K3FA 4WEPA 5DVJA 4KFQA 3V83A 1H3DA 4NF5B 1B0LA 2R9JA 2WOKA 3QAXA 4TQUQ 4F3GA 1NNFA 1S9TA 1N0TA 2UYFA 4GXAA 2H25A 3PPRA 4N6PA 4WXJA 4GFRA 4XKQA 3Q27A 1MXVA 4PFYA 4XIGQ 5H8HB 2QS3A 4FEBA 4OFOA 3O28A 4NF4A 4NF8B 2DVCA 4I8CA 1MY3A 5CMKA 3B6QA 3Q25A 1B0HA 4UA8A 1ZIUA 1QUJA 1XT8A 4ISUA 1IITA 1UTBA 2QL3A 1B32A 2XXQA 5B70A 1SBPA 3N5LA 4TLMB 3VV5A 3RQTA 3FVNA 4KYDA 1B05A 4BDLA 1FQFA 3MW0A 4U4SA 4JSDA 4OZ9A 3FJMA 3DRGA 1DSNA 4R6HA 1D9VA 3KJTA 5HBCA 1SI1A 1XC1A 1IXHA 3CG3A 3FUZA 3KSJA 4MH5A 3MWBA 3RYBA 2BJJX 2X7QA 1LB9A 4PFWA 2QMWA 2VHAA 2RKMA 3SEWA 4F2QA 3OD7A 4MBPA 4X48A 5AA4A 2QSXA 2VOZA 1T0KA 1B7ZA 4IB2A 1OQGA 2UVJA 2H9BA 4IY5A 3HHFA 3HHGA 4KR5A 1HSJA 3SERA 5I56B 5I2NA 4QFLA 2WKYA 1TT1A 3T9UA 3V8XB 2ZNSA 1YAEA 1ZBMA 2B3BA 4I62A 3EHUA 1IXCA 4F3PA 1ZJLA 2I3WA 1MDQA 1NL5A 3MPKA 2Q9TA 3IX1A 1FQBA 3VVFA 3TPAA 1MQGA 4HS7A 1POY1 4BDQA 1B2HA 4JDFA 4ESXA 4O3AA 4IY6A 4DCYA 5AA2B 4F18A 1LAFE 2DWAA 5AA3A 1JEVA 5IAIA 3HV1A 2XXVA 1MS7A 2F6GA 2XXIA 4ELPA 4IO5A 5CMMA 1MXYA 3S9LC 2B65A 4GOTA 4LUBA 5CI5A 4R6YA 2XX8A 1ZLQA 1H76A 2PVUA 1ZTYA 1LGBC 1HSEA 3H6UA 3OEKA 1SW4A 1II5A 1VFEA 3WAFA 3R6UA 3FVOA 3PU5A 4JXIA 1HSLA 4WKMA 5EHMA 4ZEFA 4EQBA 2PMSA 4KCDA 4JWOA 3MVXA 1N76A 1JETA 1VE4A 2CMOA 3D4CA 3OO8A 4G8HA 4BDMA 3WAEA 5HPQA 3SESA 3UGWA 3RNNA 2W7YA 1NH7A 4XTCQ 4XKRA 2FNCA 2D3IA 4FECA 2B3FA 3G7WA 2V25A 3HCQA 3MBPA 2PT2A 1OQHA 2QS2A 3TMGA 1MQDA 1F9BA 3K4UA 1A40A 1PC3A 3VDFA 1JW5A 2OWTA 3IO4A 2DS9A 4BLAA 1Z7ME 4O3CA 4F1VA 3M8UA 2X7PA 2DWIA 4M1VA 1H43A 1TXFA 4KYEA 1OLAA 2G29A 3DP6A 3O6IA 1LBBA 1S50A 1VR5A 3MP8A 4OTEA 2GHAA 5DTBA 1VSOA 1OIBA 2D21A 2F7AA 3ECRA 5DVIA 5DYHA 2HCAA 4GQOA 1A7LA 4GRKA 1NNKA 4ELQA 3HN0A 5AA2A 1MPBA 2O69A 1EH3A 4PFTA 1Z7NE 2QS1A 1IZ1A 4NWCA 5BWJA 3H4ZA 4YB5A 4C1TA 3H6VA 1CB6A 5I84A 1DPEA 1PB8A 1AMFA 3G3GA 3ILUB 1P99A 1XS5A 4OQOA 4N13A 4GD5A 4ND9A 3OENA 3OOAA 5FTIA 4OVJA 3EHSA 3ILTB 3K1PA 2ZYKA 3BFUA 4R2BA 3H06B 3SEYA 2V93A 3MPLA 3VVEA 4DXCA 4LA9A 3G3FA 3DRHA 2AYSA 3RT8A 4QFOA 1SQYA 3IL1B 1US5A 2I0BA 5DT6A 3MUQA 2Q88A 1PB9A 4F39A 5ICQA 2I6EA 2KLFA 4QSCA 5IKBA 1XHYA 2UVGA 3K2DA 3H6WA 3TTRA 3QIMA 5K2YA 3E3KA 2XXRA 2RC9A 3E4RA 4ELRA 1SW1A 1IXGA 4DXBA 4ZE9A 5AE4A 4FEDA 3OO9A 2R71A 3PAMA 4GL0A 3RN8A 4F31B 4DCXA 4ZECA 1PBPA 1PEBA 4G8MA 4KHZE 4Z0IA 4ZZEA 4IO4A 4ZEIA 2XXWA 1JW1A 3V89B 2DE3A 1ZU0A 1I6QA 1MPDA 1OVBA 1B51A 2F8DA 1R9QA 3M3FA 1VFDA 1UTHA 2DSFA 2Z8FA 3PMWA 1P1UA 2PYYA 4G2ZA 2B4MA 3KN8A 2PT1A 4G68A 2O7IA 4H8IA 2IA4A 4OYVA 5H8SA 3SEUA 5J1DA 2M8CA 3SEXA 3N94A 1RYOA 1B52A 2OLBA 2I4CA 2ONKE 2V3UA 1Q35A 3E13X 4GLIA 1FQDA 4U23A 3USDA 2UVHA 4LP2B 5KDTA 4FJPA 4OFLA 4ONYA 3ONMA 3O2AA 3C35A 4TLLB 4OXVA 5JK4A 3ZKLA 3VFJA 1O64A 1SW2A 4AB5A 4OETA 1QJMA 4BDOA 3BFTA 2AIXA 3LVUA 4RNSA 2DYXA 3A09A 3CVGA 3K1NA 3O66A 4DIGA 5ELVA 4NF5A 4C1UA 5FHMA 3U1OA 1SD3A 3QSLA 2H5YA 2I48A 1FW0A 1QUKA 2GH9A 3B7DA 2NXOA 3PGFA 4XXUA 5F7VA 2WOPA 3TYHA 4F1YA 4NF6A 5A5XA 3O29A 1B5IA 3FATA 2HAUA 3P7IA 4G8NA 3N6TA 4R75A 1B4ZA 3HPIA 2I49A 3LBSA 3K02A 1LLSA 2Q2CA 3M3LA 4POWA 3UP9A 4XKNA 2NVUB 4Q30B 3U92A 5L8DA 1MY4A 3H6TA 3L6GA 1D9YA 2AL5A 1Y4TA 4EDPA 3PV0E 2Y7RA 3V5AA 4OESA 4PFUA 4TOZA 4XKPA 4OFJA 1BP5A 1DTZA 2QS4A 2YPNA 1IUDA 4GXSB 2RC8A 1FQEA 4IGTA 5TP9B 4OWDA 2NWJA 3VVDA 5ITOA 2DE2A 1S7YA 3TQWA 2F36A 3OEMA 4KCCA 3DLNA 3LSWA 3TFLA 1UTBB 3CG1A 2HAVA 3W9WA 1FTMA 3RTWB 2ZYMA 3FV1A 1FTOA 3FVGA 3VLWA 5AA4B 2VD3A 3GBAA 4ESWA 5I59A 1EZ9A 3C9HA 1GV8A 2DVZA 4MF3A 3QK6A 3RUMA 2NOOA 3BKIB 3EHTA 3FIRA 4RJZA 1B3FA 1Y3QA 3IJXB 2V3QA 4QFKA 5I59B 2DOJA 4ZDMA 1FQCA 3CSBA 3G3JA 2OK2A 3H3GA 5H8NA 2HFBA 2X26A 4HCWA 3MAMA 4RPNA 4YB6A 3TTKA 2Z22A 4G4PA 4POXA 2F78A 2O1MA 4YB7A 3FXQA 3S2VA 4U21A 3MQ9A 1ZMGA 2ZNTA 3LC8A 3UORA 1IIWA 1RKMA 1PB7A 2B4LA 1O7TA 1Y4CA 3O6GA 4NTLA 4NWDA 4DDDA 4DXUA 4F3BA 5B7DA 3N6UA 4H8JA 1A8EA 1NKXA 4PQJA 4H67A 3T9XB 1LSTA 4YICA 2DWHA 1R1NA 4C0RA 3CHGA 4H65A 3IJOB 4U22A 3ZS6A 3FVKA 4R74A 4IO7A 3VLVA 2E0SA 4ZEBA 4KYSA 1IEJA 4MLVA 5H8FB 4LQ5A 4YKJA 5FHOA 3S9NC 3MJNA 2XHDA 4Q5TA 2THIA 4QSDA 4GL8A 2GHBA 3CIJA 3G3KA 4FAJA 4R72A 5AA1A 1NNPA 3IO6A 3KSXA 3B6TA 2P0SA 4H5GA 3U72A 3U8QA 5KCJA 2ESNA 3O6PA 3IB1A 1PBQA 4FIMA 1ANFA 1Y1ZA 4NE4A 3KEIA 2O68A 1QKBA 5A5XB 1LAHE 3TEPA 4MLQA 1N84A 1NNTA 1OVTA 5JTYA 2I0CA 2HZKA 4YKKA 1GVCA 5CM6A 1LFHA 3KFMA 3I5OA 2H99A 4PE5B 5CMBA 3PPNA 4FATA 5L9SA 1FTKA 3C32A 4ZE8A 4R9FA 4U4XA 3RTFB 2V3TA 1BLFA 2RF1A 5JTYB 3TELA 4DLDA 2Y7PA 2VD2A 1D4NA 5H8FA 4G68B 4PETA 1LFIA 2Z8DA 3OO6A 5AA2D 3TCHA 4ZEDA 2OBGA 1MY1A 4H6DA 3OELA 2RCAA 3N26A 3TDJA 4AQ4A 3CFLA 4EQ7A 5TPAA 1MPCA 4RPOA 3JYRA 4IO2A 4G77A 4EQ9A 3LSFB 3FJ7A 1B3EA 1P1WA 2CZLA 2PBWA 3K6WA 5F1QA 2Q89A 3DRFA 1ATGA 1M5FA 1MXWA 3FV2A 3H7MA 1B5HA 3K01A 3TODA 1QVSA 2DQVA 1USYH 4JSOA 2HEUA 2I58A 3FXUA 4HTGA 3KZGA 2I4BA 2H98A 4NEDA 1OLCA 3F11A 4Q0CA 1GR2A 3PPPA 4YAHX 3A3UA 2XX7A 3PUWE 3QXMA 4LQ2A 2ZNUA 5FTHA 3U93A 5I2NB 2NUVA 1IQ7A 2REGA 4Z7EA 1BTJA 1IXIA 1GTKA 3R7XA 2XD3A 2QJEA 1LAGE 1XVXA 3G3IA 4QHQA 1DTGA 5ITPA 2XXPA 3VE1B 3MVYA 4OHNA 1QUIA 5L9OA 1M5EA 2G93A 2XXTA 3KJ7A 1EZOA 3I6VA 3DM0A 3S9EA 4LZ8A 1MQHA 3KN3A 2XXXA 3FJGA 4P0IA 1EZPA 1UQWA 4I9DA 4R6KA 1QULA 2GRVA 1TWYA 4RYAA 1A99A 3THIA 1UIVA 2UXAA 3MZ1A 2GFEA 4R2FA 1DOTA 1Y3NA 4QFNA 2V84A 5CC2A 3KOTA 2XXHA 1URGA 2OCUA 4F2OA 1MM6A 1LCTA 2DXRA 4OMBA 1B1HA 3MVZA 1JNFA 3DP4A 2UVIA 3IOWA 2IEEA 2QRYA 3PPQA 1YPNA 2F7BA 3TQLA 1MRPA 4LZ7A 2Y7IA 4UACA 2LAOA 4X1DA 5EHSA 1XOCA 1URDA 5FHNA 3T96B 3TTMA 3UK4A 4LVQA 1N3WA 1P1QA 4EF2A 1N7WA 1P1NA 3RLFE 3QUFA 4QSEA 2H4IA 4L17A 2F35A 2A5TA
chains in the Genus database with same CATH superfamily
3EN3A 4YU0A 4OEUA 1WDNA 1SI0A 1BKAA 5DVFA 1NV2A 4R9GA 3FTOA 3S9MC 2VP1A 1B58A 4U2RA 3DRJA 3ISPA 2YJPA 1UTHB 4QFPA 3O6HA 1FPKA 5TPAB 1USYE 2OWSA 3CFZA 1B7HA 5I58A 4M4GA 3FXRA 4GWOA 1YCJA 1R6ZA 3RPLB 1DBZA 3ZKKA 2AL4A 2HZLA 3AXFA 2Z8EA 2P1SA 3U94A 3LSLA 1P1OA 3RPWA 2RINA 3PUZE 1M5BA 4IO6A 3VLUA 5LTCA 3H03A 1MDP1 2FIXA 5I2KB 4EXLA 2ZXTA 2FYIA 3PMXA 4MJOA 4EF1A 4P11A 1B9JA 3W15C 1Y1MA 4NAPA 3D4GA 4YMBA 4NHBA 1FQAA 4I3EA 3TCGA 1FBCA 2Y84A 1LCFA 3EPEA 4LONB 2E1SA 1SW5A 3W9VA 1GGGA 2WOLA 3K00A 3K1MA 2L5VA 2UYEA 4N8GA 1FPBA 1KWHA 3MP1A 4O3BA 2Q2AA 1Y3PA 1QKAA 1TFDA 4N17A 4H0WA 4U1OA 4BDNA 3CSGA 3IK6B 5K2XA 4GIZA 4X1BA 4OERA 3HSTA 3FD3A 1MXZA 1B4HA 3IOUA 4I3YA 5DEXA 5IM2A 4THIA 5H8HA 3CRBA 4JBZA 2F3BA 4MMPA 1DPPA 1FPLA 4HE0A 1Q9DA 4OVRA 4QF9A 3BIGA 5CBRA 1MG1A 1N7XA 2PX1A 1SYHA 1KA1A 1EYIA 1POTA 4K3FA 2R9JA 4TQUQ 1NNFA 3PPRA 3Q27A 4XIGQ 5H8HB 2QS3A 2WYPA 2DVCA 3Q25A 1ZIUA 1XT8A 1B32A 1BK4A 1SBPA 3VV5A 2WBBA 4KYDA 4JSDA 3DRGA 4P1LA 3CG3A 3KSJA 2BJJX 1LB9A 4PFWA 2QMWA 5AA4A 3OD7A 2WYKA 2QSXA 2VOZA 1T0KA 1B7ZA 3IFCA 4GBWA 1HSJA 5I2NA 1NV7A 1MDQA 3TPAA 4PBQA 1POY1 4IY6A 3EKIA 1LAFE 1JEVA 2XXVA 1MS7A 1LEVA 5CMMA 3S9LC 4GOTA 5CI5A 2XX8A 4I40A 2R8TA 1LGBC 3H6UA 3OEKA 4GWSA 4PFRA 5EHMA 2HHMA 3RNNA 1QGXA 4XTCQ 2B3FA 3G7WA 1OQHA 3TMGA 4LN5A 2ZZXA 2Q8MA 3E78A 4M1VA 1H43A 4KYEA 3DP6A 5ET5A 4ZZAA 3ECRA 4GRKA 3HN0A 4N15A 1IZ1A 3H4ZA 1IMFA 3G3GA 4GD5A 4R2BA 3SEYA 3MPLA 4H46A 3G3FA 3IL1B 5DT6A 2Q88A 4F39A 5IKBA 2I6EA 1XHYA 2RC9A 1FPFA 1IXGA 4FEDA 3OO9A 2XXWA 3V89B 1I6QA 1B51A 2DSFA 2PYYA 4OYVA 4H8IA 2M8CA 3SEXA 1RYOA 2V3UA 5KDTA 1Q35A 1NUZA 4TLLB 4OXVA 5JK4A 3VFJA 1O64A 3CVGA 5ELVA 2GH9A 5A5XA 2HAUA 3P7IA 4R75A 4N4UA 2I49A 4POWA 2CEXA 4XKNA 3H6TA 3V5AA 4TOZA 2YPNA 3KZGA 1BP5A 4OFJA 4F3PA 2RC8A 3PTYA 3TQWA 3OEMA 4KCCA 3TFLA 1IMDA 4PFBA 5AA4B 4ESWA 5I59A 3RUMA 3BKIB 1Y3QA 1YYZA 2V3QA 2DOJA 3ROJA 2OK2A 2Z22A 2O1MA 4U21A 3MQ9A 1IIWA 1RKMA 1PB7A 4NG7A 3N6UA 1IMEA 4H67A 1LSTA 4C0RA 4GX6A 3FVKA 4PFIA 4IO7A 4QBAA 5H8FB 4GL8A 3G3KA 1NNPA 3U8QA 5KCJA 2ESNA 3O6PA 1LAHE 4MLQA 1NV4A 2HZKA 5IZZA 3I5OA 4H45A 3C32A 4U4XA 2RF1A 4G68B 4PETA 4NN3A 5AA2D 3TCHA 3LUZA 5AA2B 3N26A 5TPAA 4RPOA 3JYRA 4IO2A 2FHYA 3FJ7A 4HE2A 1FJ6A 1P1WA 3RGYA 3TODA 3K01A 2I58A 4Q0CA 1GR2A 4O7IA 3PPPA 4LQ2A 1IQ7A 4PDHA 1BTJA 1IXIA 4IR8A 3R7XA 2QJEA 5L9OA 2QVVA 1FBEA 1EZOA 5ET6A 4P0IA 3FJGA 4I9DA 1QULA 3T1BA 1A99A 1UIVA 2GFEA 2OX3A 2QVUA 1LCTA 1JNFA 1LBXA 2OWZA 2UVIA 3IOWA 1YPNA 2F7BA 3UP9A 5FHNA 1N3WA 2HXRA 4MNPA 2F35A 1FCKA 5CRYA 1LB8A 3TCFA 3R26A 1MY0A 2F97A 1NV0A 1RYXA 4FE8A 3EF7A 5KCJB 1JVXA 4N07A 3DRKA 5EQ9A 4GF8A 4FBPA 3MZBA 5H8QB 4YZZA 5EYFA 1A54A 5CBSA 2PCRA 5I58B 2Z23A 5I57A 1URSA 4OENA 4GVOA 2O7UA 4HW8A 5IZ3B 3BBRA 1Y20A 1B40A 4U1ZA 3FZVA 5I56A 1OMPA 1MY2A 4JWYA 4OEVA 1R9LA 1NI9A 3B50A 1LBZA 2F7CA 1M5DA 4PF8A 1KZ8A 2O6AA 3FASA 1LBWA 2OJTA 1YZ0A 3KBRA 1MQIA 1N3XA 4F19A 3QUJA 4G68C 4PBHA 2V4CA 1B6HA 3SDFA 4IO3A 1NFTA 3SEVA 2A5TB 3OO7A 2FBPA 3PD9A 4NF6B 4F22A 2QMXA 4AB6A 2Q8JA 2XXYA 3OSQA 1B46A 1DCUA 1RDZA 2DXYA 1B3GA 4ZS9A 1LFGA 1PDAA 3MZ9A 1B1XA 1H45A 1WVJA 3MYUA 2CEYA 1Q1KA 4AS4A 4ZEKA 1FJ9A 3DELB 4E0XA 2VGQA 3IOVA 1TFAA 4NF8A 4NF4B 3C33A 1DK4A 2O84X 3OSRA 4I1DA 4RK9A 5I2KA 1A8FA 3RT6B 3GBBA 5ICTA 5L9MA 3VXCA 2F5XA 3S9NC 4JB7A 3FXBA 3G3HA 4RXLA 1I6BA 1MM7A 3L6HA 2XWOA 5HM4B 2KQZA 4YMAA 3A3CA 2I3VA 2RC7A 4WEPA 3IR1A 1AH5A 4X04A 3C34A 1H3DA 4F3GA 4OA4A 2H25A 4XKQA 4PFYA 4FEBA 3O28A 2ZZWA 3B6QA 4ISUA 1IITA 4TLMB 3HFUA 5HBCA 1SI1A 4X8RA 4HXVA 1IXHA 4MH5A 3RYBA 1NUYA 2VHAA 4F2QA 2RKMA 4NX1A 4IY5A 3SERA 5I56B 3T9UA 1IMCA 2WKYA 3V8XB 2ZNSA 1ZBMA 2B3BA 1IXCA 1NL5A 3MPKA 4XEQA 4HS7A 4ESXA 1INPA 1B2HA 4O3AA 4F18A 1MXYA 2PVUA 1HSEA 1SW4A 3R6UA 2PMSA 3MVXA 1N76A 4G8HA 3OO8A 4BDMA 4PAFA 3SESA 3UGWA 1NH7A 4XKRA 2D3IA 4MNCA 3IO4A 1Z7ME 4O3CA 3FBPA 2P3VA 1TXFA 1RDXA 1NUXA 1VSOA 5DVIA 4MIJA 4PFTA 1Z7NE 4NWCA 4C1TA 4OVPA 1DPEA 1AMFA 1P99A 1XS5A 4OQOA 4N13A 3EHSA 3ILTB 3VVEA 4DXCA 4EXKA 4QFOA 5ICQA 4PE3A 3E4RA 4DXBA 5AE4A 5F24A 3B8BA 3RN8A 2CZKA 4ZEIA 1MPDA 3TTRA 1VFDA 3PMWA 2Z8FA 2B4MA 2O7IA 3N94A 4BDRA 1B52A 2UVHA 4FJPA 3O2AA 1SW2A 4OETA 3BFTA 2AIXA 2XA5A 4RNSA 3K1NA 4DIGA 1SD3A 1QUKA 4F1YA 5F7VA 1B5IA 1B4ZA 3LBSA 4P56A 4GWYA 3U92A 1MY4A 3L6GA 1D9YA 2Y7RA 4YKJA 4GXSB 1FQEA 5TP9B 2NWJA 3KBZA 2DE2A 3DLNA 3BIHA 3W9WA 3RTWB 3KC1A 1EZ9A 4NGUA 4PC9A 1B3FA 3IJXB 4QFKA 4ZDMA 3H3GA 2HFBA 4HCWA 3MAMA 4YB7A 3O6GA 4DDDA 2KR0A 4NTLA 4NWDA 5B7DA 4H8JA 1A8EA 4YICA 4H65A 5A5LA 3ZS6A 4R74A 3VLVA 4ZEBA 1IEJA 2VPNA 4MLVA 1YXIA 5FHOA 3MJNA 2XHDA 2THIA 2GHBA 3CIJA 4R72A 3B6TA 3U72A 1PBQA 1ANFA 3KEIA 2O68A 3RPLA 1FPIA 1N84A 1OVTA 4YKKA 5IGAA 5CM6A 2MKZA 3PPNA 4FATA 1FTKA 1BLFA 5JTYB 4HE1A 5ET7A 3OO6A 4ZEDA 1MY1A 1IMBA 3TDJA 4AQ4A 3CFLA 3LSFB 2PBWA 5IZ3A 5ESYA 5ET8A 1ATGA 1FTAA 2CZIA 1QVSA 4JSOA 3FXUA 4NEDA 3F11A 5FTHA 1GTKA 2XD3A 1XVXA 3G3IA 5ITPA 2XXPA 3VE1B 3MVYA 2XXTA 3I6VA 3MSTA 4LZ8A 1EZPA 4OANA 2GRVA 4RYAA 4R2FA 1DOTA 2V84A 4QFNA 5I5PA 3KOTA 2XXHA 4F2OA 1LBYA 4OMBA 1B1HA 1SPIA 3DP4A 2IEEA 2Q74A 1IMAA 1MRPA 4UACA 4X1DA 5EHSA 4LVQA 1P1QA 4EF2A 3RLFE 3QUFA 3H06B 3K6XA 3T9VA 4MX6A 2RCBA 3DP8A 1XVYA 3CR9A 5ISUA 1SVXB 2P3NA 3LUYA 3KGCA 1CNQA 3PUVE 4HCYA 2XX9A 4NMYA 2DP8A 3UA8A 2FVZA 1JQFA 5EQ8A 2DWJA 4DI4B 2ZYOA 2FIEA 4MHFA 2O1LA 1B3HA 4DE8A 2OZZA 3PUXE 1B5JA 5KZTA 2ALUA 2DE4A 1MXXA 3Q28A 2QPQA 4N8YA 5EQAA 3K6UA 1FBFA 4NQ8A 3IB0A 1JVYA 2HXWA 3PMVA 3T22A 2P2AA 2HQ0A 1M5CA 3I3VA 1D3KA 4FORA 2XWIA 3ZSFA 1NV6A 1AIVA 4YKPA 4F1UA 4RY1A 1AL3A 1US4A 3GXAA 3HO7A 4P9KA 4P8BA 5TP9A 1EYJA 1FBPA 3RY3A 1EU8A 4ELOA 2Y7KA 1I6AA 2FA7A 3T9HB 4DZ1A 1AOVA 3VXBA 3TAJA 2PFZA 4F3SA 5I7IA 1UIUA 2VPOA 3LSXA 3T66A 4LATA 1WODA 4DI3D 4KQPA 3MP6A 1A55A 4PP0A 3JV9A 2F34A 3T93B 1O63A 4P0GA 2O51A 1B3LA 3LR1A 3MC2A 3Q26A 3UN6A 3CI8A 1MXUA 4RK2A 5M2VA 3MVWA 4R73A 2F6PA 3IORA 3KN7A 3K0VA 3CFXA 3C36A 4YKIA 1L5TA 3OXNA 1MQJA 1SYIA 3O97A 1SDXA 3O9PA 1JW4A 3B6WA 3KG2A 3C4MA 3KOSA 4LZ5A 3SKPA 1FPDA 2REJA 2XD2A 1JEUA 4XF5A 1H44A 3M3KA 5DVJA 4KFQA 1B0LA 2WOKA 3QAXA 4UABA 1S9TA 1N0TA 2UYFA 4GWUA 4WXJA 1MXVA 5EYHA 4OFOA 4NF4A 4NF8B 1MY3A 1B0HA 2XXQA 5B70A 3RQTA 3FVNA 1LBVA 4BDLA 1FQFA 4U4SA 1FPJA 3FJMA 1D9VA 2Y5KA 1FPEA 2X7QA 3SEWA 4MBPA 4X48A 2H9BA 1YAEA 3EHUA 2Q9TA 1FQBA 3VVFA 1MQGA 4BDQA 4DCYA 5IAIA 2VT5A 4ELPA 2F6GA 2B65A 4LUBA 1ZLQA 1H76A 1ZTYA 1VFEA 3PU5A 1HSLA 4KCDA 2CMOA 2FNCA 2QS2A 3VDFA 1JW5A 4F1VA 2DS9A 3M8UA 2DWIA 2G29A 3O6IA 1LBBA 5DTBA 1S50A 2QVRA 4DXUA 2GHAA 1OIBA 4ELQA 1A7LA 5AA2A 2O69A 5BWJA 4YB5A 5I84A 3ILUB 4ND9A 3OENA 5FTIA 4OVJA 1VDWA 4LA9A 3DRHA 3RT8A 1SQYA 3MUQA 1PB9A 4QSCA 2KLFA 2UVGA 5K2YA 3E3KA 3A29A 4ZE9A 2R71A 3PAMA 4GL0A 1PBPA 1PEBA 4KHZE 4O8MA 4Z0IA 4IO4A 1AWBA 2DE3A 4PDDA 4PF6A 4LZ7A 1R9QA 1UTHA 4G2ZA 3KN8A 4G68A 2PT1A 5H8SA 2IA4A 2ONKE 4U23A 2OLBA 4GLIA 3USDA 3S9EA 4ONYA 3ONMA 3C35A 4AB5A 4GBVA 4BDOA 2DYXA 3O66A 4C1UA 4NF0A 3QSLA 3QMFA 3B7DA 4XXUA 2WEFA 2WOPA 2HPGA 4NF6A 3GYYA 1FSAA 2Q2CA 3M3LA 4Q30B 5L8DA 1Y4TA 4PFUA 4MCOA 2QS4A 1S7YA 2F36A 3LSWA 5T3JA 3FV1A 1FTOA 3FVGA 3VLWA 4PAKA 2VD3A 1GV8A 4O94A 2DVZA 3QK6A 2NOOA 2F3DA 3EHTA 3FIRA 4RJZA 2XXKA 1FQCA 3CSBA 3G3JA 5H8NA 2X26A 4YB6A 4G4PA 2F78A 3FXQA 2ZNTA 3UORA 1Y4CA 1O7TA 1NKXA 4PQJA 2DWHA 1G0HA 4N6KA 3CHGA 1K9YA 4U22A 4JVDA 2E0SA 2GQ1A 4LQ5A 3KSXA 3IO6A 2P0SA 4PCDA 3TEPA 5JTYA 1GVCA 1LFHA 3KFMA 2H99A 5CMBA 4ZE8A 3U65A 3TELA 2Y7PA 5J16A 2Z8DA 4PTKA 1FBDA 4H6DA 3OELA 4EQ7A 4G77A 1B3EA 2CZLA 3K6WA 4ELRA 2Q89A 3H7MA 1M5FA 2ZZVA 3FV2A 1USYH 2HEUA 2I4BA 2H98A 4MAGA 2XX7A 3PUWE 3QXMA 3U93A 1FBHA 4Z7EA 4OVSA 1LAGE 4OHNA 1QUIA 2G93A 1FRPA 3KN3A 2XXXA 4R6KA 1TWYA 2UXAA 3MZ1A 2OCUA 4OVQA 3MVZA 3PPQA 3TQLA 3RYDA 2Y7IA 3IFAA 2LAOA 3TTMA 1URDA 1N7WA 4QSEA 2A5TA 4EUOA 2ZMBA 4QXDA 4PGPA 3DRIA 4JVCA 1YTVA 3TTNA 2XXUA 3IOTA 3RYAA 2D5WA 4H5FA 4QRZA 3E9XA 1ZKBA 1CE2A 1NMUA 1LAXA 1FTJA 3SETA 3Q29A 3ODBA 2YLNA 4JWXA 4N6DA 3SZPA 1N04A 2PFYA 3C31A 5CMCA 1QW0A 4IGRA 5H8NB 2ANJA 4Q8RA 1I69A 4KI0E 4P3LA 5I3SA 2CZHA 3LV0A 3UIFA 3K6VA 3OMBA 4ECFA 4E0WA 4WEDA 4GWXA 3TKDA 3JZJA 3GLBA 4GWZA 1FTLA 1BIYA 2ABHA 5H8QA 3EQ1A 3PPOA 5I57B 4H1XA 2ONRA 5FBPA 1LBCA 3PD8A 3QYTA 5BUUA 3TUSA 3E79A 2ONSA 5DEXB 4KPTA 3TZAA 1ELJA 2DDKA 2Y5LA 2Y7WA 1FBGA 3PUYE 5TU0A 5JEIA 3TTLA 4RA1A 1DMBA 1MH3A 3GZGA 2A5SA 1MH4A 5KDTB 3IB2A 3S4UA 5LOMA 1J1NA 3IAZA 4MFIA 3UK4A 1NH8A 1K9ZA 1B7UA 1Y9UA 2ZYNA 2R6GE 3FGSA 2BJIA 4F29A 4KD5A 3V83A 3D1RA 4NF5B 4OVTA 4AS5A 4GXAA 4N6PA 4GFRA 1NV3A 4I8CA 5CMKA 4PGNA 4UA8A 1QUJA 1UTBA 2QL3A 3N5LA 2QFLA 1B05A 3MW0A 4OZ9A 2WBDA 1DSNA 4R6HA 3KJTA 1XC1A 3FUZA 3MWBA 4JVIA 1RDYA 5EYGA 4IB2A 1OQGA 2UVJA 3HHFA 3HHGA 4KR5A 4QFLA 1TT1A 4I62A 5DW8A 1ZJLA 2I3WA 2WX9A 3IX1A 4JDFA 5AA3A 2DWAA 3HV1A 2XXIA 4IO5A 4R6YA 3NOHA 1JP4A 1II5A 3WAFA 4O7MA 3FVOA 4JXIA 4EQBA 4WKMA 4ZEFA 4JWOA 1VE4A 1JETA 3D4CA 5HPQA 3WAEA 2XWKA 2W7YA 4FECA 3HCQA 3MBPA 2PT2A 1MQDA 1F9BA 3K4UA 1A40A 1PC3A 2OWTA 4BLAA 2X7PA 4GWWA 1OLAA 4OTEA 1VR5A 3MP8A 5DYHA 2F7AA 2D21A 2HCAA 4GQOA 1NNKA 1MPBA 1EH3A 2QS1A 3H6VA 1CB6A 1PB8A 1FPGA 4MEVA 1G0IA 3OOAA 5LDZA 3K1PA 2ZYKA 3BFUA 4MNIA 2V93A 2AYSA 1US5A 2I0BA 3K2DA 3H6WA 3QIMA 2XXRA 1SW1A 4F31B 4DCXA 4ZECA 4G8MA 4KXPA 4ZZEA 1JW1A 1ZU0A 1OVBA 3M3FA 2F8DA 4X9TA 1P1UA 3SEUA 5J1DA 2I4CA 1XI6A 3E13X 4P47A 1FQDA 3KC0A 4LP2B 4OFLA 3ZKLA 4PAIA 1QJMA 3LVUA 2XWVA 3A09A 4NF5A 5FHMA 3U1OA 2H5YA 2I48A 1FW0A 3PGFA 3TYHA 2NXOA 3O29A 3FATA 4G8NA 3N6TA 3HPIA 3K02A 1LLSA 4P1EA 2NVUB 1D9QA 2AL5A 4EDPA 3PV0E 4G61A 4OESA 4XKPA 4GX4A 1DTZA 1IUDA 4IGTA 4OWDA 3VVDA 5ITOA 1KA0A 1UTBB 3CG1A 2HAVA 1FTMA 2ZYMA 4N81A 3GBAA 4XFEA 3C9HA 4MF3A 5I59B 4RPNA 3TTKA 4POXA 1EYKA 3S2VA 1ZMGA 3LC8A 2B4LA 4F3BA 1NV5A 3T9XB 1R1NA 5IZ1A 3IJOB 4KYSA 1NV1A 4Q5TA 4QSDA 5AA1A 4FAJA 4H5GA 3IB1A 4FIMA 4NE4A 1Y1ZA 5A5XB 1QKBA 3T0JA 1NNTA 2I0CA 4PE5B 5L9SA 4R9FA 3RTFB 2V3TA 4DLDA 2VD2A 1D4NA 5H8FA 1LFIA 2OBGA 2RCAA 1MPCA 4EQ9A 1NUWA 5F1QA 3DRFA 1MXWA 1B5HA 2DQVA 4HTGA 1OLCA 4GX3A 5EQ7A 4YAHX 3A3UA 2ZNUA 5I2NB 2NUVA 2REGA 4QHQA 1DTGA 1M5EA 3KJ7A 3DM0A 1MQHA 1UQWA 3THIA 1Y3NA 5CC2A 1URGA 1MM6A 2DXRA 2JJKA 2QRYA 3T96B 1XOCA 4N91A 1P1NA 2H4IA 4L17A 2V25A
chains in the Genus database with same CATH topology
3EN3A 3K6XA 1FCKA 3T9VA 5CRYA 1LB8A 4YU0A 3TCFA 4OEUA 2RCBA 2ZMBA 3DP8A 1WDNA 1SI0A 1XVYA 3CR9A 5ISUA 1BKAA 3R26A 1MY0A 1SVXB 5DVFA 2F97A 1RYXA 3LUYA 3DRIA 4BDRA 3TTNA 1YTVA 4FE8A 3KGCA 2XXUA 3IOTA 3PUVE 2XX9A 4HCYA 4NMYA 4R9GA 3EF7A 3FTOA 3S9MC 2VP1A 4X9TA 3RYAA 2DP8A 2D5WA 5KCJB 1JVXA 1B58A 4H5FA 3UA8A 4N07A 4QRZA 4U2RA 3DRKA 1JQFA 3E9XA 3DRJA 1ZKBA 4GF8A 2DWJA 2ZYOA 1CE2A 2YJPA 3MZBA 1UTHB 5H8QB 2O1LA 4QFPA 4YZZA 5EYFA 1B3HA 1A54A 3O6HA 1NMUA 1LAXA 5CBSA 5I58B 2Z23A 1FTJA 3SETA 5I57A 1URSA 4DE8A 2OZZA 4OENA 3PUXE 1B5JA 5KZTA 5TPAB 3Q29A 1USYE 2OWSA 3CFZA 3ODBA 1B7HA 2ALUA 2YLNA 2DE4A 4GVOA 4JWXA 5I58A 2O7UA 4M4GA 4EXKA 4HW8A 1MXXA 3FXRA 1N04A 3Q28A 4GWOA 2QPQA 3BBRA 1YCJA 1Y20A 3C31A 1B40A 4U1ZA 3FZVA 3K6UA 1R6ZA 5I56A 1OMPA 3ZKKA 5CMCA 1QW0A 2AL4A 1MY2A 4IGRA 2HZLA 4JWYA 5H8NB 3AXFA 4OEVA 1R9LA 2Z8EA 2ANJA 2P1SA 4Q8RA 1I69A 4KI0E 3IB0A 3U94A 2F7CA 3LSLA 1P1OA 3RPWA 1M5DA 1JVYA 2HXWA 3PMVA 3T22A 2O6AA 2P2AA 3FASA 3UIFA 3K6VA 2HQ0A 1M5CA 2RINA 3I3VA 3OMBA 4ECFA 1D3KA 4FORA 4E0WA 4WEDA 3TKDA 2OJTA 3ZSFA 3KBRA 3PUZE 1AIVA 1MQIA 4YKPA 1N3XA 4F1UA 4F19A 3JZJA 3GLBA 3RGYA 3QUJA 4RY1A 1M5BA 4G68C 1AL3A 1US4A 3GXAA 3HO7A 4IO6A 3VLUA 1FTLA 3H03A 1BIYA 1MDP1 5TP9A 5I2KB 2ABHA 5H8QA 1B6HA 4EXLA 3EQ1A 2ZXTA 3RY3A 2FYIA 1EU8A 3PMXA 3PPOA 3SDFA 4ELOA 4IO3A 1NFTA 5I57B 4H1XA 2ONRA 2Y7KA 4EF1A 4P11A 1B9JA 1I6AA 2FA7A 3T9HB 4DZ1A 1LBCA 3PD8A 3QYTA 3SEVA 3VXBA 3W15C 3TAJA 1Y1MA 5BUUA 1AOVA 3TUSA 3D4GA 4YMBA 4F3SA 2A5TB 1FQAA 1UIUA 3OO7A 3LSXA 3TCGA 2ONSA 5DEXB 2Y84A 3T66A 3PD9A 4NF6B 4KPTA 2QMXA 4LATA 1WODA 2Q8JA 4AB6A 4F22A 2XXYA 4KQPA 1LCFA 1ELJA 1B46A 3EPEA 3OSQA 3TZAA 2DXYA 4LONB 3MP6A 1A55A 2E1SA 1SW5A 1B3GA 2Y7WA 4PP0A 1LFGA 4ZS9A 3W9VA 1PDAA 3JV9A 1GGGA 2F34A 3MZ9A 1B1XA 1H45A 3PUYE 3T93B 1O63A 4EUOA 4P0GA 2WOLA 3K00A 1WVJA 2O51A 3K1MA 1Q1KA 1B3LA 3LR1A 2UYEA 3MC2A 3Q26A 4ZEKA 3UN6A 3DELB 4E0XA 5TU0A 5JEIA 3TTLA 1KWHA 3MP1A 4O3BA 2Q2AA 2VGQA 1MXUA 3CI8A 4ZZAA 4RA1A 3IOVA 1Y3PA 1DMBA 4RK2A 1MH3A 1TFAA 1QKAA 4NF8A 4NF4B 1TFDA 3GZGA 2A5SA 3C33A 5M2VA 2O84X 3OSRA 4H0WA 4U1OA 4BDNA 4I1DA 1MH4A 3CSGA 4RK9A 3MVWA 5I2KA 4R73A 3IK6B 1A8FA 3RT6B 5KDTB 3GBBA 3IB2A 2F6PA 3IORA 3S4UA 5K2XA 3KN7A 4GIZA 4X1BA 5ICTA 5LOMA 5L9MA 4OERA 1J1NA 3K0VA 3HSTA 3IAZA 3VXCA 3CFXA 3FD3A 3C36A 4MFIA 2F5XA 4YKIA 1L5TA 3OXNA 1NH8A 1MQJA 1MXZA 1SYIA 3O97A 1SDXA 3O9PA 1B4HA 1JW4A 1B7UA 1Y9UA 3B6WA 4JB7A 3G3HA 3IOUA 4RXLA 1I6BA 1MM7A 5DEXA 4THIA 5H8HA 3CRBA 3KG2A 4JBZA 3L6HA 5HM4B 2ZYNA 2R6GE 1DPPA 3C4MA 3KOSA 4LZ5A 3SKPA 4YMAA 4QF9A 2REJA 2XD2A 1JEUA 2I3VA 3A3CA 5CBRA 1H44A 1MG1A 2RC7A 3FGSA 1N7XA 2PX1A 4F29A 3M3KA 3IR1A 1AH5A 1SYHA 4KD5A 1POTA 3C34A 4K3FA 4WEPA 5DVJA 4KFQA 3V83A 1H3DA 4NF5B 1B0LA 2R9JA 2WOKA 3QAXA 4TQUQ 4F3GA 1NNFA 1S9TA 1N0TA 2UYFA 4GXAA 2H25A 3PPRA 4N6PA 4WXJA 4GFRA 4XKQA 3Q27A 1MXVA 4PFYA 4XIGQ 5H8HB 2QS3A 4FEBA 4OFOA 3O28A 4NF4A 4NF8B 2DVCA 4I8CA 1MY3A 5CMKA 3B6QA 3Q25A 1B0HA 4UA8A 1ZIUA 1QUJA 1XT8A 4ISUA 1IITA 1UTBA 2QL3A 1B32A 2XXQA 5B70A 1SBPA 3N5LA 4TLMB 3VV5A 3RQTA 3FVNA 4KYDA 1B05A 4BDLA 1FQFA 3MW0A 4U4SA 4JSDA 4OZ9A 3FJMA 3DRGA 1DSNA 4R6HA 1D9VA 3KJTA 5HBCA 1SI1A 1XC1A 1IXHA 3CG3A 3FUZA 3KSJA 4MH5A 3MWBA 3RYBA 2BJJX 2X7QA 1LB9A 4PFWA 2QMWA 2VHAA 2RKMA 3SEWA 4F2QA 3OD7A 4MBPA 4X48A 5AA4A 2QSXA 2VOZA 1T0KA 1B7ZA 4IB2A 1OQGA 2UVJA 2H9BA 4IY5A 3HHFA 3HHGA 4KR5A 1HSJA 3SERA 5I56B 5I2NA 4QFLA 2WKYA 1TT1A 3T9UA 3V8XB 2ZNSA 1YAEA 1ZBMA 2B3BA 4I62A 3EHUA 1IXCA 4F3PA 1ZJLA 2I3WA 1MDQA 1NL5A 3MPKA 2Q9TA 3IX1A 1FQBA 3VVFA 3TPAA 1MQGA 4HS7A 1POY1 4BDQA 1B2HA 4JDFA 4ESXA 4O3AA 4IY6A 4DCYA 5AA2B 4F18A 1LAFE 2DWAA 5AA3A 1JEVA 5IAIA 3HV1A 2XXVA 1MS7A 2F6GA 2XXIA 4ELPA 4IO5A 5CMMA 1MXYA 3S9LC 2B65A 4GOTA 4LUBA 5CI5A 4R6YA 2XX8A 1ZLQA 1H76A 2PVUA 1ZTYA 1LGBC 1HSEA 3H6UA 3OEKA 1SW4A 1II5A 1VFEA 3WAFA 3R6UA 3FVOA 3PU5A 4JXIA 1HSLA 4WKMA 5EHMA 4ZEFA 4EQBA 2PMSA 4KCDA 4JWOA 3MVXA 1N76A 1JETA 1VE4A 2CMOA 3D4CA 3OO8A 4G8HA 4BDMA 3WAEA 5HPQA 3SESA 3UGWA 3RNNA 2W7YA 1NH7A 4XTCQ 4XKRA 2FNCA 2D3IA 4FECA 2B3FA 3G7WA 2V25A 3HCQA 3MBPA 2PT2A 1OQHA 2QS2A 3TMGA 1MQDA 1F9BA 3K4UA 1A40A 1PC3A 3VDFA 1JW5A 2OWTA 3IO4A 2DS9A 4BLAA 1Z7ME 4O3CA 4F1VA 3M8UA 2X7PA 2DWIA 4M1VA 1H43A 1TXFA 4KYEA 1OLAA 2G29A 3DP6A 3O6IA 1LBBA 1S50A 1VR5A 3MP8A 4OTEA 2GHAA 5DTBA 1VSOA 1OIBA 2D21A 2F7AA 3ECRA 5DVIA 5DYHA 2HCAA 4GQOA 1A7LA 4GRKA 1NNKA 4ELQA 3HN0A 5AA2A 1MPBA 2O69A 1EH3A 4PFTA 1Z7NE 2QS1A 1IZ1A 4NWCA 5BWJA 3H4ZA 4YB5A 4C1TA 3H6VA 1CB6A 5I84A 1DPEA 1PB8A 1AMFA 3G3GA 3ILUB 1P99A 1XS5A 4OQOA 4N13A 4GD5A 4ND9A 3OENA 3OOAA 5FTIA 4OVJA 3EHSA 3ILTB 3K1PA 2ZYKA 3BFUA 4R2BA 3H06B 3SEYA 2V93A 3MPLA 3VVEA 4DXCA 4LA9A 3G3FA 3DRHA 2AYSA 3RT8A 4QFOA 1SQYA 3IL1B 1US5A 2I0BA 5DT6A 3MUQA 2Q88A 1PB9A 4F39A 5ICQA 2I6EA 2KLFA 4QSCA 5IKBA 1XHYA 2UVGA 3K2DA 3H6WA 3TTRA 3QIMA 5K2YA 3E3KA 2XXRA 2RC9A 3E4RA 4ELRA 1SW1A 1IXGA 4DXBA 4ZE9A 5AE4A 4FEDA 3OO9A 2R71A 3PAMA 4GL0A 3RN8A 4F31B 4DCXA 4ZECA 1PBPA 1PEBA 4G8MA 4KHZE 4Z0IA 4ZZEA 4IO4A 4ZEIA 2XXWA 1JW1A 3V89B 2DE3A 1ZU0A 1I6QA 1MPDA 1OVBA 1B51A 2F8DA 1R9QA 3M3FA 1VFDA 1UTHA 2DSFA 2Z8FA 3PMWA 1P1UA 2PYYA 4G2ZA 2B4MA 3KN8A 2PT1A 4G68A 2O7IA 4H8IA 2IA4A 4OYVA 5H8SA 3SEUA 5J1DA 2M8CA 3SEXA 3N94A 1RYOA 1B52A 2OLBA 2I4CA 2ONKE 2V3UA 1Q35A 3E13X 4GLIA 1FQDA 4U23A 3USDA 2UVHA 4LP2B 5KDTA 4FJPA 4OFLA 4ONYA 3ONMA 3O2AA 3C35A 4TLLB 4OXVA 5JK4A 3ZKLA 3VFJA 1O64A 1SW2A 4AB5A 4OETA 1QJMA 4BDOA 3BFTA 2AIXA 3LVUA 4RNSA 2DYXA 3A09A 3CVGA 3K1NA 3O66A 4DIGA 5ELVA 4NF5A 4C1UA 5FHMA 3U1OA 1SD3A 3QSLA 2H5YA 2I48A 1FW0A 1QUKA 2GH9A 3B7DA 2NXOA 3PGFA 4XXUA 5F7VA 2WOPA 3TYHA 4F1YA 4NF6A 5A5XA 3O29A 1B5IA 3FATA 2HAUA 3P7IA 4G8NA 3N6TA 4R75A 1B4ZA 3HPIA 2I49A 3LBSA 3K02A 1LLSA 2Q2CA 3M3LA 4POWA 3UP9A 4XKNA 2NVUB 4Q30B 3U92A 5L8DA 1MY4A 3H6TA 3L6GA 1D9YA 2AL5A 1Y4TA 4EDPA 3PV0E 2Y7RA 3V5AA 4OESA 4PFUA 4TOZA 4XKPA 4OFJA 1BP5A 1DTZA 2QS4A 2YPNA 1IUDA 4GXSB 2RC8A 1FQEA 4IGTA 5TP9B 4OWDA 2NWJA 3VVDA 5ITOA 2DE2A 1S7YA 3TQWA 2F36A 3OEMA 4KCCA 3DLNA 3LSWA 3TFLA 1UTBB 3CG1A 2HAVA 3W9WA 1FTMA 3RTWB 2ZYMA 3FV1A 1FTOA 3FVGA 3VLWA 5AA4B 2VD3A 3GBAA 4ESWA 5I59A 1EZ9A 3C9HA 1GV8A 2DVZA 4MF3A 3QK6A 3RUMA 2NOOA 3BKIB 3EHTA 3FIRA 4RJZA 1B3FA 1Y3QA 3IJXB 2V3QA 4QFKA 5I59B 2DOJA 4ZDMA 1FQCA 3CSBA 3G3JA 2OK2A 3H3GA 5H8NA 2HFBA 2X26A 4HCWA 3MAMA 4RPNA 4YB6A 3TTKA 2Z22A 4G4PA 4POXA 2F78A 2O1MA 4YB7A 3FXQA 3S2VA 4U21A 3MQ9A 1ZMGA 2ZNTA 3LC8A 3UORA 1IIWA 1RKMA 1PB7A 2B4LA 1O7TA 1Y4CA 3O6GA 4NTLA 4NWDA 4DDDA 4DXUA 4F3BA 5B7DA 3N6UA 4H8JA 1A8EA 1NKXA 4PQJA 4H67A 3T9XB 1LSTA 4YICA 2DWHA 1R1NA 4C0RA 3CHGA 4H65A 3IJOB 4U22A 3ZS6A 3FVKA 4R74A 4IO7A 3VLVA 2E0SA 4ZEBA 4KYSA 1IEJA 4MLVA 5H8FB 4LQ5A 4YKJA 5FHOA 3S9NC 3MJNA 2XHDA 4Q5TA 2THIA 4QSDA 4GL8A 2GHBA 3CIJA 3G3KA 4FAJA 4R72A 5AA1A 1NNPA 3IO6A 3KSXA 3B6TA 2P0SA 4H5GA 3U72A 3U8QA 5KCJA 2ESNA 3O6PA 3IB1A 1PBQA 4FIMA 1ANFA 1Y1ZA 4NE4A 3KEIA 2O68A 1QKBA 5A5XB 1LAHE 3TEPA 4MLQA 1N84A 1NNTA 1OVTA 5JTYA 2I0CA 2HZKA 4YKKA 1GVCA 5CM6A 1LFHA 3KFMA 3I5OA 2H99A 4PE5B 5CMBA 3PPNA 4FATA 5L9SA 1FTKA 3C32A 4ZE8A 4R9FA 4U4XA 3RTFB 2V3TA 1BLFA 2RF1A 5JTYB 3TELA 4DLDA 2Y7PA 2VD2A 1D4NA 5H8FA 4G68B 4PETA 1LFIA 2Z8DA 3OO6A 5AA2D 3TCHA 4ZEDA 2OBGA 1MY1A 4H6DA 3OELA 2RCAA 3N26A 3TDJA 4AQ4A 3CFLA 4EQ7A 5TPAA 1MPCA 4RPOA 3JYRA 4IO2A 4G77A 4EQ9A 3LSFB 3FJ7A 1B3EA 1P1WA 2CZLA 2PBWA 3K6WA 5F1QA 2Q89A 3DRFA 1ATGA 1M5FA 1MXWA 3FV2A 3H7MA 1B5HA 3K01A 3TODA 1QVSA 2DQVA 1USYH 4JSOA 2HEUA 2I58A 3FXUA 4HTGA 3KZGA 2I4BA 2H98A 4NEDA 1OLCA 3F11A 4Q0CA 1GR2A 3PPPA 4YAHX 3A3UA 2XX7A 3PUWE 3QXMA 4LQ2A 2ZNUA 5FTHA 3U93A 5I2NB 2NUVA 1IQ7A 2REGA 4Z7EA 1BTJA 1IXIA 1GTKA 3R7XA 2XD3A 2QJEA 1LAGE 1XVXA 3G3IA 4QHQA 1DTGA 5ITPA 2XXPA 3VE1B 3MVYA 4OHNA 1QUIA 5L9OA 1M5EA 2G93A 2XXTA 3KJ7A 1EZOA 3I6VA 3DM0A 3S9EA 4LZ8A 1MQHA 3KN3A 2XXXA 3FJGA 4P0IA 1EZPA 1UQWA 4I9DA 4R6KA 1QULA 2GRVA 1TWYA 4RYAA 1A99A 3THIA 1UIVA 2UXAA 3MZ1A 2GFEA 4R2FA 1DOTA 1Y3NA 4QFNA 2V84A 5CC2A 3KOTA 2XXHA 1URGA 2OCUA 4F2OA 1MM6A 1LCTA 2DXRA 4OMBA 1B1HA 3MVZA 1JNFA 3DP4A 2UVIA 3IOWA 2IEEA 2QRYA 3PPQA 1YPNA 2F7BA 3TQLA 1MRPA 4LZ7A 2Y7IA 4UACA 2LAOA 4X1DA 5EHSA 1XOCA 1URDA 5FHNA 3T96B 3TTMA 3UK4A 4LVQA 1N3WA 1P1QA 4EF2A 1N7WA 1P1NA 3RLFE 3QUFA 4QSEA 2H4IA 4L17A 2F35A 2A5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN3 A;  3K6X A;  1FCK A;  3T9V A;  5CRY A;  1LB8 A;  4YU0 A;  3TCF A;  4OEU A;  2RCB A;  2ZMB A;  3DP8 A;  1WDN A;  1SI0 A;  1XVY A;  3CR9 A;  5ISU A;  1BKA A;  3R26 A;  1MY0 A;  1SVX B;  5DVF A;  2F97 A;  1RYX A;  3LUY A;  3DRI A;  4BDR A;  3TTN A;  1YTV A;  4FE8 A;  3KGC A;  2XXU A;  3IOT A;  3PUV E;  2XX9 A;  4HCY A;  4NMY A;  4R9G A;  3EF7 A;  3FTO A;  3S9M C;  2VP1 A;  4X9T A;  3RYA A;  2DP8 A;  2D5W A;  5KCJ B;  1JVX A;  1B58 A;  4H5F A;  3UA8 A;  4N07 A;  4QRZ A;  4U2R A;  3DRK A;  1JQF A;  3E9X A;  3DRJ A;  1ZKB A;  4GF8 A;  2DWJ A;  2ZYO A;  1CE2 A;  2YJP A;  3MZB A;  1UTH B;  5H8Q B;  2O1L A;  4QFP A;  4YZZ A;  5EYF A;  1B3H A;  1A54 A;  3O6H A;  1NMU A;  1LAX A;  5CBS A;  5I58 B;  2Z23 A;  1FTJ A;  3SET A;  5I57 A;  1URS A;  4DE8 A;  2OZZ A;  4OEN A;  3PUX E;  1B5J A;  5KZT A;  5TPA B;  3Q29 A;  1USY E;  2OWS A;  3CFZ A;  3ODB A;  1B7H A;  2ALU A;  2YLN A;  2DE4 A;  4GVO A;  4JWX A;  5I58 A;  2O7U A;  4M4G A;  4EXK A;  4HW8 A;  1MXX A;  3FXR A;  1N04 A;  3Q28 A;  4GWO A;  2QPQ A;  3BBR A;  1YCJ A;  1Y20 A;  3C31 A;  1B40 A;  4U1Z A;  3FZV A;  3K6U A;  1R6Z A;  5I56 A;  1OMP A;  3ZKK A;  5CMC A;  1QW0 A;  2AL4 A;  1MY2 A;  4IGR A;  2HZL A;  4JWY A;  5H8N B;  3AXF A;  4OEV A;  1R9L A;  2Z8E A;  2ANJ A;  2P1S A;  4Q8R A;  1I69 A;  4KI0 E;  3IB0 A;  3U94 A;  2F7C A;  3LSL A;  1P1O A;  3RPW A;  1M5D A;  1JVY A;  2HXW A;  3PMV A;  3T22 A;  2O6A A;  2P2A A;  3FAS A;  3UIF A;  3K6V A;  2HQ0 A;  1M5C A;  2RIN A;  3I3V A;  3OMB A;  4ECF A;  1D3K A;  4FOR A;  4E0W A;  4WED A;  3TKD A;  2OJT A;  3ZSF A;  3KBR A;  3PUZ E;  1AIV A;  1MQI A;  4YKP A;  1N3X A;  4F1U A;  4F19 A;  3JZJ A;  3GLB A;  3RGY A;  3QUJ A;  4RY1 A;  1M5B A;  4G68 C;  1AL3 A;  1US4 A;  3GXA A;  3HO7 A;  4IO6 A;  3VLU A;  1FTL A;  3H03 A;  1BIY A;  1MDP 1;  5TP9 A;  5I2K B;  2ABH A;  5H8Q A;  1B6H A;  4EXL A;  3EQ1 A;  2ZXT A;  3RY3 A;  2FYI A;  1EU8 A;  3PMX A;  3PPO A;  3SDF A;  4ELO A;  4IO3 A;  1NFT A;  5I57 B;  4H1X A;  2ONR A;  2Y7K A;  4EF1 A;  4P11 A;  1B9J A;  1I6A A;  2FA7 A;  3T9H B;  4DZ1 A;  1LBC A;  3PD8 A;  3QYT A;  3SEV A;  3VXB A;  3W15 C;  3TAJ A;  1Y1M A;  5BUU A;  1AOV A;  3TUS A;  3D4G A;  4YMB A;  4F3S A;  2A5T B;  1FQA A;  1UIU A;  3OO7 A;  3LSX A;  3TCG A;  2ONS A;  5DEX B;  2Y84 A;  3T66 A;  3PD9 A;  4NF6 B;  4KPT A;  2QMX A;  4LAT A;  1WOD A;  2Q8J A;  4AB6 A;  4F22 A;  2XXY A;  4KQP A;  1LCF A;  1ELJ A;  1B46 A;  3EPE A;  3OSQ A;  3TZA A;  2DXY A;  4LON B;  3MP6 A;  1A55 A;  2E1S A;  1SW5 A;  1B3G A;  2Y7W A;  4PP0 A;  1LFG A;  4ZS9 A;  3W9V A;  1PDA A;  3JV9 A;  1GGG A;  2F34 A;  3MZ9 A;  1B1X A;  1H45 A;  3PUY E;  3T93 B;  1O63 A;  4EUO A;  4P0G A;  2WOL A;  3K00 A;  1WVJ A;  2O51 A;  3K1M A;  1Q1K A;  1B3L A;  3LR1 A;  2UYE A;  3MC2 A;  3Q26 A;  4ZEK A;  3UN6 A;  3DEL B;  4E0X A;  5TU0 A;  5JEI A;  3TTL A;  1KWH A;  3MP1 A;  4O3B A;  2Q2A A;  2VGQ A;  1MXU A;  3CI8 A;  4ZZA A;  4RA1 A;  3IOV A;  1Y3P A;  1DMB A;  4RK2 A;  1MH3 A;  1TFA A;  1QKA A;  4NF8 A;  4NF4 B;  1TFD A;  3GZG A;  2A5S A;  3C33 A;  5M2V A;  2O84 X;  3OSR A;  4H0W A;  4U1O A;  4BDN A;  4I1D A;  1MH4 A;  3CSG A;  4RK9 A;  3MVW A;  5I2K A;  4R73 A;  3IK6 B;  1A8F A;  3RT6 B;  5KDT B;  3GBB A;  3IB2 A;  2F6P A;  3IOR A;  3S4U A;  5K2X A;  3KN7 A;  4GIZ A;  4X1B A;  5ICT A;  5LOM A;  5L9M A;  4OER A;  1J1N A;  3K0V A;  3HST A;  3IAZ A;  3VXC A;  3CFX A;  3FD3 A;  3C36 A;  4MFI A;  2F5X A;  4YKI A;  1L5T A;  3OXN A;  1NH8 A;  1MQJ A;  1MXZ A;  1SYI A;  3O97 A;  1SDX A;  3O9P A;  1B4H A;  1JW4 A;  1B7U A;  1Y9U A;  3B6W A;  4JB7 A;  3G3H A;  3IOU A;  4RXL A;  1I6B A;  1MM7 A;  5DEX A;  4THI A;  5H8H A;  3CRB A;  3KG2 A;  4JBZ A;  3L6H A;  5HM4 B;  2ZYN A;  2R6G E;  1DPP A;  3C4M A;  3KOS A;  4LZ5 A;  3SKP A;  4YMA A;  4QF9 A;  2REJ A;  2XD2 A;  1JEU A;  2I3V A;  3A3C A;  5CBR A;  1H44 A;  1MG1 A;  2RC7 A;  3FGS A;  1N7X A;  2PX1 A;  4F29 A;  3M3K A;  3IR1 A;  1AH5 A;  1SYH A;  4KD5 A;  1POT A;  3C34 A;  4K3F A;  4WEP A;  5DVJ A;  4KFQ A;  3V83 A;  1H3D A;  4NF5 B;  1B0L A;  2R9J A;  2WOK A;  3QAX A;  4TQU Q;  4F3G A;  1NNF A;  1S9T A;  1N0T A;  2UYF A;  4GXA A;  2H25 A;  3PPR A;  4N6P A;  4WXJ A;  4GFR A;  4XKQ A;  3Q27 A;  1MXV A;  4PFY A;  4XIG Q;  5H8H B;  2QS3 A;  4FEB A;  4OFO A;  3O28 A;  4NF4 A;  4NF8 B;  2DVC A;  4I8C A;  1MY3 A;  5CMK A;  3B6Q A;  3Q25 A;  1B0H A;  4UA8 A;  1ZIU A;  1QUJ A;  1XT8 A;  4ISU A;  1IIT A;  1UTB A;  2QL3 A;  1B32 A;  2XXQ A;  5B70 A;  1SBP A;  3N5L A;  4TLM B;  3VV5 A;  3RQT A;  3FVN A;  4KYD A;  1B05 A;  4BDL A;  1FQF A;  3MW0 A;  4U4S A;  4JSD A;  4OZ9 A;  3FJM A;  3DRG A;  1DSN A;  4R6H A;  1D9V A;  3KJT A;  5HBC A;  1SI1 A;  1XC1 A;  1IXH A;  3CG3 A;  3FUZ A;  3KSJ A;  4MH5 A;  3MWB A;  3RYB A;  2BJJ X;  2X7Q A;  1LB9 A;  4PFW A;  2QMW A;  2VHA A;  2RKM A;  3SEW A;  4F2Q A;  3OD7 A;  4MBP A;  4X48 A;  5AA4 A;  2QSX A;  2VOZ A;  1T0K A;  1B7Z A;  4IB2 A;  1OQG A;  2UVJ A;  2H9B A;  4IY5 A;  3HHF A;  3HHG A;  4KR5 A;  1HSJ A;  3SER A;  5I56 B;  5I2N A;  4QFL A;  2WKY A;  1TT1 A;  3T9U A;  3V8X B;  2ZNS A;  1YAE A;  1ZBM A;  2B3B A;  4I62 A;  3EHU A;  1IXC A;  4F3P A;  1ZJL A;  2I3W A;  1MDQ A;  1NL5 A;  3MPK A;  2Q9T A;  3IX1 A;  1FQB A;  3VVF A;  3TPA A;  1MQG A;  4HS7 A;  1POY 1;  4BDQ A;  1B2H A;  4JDF A;  4ESX A;  4O3A A;  4IY6 A;  4DCY A;  5AA2 B;  4F18 A;  1LAF E;  2DWA A;  5AA3 A;  1JEV A;  5IAI A;  3HV1 A;  2XXV A;  1MS7 A;  2F6G A;  2XXI A;  4ELP A;  4IO5 A;  5CMM A;  1MXY A;  3S9L C;  2B65 A;  4GOT A;  4LUB A;  5CI5 A;  4R6Y A;  2XX8 A;  1ZLQ A;  1H76 A;  2PVU A;  1ZTY A;  1LGB C;  1HSE A;  3H6U A;  3OEK A;  1SW4 A;  1II5 A;  1VFE A;  3WAF A;  3R6U A;  3FVO A;  3PU5 A;  4JXI A;  1HSL A;  4WKM A;  5EHM A;  4ZEF A;  4EQB A;  2PMS A;  4KCD A;  4JWO A;  3MVX A;  1N76 A;  1JET A;  1VE4 A;  2CMO A;  3D4C A;  3OO8 A;  4G8H A;  4BDM A;  3WAE A;  5HPQ A;  3SES A;  3UGW A;  3RNN A;  2W7Y A;  1NH7 A;  4XTC Q;  4XKR A;  2FNC A;  2D3I A;  4FEC A;  2B3F A;  3G7W A;  2V25 A;  3HCQ A;  3MBP A;  2PT2 A;  1OQH A;  2QS2 A;  3TMG A;  1MQD A;  1F9B A;  3K4U A;  1A40 A;  1PC3 A;  3VDF A;  1JW5 A;  2OWT A;  3IO4 A;  2DS9 A;  4BLA A;  1Z7M E;  4O3C A;  4F1V A;  3M8U A;  2X7P A;  2DWI A;  4M1V A;  1H43 A;  1TXF A;  4KYE A;  1OLA A;  2G29 A;  3DP6 A;  3O6I A;  1LBB A;  1S50 A;  1VR5 A;  3MP8 A;  4OTE A;  2GHA A;  5DTB A;  1VSO A;  1OIB A;  2D21 A;  2F7A A;  3ECR A;  5DVI A;  5DYH A;  2HCA A;  4GQO A;  1A7L A;  4GRK A;  1NNK A;  4ELQ A;  3HN0 A;  5AA2 A;  1MPB A;  2O69 A;  1EH3 A;  4PFT A;  1Z7N E;  2QS1 A;  1IZ1 A;  4NWC A;  5BWJ A;  3H4Z A;  4YB5 A;  4C1T A;  3H6V A;  1CB6 A;  5I84 A;  1DPE A;  1PB8 A;  1AMF A;  3G3G A;  3ILU B;  1P99 A;  1XS5 A;  4OQO A;  4N13 A;  4GD5 A;  4ND9 A;  3OEN A;  3OOA A;  5FTI A;  4OVJ A;  3EHS A;  3ILT B;  3K1P A;  2ZYK A;  3BFU A;  4R2B A;  3H06 B;  3SEY A;  2V93 A;  3MPL A;  3VVE A;  4DXC A;  4LA9 A;  3G3F A;  3DRH A;  2AYS A;  3RT8 A;  4QFO A;  1SQY A;  3IL1 B;  1US5 A;  2I0B A;  5DT6 A;  3MUQ A;  2Q88 A;  1PB9 A;  4F39 A;  5ICQ A;  2I6E A;  2KLF A;  4QSC A;  5IKB A;  1XHY A;  2UVG A;  3K2D A;  3H6W A;  3TTR A;  3QIM A;  5K2Y A;  3E3K A;  2XXR A;  2RC9 A;  3E4R A;  4ELR A;  1SW1 A;  1IXG A;  4DXB A;  4ZE9 A;  5AE4 A;  4FED A;  3OO9 A;  2R71 A;  3PAM A;  4GL0 A;  3RN8 A;  4F31 B;  4DCX A;  4ZEC A;  1PBP A;  1PEB A;  4G8M A;  4KHZ E;  4Z0I A;  4ZZE A;  4IO4 A;  4ZEI A;  2XXW A;  1JW1 A;  3V89 B;  2DE3 A;  1ZU0 A;  1I6Q A;  1MPD A;  1OVB A;  1B51 A;  2F8D A;  1R9Q A;  3M3F A;  1VFD A;  1UTH A;  2DSF A;  2Z8F A;  3PMW A;  1P1U A;  2PYY A;  4G2Z A;  2B4M A;  3KN8 A;  2PT1 A;  4G68 A;  2O7I A;  4H8I A;  2IA4 A;  4OYV A;  5H8S A;  3SEU A;  5J1D A;  2M8C A;  3SEX A;  3N94 A;  1RYO A;  1B52 A;  2OLB A;  2I4C A;  2ONK E;  2V3U A;  1Q35 A;  3E13 X;  4GLI A;  1FQD A;  4U23 A;  3USD A;  2UVH A;  4LP2 B;  5KDT A;  4FJP A;  4OFL A;  4ONY A;  3ONM A;  3O2A A;  3C35 A;  4TLL B;  4OXV A;  5JK4 A;  3ZKL A;  3VFJ A;  1O64 A;  1SW2 A;  4AB5 A;  4OET A;  1QJM A;  4BDO A;  3BFT A;  2AIX A;  3LVU A;  4RNS A;  2DYX A;  3A09 A;  3CVG A;  3K1N A;  3O66 A;  4DIG A;  5ELV A;  4NF5 A;  4C1U A;  5FHM A;  3U1O A;  1SD3 A;  3QSL A;  2H5Y A;  2I48 A;  1FW0 A;  1QUK A;  2GH9 A;  3B7D A;  2NXO A;  3PGF A;  4XXU A;  5F7V A;  2WOP A;  3TYH A;  4F1Y A;  4NF6 A;  5A5X A;  3O29 A;  1B5I A;  3FAT A;  2HAU A;  3P7I A;  4G8N A;  3N6T A;  4R75 A;  1B4Z A;  3HPI A;  2I49 A;  3LBS A;  3K02 A;  1LLS A;  2Q2C A;  3M3L A;  4POW A;  3UP9 A;  4XKN A;  2NVU B;  4Q30 B;  3U92 A;  5L8D A;  1MY4 A;  3H6T A;  3L6G A;  1D9Y A;  2AL5 A;  1Y4T A;  4EDP A;  3PV0 E;  2Y7R A;  3V5A A;  4OES A;  4PFU A;  4TOZ A;  4XKP A;  4OFJ A;  1BP5 A;  1DTZ A;  2QS4 A;  2YPN A;  1IUD A;  4GXS B;  2RC8 A;  1FQE A;  4IGT A;  5TP9 B;  4OWD A;  2NWJ A;  3VVD A;  5ITO A;  2DE2 A;  1S7Y A;  3TQW A;  2F36 A;  3OEM A;  4KCC A;  3DLN A;  3LSW A;  3TFL A;  1UTB B;  3CG1 A;  2HAV A;  3W9W A;  1FTM A;  3RTW B;  2ZYM A;  3FV1 A;  1FTO A;  3FVG A;  3VLW A;  5AA4 B;  2VD3 A;  3GBA A;  4ESW A;  5I59 A;  1EZ9 A;  3C9H A;  1GV8 A;  2DVZ A;  4MF3 A;  3QK6 A;  3RUM A;  2NOO A;  3BKI B;  3EHT A;  3FIR A;  4RJZ A;  1B3F A;  1Y3Q A;  3IJX B;  2V3Q A;  4QFK A;  5I59 B;  2DOJ A;  4ZDM A;  1FQC A;  3CSB A;  3G3J A;  2OK2 A;  3H3G A;  5H8N A;  2HFB A;  2X26 A;  4HCW A;  3MAM A;  4RPN A;  4YB6 A;  3TTK A;  2Z22 A;  4G4P A;  4POX A;  2F78 A;  2O1M A;  4YB7 A;  3FXQ A;  3S2V A;  4U21 A;  3MQ9 A;  1ZMG A;  2ZNT A;  3LC8 A;  3UOR A;  1IIW A;  1RKM A;  1PB7 A;  2B4L A;  1O7T A;  1Y4C A;  3O6G A;  4NTL A;  4NWD A;  4DDD A;  4DXU A;  4F3B A;  5B7D A;  3N6U A;  4H8J A;  1A8E A;  1NKX A;  4PQJ A;  4H67 A;  3T9X B;  1LST A;  4YIC A;  2DWH A;  1R1N A;  4C0R A;  3CHG A;  4H65 A;  3IJO B;  4U22 A;  3ZS6 A;  3FVK A;  4R74 A;  4IO7 A;  3VLV A;  2E0S A;  4ZEB A;  4KYS A;  1IEJ A;  4MLV A;  5H8F B;  4LQ5 A;  4YKJ A;  5FHO A;  3S9N C;  3MJN A;  2XHD A;  4Q5T A;  2THI A;  4QSD A;  4GL8 A;  2GHB A;  3CIJ A;  3G3K A;  4FAJ A;  4R72 A;  5AA1 A;  1NNP A;  3IO6 A;  3KSX A;  3B6T A;  2P0S A;  4H5G A;  3U72 A;  3U8Q A;  5KCJ A;  2ESN A;  3O6P A;  3IB1 A;  1PBQ A;  4FIM A;  1ANF A;  1Y1Z A;  4NE4 A;  3KEI A;  2O68 A;  1QKB A;  5A5X B;  1LAH E;  3TEP A;  4MLQ A;  1N84 A;  1NNT A;  1OVT A;  5JTY A;  2I0C A;  2HZK A;  4YKK A;  1GVC A;  5CM6 A;  1LFH A;  3KFM A;  3I5O A;  2H99 A;  4PE5 B;  5CMB A;  3PPN A;  4FAT A;  5L9S A;  1FTK A;  3C32 A;  4ZE8 A;  4R9F A;  4U4X A;  3RTF B;  2V3T A;  1BLF A;  2RF1 A;  5JTY B;  3TEL A;  4DLD A;  2Y7P A;  2VD2 A;  1D4N A;  5H8F A;  4G68 B;  4PET A;  1LFI A;  2Z8D A;  3OO6 A;  5AA2 D;  3TCH A;  4ZED A;  2OBG A;  1MY1 A;  4H6D A;  3OEL A;  2RCA A;  3N26 A;  3TDJ A;  4AQ4 A;  3CFL A;  4EQ7 A;  5TPA A;  1MPC A;  4RPO A;  3JYR A;  4IO2 A;  4G77 A;  4EQ9 A;  3LSF B;  3FJ7 A;  1B3E A;  1P1W A;  2CZL A;  2PBW A;  3K6W A;  5F1Q A;  2Q89 A;  3DRF A;  1ATG A;  1M5F A;  1MXW A;  3FV2 A;  3H7M A;  1B5H A;  3K01 A;  3TOD A;  1QVS A;  2DQV A;  1USY H;  4JSO A;  2HEU A;  2I58 A;  3FXU A;  4HTG A;  3KZG A;  2I4B A;  2H98 A;  4NED A;  1OLC A;  3F11 A;  4Q0C A;  1GR2 A;  3PPP A;  4YAH X;  3A3U A;  2XX7 A;  3PUW E;  3QXM A;  4LQ2 A;  2ZNU A;  5FTH A;  3U93 A;  5I2N B;  2NUV A;  1IQ7 A;  2REG A;  4Z7E A;  1BTJ A;  1IXI A;  1GTK A;  3R7X A;  2XD3 A;  2QJE A;  1LAG E;  1XVX A;  3G3I A;  4QHQ A;  1DTG A;  5ITP A;  2XXP A;  3VE1 B;  3MVY A;  4OHN A;  1QUI A;  5L9O A;  1M5E A;  2G93 A;  2XXT A;  3KJ7 A;  1EZO A;  3I6V A;  3DM0 A;  3S9E A;  4LZ8 A;  1MQH A;  3KN3 A;  2XXX A;  3FJG A;  4P0I A;  1EZP A;  1UQW A;  4I9D A;  4R6K A;  1QUL A;  2GRV A;  1TWY A;  4RYA A;  1A99 A;  3THI A;  1UIV A;  2UXA A;  3MZ1 A;  2GFE A;  4R2F A;  1DOT A;  1Y3N A;  4QFN A;  2V84 A;  5CC2 A;  3KOT A;  2XXH A;  1URG A;  2OCU A;  4F2O A;  1MM6 A;  1LCT A;  2DXR A;  4OMB A;  1B1H A;  3MVZ A;  1JNF A;  3DP4 A;  2UVI A;  3IOW A;  2IEE A;  2QRY A;  3PPQ A;  1YPN A;  2F7B A;  3TQL A;  1MRP A;  4LZ7 A;  2Y7I A;  4UAC A;  2LAO A;  4X1D A;  5EHS A;  1XOC A;  1URD A;  5FHN A;  3T96 B;  3TTM A;  3UK4 A;  4LVQ A;  1N3W A;  1P1Q A;  4EF2 A;  1N7W A;  1P1N A;  3RLF E;  3QUF A;  4QSE A;  2H4I A;  4L17 A;  2F35 A;  2A5T A; 
#chains in the Genus database with same CATH topology
 3EN3 A;  4YU0 A;  4OEU A;  1WDN A;  1SI0 A;  1BKA A;  5DVF A;  1NV2 A;  4R9G A;  3FTO A;  3S9M C;  2VP1 A;  1B58 A;  4U2R A;  3DRJ A;  3ISP A;  2YJP A;  1UTH B;  4QFP A;  3O6H A;  1FPK A;  5TPA B;  1USY E;  2OWS A;  3CFZ A;  1B7H A;  5I58 A;  4M4G A;  3FXR A;  4GWO A;  1YCJ A;  1R6Z A;  3RPL B;  1DBZ A;  3ZKK A;  2AL4 A;  2HZL A;  3AXF A;  2Z8E A;  2P1S A;  3U94 A;  3LSL A;  1P1O A;  3RPW A;  2RIN A;  3PUZ E;  1M5B A;  4IO6 A;  3VLU A;  5LTC A;  3H03 A;  1MDP 1;  2FIX A;  5I2K B;  4EXL A;  2ZXT A;  2FYI A;  3PMX A;  4MJO A;  4EF1 A;  4P11 A;  1B9J A;  3W15 C;  1Y1M A;  4NAP A;  3D4G A;  4YMB A;  4NHB A;  1FQA A;  4I3E A;  3TCG A;  1FBC A;  2Y84 A;  1LCF A;  3EPE A;  4LON B;  2E1S A;  1SW5 A;  3W9V A;  1GGG A;  2WOL A;  3K00 A;  3K1M A;  2L5V A;  2UYE A;  4N8G A;  1FPB A;  1KWH A;  3MP1 A;  4O3B A;  2Q2A A;  1Y3P A;  1QKA A;  1TFD A;  4N17 A;  4H0W A;  4U1O A;  4BDN A;  3CSG A;  3IK6 B;  5K2X A;  4GIZ A;  4X1B A;  4OER A;  3HST A;  3FD3 A;  1MXZ A;  1B4H A;  3IOU A;  4I3Y A;  5DEX A;  5IM2 A;  4THI A;  5H8H A;  3CRB A;  4JBZ A;  2F3B A;  4MMP A;  1DPP A;  1FPL A;  4HE0 A;  1Q9D A;  4OVR A;  4QF9 A;  3BIG A;  5CBR A;  1MG1 A;  1N7X A;  2PX1 A;  1SYH A;  1KA1 A;  1EYI A;  1POT A;  4K3F A;  2R9J A;  4TQU Q;  1NNF A;  3PPR A;  3Q27 A;  4XIG Q;  5H8H B;  2QS3 A;  2WYP A;  2DVC A;  3Q25 A;  1ZIU A;  1XT8 A;  1B32 A;  1BK4 A;  1SBP A;  3VV5 A;  2WBB A;  4KYD A;  4JSD A;  3DRG A;  4P1L A;  3CG3 A;  3KSJ A;  2BJJ X;  1LB9 A;  4PFW A;  2QMW A;  5AA4 A;  3OD7 A;  2WYK A;  2QSX A;  2VOZ A;  1T0K A;  1B7Z A;  3IFC A;  4GBW A;  1HSJ A;  5I2N A;  1NV7 A;  1MDQ A;  3TPA A;  4PBQ A;  1POY 1;  4IY6 A;  3EKI A;  1LAF E;  1JEV A;  2XXV A;  1MS7 A;  1LEV A;  5CMM A;  3S9L C;  4GOT A;  5CI5 A;  2XX8 A;  4I40 A;  2R8T A;  1LGB C;  3H6U A;  3OEK A;  4GWS A;  4PFR A;  5EHM A;  2HHM A;  3RNN A;  1QGX A;  4XTC Q;  2B3F A;  3G7W A;  1OQH A;  3TMG A;  4LN5 A;  2ZZX A;  2Q8M A;  3E78 A;  4M1V A;  1H43 A;  4KYE A;  3DP6 A;  5ET5 A;  4ZZA A;  3ECR A;  4GRK A;  3HN0 A;  4N15 A;  1IZ1 A;  3H4Z A;  1IMF A;  3G3G A;  4GD5 A;  4R2B A;  3SEY A;  3MPL A;  4H46 A;  3G3F A;  3IL1 B;  5DT6 A;  2Q88 A;  4F39 A;  5IKB A;  2I6E A;  1XHY A;  2RC9 A;  1FPF A;  1IXG A;  4FED A;  3OO9 A;  2XXW A;  3V89 B;  1I6Q A;  1B51 A;  2DSF A;  2PYY A;  4OYV A;  4H8I A;  2M8C A;  3SEX A;  1RYO A;  2V3U A;  5KDT A;  1Q35 A;  1NUZ A;  4TLL B;  4OXV A;  5JK4 A;  3VFJ A;  1O64 A;  3CVG A;  5ELV A;  2GH9 A;  5A5X A;  2HAU A;  3P7I A;  4R75 A;  4N4U A;  2I49 A;  4POW A;  2CEX A;  4XKN A;  3H6T A;  3V5A A;  4TOZ A;  2YPN A;  3KZG A;  1BP5 A;  4OFJ A;  4F3P A;  2RC8 A;  3PTY A;  3TQW A;  3OEM A;  4KCC A;  3TFL A;  1IMD A;  4PFB A;  5AA4 B;  4ESW A;  5I59 A;  3RUM A;  3BKI B;  1Y3Q A;  1YYZ A;  2V3Q A;  2DOJ A;  3ROJ A;  2OK2 A;  2Z22 A;  2O1M A;  4U21 A;  3MQ9 A;  1IIW A;  1RKM A;  1PB7 A;  4NG7 A;  3N6U A;  1IME A;  4H67 A;  1LST A;  4C0R A;  4GX6 A;  3FVK A;  4PFI A;  4IO7 A;  4QBA A;  5H8F B;  4GL8 A;  3G3K A;  1NNP A;  3U8Q A;  5KCJ A;  2ESN A;  3O6P A;  1LAH E;  4MLQ A;  1NV4 A;  2HZK A;  5IZZ A;  3I5O A;  4H45 A;  3C32 A;  4U4X A;  2RF1 A;  4G68 B;  4PET A;  4NN3 A;  5AA2 D;  3TCH A;  3LUZ A;  5AA2 B;  3N26 A;  5TPA A;  4RPO A;  3JYR A;  4IO2 A;  2FHY A;  3FJ7 A;  4HE2 A;  1FJ6 A;  1P1W A;  3RGY A;  3TOD A;  3K01 A;  2I58 A;  4Q0C A;  1GR2 A;  4O7I A;  3PPP A;  4LQ2 A;  1IQ7 A;  4PDH A;  1BTJ A;  1IXI A;  4IR8 A;  3R7X A;  2QJE A;  5L9O A;  2QVV A;  1FBE A;  1EZO A;  5ET6 A;  4P0I A;  3FJG A;  4I9D A;  1QUL A;  3T1B A;  1A99 A;  1UIV A;  2GFE A;  2OX3 A;  2QVU A;  1LCT A;  1JNF A;  1LBX A;  2OWZ A;  2UVI A;  3IOW A;  1YPN A;  2F7B A;  3UP9 A;  5FHN A;  1N3W A;  2HXR A;  4MNP A;  2F35 A;  1FCK A;  5CRY A;  1LB8 A;  3TCF A;  3R26 A;  1MY0 A;  2F97 A;  1NV0 A;  1RYX A;  4FE8 A;  3EF7 A;  5KCJ B;  1JVX A;  4N07 A;  3DRK A;  5EQ9 A;  4GF8 A;  4FBP A;  3MZB A;  5H8Q B;  4YZZ A;  5EYF A;  1A54 A;  5CBS A;  2PCR A;  5I58 B;  2Z23 A;  5I57 A;  1URS A;  4OEN A;  4GVO A;  2O7U A;  4HW8 A;  5IZ3 B;  3BBR A;  1Y20 A;  1B40 A;  4U1Z A;  3FZV A;  5I56 A;  1OMP A;  1MY2 A;  4JWY A;  4OEV A;  1R9L A;  1NI9 A;  3B50 A;  1LBZ A;  2F7C A;  1M5D A;  4PF8 A;  1KZ8 A;  2O6A A;  3FAS A;  1LBW A;  2OJT A;  1YZ0 A;  3KBR A;  1MQI A;  1N3X A;  4F19 A;  3QUJ A;  4G68 C;  4PBH A;  2V4C A;  1B6H A;  3SDF A;  4IO3 A;  1NFT A;  3SEV A;  2A5T B;  3OO7 A;  2FBP A;  3PD9 A;  4NF6 B;  4F22 A;  2QMX A;  4AB6 A;  2Q8J A;  2XXY A;  3OSQ A;  1B46 A;  1DCU A;  1RDZ A;  2DXY A;  1B3G A;  4ZS9 A;  1LFG A;  1PDA A;  3MZ9 A;  1B1X A;  1H45 A;  1WVJ A;  3MYU A;  2CEY A;  1Q1K A;  4AS4 A;  4ZEK A;  1FJ9 A;  3DEL B;  4E0X A;  2VGQ A;  3IOV A;  1TFA A;  4NF8 A;  4NF4 B;  3C33 A;  1DK4 A;  2O84 X;  3OSR A;  4I1D A;  4RK9 A;  5I2K A;  1A8F A;  3RT6 B;  3GBB A;  5ICT A;  5L9M A;  3VXC A;  2F5X A;  3S9N C;  4JB7 A;  3FXB A;  3G3H A;  4RXL A;  1I6B A;  1MM7 A;  3L6H A;  2XWO A;  5HM4 B;  2KQZ A;  4YMA A;  3A3C A;  2I3V A;  2RC7 A;  4WEP A;  3IR1 A;  1AH5 A;  4X04 A;  3C34 A;  1H3D A;  4F3G A;  4OA4 A;  2H25 A;  4XKQ A;  4PFY A;  4FEB A;  3O28 A;  2ZZW A;  3B6Q A;  4ISU A;  1IIT A;  4TLM B;  3HFU A;  5HBC A;  1SI1 A;  4X8R A;  4HXV A;  1IXH A;  4MH5 A;  3RYB A;  1NUY A;  2VHA A;  4F2Q A;  2RKM A;  4NX1 A;  4IY5 A;  3SER A;  5I56 B;  3T9U A;  1IMC A;  2WKY A;  3V8X B;  2ZNS A;  1ZBM A;  2B3B A;  1IXC A;  1NL5 A;  3MPK A;  4XEQ A;  4HS7 A;  4ESX A;  1INP A;  1B2H A;  4O3A A;  4F18 A;  1MXY A;  2PVU A;  1HSE A;  1SW4 A;  3R6U A;  2PMS A;  3MVX A;  1N76 A;  4G8H A;  3OO8 A;  4BDM A;  4PAF A;  3SES A;  3UGW A;  1NH7 A;  4XKR A;  2D3I A;  4MNC A;  3IO4 A;  1Z7M E;  4O3C A;  3FBP A;  2P3V A;  1TXF A;  1RDX A;  1NUX A;  1VSO A;  5DVI A;  4MIJ A;  4PFT A;  1Z7N E;  4NWC A;  4C1T A;  4OVP A;  1DPE A;  1AMF A;  1P99 A;  1XS5 A;  4OQO A;  4N13 A;  3EHS A;  3ILT B;  3VVE A;  4DXC A;  4EXK A;  4QFO A;  5ICQ A;  4PE3 A;  3E4R A;  4DXB A;  5AE4 A;  5F24 A;  3B8B A;  3RN8 A;  2CZK A;  4ZEI A;  1MPD A;  3TTR A;  1VFD A;  3PMW A;  2Z8F A;  2B4M A;  2O7I A;  3N94 A;  4BDR A;  1B52 A;  2UVH A;  4FJP A;  3O2A A;  1SW2 A;  4OET A;  3BFT A;  2AIX A;  2XA5 A;  4RNS A;  3K1N A;  4DIG A;  1SD3 A;  1QUK A;  4F1Y A;  5F7V A;  1B5I A;  1B4Z A;  3LBS A;  4P56 A;  4GWY A;  3U92 A;  1MY4 A;  3L6G A;  1D9Y A;  2Y7R A;  4YKJ A;  4GXS B;  1FQE A;  5TP9 B;  2NWJ A;  3KBZ A;  2DE2 A;  3DLN A;  3BIH A;  3W9W A;  3RTW B;  3KC1 A;  1EZ9 A;  4NGU A;  4PC9 A;  1B3F A;  3IJX B;  4QFK A;  4ZDM A;  3H3G A;  2HFB A;  4HCW A;  3MAM A;  4YB7 A;  3O6G A;  4DDD A;  2KR0 A;  4NTL A;  4NWD A;  5B7D A;  4H8J A;  1A8E A;  4YIC A;  4H65 A;  5A5L A;  3ZS6 A;  4R74 A;  3VLV A;  4ZEB A;  1IEJ A;  2VPN A;  4MLV A;  1YXI A;  5FHO A;  3MJN A;  2XHD A;  2THI A;  2GHB A;  3CIJ A;  4R72 A;  3B6T A;  3U72 A;  1PBQ A;  1ANF A;  3KEI A;  2O68 A;  3RPL A;  1FPI A;  1N84 A;  1OVT A;  4YKK A;  5IGA A;  5CM6 A;  2MKZ A;  3PPN A;  4FAT A;  1FTK A;  1BLF A;  5JTY B;  4HE1 A;  5ET7 A;  3OO6 A;  4ZED A;  1MY1 A;  1IMB A;  3TDJ A;  4AQ4 A;  3CFL A;  3LSF B;  2PBW A;  5IZ3 A;  5ESY A;  5ET8 A;  1ATG A;  1FTA A;  2CZI A;  1QVS A;  4JSO A;  3FXU A;  4NED A;  3F11 A;  5FTH A;  1GTK A;  2XD3 A;  1XVX A;  3G3I A;  5ITP A;  2XXP A;  3VE1 B;  3MVY A;  2XXT A;  3I6V A;  3MST A;  4LZ8 A;  1EZP A;  4OAN A;  2GRV A;  4RYA A;  4R2F A;  1DOT A;  2V84 A;  4QFN A;  5I5P A;  3KOT A;  2XXH A;  4F2O A;  1LBY A;  4OMB A;  1B1H A;  1SPI A;  3DP4 A;  2IEE A;  2Q74 A;  1IMA A;  1MRP A;  4UAC A;  4X1D A;  5EHS A;  4LVQ A;  1P1Q A;  4EF2 A;  3RLF E;  3QUF A;  3H06 B;  3K6X A;  3T9V A;  4MX6 A;  2RCB A;  3DP8 A;  1XVY A;  3CR9 A;  5ISU A;  1SVX B;  2P3N A;  3LUY A;  3KGC A;  1CNQ A;  3PUV E;  4HCY A;  2XX9 A;  4NMY A;  2DP8 A;  3UA8 A;  2FVZ A;  1JQF A;  5EQ8 A;  2DWJ A;  4DI4 B;  2ZYO A;  2FIE A;  4MHF A;  2O1L A;  1B3H A;  4DE8 A;  2OZZ A;  3PUX E;  1B5J A;  5KZT A;  2ALU A;  2DE4 A;  1MXX A;  3Q28 A;  2QPQ A;  4N8Y A;  5EQA A;  3K6U A;  1FBF A;  4NQ8 A;  3IB0 A;  1JVY A;  2HXW A;  3PMV A;  3T22 A;  2P2A A;  2HQ0 A;  1M5C A;  3I3V A;  1D3K A;  4FOR A;  2XWI A;  3ZSF A;  1NV6 A;  1AIV A;  4YKP A;  4F1U A;  4RY1 A;  1AL3 A;  1US4 A;  3GXA A;  3HO7 A;  4P9K A;  4P8B A;  5TP9 A;  1EYJ A;  1FBP A;  3RY3 A;  1EU8 A;  4ELO A;  2Y7K A;  1I6A A;  2FA7 A;  3T9H B;  4DZ1 A;  1AOV A;  3VXB A;  3TAJ A;  2PFZ A;  4F3S A;  5I7I A;  1UIU A;  2VPO A;  3LSX A;  3T66 A;  4LAT A;  1WOD A;  4DI3 D;  4KQP A;  3MP6 A;  1A55 A;  4PP0 A;  3JV9 A;  2F34 A;  3T93 B;  1O63 A;  4P0G A;  2O51 A;  1B3L A;  3LR1 A;  3MC2 A;  3Q26 A;  3UN6 A;  3CI8 A;  1MXU A;  4RK2 A;  5M2V A;  3MVW A;  4R73 A;  2F6P A;  3IOR A;  3KN7 A;  3K0V A;  3CFX A;  3C36 A;  4YKI A;  1L5T A;  3OXN A;  1MQJ A;  1SYI A;  3O97 A;  1SDX A;  3O9P A;  1JW4 A;  3B6W A;  3KG2 A;  3C4M A;  3KOS A;  4LZ5 A;  3SKP A;  1FPD A;  2REJ A;  2XD2 A;  1JEU A;  4XF5 A;  1H44 A;  3M3K A;  5DVJ A;  4KFQ A;  1B0L A;  2WOK A;  3QAX A;  4UAB A;  1S9T A;  1N0T A;  2UYF A;  4GWU A;  4WXJ A;  1MXV A;  5EYH A;  4OFO A;  4NF4 A;  4NF8 B;  1MY3 A;  1B0H A;  2XXQ A;  5B70 A;  3RQT A;  3FVN A;  1LBV A;  4BDL A;  1FQF A;  4U4S A;  1FPJ A;  3FJM A;  1D9V A;  2Y5K A;  1FPE A;  2X7Q A;  3SEW A;  4MBP A;  4X48 A;  2H9B A;  1YAE A;  3EHU A;  2Q9T A;  1FQB A;  3VVF A;  1MQG A;  4BDQ A;  4DCY A;  5IAI A;  2VT5 A;  4ELP A;  2F6G A;  2B65 A;  4LUB A;  1ZLQ A;  1H76 A;  1ZTY A;  1VFE A;  3PU5 A;  1HSL A;  4KCD A;  2CMO A;  2FNC A;  2QS2 A;  3VDF A;  1JW5 A;  4F1V A;  2DS9 A;  3M8U A;  2DWI A;  2G29 A;  3O6I A;  1LBB A;  5DTB A;  1S50 A;  2QVR A;  4DXU A;  2GHA A;  1OIB A;  4ELQ A;  1A7L A;  5AA2 A;  2O69 A;  5BWJ A;  4YB5 A;  5I84 A;  3ILU B;  4ND9 A;  3OEN A;  5FTI A;  4OVJ A;  1VDW A;  4LA9 A;  3DRH A;  3RT8 A;  1SQY A;  3MUQ A;  1PB9 A;  4QSC A;  2KLF A;  2UVG A;  5K2Y A;  3E3K A;  3A29 A;  4ZE9 A;  2R71 A;  3PAM A;  4GL0 A;  1PBP A;  1PEB A;  4KHZ E;  4O8M A;  4Z0I A;  4IO4 A;  1AWB A;  2DE3 A;  4PDD A;  4PF6 A;  4LZ7 A;  1R9Q A;  1UTH A;  4G2Z A;  3KN8 A;  4G68 A;  2PT1 A;  5H8S A;  2IA4 A;  2ONK E;  4U23 A;  2OLB A;  4GLI A;  3USD A;  3S9E A;  4ONY A;  3ONM A;  3C35 A;  4AB5 A;  4GBV A;  4BDO A;  2DYX A;  3O66 A;  4C1U A;  4NF0 A;  3QSL A;  3QMF A;  3B7D A;  4XXU A;  2WEF A;  2WOP A;  2HPG A;  4NF6 A;  3GYY A;  1FSA A;  2Q2C A;  3M3L A;  4Q30 B;  5L8D A;  1Y4T A;  4PFU A;  4MCO A;  2QS4 A;  1S7Y A;  2F36 A;  3LSW A;  5T3J A;  3FV1 A;  1FTO A;  3FVG A;  3VLW A;  4PAK A;  2VD3 A;  1GV8 A;  4O94 A;  2DVZ A;  3QK6 A;  2NOO A;  2F3D A;  3EHT A;  3FIR A;  4RJZ A;  2XXK A;  1FQC A;  3CSB A;  3G3J A;  5H8N A;  2X26 A;  4YB6 A;  4G4P A;  2F78 A;  3FXQ A;  2ZNT A;  3UOR A;  1Y4C A;  1O7T A;  1NKX A;  4PQJ A;  2DWH A;  1G0H A;  4N6K A;  3CHG A;  1K9Y A;  4U22 A;  4JVD A;  2E0S A;  2GQ1 A;  4LQ5 A;  3KSX A;  3IO6 A;  2P0S A;  4PCD A;  3TEP A;  5JTY A;  1GVC A;  1LFH A;  3KFM A;  2H99 A;  5CMB A;  4ZE8 A;  3U65 A;  3TEL A;  2Y7P A;  5J16 A;  2Z8D A;  4PTK A;  1FBD A;  4H6D A;  3OEL A;  4EQ7 A;  4G77 A;  1B3E A;  2CZL A;  3K6W A;  4ELR A;  2Q89 A;  3H7M A;  1M5F A;  2ZZV A;  3FV2 A;  1USY H;  2HEU A;  2I4B A;  2H98 A;  4MAG A;  2XX7 A;  3PUW E;  3QXM A;  3U93 A;  1FBH A;  4Z7E A;  4OVS A;  1LAG E;  4OHN A;  1QUI A;  2G93 A;  1FRP A;  3KN3 A;  2XXX A;  4R6K A;  1TWY A;  2UXA A;  3MZ1 A;  2OCU A;  4OVQ A;  3MVZ A;  3PPQ A;  3TQL A;  3RYD A;  2Y7I A;  3IFA A;  2LAO A;  3TTM A;  1URD A;  1N7W A;  4QSE A;  2A5T A;  4EUO A;  2ZMB A;  4QXD A;  4PGP A;  3DRI A;  4JVC A;  1YTV A;  3TTN A;  2XXU A;  3IOT A;  3RYA A;  2D5W A;  4H5F A;  4QRZ A;  3E9X A;  1ZKB A;  1CE2 A;  1NMU A;  1LAX A;  1FTJ A;  3SET A;  3Q29 A;  3ODB A;  2YLN A;  4JWX A;  4N6D A;  3SZP A;  1N04 A;  2PFY A;  3C31 A;  5CMC A;  1QW0 A;  4IGR A;  5H8N B;  2ANJ A;  4Q8R A;  1I69 A;  4KI0 E;  4P3L A;  5I3S A;  2CZH A;  3LV0 A;  3UIF A;  3K6V A;  3OMB A;  4ECF A;  4E0W A;  4WED A;  4GWX A;  3TKD A;  3JZJ A;  3GLB A;  4GWZ A;  1FTL A;  1BIY A;  2ABH A;  5H8Q A;  3EQ1 A;  3PPO A;  5I57 B;  4H1X A;  2ONR A;  5FBP A;  1LBC A;  3PD8 A;  3QYT A;  5BUU A;  3TUS A;  3E79 A;  2ONS A;  5DEX B;  4KPT A;  3TZA A;  1ELJ A;  2DDK A;  2Y5L A;  2Y7W A;  1FBG A;  3PUY E;  5TU0 A;  5JEI A;  3TTL A;  4RA1 A;  1DMB A;  1MH3 A;  3GZG A;  2A5S A;  1MH4 A;  5KDT B;  3IB2 A;  3S4U A;  5LOM A;  1J1N A;  3IAZ A;  4MFI A;  3UK4 A;  1NH8 A;  1K9Z A;  1B7U A;  1Y9U A;  2ZYN A;  2R6G E;  3FGS A;  2BJI A;  4F29 A;  4KD5 A;  3V83 A;  3D1R A;  4NF5 B;  4OVT A;  4AS5 A;  4GXA A;  4N6P A;  4GFR A;  1NV3 A;  4I8C A;  5CMK A;  4PGN A;  4UA8 A;  1QUJ A;  1UTB A;  2QL3 A;  3N5L A;  2QFL A;  1B05 A;  3MW0 A;  4OZ9 A;  2WBD A;  1DSN A;  4R6H A;  3KJT A;  1XC1 A;  3FUZ A;  3MWB A;  4JVI A;  1RDY A;  5EYG A;  4IB2 A;  1OQG A;  2UVJ A;  3HHF A;  3HHG A;  4KR5 A;  4QFL A;  1TT1 A;  4I62 A;  5DW8 A;  1ZJL A;  2I3W A;  2WX9 A;  3IX1 A;  4JDF A;  5AA3 A;  2DWA A;  3HV1 A;  2XXI A;  4IO5 A;  4R6Y A;  3NOH A;  1JP4 A;  1II5 A;  3WAF A;  4O7M A;  3FVO A;  4JXI A;  4EQB A;  4WKM A;  4ZEF A;  4JWO A;  1VE4 A;  1JET A;  3D4C A;  5HPQ A;  3WAE A;  2XWK A;  2W7Y A;  4FEC A;  3HCQ A;  3MBP A;  2PT2 A;  1MQD A;  1F9B A;  3K4U A;  1A40 A;  1PC3 A;  2OWT A;  4BLA A;  2X7P A;  4GWW A;  1OLA A;  4OTE A;  1VR5 A;  3MP8 A;  5DYH A;  2F7A A;  2D21 A;  2HCA A;  4GQO A;  1NNK A;  1MPB A;  1EH3 A;  2QS1 A;  3H6V A;  1CB6 A;  1PB8 A;  1FPG A;  4MEV A;  1G0I A;  3OOA A;  5LDZ A;  3K1P A;  2ZYK A;  3BFU A;  4MNI A;  2V93 A;  2AYS A;  1US5 A;  2I0B A;  3K2D A;  3H6W A;  3QIM A;  2XXR A;  1SW1 A;  4F31 B;  4DCX A;  4ZEC A;  4G8M A;  4KXP A;  4ZZE A;  1JW1 A;  1ZU0 A;  1OVB A;  3M3F A;  2F8D A;  4X9T A;  1P1U A;  3SEU A;  5J1D A;  2I4C A;  1XI6 A;  3E13 X;  4P47 A;  1FQD A;  3KC0 A;  4LP2 B;  4OFL A;  3ZKL A;  4PAI A;  1QJM A;  3LVU A;  2XWV A;  3A09 A;  4NF5 A;  5FHM A;  3U1O A;  2H5Y A;  2I48 A;  1FW0 A;  3PGF A;  3TYH A;  2NXO A;  3O29 A;  3FAT A;  4G8N A;  3N6T A;  3HPI A;  3K02 A;  1LLS A;  4P1E A;  2NVU B;  1D9Q A;  2AL5 A;  4EDP A;  3PV0 E;  4G61 A;  4OES A;  4XKP A;  4GX4 A;  1DTZ A;  1IUD A;  4IGT A;  4OWD A;  3VVD A;  5ITO A;  1KA0 A;  1UTB B;  3CG1 A;  2HAV A;  1FTM A;  2ZYM A;  4N81 A;  3GBA A;  4XFE A;  3C9H A;  4MF3 A;  5I59 B;  4RPN A;  3TTK A;  4POX A;  1EYK A;  3S2V A;  1ZMG A;  3LC8 A;  2B4L A;  4F3B A;  1NV5 A;  3T9X B;  1R1N A;  5IZ1 A;  3IJO B;  4KYS A;  1NV1 A;  4Q5T A;  4QSD A;  5AA1 A;  4FAJ A;  4H5G A;  3IB1 A;  4FIM A;  4NE4 A;  1Y1Z A;  5A5X B;  1QKB A;  3T0J A;  1NNT A;  2I0C A;  4PE5 B;  5L9S A;  4R9F A;  3RTF B;  2V3T A;  4DLD A;  2VD2 A;  1D4N A;  5H8F A;  1LFI A;  2OBG A;  2RCA A;  1MPC A;  4EQ9 A;  1NUW A;  5F1Q A;  3DRF A;  1MXW A;  1B5H A;  2DQV A;  4HTG A;  1OLC A;  4GX3 A;  5EQ7 A;  4YAH X;  3A3U A;  2ZNU A;  5I2N B;  2NUV A;  2REG A;  4QHQ A;  1DTG A;  1M5E A;  3KJ7 A;  3DM0 A;  1MQH A;  1UQW A;  3THI A;  1Y3N A;  5CC2 A;  1URG A;  1MM6 A;  2DXR A;  2JJK A;  2QRY A;  3T96 B;  1XOC A;  4N91 A;  1P1N A;  2H4I A;  4L17 A;  2V25 A; 
#chains in the Genus database with same CATH homology
 3EN3 A;  3K6X A;  1FCK A;  3T9V A;  5CRY A;  1LB8 A;  4YU0 A;  3TCF A;  4OEU A;  2RCB A;  2ZMB A;  3DP8 A;  1WDN A;  1SI0 A;  1XVY A;  3CR9 A;  5ISU A;  1BKA A;  3R26 A;  1MY0 A;  1SVX B;  5DVF A;  2F97 A;  1RYX A;  3LUY A;  3DRI A;  4BDR A;  3TTN A;  1YTV A;  4FE8 A;  3KGC A;  2XXU A;  3IOT A;  3PUV E;  2XX9 A;  4HCY A;  4NMY A;  4R9G A;  3EF7 A;  3FTO A;  3S9M C;  2VP1 A;  4X9T A;  3RYA A;  2DP8 A;  2D5W A;  5KCJ B;  1JVX A;  1B58 A;  4H5F A;  3UA8 A;  4N07 A;  4QRZ A;  4U2R A;  3DRK A;  1JQF A;  3E9X A;  3DRJ A;  1ZKB A;  4GF8 A;  2DWJ A;  2ZYO A;  1CE2 A;  2YJP A;  3MZB A;  1UTH B;  5H8Q B;  2O1L A;  4QFP A;  4YZZ A;  5EYF A;  1B3H A;  1A54 A;  3O6H A;  1NMU A;  1LAX A;  5CBS A;  5I58 B;  2Z23 A;  1FTJ A;  3SET A;  5I57 A;  1URS A;  4DE8 A;  2OZZ A;  4OEN A;  3PUX E;  1B5J A;  5KZT A;  5TPA B;  3Q29 A;  1USY E;  2OWS A;  3CFZ A;  3ODB A;  1B7H A;  2ALU A;  2YLN A;  2DE4 A;  4GVO A;  4JWX A;  5I58 A;  2O7U A;  4M4G A;  4EXK A;  4HW8 A;  1MXX A;  3FXR A;  1N04 A;  3Q28 A;  4GWO A;  2QPQ A;  3BBR A;  1YCJ A;  1Y20 A;  3C31 A;  1B40 A;  4U1Z A;  3FZV A;  3K6U A;  1R6Z A;  5I56 A;  1OMP A;  3ZKK A;  5CMC A;  1QW0 A;  2AL4 A;  1MY2 A;  4IGR A;  2HZL A;  4JWY A;  5H8N B;  3AXF A;  4OEV A;  1R9L A;  2Z8E A;  2ANJ A;  2P1S A;  4Q8R A;  1I69 A;  4KI0 E;  3IB0 A;  3U94 A;  2F7C A;  3LSL A;  1P1O A;  3RPW A;  1M5D A;  1JVY A;  2HXW A;  3PMV A;  3T22 A;  2O6A A;  2P2A A;  3FAS A;  3UIF A;  3K6V A;  2HQ0 A;  1M5C A;  2RIN A;  3I3V A;  3OMB A;  4ECF A;  1D3K A;  4FOR A;  4E0W A;  4WED A;  3TKD A;  2OJT A;  3ZSF A;  3KBR A;  3PUZ E;  1AIV A;  1MQI A;  4YKP A;  1N3X A;  4F1U A;  4F19 A;  3JZJ A;  3GLB A;  3RGY A;  3QUJ A;  4RY1 A;  1M5B A;  4G68 C;  1AL3 A;  1US4 A;  3GXA A;  3HO7 A;  4IO6 A;  3VLU A;  1FTL A;  3H03 A;  1BIY A;  1MDP 1;  5TP9 A;  5I2K B;  2ABH A;  5H8Q A;  1B6H A;  4EXL A;  3EQ1 A;  2ZXT A;  3RY3 A;  2FYI A;  1EU8 A;  3PMX A;  3PPO A;  3SDF A;  4ELO A;  4IO3 A;  1NFT A;  5I57 B;  4H1X A;  2ONR A;  2Y7K A;  4EF1 A;  4P11 A;  1B9J A;  1I6A A;  2FA7 A;  3T9H B;  4DZ1 A;  1LBC A;  3PD8 A;  3QYT A;  3SEV A;  3VXB A;  3W15 C;  3TAJ A;  1Y1M A;  5BUU A;  1AOV A;  3TUS A;  3D4G A;  4YMB A;  4F3S A;  2A5T B;  1FQA A;  1UIU A;  3OO7 A;  3LSX A;  3TCG A;  2ONS A;  5DEX B;  2Y84 A;  3T66 A;  3PD9 A;  4NF6 B;  4KPT A;  2QMX A;  4LAT A;  1WOD A;  2Q8J A;  4AB6 A;  4F22 A;  2XXY A;  4KQP A;  1LCF A;  1ELJ A;  1B46 A;  3EPE A;  3OSQ A;  3TZA A;  2DXY A;  4LON B;  3MP6 A;  1A55 A;  2E1S A;  1SW5 A;  1B3G A;  2Y7W A;  4PP0 A;  1LFG A;  4ZS9 A;  3W9V A;  1PDA A;  3JV9 A;  1GGG A;  2F34 A;  3MZ9 A;  1B1X A;  1H45 A;  3PUY E;  3T93 B;  1O63 A;  4EUO A;  4P0G A;  2WOL A;  3K00 A;  1WVJ A;  2O51 A;  3K1M A;  1Q1K A;  1B3L A;  3LR1 A;  2UYE A;  3MC2 A;  3Q26 A;  4ZEK A;  3UN6 A;  3DEL B;  4E0X A;  5TU0 A;  5JEI A;  3TTL A;  1KWH A;  3MP1 A;  4O3B A;  2Q2A A;  2VGQ A;  1MXU A;  3CI8 A;  4ZZA A;  4RA1 A;  3IOV A;  1Y3P A;  1DMB A;  4RK2 A;  1MH3 A;  1TFA A;  1QKA A;  4NF8 A;  4NF4 B;  1TFD A;  3GZG A;  2A5S A;  3C33 A;  5M2V A;  2O84 X;  3OSR A;  4H0W A;  4U1O A;  4BDN A;  4I1D A;  1MH4 A;  3CSG A;  4RK9 A;  3MVW A;  5I2K A;  4R73 A;  3IK6 B;  1A8F A;  3RT6 B;  5KDT B;  3GBB A;  3IB2 A;  2F6P A;  3IOR A;  3S4U A;  5K2X A;  3KN7 A;  4GIZ A;  4X1B A;  5ICT A;  5LOM A;  5L9M A;  4OER A;  1J1N A;  3K0V A;  3HST A;  3IAZ A;  3VXC A;  3CFX A;  3FD3 A;  3C36 A;  4MFI A;  2F5X A;  4YKI A;  1L5T A;  3OXN A;  1NH8 A;  1MQJ A;  1MXZ A;  1SYI A;  3O97 A;  1SDX A;  3O9P A;  1B4H A;  1JW4 A;  1B7U A;  1Y9U A;  3B6W A;  4JB7 A;  3G3H A;  3IOU A;  4RXL A;  1I6B A;  1MM7 A;  5DEX A;  4THI A;  5H8H A;  3CRB A;  3KG2 A;  4JBZ A;  3L6H A;  5HM4 B;  2ZYN A;  2R6G E;  1DPP A;  3C4M A;  3KOS A;  4LZ5 A;  3SKP A;  4YMA A;  4QF9 A;  2REJ A;  2XD2 A;  1JEU A;  2I3V A;  3A3C A;  5CBR A;  1H44 A;  1MG1 A;  2RC7 A;  3FGS A;  1N7X A;  2PX1 A;  4F29 A;  3M3K A;  3IR1 A;  1AH5 A;  1SYH A;  4KD5 A;  1POT A;  3C34 A;  4K3F A;  4WEP A;  5DVJ A;  4KFQ A;  3V83 A;  1H3D A;  4NF5 B;  1B0L A;  2R9J A;  2WOK A;  3QAX A;  4TQU Q;  4F3G A;  1NNF A;  1S9T A;  1N0T A;  2UYF A;  4GXA A;  2H25 A;  3PPR A;  4N6P A;  4WXJ A;  4GFR A;  4XKQ A;  3Q27 A;  1MXV A;  4PFY A;  4XIG Q;  5H8H B;  2QS3 A;  4FEB A;  4OFO A;  3O28 A;  4NF4 A;  4NF8 B;  2DVC A;  4I8C A;  1MY3 A;  5CMK A;  3B6Q A;  3Q25 A;  1B0H A;  4UA8 A;  1ZIU A;  1QUJ A;  1XT8 A;  4ISU A;  1IIT A;  1UTB A;  2QL3 A;  1B32 A;  2XXQ A;  5B70 A;  1SBP A;  3N5L A;  4TLM B;  3VV5 A;  3RQT A;  3FVN A;  4KYD A;  1B05 A;  4BDL A;  1FQF A;  3MW0 A;  4U4S A;  4JSD A;  4OZ9 A;  3FJM A;  3DRG A;  1DSN A;  4R6H A;  1D9V A;  3KJT A;  5HBC A;  1SI1 A;  1XC1 A;  1IXH A;  3CG3 A;  3FUZ A;  3KSJ A;  4MH5 A;  3MWB A;  3RYB A;  2BJJ X;  2X7Q A;  1LB9 A;  4PFW A;  2QMW A;  2VHA A;  2RKM A;  3SEW A;  4F2Q A;  3OD7 A;  4MBP A;  4X48 A;  5AA4 A;  2QSX A;  2VOZ A;  1T0K A;  1B7Z A;  4IB2 A;  1OQG A;  2UVJ A;  2H9B A;  4IY5 A;  3HHF A;  3HHG A;  4KR5 A;  1HSJ A;  3SER A;  5I56 B;  5I2N A;  4QFL A;  2WKY A;  1TT1 A;  3T9U A;  3V8X B;  2ZNS A;  1YAE A;  1ZBM A;  2B3B A;  4I62 A;  3EHU A;  1IXC A;  4F3P A;  1ZJL A;  2I3W A;  1MDQ A;  1NL5 A;  3MPK A;  2Q9T A;  3IX1 A;  1FQB A;  3VVF A;  3TPA A;  1MQG A;  4HS7 A;  1POY 1;  4BDQ A;  1B2H A;  4JDF A;  4ESX A;  4O3A A;  4IY6 A;  4DCY A;  5AA2 B;  4F18 A;  1LAF E;  2DWA A;  5AA3 A;  1JEV A;  5IAI A;  3HV1 A;  2XXV A;  1MS7 A;  2F6G A;  2XXI A;  4ELP A;  4IO5 A;  5CMM A;  1MXY A;  3S9L C;  2B65 A;  4GOT A;  4LUB A;  5CI5 A;  4R6Y A;  2XX8 A;  1ZLQ A;  1H76 A;  2PVU A;  1ZTY A;  1LGB C;  1HSE A;  3H6U A;  3OEK A;  1SW4 A;  1II5 A;  1VFE A;  3WAF A;  3R6U A;  3FVO A;  3PU5 A;  4JXI A;  1HSL A;  4WKM A;  5EHM A;  4ZEF A;  4EQB A;  2PMS A;  4KCD A;  4JWO A;  3MVX A;  1N76 A;  1JET A;  1VE4 A;  2CMO A;  3D4C A;  3OO8 A;  4G8H A;  4BDM A;  3WAE A;  5HPQ A;  3SES A;  3UGW A;  3RNN A;  2W7Y A;  1NH7 A;  4XTC Q;  4XKR A;  2FNC A;  2D3I A;  4FEC A;  2B3F A;  3G7W A;  2V25 A;  3HCQ A;  3MBP A;  2PT2 A;  1OQH A;  2QS2 A;  3TMG A;  1MQD A;  1F9B A;  3K4U A;  1A40 A;  1PC3 A;  3VDF A;  1JW5 A;  2OWT A;  3IO4 A;  2DS9 A;  4BLA A;  1Z7M E;  4O3C A;  4F1V A;  3M8U A;  2X7P A;  2DWI A;  4M1V A;  1H43 A;  1TXF A;  4KYE A;  1OLA A;  2G29 A;  3DP6 A;  3O6I A;  1LBB A;  1S50 A;  1VR5 A;  3MP8 A;  4OTE A;  2GHA A;  5DTB A;  1VSO A;  1OIB A;  2D21 A;  2F7A A;  3ECR A;  5DVI A;  5DYH A;  2HCA A;  4GQO A;  1A7L A;  4GRK A;  1NNK A;  4ELQ A;  3HN0 A;  5AA2 A;  1MPB A;  2O69 A;  1EH3 A;  4PFT A;  1Z7N E;  2QS1 A;  1IZ1 A;  4NWC A;  5BWJ A;  3H4Z A;  4YB5 A;  4C1T A;  3H6V A;  1CB6 A;  5I84 A;  1DPE A;  1PB8 A;  1AMF A;  3G3G A;  3ILU B;  1P99 A;  1XS5 A;  4OQO A;  4N13 A;  4GD5 A;  4ND9 A;  3OEN A;  3OOA A;  5FTI A;  4OVJ A;  3EHS A;  3ILT B;  3K1P A;  2ZYK A;  3BFU A;  4R2B A;  3H06 B;  3SEY A;  2V93 A;  3MPL A;  3VVE A;  4DXC A;  4LA9 A;  3G3F A;  3DRH A;  2AYS A;  3RT8 A;  4QFO A;  1SQY A;  3IL1 B;  1US5 A;  2I0B A;  5DT6 A;  3MUQ A;  2Q88 A;  1PB9 A;  4F39 A;  5ICQ A;  2I6E A;  2KLF A;  4QSC A;  5IKB A;  1XHY A;  2UVG A;  3K2D A;  3H6W A;  3TTR A;  3QIM A;  5K2Y A;  3E3K A;  2XXR A;  2RC9 A;  3E4R A;  4ELR A;  1SW1 A;  1IXG A;  4DXB A;  4ZE9 A;  5AE4 A;  4FED A;  3OO9 A;  2R71 A;  3PAM A;  4GL0 A;  3RN8 A;  4F31 B;  4DCX A;  4ZEC A;  1PBP A;  1PEB A;  4G8M A;  4KHZ E;  4Z0I A;  4ZZE A;  4IO4 A;  4ZEI A;  2XXW A;  1JW1 A;  3V89 B;  2DE3 A;  1ZU0 A;  1I6Q A;  1MPD A;  1OVB A;  1B51 A;  2F8D A;  1R9Q A;  3M3F A;  1VFD A;  1UTH A;  2DSF A;  2Z8F A;  3PMW A;  1P1U A;  2PYY A;  4G2Z A;  2B4M A;  3KN8 A;  2PT1 A;  4G68 A;  2O7I A;  4H8I A;  2IA4 A;  4OYV A;  5H8S A;  3SEU A;  5J1D A;  2M8C A;  3SEX A;  3N94 A;  1RYO A;  1B52 A;  2OLB A;  2I4C A;  2ONK E;  2V3U A;  1Q35 A;  3E13 X;  4GLI A;  1FQD A;  4U23 A;  3USD A;  2UVH A;  4LP2 B;  5KDT A;  4FJP A;  4OFL A;  4ONY A;  3ONM A;  3O2A A;  3C35 A;  4TLL B;  4OXV A;  5JK4 A;  3ZKL A;  3VFJ A;  1O64 A;  1SW2 A;  4AB5 A;  4OET A;  1QJM A;  4BDO A;  3BFT A;  2AIX A;  3LVU A;  4RNS A;  2DYX A;  3A09 A;  3CVG A;  3K1N A;  3O66 A;  4DIG A;  5ELV A;  4NF5 A;  4C1U A;  5FHM A;  3U1O A;  1SD3 A;  3QSL A;  2H5Y A;  2I48 A;  1FW0 A;  1QUK A;  2GH9 A;  3B7D A;  2NXO A;  3PGF A;  4XXU A;  5F7V A;  2WOP A;  3TYH A;  4F1Y A;  4NF6 A;  5A5X A;  3O29 A;  1B5I A;  3FAT A;  2HAU A;  3P7I A;  4G8N A;  3N6T A;  4R75 A;  1B4Z A;  3HPI A;  2I49 A;  3LBS A;  3K02 A;  1LLS A;  2Q2C A;  3M3L A;  4POW A;  3UP9 A;  4XKN A;  2NVU B;  4Q30 B;  3U92 A;  5L8D A;  1MY4 A;  3H6T A;  3L6G A;  1D9Y A;  2AL5 A;  1Y4T A;  4EDP A;  3PV0 E;  2Y7R A;  3V5A A;  4OES A;  4PFU A;  4TOZ A;  4XKP A;  4OFJ A;  1BP5 A;  1DTZ A;  2QS4 A;  2YPN A;  1IUD A;  4GXS B;  2RC8 A;  1FQE A;  4IGT A;  5TP9 B;  4OWD A;  2NWJ A;  3VVD A;  5ITO A;  2DE2 A;  1S7Y A;  3TQW A;  2F36 A;  3OEM A;  4KCC A;  3DLN A;  3LSW A;  3TFL A;  1UTB B;  3CG1 A;  2HAV A;  3W9W A;  1FTM A;  3RTW B;  2ZYM A;  3FV1 A;  1FTO A;  3FVG A;  3VLW A;  5AA4 B;  2VD3 A;  3GBA A;  4ESW A;  5I59 A;  1EZ9 A;  3C9H A;  1GV8 A;  2DVZ A;  4MF3 A;  3QK6 A;  3RUM A;  2NOO A;  3BKI B;  3EHT A;  3FIR A;  4RJZ A;  1B3F A;  1Y3Q A;  3IJX B;  2V3Q A;  4QFK A;  5I59 B;  2DOJ A;  4ZDM A;  1FQC A;  3CSB A;  3G3J A;  2OK2 A;  3H3G A;  5H8N A;  2HFB A;  2X26 A;  4HCW A;  3MAM A;  4RPN A;  4YB6 A;  3TTK A;  2Z22 A;  4G4P A;  4POX A;  2F78 A;  2O1M A;  4YB7 A;  3FXQ A;  3S2V A;  4U21 A;  3MQ9 A;  1ZMG A;  2ZNT A;  3LC8 A;  3UOR A;  1IIW A;  1RKM A;  1PB7 A;  2B4L A;  1O7T A;  1Y4C A;  3O6G A;  4NTL A;  4NWD A;  4DDD A;  4DXU A;  4F3B A;  5B7D A;  3N6U A;  4H8J A;  1A8E A;  1NKX A;  4PQJ A;  4H67 A;  3T9X B;  1LST A;  4YIC A;  2DWH A;  1R1N A;  4C0R A;  3CHG A;  4H65 A;  3IJO B;  4U22 A;  3ZS6 A;  3FVK A;  4R74 A;  4IO7 A;  3VLV A;  2E0S A;  4ZEB A;  4KYS A;  1IEJ A;  4MLV A;  5H8F B;  4LQ5 A;  4YKJ A;  5FHO A;  3S9N C;  3MJN A;  2XHD A;  4Q5T A;  2THI A;  4QSD A;  4GL8 A;  2GHB A;  3CIJ A;  3G3K A;  4FAJ A;  4R72 A;  5AA1 A;  1NNP A;  3IO6 A;  3KSX A;  3B6T A;  2P0S A;  4H5G A;  3U72 A;  3U8Q A;  5KCJ A;  2ESN A;  3O6P A;  3IB1 A;  1PBQ A;  4FIM A;  1ANF A;  1Y1Z A;  4NE4 A;  3KEI A;  2O68 A;  1QKB A;  5A5X B;  1LAH E;  3TEP A;  4MLQ A;  1N84 A;  1NNT A;  1OVT A;  5JTY A;  2I0C A;  2HZK A;  4YKK A;  1GVC A;  5CM6 A;  1LFH A;  3KFM A;  3I5O A;  2H99 A;  4PE5 B;  5CMB A;  3PPN A;  4FAT A;  5L9S A;  1FTK A;  3C32 A;  4ZE8 A;  4R9F A;  4U4X A;  3RTF B;  2V3T A;  1BLF A;  2RF1 A;  5JTY B;  3TEL A;  4DLD A;  2Y7P A;  2VD2 A;  1D4N A;  5H8F A;  4G68 B;  4PET A;  1LFI A;  2Z8D A;  3OO6 A;  5AA2 D;  3TCH A;  4ZED A;  2OBG A;  1MY1 A;  4H6D A;  3OEL A;  2RCA A;  3N26 A;  3TDJ A;  4AQ4 A;  3CFL A;  4EQ7 A;  5TPA A;  1MPC A;  4RPO A;  3JYR A;  4IO2 A;  4G77 A;  4EQ9 A;  3LSF B;  3FJ7 A;  1B3E A;  1P1W A;  2CZL A;  2PBW A;  3K6W A;  5F1Q A;  2Q89 A;  3DRF A;  1ATG A;  1M5F A;  1MXW A;  3FV2 A;  3H7M A;  1B5H A;  3K01 A;  3TOD A;  1QVS A;  2DQV A;  1USY H;  4JSO A;  2HEU A;  2I58 A;  3FXU A;  4HTG A;  3KZG A;  2I4B A;  2H98 A;  4NED A;  1OLC A;  3F11 A;  4Q0C A;  1GR2 A;  3PPP A;  4YAH X;  3A3U A;  2XX7 A;  3PUW E;  3QXM A;  4LQ2 A;  2ZNU A;  5FTH A;  3U93 A;  5I2N B;  2NUV A;  1IQ7 A;  2REG A;  4Z7E A;  1BTJ A;  1IXI A;  1GTK A;  3R7X A;  2XD3 A;  2QJE A;  1LAG E;  1XVX A;  3G3I A;  4QHQ A;  1DTG A;  5ITP A;  2XXP A;  3VE1 B;  3MVY A;  4OHN A;  1QUI A;  5L9O A;  1M5E A;  2G93 A;  2XXT A;  3KJ7 A;  1EZO A;  3I6V A;  3DM0 A;  3S9E A;  4LZ8 A;  1MQH A;  3KN3 A;  2XXX A;  3FJG A;  4P0I A;  1EZP A;  1UQW A;  4I9D A;  4R6K A;  1QUL A;  2GRV A;  1TWY A;  4RYA A;  1A99 A;  3THI A;  1UIV A;  2UXA A;  3MZ1 A;  2GFE A;  4R2F A;  1DOT A;  1Y3N A;  4QFN A;  2V84 A;  5CC2 A;  3KOT A;  2XXH A;  1URG A;  2OCU A;  4F2O A;  1MM6 A;  1LCT A;  2DXR A;  4OMB A;  1B1H A;  3MVZ A;  1JNF A;  3DP4 A;  2UVI A;  3IOW A;  2IEE A;  2QRY A;  3PPQ A;  1YPN A;  2F7B A;  3TQL A;  1MRP A;  4LZ7 A;  2Y7I A;  4UAC A;  2LAO A;  4X1D A;  5EHS A;  1XOC A;  1URD A;  5FHN A;  3T96 B;  3TTM A;  3UK4 A;  4LVQ A;  1N3W A;  1P1Q A;  4EF2 A;  1N7W A;  1P1N A;  3RLF E;  3QUF A;  4QSE A;  2H4I A;  4L17 A;  2F35 A;  2A5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...