4OF0A

Crystal structure of syg-1 d1-d2, refolded
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
246
structure length
230
Chain Sequence
QRIVEAPKDTLAAVGETAILTCRVEHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVKSHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGESRSKFEISQETVIAHVNETTQVESSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPNKIEVDSVKLSLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SYG-1, isoform b
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
total genus 44
structure length 230
sequence length 246
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A02
3L3IB 3I3BA 4IHOB 4OSUH 3ULVH 5E7BA 4D8PA 4JFXB 4NJAH 1AO7E 3L7FB 4QXTB 1X4XA 3DVGA 4UNVA 4JN1L 3O2DL 1YDPA 5CSGA 5E99H 4U1MB 5J6HA 3PG2A 2ESVA 5LGHH 3P0YL 1L6ZA 1XF3A 4CL7A 1QO3B 1EEYB 4O2CB 2A83B 2VDPH 2Y1VA 4MS8C 2ZCKH 4JANA 3V52L 4GFTB 1ZGLA 4NQSB 4P59H 3NTCH 4KV5E 3KPQA 2Y5TA 1MPAH 2VKWA 2D3VA 5IW1B 3DMMB 2R2BB 3P73A 3TWCH 2DTMH 2YA2A 4HUUB 2O5ZH 1J8HA 2AJUL 5EU6A 1Z5LA 2F54D 3L5IA 2APWA 3B2VH 2E9WA 3O6FC 5CP3H 4PJ9A 3RWIB 2MHAA 2C7UB 1PVHA 5DUBB 5A3IC 2P5EA 3VFPB 5DJCA 5KSAA 1NCNA 2YC1B 3AVEA 3T0DA 2DLTA 1MCOL 1FZMB 3RRQA 5FECB 3SN6N 3MODH 1U58B 2VRAA 1I7UB 3ARQA 3GGWA 1HH9A 2AJ3B 1FCGA 3VXME 5IB1B 2UY7A 5GZOD 3VE0A 3C5SB 2HT4C 5T1LA 4QCIA 3I50L 3HNSL 4Q6IC 5ESAA 2ICWI 1U3ZA 4M5YL 4WNQB 1OAYH 1LDSA 2N7BA 5DFVC 2P47B 4GRLC 1LO2H 1QLRB 2HP4A 4PBVC 2Z92A 4L3CA 2AV7B 4UV7H 4NNXA 2AXGB 1VADA 3R06B 4M3JA 1WGOA 4P46B 3SCMD 1JF1B 3V5HA 4Y4HB 4CUCA 5D7IB 3MUGA 1IEHA 3V0WL 1SVZA 3MLXL 2FGWH 1E4KC 1HZHL 3F58H 1AP2B 4WUKL 1I8LC 1I7ZA 3BZDA 4WFHD 2HJKB 4LDEB 4YHLL 5DJ6B 1G9MC 1VGKB 4NJ9H 2OL3H 5F3HB 1WISA 4KMTH 5CJQH 3V0VA 1ZSDA 5D7IF 3K2UL 4NPYB 5ITFA 1J7VR 1N4XL 4L29B 2FL5B 4PJCE 4ALAL 2HTKD 1MHCB 1CIDA 1C5BH 5CGTA 4OIBA 4X9GA 3VFWA 1TJHL 1XGYL 1OP3K 4C56B 1QSEE 1T89A 2D31A 4ZUSA 2YPKB 1Q1JL 5CKAA 4XH2A 3WNMA 4ODUB 4WHCA 2VDRH 5INCB 5IEKA 1A02N 2BMKA 5CUSL 4RAUA 1Q94B 4I13B 2VLRD 4XCNA 2ARJB 4NQCE 1U3HD 5KW9L 1T0MA 1UM5H 1U95B 4X98B 4I3SL 1DN0A 3QDMB 1YNKH 1IRAY 4U2ZA 1F6AA 4P5MB 3DX9B 4OZHA 5HHNA 2X4TA 1OT1A 3W9DB 2Q8AH 2F53E 3HFMH 4KK9D 4XNXL 3WNPA 1K3ZA 1HNFA 5E0QA 2NY7H 1RIHL 2IWGA 4OF3A 4YX2H 1U8IB 3TT1L 2ATKA 2R8SH 4PJFE 3JWOL 3KXFA 4GLRI 1CF8H 5FUZL 5GGTA 3SDCB 1QFWM 2A6JA 1Q9OA 4PJGF 6FABL 1I85C 2Q3AA 1KIRA 3IDIB 5DA4A 3DJ9A 4PJHB 1IGYB 1MCEA 4OLWL 1MJ7H 5BZWB 5IMKB 3FQWA 5TFSL 2ZUTA 4EXKA 4MCYA 4YXHH 1EHNA 4GRWE 5HBBA 5I8OL 3WKML 1CXFA 1X5YA 4Y4FC 3TZVA 4U7MA 3W81A 4EDWL 3MGOB 4JDTH 4JGUA 4TVSa 1MFBL 4I3RL 4YGAB 5E2JA 4E41B 2FJHB 1QVOB 3EJJX 4X8JB 2X70A 4IM8A 4NQDB 4Y16B 4MNQA 4JN1H 3O2DH 5BQ7A 4MDIA 1YEIL 3TNMA 2YSSB 3I02B 5JHDE 4MWFB 4S1DC 2J8UF 4AENB 1T0NA 5EBWA 5F71A 1GGCL 2R0LH 5FFLA 4XZUB 2YUZA 1XZ0A 5HGDB 2VL5B 3VG9C 1DANU 4CU6A 4YHYC 4QOKE 5F9OL 2JJUA 1RK1B 5IT2L 2XY1A 4NO3A 1FVDB 4P2OC 4MNGA 5F9DC 1PX4A 1VB9A 4GOSA 4I2XA 1CFSA 4PJBB 2C1OA 2RGSA 3SKOA 1JF6A 4XBEH 4HIEB 1OP5K 2AK4E 4HWZB 2BJMH 1A3QA 2OI9C 3P4MA 2DQFB 1BAFL 1XIWD 5C70A 2YN5A 2GI7A 1JWUA 3MJ9A 3VFMB 5F89B 5H35B 1BZ9A 3PL6B 4DGIL 4PJBF 2W38A 1FLRL 3PP3H 4JPKL 4K7PL 1KPVA 4TPRL 5JOEA 4PG2C 3HA0A 3W9EB 3MQIA 3T3PE 1KF9B 5KG9B 5GRWA 3OXRB 1T4KA 4JGMA 3RX5A 1CDYA 4Z7UB 4PYHA 4K8RD 3PHSA 3HNSH 3VFRA 5ID1A 4UTAH 5F7DB 1FO0A 2GT9A 1AKJB 1DE4A 4XCYB 5HXMA 4K7PX 2DRUA 3PWPD 3QA3B 4PP2B 2H41A 1MIML 4DAGL 1DTUA 4Q97A 5JW4Q 2EYSB 5FYJD 5IMLB 4XPTH 2A0LD 4YBLC 1LD9A 1RZ8B 4UT9H 1FVEA 4J8RA 4ONGL 4NN5B 4MJID 2BVUA 4XI5C 5GGSA 1JNHA 5JUEL 4Z7UF 1CFVH 2A6DA 2VDLL 4U6TA 4ZS7L 2L4OA 1A1MA 3MLXH 4K7PY 4KROD 5MI0B 5FYLL 3RTQC 4I5BA 3S6CA 2IH1A 4OTXL 1QHOA 1IGIL 3FT3B 3QNZB 2HG5A 3N1GC 3SY0B 3TJEL 2BY0A 4KI5D 1N59B 5H8DA 3DO7A 3ZKND 1MUJA 3QCUL 1KIQB 1MJJB 4GKZB 5E6IC 4K9EC 4KDVA 2HJFB 1N4XH 3HE6C 3PJSB 4ALAH 4CN6A 4YXLH 2Z91A 5KSVA 4NN7C 3OXSB 1TJHH 2DIJA 4JFQA 2DQGL 3RIFK 1GSMA 3ARGD 3EDDA 1MFAH 3L3GA 5DJ2B 1FDLH 5CUSH 4G3YL 4EI5D 2V9TA 4M1GH 4RNRA 5HI4D 3RVVD 4I3SH 2Z0BA 3L95B 3PIQB 4S1SL 4DKEL 1P53A 1FRGL 1MH5A 3NA4A 1UADC 1H3XA 4ZFGL 3GKWH 2J8UA 3ZE0E 4Y1AD 4C57C 2J2ZA 4XNXH 5A2LH 4BH7B 2GJ6E 3QFJE 4KRNA 5I71B 3A6CL 5GIRB 4BQ8A 3NMEA 4HJJH 3MR9A 3TT1H 5MHSE 5DJZB 4RFOH 3RAJL 5K9KB 3HUJF 4FQHB 4PUBH 4B50A 3BIAX 3JZ7A 5IBLC 6FABH 1T5WA 3PWUB 2VB5A 4JDVB 5TQ0H 4K7FB 4P5TA 1K2DA 3S98A 3PWJB 1CK0H 4IIQB 5MEQB 1OCWL 2MKLC 5TFSH 1CFTB 5C71A 3GSXA 1OT2A 4RZCB 1NGQH 1S9WA 1R3KB 2UY6A 4IJ3C 3X17A 2BNQD 4RGNC 4EDWH 2VL4A 2OXHA 1FFRA 1E27A 1JZ3A 2ADGB 4U6YA 1VGEL 1S7XB 4RAHA 1C7TA 1JHKH 3T1WA 3JWDL 3L3HA 5HYQA 1ZOXA 4XBGB 5E2VH 3DI2B 2FECL 4Z76A 2VDKH 1P5VA 1YEIH 2Q76A 5HJ3B 3OKEB 1JI2A 4G43A 1ZT7B 3SJVB 1NUDA 5EIVA 5C3LD 4AEHL 1A7RL 4G8GE 5CZVL 1RZGA 4ZSOE 2Z35B 3KLAA 1HINH 1KTDB 1IQWL 5E4EB 4FNLH 1KUMA 2HN7B 5IT2H 4MD5A 1EEQA 2ORBL 4NRXB 4XVUC 4FQQA 4QF1B 4OCRL 4ZO6A 1EDQA 5EOCJ 4JY4A 5ERWA 1BAFH 1UKTA 3IAGC 4G6AD 3LKOA 1WTLA 1TJGL 5IB3B 5HHQB 3HZKB 3CU1A 3IRPX 1G0DA 3KYOB 1FNEB 4HK3J 5J9PB 3O8XB 3OGOE 4TOYL 3RWCB 1FLRH 4JPKH 3DBXB 4TQEH 4O58L 4EEEA 1P4LA 3CJJA 3UTQA 3SPVB 5F6IC 5F3BA 1JWSB 3KPRB 3QNYB 3H7BB 2ZZUT 1RURL 4I0PA 4RA3A 1S9XB 1FYTE 4KUCD 5DMGD 3TO2B 4DGVL 4KU1A 4PJ5B 3ARDA 5I17B 3MC0A 2AJZA 3U7WH 4HZLA 5JPMA 4XMLH 5HDLA 1FBIL 4LSQL 3UJTH 1HDMA 2FEEL 5BO1L 4TULL 1EPFA 5FK9A 5JUEH 4GAJL 4LCWE 5CP3A 2PCPA 3OR7A 3WFBL 1GPOL 3QXUA 4ZS7H 4RGNE 3MRNA 4OKVA 3WXVL 3HUJA 5E8NA 1UJ3B 5GJTH 1IGIH 2Q87A 2DTSA 5TGBA 4MX7A 2DF3A 4UUJB 1MFEL 3VXSB 3TJEH 4EN3B 4TSCL 2HLFD 1CICC 3ARBC 3SGDI 2W9LA 5DFTA 1P6FA 2YEZB 3GSWB 5DK0A 3WYRA 1N0XL 4LAQH 4QHNA 5T5FH 1R3LB 2IG2L 4HXAH 1RUAH 2K7PA 2WMPA 4CAGA 4LARL 4UQ3A 3OX8B 3KYKH 1YUHB 4Y5VB 2FJGB 3BO8B 1N5AB 2DQGH 1IM3B 3CLFL 4CDGC 1KN4H 2LABA 3W82A 2VERN 2PTUA 1I3RA 5A2FA 4G3YH 3EUUA 5CSBA 3E6HA 5FKAA 1DDHA 4X5XA 4FQCH 4WI3A 5TE6L 3C6LB 3IDJA 3OKMA 4KVNH 4S1SH 5MEPB 3DPBA 4DKEH 1FRGH 2R29L 3TYFB 4Q9CA 3FRUB 4X9HA 3KPSB 3VFTB 5IM7B 3QUYC 1RPQA 2GJZA 1CGSH 1W72H 3ETBF 4K3GA 5D96C 1ZLUK 2W60A 1FPTH 2XKUA 5F96L 4JM2A 5K59F 2DYPD 1CU4L 5DRXA 1QSFE 5MHSD 5KSBE 2WM0A 2OL3A 1MELA 3F6LA 3KAAA 3CFCH 5KN5B 1OLLA 4X99B 1NCBH 3QXWA 5FA4A 1BVZA 4ZXBC 4XVJH 2QR0A 3SKUD 5F88B 1MAJA 1OCWH 4H25B 4OI8A 4NZDA 4UI2A 4JO2L 2AQ1A 3MGTA 4PG9A 5GS2H 4EQ3A 4Y5YC 4DUXA 4IRJB 4XB7A 4K3JL 1KCVL 1CL7L 5LQBH 3BPLB 1VGEH 2YPLE 4S1QL 5HD8D 1T03H 3ECBA 3DUSB 2OTPA 3HB3D 4KJWC 5EFIB 1M1SA 2VNCA 4ZUWA 5JDSB 3FQTB 1ORQA 5IOPB 5DJ0A 1B4JL 1QQDB 4NM4L 4P4RB 1FL5B 2PTTA 3IAQA 1J0HA 2V5RA 1YMMA 4GMTH 1TPXC 5AUMA 3G5ZB 1UM6L 4AEFA 4ZO7A 3RL2A 4AEHH 1A7RH 1INQA 4G8GD 5CZVH 4QEGA 3W0WE 4C4KO 3FAXA 4NZRL 1DBBL 4GMSL 3PNWB 5FV1L 2HFFA 4HHAB 2CK2A 4J3TA 4M7LL 4MQXD 1R3HA 2VXQL 2DKSA 1DEDA 1GH7A 2IH3B 3T1FB 4NQEA 1A9BA 5AEAA 2PUQT 3OBAA 4BKLB 3TN0D 3PHOB 3MV7D 3CAFA 1LO5A 4U1JA 3F12B 1EIBA 1EHLL 5JXAH 3JTTA 1F2QA 4O58H 5AWNL 5L8KB 4XCFL 5D2NA 3WN5C 1A6UL 1R5VB 3O2DA 5ALBL 4O5LL 3LRSA 1R24B 2C4XA 4LCYA 4J4PA 2YD2A 3MNZA 1RURH 1G7HA 5DGQA 3IDUA 1OTUD 3E2HC 1T66C 1WZ1L 2WBJA 4X9BA 1K6QH 2EDFA 5F7HA 3BKCH 4J3UA 4U0RB 2V9RA 4GAGL 1FBIH 4LSQH 2DDQL 3KLHD 1WEJH 4FQ2L 5BO1H 1X5AA 4GAJH 4LCWD 3RX7A 7FABL 1QR4A 2GQHA 3QIWA 3WFBH 1GPOH 3CX5J 3LKQB 3UTTB 1D9KD 4XHQA 1C5DA 1AY1L 5E2UL 5D7KD 3ZDYF 3MO1A 5KAQG 1IEAA 2G2RA 1QG3A 5T1KD 3BD5A 5SWSB 3UTSB 5TQ2L 2JK5B 4KXZH 3R4DA 3BEVB 4FQ1H 5D6CB 3ESUF 5TDOA 2RCSL 1PG7H 1N0XH 2C3HA 3C5JA 3WLBB 4URTB 1WAAA 5IV2A 4Q6YA 3I75B 3GSUA 4LSRL 4Z0XB 4GRMA 3LEVL 1Z9OA 3RU8L 3LSOA 3HZYB 5GRYA 4XC3L 3G6AA 3Q48A 3PQYE 1PG7W 4P2QE 1MRCL 1FL6B 2H9GA 1YJDC 3GIVA 4PRIE 2Z4QB 1OARL 2X4SB 4O51A 3C5ZD 4RFEB 4HKXA 3MREA 4EOWL 3P0GB 5HI5D 5EU3A 4OZGB 4KI1A 3VI3F 1WICA 1LWRA 2BRQA 4HDIA 4WW1B 3HRZB 5I66B 3FO2A 1C8PA 5F96H 4NKOA 1LK3H 5C0JA 3ZDZE 1FL3A 3NOIA 5DJ8B 1J86A 4PJEE 4O9HL 5DD6A 3LB6D 1YPZB 1RZJL 2ESVD 1C08A 1FGVH 1AXSB 3R1GH 1MVFA 3N1PC 5JNYA 4G7YL 5JPNA 2BX5A 3STZB 2R4RL 3PF2A 3SGKC 3OAZK 3KVQA 4OFIA 1AD0B 1XGUA 4QXUL 4KPHH 3IDYB 2YRZA 1RHFA 3SO5A 4JO2H 4PJ7A 1J8HD 5EU6D 1ZLWH 1RVFH 5DHVB 4K3JH 3FMGL 4PJIB 2SEBA 2Y36L 4OCSL 4PJ9D 4S1QH 4FQIL 1VA9A 3UO1H 4FQXC 5IBTL 1SEBA 4YJZL 2JB6B 3O4LB 3V0AC 3HC3L 1B4JH 5KSAD 1A47A 4Z7NE 4JVWA 5I15L 1G1CA 1U8QA 4I48B 4GW5A 3E8UH 1E6JL 3MRCA 1FN4B 2WNGA 4GW4B 4HK0B 5E8PA 4M6NL 4XHJD 3PHQA 3MA9H 3OAYK 1IC4L 5T1LD 5EU4B 1TITA 4JN2B 4WHYG 4D94A 5MENE 3BVNB 3ZTJH 1RZIB 4NZRH 4M7KL 5I74B 2FH8A 3GMOA 3P77B 1M7IB 4QRRE 1S8DA 5C0EA 2IALA 4M7LH 1NCAH 1R3IL 4KRPC 5IMOA 4BFGA 4O2EA 2VXQH 1XR8B 2AI0H 4HQQL 3HS0A 1P4BH 4R2GB 5DI8B 5B3JE 3T0WA 3ZHLA 4MXQC 1NUGA 4LIQL 1RAMA 1ZVHA 5D7SH 2F19H 1QFPA 1B6UA 4CMMA 3ZHDA 3MLYH 1EHLH 2D7PA 3C09C 2Z9TA 3KJ4B 2BOCB 4GKNA 5AWNH 1CE1H 3RWFA 4RFNC 4XCFH 4NKIL 1AGDB 1I1FB 3WNLA 1DBAH 5ALBH 3ULUC 4L8CA 3X13B 3KR3L 1K8DA 3MX0A 2ZSVA 5M94B 1LVEA 4JFDA 5KVGL 1I7TB 4PRHA 3RGVB 3DXAB 3CC5B 5FUOL 4ETQA 4IMKA 4QKXB 4HWBL 1WT5A 1E0OB 1WZ1H 1T3FB 4HXBH 4POYA 1DBML 2A38A 3D3VE 4OCWH 3UEZA 3VXRB 4OT1L 3B9KA 1WZLA 4WI6A 5BRZB 1YYLH 1RIUH 2DDQH 5T3XH 4WIQA 2J6EH 4WI2A 3D39E 2HWZL 3V5KB 4K94C 3CK0H 2BSTA 3K3QA 1BX2A 3LEXB 5J1AA 1WF5A 5INDA 3ZHKA 1N6QL 2W1NA 3QO0A 5B22A 1JZ4A 1AY1H 1D5BA 2P7TB 3STBA 5CEYA 3U7YL 2ENYA 2QL1A 5IQ9B 2ZPKH 4PJAB 1ZGLM 3O3BB 1LDPH 1ZMYA 3V6OA 1JRHH 1U8NB 2VIRA 4GG6B 4YPGA 1JGDA 5HY9B 4N8VG 3T0BA 4NQTA 3P0VL 1NFKA 1CLZL 4LSRH 3K4DA 5I1JL 4EQ2A 3KXFD 1P1ZB 5E1HB 4H8WL 4JKLA 5C09E 3U2SB 4JAMB 4XC3H 3MJ6A 3PQYD 1BFTA 4F33B 3NCFB 1IAKA 2W0LA 2DLHA 2XV6B 4F7TB 1F4YL 3DURB 4UBDD 4F3FA 4G6KH 1IFHL 1NGZA 1J9CT 3O11A 4DKDC 2C3GA 4U1LB 1A2YA 1U2HA 1QNZL 1NC4A 3LQZA 4EOWH 1YY9D 4UOJA 1EFXA 3OJDA 3CFKA 3VWJB 3TZVD 3B4NA 4JO4L 1MFDL 2H32H 2JCCE 3T0AA 3IJHB 1GHFL 4PRBA 3CCHB 5C0FB 4YO0B 4U1KB 3SO3B 3SOBL 5EUOF 4P4KC 2VLLB 1QBBA 4HJGB 5FIEA 3TH2T 4YDIL 4ZAKB 5TDPB 1BJ1J 3QUMH 4MNQD 4YE4H 4O9HH 4N9GA 5C0BA 3ULUE 4HWUA 5E9DB 5DUPL 2EH8L 4OM1L 5EZJA 4NWUL 3TBVA 3L6FA 4ODXA 2ITDB 2R2CA 3IJSA 2R4RH 1XF5A 2E27H 2R23B 1A6WL 3S96B 1CLYL 5IWLA 3NFSH 4QXUH 3U46A 3LH2L 15C8L 2L7UA 1MFCL 4PJ8A 3QDJB 2DWEA 2BNUB 4G6ML 4F2MB 4WWKB 3B2UD 5ICXA 5I1LA 2HKFL 3B3IB 3BW9A 1AGBB 2RB8A 3FMGH 4CN1A 1S7UB 2Y36H 4OCSH 3AB0B 4N8VA 4NUJA 1C5CL 5C08B 3EJZC 3G6JB 3QPQC 1FZKA 1A7NL 4PTTB 4XXCC 5IBTH 1Q9WB 1BQHB 4LLVB 5CSZA 4LHQB 3CFDB 1W72A 1ZEAL 9CGTA 2PYEA 4HFUL 3LKNA 2XXMB 1ZA6B 1UH3A 5J13C 4CVXA 1ZHLB 2KPNA 5IJKA 1RUKL 4M6NH 3EYUH 4J3VA 3RPIA 1UYWH 3DGCR 3PE9A 3MFFB 3M8OH 5K93A 5EDXA 3C8DA 1T1XB 1IGML 3U36A 1NQBA 5EU7C 3CSYA 2J12B 1I75A 4PR5B 2X89A 4MZ2A 3DETC 4H1LH 4M6OH 2V7NB 2VQ1A 4LLMA 4XPAH 2NY5H 4FZEL 5DMIL 1R5WA 4DZBA 2AJSL 1NC2A 5IK3B 4B5EA 6CGTA 2DICA 2GSIA 2VXVH 5FO9A 2EICA 4X5WB 3L3JA 1XF4A 1BFSA 3BIKB 3GO1L 5CBEB 4UDUB 2CRZA 3BD4A 3OR6A 1V7MH 4X4MA 3MLUL 4IDJL 1VFOA 3RDTA 5F7NC 2EDRA 3U4BL 1VACA 2FCBA 5CIPB 4HH9B 5E4IA 3LN9A 2WWMC 3K80A 5GRVK 2FSEB 4XGZA 1EJOL 4JZOB 4NKIH 4WFFE 4HMDA 2AEQL 4QHUA 1TVHB 1OAXL 2NY6D 3O3UN 1BD2A 3BISA 5D1QB 4PRAB 4DW2H 1KB5L 1II4E 1V05A 2FLRT 3QUXA 3ZO0A 3ARFB 1EZVX 2WP3T 3FO0L 4OGAD 5GHWH 4NBYB 3AXLB 1I1AA 2HT2D 3QULB 1CGWA 4R4BB 2ZP0T 4P2RE 4R90L 3PUCA 1NLBL 5F9AC 4XP9L 3IETB 1N64L 4HF5L 1AHWB 3QJHB 3D39D 1XGPB 2NPLX 4HD9A 4KJYA 2DMCA 3JV6B 1K4CA 3ARZA 1GGBH 1I4FA 1KCUH 3HMWH 4FG6D 5I1IL 2ZUQC 5DJXB 4O4YH 3HG1E 2X9YA 3U7YH 4FQLL 5I8KL 2EIZA 3EIFA 1FG2B 4HX1A 1HOCA 5KJRH 1PZUB 1W0VB 2F8VA 3MRBA 3WS3B 2OX5A 3S8WA 3P0VH 1OW0A 1CLZH 3MLZL 2GTWB 4I4WA 3WS6A 3BUYB 3EOBB 4FP8L 3RY5A 2BDNH 1S7TB 4S1RL 5F9WB 3TJHC 5CEZE 2AXFB 3HI1A 2VOTA 4LBEB 2P46B 5EU7E 1F02I 4M93B 5DJYB 3V95A 1DVFB 4KDWA 4P5TD 1WQVT 3QR2A 4ZUTA 1OGAA 3FCTA 5FHBL 4KRLB 2NY3D 1J0YA 1I1CA 1S9VA 1QNZH 1SMAA 4HLJA 4JY6B 3TFKD 1CDGA 3HE7B 1P9MC 5DMKA 1MFDH 1F3JB 1KFAL 4P9HL 3QEQE 2KUTA 3VDAA 1T6VN 2XRAH 3SOBH 1AXIB 4HPYH 2V5SA 4WHTB 4ZPTB 5C8JA 4YDIH 1EAPB 5TF1L 2H3NA 4MAYB 5CGYD 2ZCLL 2K7QA 5C0GA 1OL0A 1X5IA 1MFNA 5CWSA 3ZL4H 4CW1B 1AI1L 3WE6A 3P9LA 4TUKL 2BY1A 4G9FB 4KK5D 3WKNA 4V1DE 1CLYH 4WRLA 5DR5H 3SE4C 5IB2B 4Z8FL 1IZKA 4KH2A 3MOAL 4NDMB 2BSSB 4GLRH 1B0GA 4C54A 4TVPL 4Y4KC 2JIXB 2BVOA 2I9TB 1JGEA 3F7VA 4HUNB 3KNBB 2QEJA 3G6DL 2FHCA 2QKIA 3L5XH 3ZTJG 1A7NH 1YQ2A 4OZFH 1IGJA 5IFAH 3W11D 2HFEB 1UZ6F 2A73B 1ZEAH 1I9IL 1U8MB 3ULVD 5JW4M 2DQDL 1X4YA 2XTJD 4JQIL 1YEHH 1V3KA 2VE6B 2VITB 2GK0B 2B4CL 2NY4B 1RUKH 1YMHA 5SV4A 4OAWA 4QRTA 5GSVB 4YHOL 1JYXA 3JTSB 3LD8C 3L7FA 3F7QA 5H94B 4I0PD 5IHUL 3V4VL 3TIDA 4HEME 1S78C 3SBWC 1HHIA 1S7RA 3ARDD 5DMIH 5C0RL 1DFBL 1A9EA 3IDMA 4PRPA 4U2YA 2A83A 1AGFA 2EKSB 1RK0B 1YEGL 1BPVA 3S3JA 2J8OA 3WDHA 1A6TA 3KYAA 1HEZA 2FWOB 4Y5XA 3WHE1 4UIMB 2R2BA 3GO1H 2IFFL 4JRXB 4XPBL 1SHMA 1YQVL 4IDJH 3S88L 3T0EC 1KIUA 3NN8A 3U4BH 2Q7YA 3QYCA 3LN5A 4YHYB 1L0YA 3QG6A 3AREA 4WFFD 2Z31A 3ZKQD 4K2UL 4JJHA 2AEQH 3BPNC 4XP5L 1M71A 5DEZA 5HGBB 3NCMA 4GG8A 4W81A 1B6DA 4IRSB 1DLFL 3NCJL 1KB5H 3MMEB 2DKMA 4S11A 1GYAA 2OI9B 1N2RA 2B20A 3W5MA 3DX8A 3K2MC 2VJXA 3MRJB 5IB1A 3RZCC 1W8NA 3BAEH 1YYML 4R90H 4P3WA 4GW1B 5SX5K 1LHZA 1JNJA 1N64H 2EIBA 4HF5H 3UTPD 1IGTA 5T5NG 4JFFE 4TUJA 3T8XA 4NQUA 2YK1L 5C2UB 1LEKB 5FGBA 5I1IH 5HGAB 4LSTH 3V8CA 5I76B 5B8CB 1J1PL 2GITB 1T1ZA 2WUBL 4FZ8L 5ETUA 5ESQA 2CO7B 3H7LA 1H5BA 3OKLA 4JM2D 4PTUB 3Q3GB 3RFZC 1PKQE 2DAVA 3BOVA 1IL1A 3V5DB 3RJDA 3TA3A 4NQXA 4TTDC 4OM0H 5EO9B 4MA8L 3BYYA 3QI9A 1IAMA 4S1RH 2E6QA 3BQUC 1CDJA 2H2SC 5CEZD 4KTEL 1JTPA 4NUGL 1GC1C 5EBGA 3TPUB 3HI5H 5BOZG 2MQ0A 5FHBH 3MRMA 2O26U 3GK8H 4JKWA 4WFED 1RZFL 2J6EA 3G5XB 3QIBB 5F1IB 4PJDA 2G9HA 4GSDL 4AG4H 1AJ7L 5F7EL 2I9LA 1A1NA 4H20L 5C0AA 2AW2A 1SYVA 4U1GB 2XZCH 5GJSL 3JV4A 3T0EE 4LL9A 1I8KB 4X98A 3VXUE 1KELL 4HUWB 5HVHB 4UMGA 2CPCA 2ZCLH 3DV4B 2K3TA 2E9JA 1YMMD 4HZAA 4F57L 3W9DA 5GGUB 3HC0B 1AI1H 4TUKH 4JHAH 4D9RD 3QXDB 1JV5B 2PO6A 1HKLH 4JRYB 1XEDA 3OKKA 3H9YA 5J57B 4Z8FH 1RZKC 4GXVL 5A16A 3NGBB 2HJLA 1DL7H 2NY1D 1LK2B 5E00A 4PJXF 5BV7B 1Z3GL 2ICWB 3EDEA 2I26N 3OGCB 3G6DH 4GBXB 3MUY1 2JJTA 4J1UA 3VRJA 5CFHA 5IW6B 1EMTL 4NQED 5EPMA 3UAJC 1ZGLP 1OAQL 1QD0A 4H1LG 2H32A 3QQ9D 3BZEB 1UEYA 3FZUC 4N0YH 3QO1B 2Q3ZA 4XNMA 5LAXB 4BQ6A 3E6FB 5JW5B 2DQDH 2FEDD 4Z7VB 4JQIH 3S4SB 3IFLH 2JJSA 3QUMA 2B4CH 1G7LB 3O9WA 4PLKD 4IJ3B 4J4PD 1BP3B 1QVOA 3CVHB 4HT1L 4JFDE 1CXHA 3S37H 3MRKB 1MJUL 1A6VL 3V4VH 3MV9B 4UZGA 2IFGA 4LSPH 3FFCE 3TC9A 3I02A 2WBJD 1QA9B 3BH9B 3QUZC 3GB7B 3I6GA 2Z93A 4I9WD 2CLVB 2JJWA 5KVMC 1G7QB 4WI9A 4L3EE 4XNUL 5E6YA 3BESR 3BXNA 2DI7A 2F74A 1ITCA 3IKKA 4MZ3A 3T2OA 5HHMB 3KHOA 3BHBA 1MVUA 2IFFH 4DCQA 3TO4A 3QIWD 3S88H 5HYJB 3VXQA 5CD3B 1T1YB 2VO5A 5LJYH 3NPSB 2CLZA 2IJ0C 2X1WL 4PBXA 2WINB 2C3VA 4ZOCA 2W65A 3EO1A 4G8FA 5T3ZL 1JYWA 1TJIL 4K3HA 3F7PC 1F6LL 3WNOA 4XCCH 4XP5H 2P8LB 2D7OA 3TBTB 4N0UB 3WL9A 3NCJH 2C3WA 3CSPA 3D5OF 3OKNB 1ZV5A 3PWNA 5CKGA 3ILPA 4L4VE 4M9OA 2BCKB 4YHIB 4UNTA 3L5WB 3BJLA 3RY4A 1YYMH 4H1LA 1F58L 3MROA 1P84K 3VXNB 1GZQB 3KPPB 3GDBA 5HHOA 5SWZA 1AR1D 3EDFA 4XCYA 5HYSB 1MRDL 1L4IA 4E42B 4ZODA 2Z8RA 4APQC 1A4KA 4LHUB 3IVKB 3RUGB 5C0NC 5JIIA 4IRZH 1QP1A 2EE9A 5GISL 4LRIA 1A22B 4OV5B 1HHGB 3FAWA 1J1PH 5FYLE 2WUBH 1PX3A 4FZ8H 2UVEA 1K9TA 3IXAA 4M61A 4F9PC 4YDVA 4ELMF 5GS0H 3SGJA 4JDZA 3QFDB 4X4XA 5D70H 4G42A 4RIRA 5ISZA 4PJXA 4M6AA 2EZ0C 1TIUA 3IFPB 2V2WA 1WIUA 2IADB 5IHZA 4MQTB 1ZHNA 1N59A 4Q0XH 3SGDH 1KXQE 2F9BT 3K7UA 4KTEH 5DEFB 3EHBC 4B7LA 4MDJA 4NWTL 2NTFA 4Z6AT 5DLML 5IKCB 4XNQB 4BJLA 2HJFA 4P23A 3H9SE 3VXTA 2AERT 1SY6L 5CLWA 1RZFH 3WDJA 1CICB 1WIPA 4RX4A 4TRPH 2NR6C 4BZ1L 4GSDH 1U3JA 5F7EH 3HRPA 4I18B 1ZE3C 1ZLVK 4L1DA 4XXDA 3UJJH 5IEHB 3NFNB 3QDGB 3BKJL 5IB4B 5EZIL 4RISH 3WFCH 1DCLA 3DIFA 2YD9A 5DFWH 3CSBA 3GMNA 1NMCB 2WIIB 5CMAB 2CIIA 1KELH 3DVNB 3JWNC 4HMCA 2OMNA 2P24A 3H2WA 3N50A 1RJLB 5KSAC 4I77H 2R0KL 3ARSA 2X05A 3BGAA 1KLUB 5C0CA 4IOIA 4OZFG 2NX5A 2XA3A 2VLKE 5C0DB 2WAHA 4BUGA 3VMPA 4BH7A 5EU5B 3K8LA 1JPSL 4AEIL 5FYKU 3F5WA 4WO4A 4R96B 4GXVH 4R8WL 3QUYB 3ZT5A 2AQ3A 1TVBB 3UBXB 5D96B 4MHHG 1T5XA 4N5UA 1EVUA 1Z3GH 3IFNL 4J6RH 2HTLC 3CGTA 5DC4B 3ZE2E 4Z0BL 1MHEA 1S7SA 3Q1SL 4G9DB 1PEWA 3MOQA 1EMTH 5IVXE 4S2SB 3IDGB 1OWWA 1DEEB 5I9QC 3RPKA 3MYJA 1KEGH 4OGZA 4DGYL 1CXIA 1G6RB 3CZFB 5KVEL 4X6DE 4YZFE 2QADC 1Y0LA 5TE7L 1NFDA 1ERNA 3FHAA 4KY1H 5IVZA 1AQDB 3H3PL 4DQOH 5I8CB 2CGRH 3LPWA 3GMLA 4JFDD 3WLWC 4PRHD 3VW3L 4POUB 1QACA 4NO0B 1U8PB 4ZYKA 3TVMB 3FFCD 2F5BL 3X3FH 1CLCA 3FQNB 3FTGB 4TNWF 1UZ8B 2R2EB 3SJVA 5IR1B 1VFMA 3B9KD 2V2XB 3NFPA 3O6KL 5D1XB 5F93C 5I18H 4M6ML 1U36A 4XNUH 1EFQA 1EGJL 2YD4A 1T89C 2B5IB 3S5LG 1C12B 4ELMA 4ERSL 1S7QA 3HCVB 3ZKMD 1JZ2A 2Z8WC 5SWQB 4WUUA 5DYOB 1XF2B 4OZFA 4JO1L 4NQVB 4F7CA 1BF8A 3AMKA 2NY2B 5T3ZH 1I8MA 1NFIB 2P5WB 1T04A 2VZ1A 3O0RL 2NW2B 4OF6A 4B41A 2VLJB 5L2KA 1MWAB 1CDUA 1EBPA 1J0JA 4D0CA 5HVWA 4QRSA 1SMOA 2BHUA 4QNPE 3DO3A 2A9ML 5TH2B 4DN4L 3GBML 4U33A 3REVB 3ARUA 1B9ZA 4H5SA 1A1OB 1PQZA 1R6VA 3EOTL 2K9UA 4OZIA 3RWJA 1S9YB 3BWAB 2FIKB 1WK0A 3TCLB 4RDQF 1F58H 1F11B 2R1XA 3H7BA 3VFOB 4PB0L 2VMFA 3LKPB 1UB6B 4OUUB 5D1ZD 4R3SA 4DEPB 4HS6B 2VQUA 4MMXC 4LVOB 1PYWB 3DMMC 4YDJB 1NC4D 5DC9B 3TH3T 5HDBE 1EFXD 3C60D 1QRNA 3CUPB 2YD7A 5GISH 2X4RA 1VESA 4KFZC 1JK8A 1LP9F 3E2HB 3C6SA 4LRNH 4NP4L 4OIIH 5FYLD 5FB8A 1G9ML 1FNSL 3HPLB 3V6ZA 1T6WA 4WV1B 3KPTA 2HMID 2G5RA 3VXPA 3A67L 5C0BD 3ULSA 2ADJB 1U8OA 1KB5A 3NH7L 5FGCE 5I8EA 2OR9L 3S5LA 4OLUH 5ICZA 3F7YB 2IANE 4NWTH 5HI3D 3U4AA 4LP5A 4L9LB 1NCDH 3VI4E 2XWTB 3H9SD 2R0ZL 3ROLB 1SY6H 3KDMB 1MLBB 2B1HL 3HHRB 5DVNA 2CLRA 4PJ8D 3BO8A 2WSKA 1G6VK 1D5MB 5KS9E 1NANI 3O6ML 4HIHA 4C83B 3BKJH 1I8IA 1Y18B 3Q5OA 5EZIH 4XVTL 2UZIH 4ZUUA 3M07A 5J11B 1DSFL 1H0DB 5I1DA 4PYGA 2XXCB 4XNZC 43CAB 2VZUA 1AC0A 4P46C 2PYED 4Y4HC 3EOAA 8CGTA 5DZLA 3FOMB 4KQ3H 1CD1B 1NUNB 1YA5A 2IQAB 2J7LA 4BELD 2ADIB 2DM3A 4JQVA 2XWJB 3X3GL 4NO2B 1V7NL 2BNRE 3VJ6B 3O45A 1DQLH 2NXZD 1U0QA 4U49A 1KG0A 4EDXA 5CBAB 2X89D 4JG1H 3LZFL 4QGTA 1U8KB 4NYLB 3MV8A 3IFNH 3P4OB 5DRZB 3QXAB 1NC2D 5D7JB 4GAYB 3Q5YA 3O3EB 5MP6L 1ED3A 1EXUA 3P30L 1CCZA 3GSRB 1T7XA 5GS2D 4YNYB 5EOTA 4HKJB 5J3HC 1FNGB 2FB4H 5D5MB 1RULL 3RDTD 3LHPH 3LMJL 3TP4A 2YD6A 5TE7H 5F7UA 2CUHA 4OB5H 3RWDA 3A6OA 3BPCA 1FFOA 3P2TA 1T2XA 4G80A 5HHVH 4O2FB 1BFOA 3VD4A 2DBLL 1BOGB 1BD2D 3PGDB 1KNOA 25C8L 1IVLA 4XVSL 5B38B 3VW3H 2OTUA 3WD5H 5I1HL 3FB5A 4NRYB 3QUXD 2C1PB 2F54B 4UILH 2Y7QA 4W4OC 3U4EA 5F1NA 2EDYA 3MRIA 1I1AD 5JW4N 3P11L 5D9SA 3C9NB 4ZFFB 5J89A 3SDCC 1LP9A 5DVKA 4PGDB 1KB9K 2ATPB 2NY0D 3PDOB 2KQNA 1T1WB 3V79C 3IDNB 2GHWB 4U6HB 3CLEL 4OQ1A 5FKPA 4JO1H 4F15B 1VKXA 3PV7A 4WW2B 4EJ1C 3QG7L 2HVKA 1JBJA 3V4PH 5BS0A 5D7LA 4E0RA 3O0RH 4GO6B 4LASL 1M7DA 4DVRL 1HHKB 3MYZA 2XZQL 5D7IE 1GOHA 1Y6KR 1RZJC 1FE8H 1KXVC 4G6FD 3K4AA 4Y16C 4BZYA 2FX9L 3FQUB 1MHHA 2XKNB 3EOTH 5T33L 1G9EA 1QR1B 4BQCA 5L0QC 4GRWH 2YN3A 3STLB 5C07A 3HAEB 3UP1A 2Y25A 3SCMB 1R0AL 4G8EB 1CQKA 4RMWA 4PV8A 1IBGL 4X7SL 1OGAD 3HI6L 3R8QA 3QEUB 1L7TH 1SBSL 4CGTA 5FF6B 5D8JH 4C56E 5E8DH 1ZANL 4CDHA 3RVXD 1CR9H 2R39A 1K5NA 3O3AA 3TFKC 5EH1A 3IF1B 4NP4H 5JLZA 2FO4A 1NAKH 2HLAA 1IKFH 2G5BA 3CMOL 5GGRY 4K9EL 5ANMB 5F1SA 3QDME 5CZXC 2BSRB 5DQJA 5GGVL 4GT7A 1KENL 5J56B 4PRNA 4X6EB 1OB1B 3I85A 5AZEL 3T65A 3NH7H 4U1HA 2X4PB 2NW3B 5K9JL 2UWEF 5DGRA 4N68A 2OR9H 3V7MA 2VLRB 1Y6NR 4LCCA 1BIHA 1U3HB 4JG0L 2X44D 1UM4H 3SDYL 2PW1B 3EO0A 5ABDE 2V2TA 4Z0XA 2Y23A 4EUPH 1A14H 2B1HH 1MY5A 3IAPA 4XCEB 4L8DA 4Y2DA 2AJXL 5EWIL 3IXTB 1KSRA 5EOCL 1BOYA 3T3MF 4YR6B 1DJSA 5IP4A 2DQTL 3QPXL 2AV1B 3C8KB 3MBEA 3T4AA 4PJHE 4NN5C 3HZMA 1RU9L 2B2XL 2NQCA 1J18A 3VD7A 3SDXF 3GSQB 3SE8L 5GGVY 2UZYB 5IIEA 5EBMB 1Q0YL 5EBLB 3OPZL 2ICEA 1XF1A 3UC0H 3X3GH 1FNLA 4WTXA 1V7NH 3QWQB 2OSLA 3RKPA 4E41E 3C87A 1CFNA 2QQKL 2WK2A 4NKDB 2Y5EA 2EKJA 1P5UA 3D2UB 3UPRB 4H88L 4NQDE 2BC4B 3QEHA 4U1NB 1HK6A 5FOBB 5GRUL 3V7AE 4ZQKB 3LZFH 4PRPD 5F7WC 1OAUL 1KPUA 3AS0A 4MJ6B 3FB7B 4JO3L 1JIBA 1NAMH 5TJWK 2E7MA 4RAVA 2QQLH 2V5YA 4MD0B 3BUTA 5E94A 1J0KA 1KEML 3IGAB 5D2LA 2MCPH 1UQSB 2BFVL 4PJBE 1T21B 3MRDB 1Y6MR 4C4KT 2X1XR 2VDMH 2YZ1A 1J1XH 4F9LA 1XH3B 3ARED 2Z31D 1AD9B 5J6GA 1Z2KA 5EA0L 1UH4A 3CFBB 2DBLH 3HLAB 4D0DB 3BP5B 4WU7A 4MYWB 4X6FB 3B9DA 4M62H 5JR1L 1X5LA 4Z5RB 5I71C 4W6WB 4WDIB 3QIUA 1RZ7L 2PXYA 1S7WB 1GZPB 4ONHB 1JN6B 3OWEA 5ITBL 2EEAA 3Q6FA 3P11H 5FDWB 1T22A 1XIWB 2GJJA 5AD0A 2ZCHL 3VXOA 1N5YL 3IS1X 4L8BB 5GGQL 1WBXB 1MREH 4Z7UE 4OFKA 5JZ7C 1U8LB 2VR9A 3SDDA 3RVUC 5L6YH 4QY8A 4M43H 5JOFB 3ZYZA 3E3QC 1CT8A 4LIQE 2XT1B 3F7RA 2CDEB 3KYMB 4O00A 3TBYB 1XR8A 2F58L 4OLYL 4LNRB 5FYJU 1QLFA 4B0MM 2JELL 2UWEA 1MCKA 1RJYA 4W6YB 4AH2B 1S9KC 1ADQL 4OF7A 4MXVE 3ZZ1A 3M1BB 3BGFC 2CDFB 5ENWB 2R56L 3LRGA 2XN9B 1DQJA 3PWPB 1TCRB 4PBWD 5LKNA 2ZUWA 2BOBB 3LKRA 3TA3D 3HNVH 2FX9H 4MJIB 1DUYA 4D9QE 1HQRB 3N1FC 3QI9D 3UYPA 4EBQH 1IT9H 4FTVA 4XT1C 2A6IB 4Y89A 1ZLSL 4N0FA 2D2OA 3X11B 3DXAA 3NA9L 1IBGH 5DS8B 3O2VH 4X7SH 3KPOB 3NABL 3EJYC 3SDXA 1OVZA 1PD6A 4OLZL 1SBSH 5T3XD 2VDNL 4L3AA 1ZANH 3GHBL 1AQKL 3JVGA 4U31A 5C0AD 3O3DB 3DUUA 3TEUA 4BSWA 1IAOB 3MJ8A 3IU4L 4JLRB 3CMOH 5BW7A 3OHXB 3FN0L 3GRWH 2P8PB 1PEZA 1ZLWK 1U9KA 1FC2D 1QBLL 5DVOA 5AZEH 4PJAA 4F8TA 3NIDE 1BBJB 1P7QA 4EI5B 2PO6D 5HY9A 4ODWA 3SDYH 4CVZB 2YUVA 4PJCF 5L88H 3QHFH 2D7NA 1BVKB 1T20B 3H0TB 3VFGH 4X7TB 4MJ4A 5EWIH 4Y1AB 3MRQA 3H8NA 5EOCH 2YS4A 1NGXA 4U7KA 2DQTH 3QPXH 1AO7A 3DURA 3QSKB 4ONFL 3E3QE 1HI6A 5KBNC 5C6WH 1F2XK 3SE8H 2BHZA 4NT6A 3MRRB 1CGUA 3LAFA 5EC1B 5CEXB 1Q0YH 4QRPB 3OPZH 3DGGB 3MJ7A 1VSCA 3DTXB 5EC2A 5KVDL 2VWEE 2XNAA 4XMKL 4J2XA 1JTTA 3D69A 1UJ3C 3O9WD 4Q74A 1W0WA 3CDGB 1F5WA 4QHMA 1A7QL 3L5JA 3MZTA 4EN3C 5HPMA 3GJEA 1X6LA 5DD0L 2GFBB 1GGUA 4Z7WB 2BNQB 5I0DA 4XAKD 5IGXL 4EI6B 1FV1A 2P45B 3SJVE 1SY6A 4JO3H 4TNVF 4Y5VC 5GSRA 3UPAA 2OZ4L 2H8PB 3KJ6L 4KKLC 4MXWL 4PRDA 3RY6A 2X4OB 4LPCA 1KEMH 3CX2A 3TO4D 1U8JB 1WIOA 2FIRT 2BNUA 2BFVH 3VXMA 2F8XC 1KLGB 4ODSL 1YEDA 3W2DH 2BVPB 5ELIA 2CDGA 3C6LC 4NNYA 4JCLA 2QLVB 5KZCD 1A8JH 1O5DT 4JHBA 2HRPL 1N3NB 2AKRA 3MCG1 4PGCB 1LILA 3IU3A 3BSZL 3RWEB 2OXGA 1ZHKA 3M45A 4H26A 3PL6D 1OAZH 2AJVH 4D0BB 4P57B 1WWBX 5CP7B 5ITBH 4YIQA 5CLTA 4CNIB 5E1AA 2ZCHH 4ODTH 1N5YH 2XKSA 3KPRE 1LNUA 2GSGA 5HHOD 5SWZD 2ZUXA 2QV2A 1YN7B 5AYUH 1AR1C 2ZKHL 1D5XA 4PJ5E 4KDTA 5IB5A 1A6PA 2IPTH 2F58H 4MB5A 3X14B 3DROB 4OLYH 1KYOJ 2JELH 3GIZL 2X4UA 4IRJC 5JTWA 2QQNH 3P9MB 3RWGB 4PJCA 4L8SB 4JPVH 4LSSH 4MD4B 1A64A 1AFVH 1QSEA 5ISZD 1YEFH 2R1YA 3T3PF 2OQJB 2HH0H 3VWKA 2VISA 3VXSE 3U0PB 4U1IB 3ZYIA 5IVOA 4NQCA 4U7SA 4X6CB 3FO9B 3O6FA 4KUCF 3QBTB 4ZUVA 2LAAA 3NA9H 2EYTB 1VHPA 4P23D 2FECI 3NABH 1CGYA 1IM9A 1HSBA 43C9A 4WEBH 4J3SA 2W0KA 4OLZH 3V6FB 4RX4D 4TUOB 4LKCB 2F53A 3RA7L 4R4BA 1BJMA 2EDHA 3GHBH 3WIFB 3WSQL 2X9WA 4KZDL 3S34H 4KK8C 4L4TB 4HCRH 4ODBD 3VD9A 1OD9A 1FFNB 5DTFB 4EUPG 3RVWC 5H2BA 1AH1A 4PJFA 4I0KA 4POZC 3R8BB 3QWRA 3BMVA 3RZCB 1U3YA 1K4DB 3CH8A 3RVTC 5E8OB 4Q6IA 3CDFA 3KPSE 1QBLH 5C0CD 1CVRA 2DQHH 1JPGA 2NX5D 3QWOB 1RFDL 1S7VA 3G5VB 2FD6L 4G8IB 4MSWA 3GI9L 3HR5A 4FXKA 4GRLA 1QYGH 1D5IL 4KKBC 4WO4D 4JKPL 2NXYD 1NBQA 1A7OL 5C9JB 3UYRH 3WFHB 1XGQB 1XR9A 2WWKO 5KSUA 4YXKL 4OF8A 4LOUC 3VGAB 3BH8A 2AXFA 1Q72H 3RI5F 4HUXB 1E4KA 4IMLB 4U0RC 2DYPB 1QLEL 4R7NA 4ONFH 3X12B 3CNKA 1I8LA 3WHXB 5DD5L 4OCMC 4QYOA 3Q0HA 4F7MA 2Q6WB 5GRZA 5JORB 5JHDA 4QTHB 3ZE0F 2EDQA 4R0LB 3VCLA 4MA7H 1U91B 4FXGA 4XB8A 3EYOB 1JWMB 1TXKA 2FEEI 4QOKA 1J05A 3ZSSA 4WFGE 3L3KA 4Q9QL 1VFAA 1A6ZB 3BEWA 4JPIB 1A7QH 1TZHB 2YD5A 3MNVA 4OD3L 1CTNA 3QUKB 2IPKB 4LVEA 2AK4A 4CW1A 1YY8A 4X6BA 3SJVD 4EUPA 1YZZA 4HJ0C 3BRGC 5MEOA 1UWGH 4R26L 4TVPE 1A4JA 3U6RA 5TDNA 3KJ6H 1FHGA 2OP4L 4MXWH 4TSBH 4MQ7B 4LAJH 4KKAC 2GTZB 2V7HB 2XZZA 5F7FA 3HPJA 4N1HB 1F3RB 3BRFA 1FYHB 4WUUD 2NNAB 4YBQD 5K9QI 4KKCC 3DNKA 4PP1C 1EJ6A 3K46A 3JSSA 3LKSA 1UACL 4GXUM 5GZNC 1NCCH 3RJQB 1FVCB 32C2A 2HAZA 2UYLA 3BSZH 4PLJC 4JREB 1VCAA 5L2KD 1P7KB 5LWYL 2V17H 3Q2CA 3GMMA 5MERB 4JFEB 4Z78B 1I85A 4AIXA 4U6VL 1HXYA 1OTTC 3KPNA 3MRFA 1UXSA 4Q2ZB 3ET9F 4FFWC 3TN0B 3MV7B 5GSVA 1G0XA 2A1WL 5M7QA 5EIIB 4UIKL 4Y4FA 1JPTL 3BN9D 3BP6B 3C08H 1MCIA 3LQAH 5BCAA 1M05B 1AE6L 4JHWL 1NAMA 3OL2A 1EVTC 1HWGB 2IPUK 1ZT1B 3FT4B 3NCEB 3OG4B 2ZG2A 2YBRA 3BGMA 3ZDYE 2XQBL 3EFFA 3IDYC 1F4XL 4JZJB 1QRND 3ARTA 5F9JB 1V5JA 2O61B 4ZFOB 1LEIB 5HGHA 3D0LA 5CD5D 1K8IB 3MA7A 4OQTL 2WUCL 3EYFB 1ND0A 4WEMB 1HWHB 3KYNA 3OSKA 1OF2B 3UTTE 2EXWC 2D9QB 4M8VA 3AY4C 4HIJA 1CL7I 2R0WH 5SWSE 5JO5B 4P2OA 3UTSE 1V3MA 1SM3L 3GSOB 3VGEA 5HGBA 5IFJB 2PKDA 3G04B 3OJMB 1D6EB 4K94L 3QNXB 2D0FA 1JUFB 4ONOA 5CJOL 5ACZA 3D18A 4YHNA 1FZJB 5T1KB 4PB9H 1AR2A 2V9QA 3HZVB 3I6LE 5IW3A 2FJFB 3MJ9H 1R3JB 3TBWB 4FHBD 2E8YA 4PJ8C 4OGXL 5IBUB 3U9PL 2GJ6A 3QFJA 4KK6D 3RHWF 1KULA 4TTGA 4R2GC 4PG2A 4NOBA 3GMRB 3Q6GH 1Q9KA 3GUTB 2A9NL 5CJXC 4JFYA 1UCTA 4UU9B 1NEZG 3SQOL 3QAZB 5IF0B 4AT6B 1FO0H 4MLSA 4OZGE 3MRLB 1N7ML 3PWVA 3FOLB 3KJ4C 5GGRA 1OTSC 1NBYA 4JR9H 3C5ZB 4K23L 2FD6H 1YJDH 3GI9H 4HS3B 3MRHB 3Q3GA 4LPVA 4XBPB 4NGHL 1A7OH 3L3OB 5DHYB 1CGXA 2YPVH 3SDAA 3RGVC 1YPZE 3CDYA 4UQ2B 1BM3L 3L9RA 4LNVA 1VEPA 3RTQA 4D8PB 2HT3C 1TNMA 2MWCA 4DJMA 1RUML 3DVGB 2NZ9D 1YDPB 5DD5H 1JHTA 5J6HB 3UDWC 2ESVB 2ZUVA 4XRCA 5EOQH 1BFVL 3MRPB 4ZDHA 5F1IA 1XF3B 3BIBX 1TCMA 4JANB 5E6IA 1ZGLB 4PJIE 3HE6A 3GRWA 5D93B 3GMQA 2R69H 3KPQB 4ZSOA 2Y5TB 3VMOA 3O4LE 3P73B 5KSBF 4OD3H 1J8HB 4YFEA 3QDHA 5EU6B 1SEQL 1Z5LB 3MCLL 2FZ3A 3OTTA 3VDBA 1MQKH 4EKXA 4PJ9B 1JMZA 2MHAB 1F8TL 4CU8A 1JV5A 2P5EB 3TBSA 4XPGH 5DJCB 5KSAB 1HCFX 3QH3A 4G6JL 3U1SH 4GQ9H 1JL8A 1NEZA 1J10A 1MCRA 3GGWB 1HH9B 5CCKL 4LLAA 4FFYL 4QTIL 3O6LL 3VE0B 1XGRA 1J1OL 4F58H 5I2IA 5T1LB 1UACH 3OG6B 3WUZA 5BS0D 5D7LD 3EOYG 4QHKJ 4ZPVA 3O41A 4KMLB 5ESAB 4PY8J 1FYTA 4BM7A 1CN4A 2DM4A 3ZSTA 3DX7A 3GSNL 4K8RL 5LAXA 4U6VH 5HYSG 5IUSA 5JW5A 4ZAKC 1ZWIA 3VFUB 2Z92B 4L3CB 1ACZA 4NNXB 4NRZA 1G7LA 1VADB 4LCWA 2DLFL 4ZOBA 5FO8A 2EXYC 5C07D 2A1WH 3QQ3A 3V5HB 2JB5L 5I1KL 3MUGB 3DXAE 5ACMA 1AE6H 3ES6A 3GBLA 4TNWK 5E8EA 1NSNH 5FCSH 4Y88A 3RKDC 1I7ZB 4LVHB 3VXRE 1F4XH 3BP4B 4M4PA 1HKFA 3D0VA 2FR4A 5BRZE 3ULUH 4WWKC 4A6YH 3BDYL 4GAFB 4OQTH 3V0VB 1ZSDB 3GJFH 1BHGA 5ITFB 3AB0C 1OM3H 3FJTA 3ARYA 1BJ1H 2XIDA 4XPHL 3UTTD 2YWYA 4LSVH 3VFWB 2H26A 2D31B 4ZUSB 1G7JB 4XH2B 1CZ8L 5SWSD 5IEKB 4PJAE 3UTSD 4BSVA 3RL1A 2BMKB 1SM3H 4RAUB 3QRFM 2WLZA 1KC5L 4GG6E 2DOCA 1T0MB 1I7RA 5I30L 1DN0B 3T77A 2DQJL 4DTGL 1F6AB 2NYYC 4OZHB 2X4TB 2FHBA 4Y2DD 4LCIH 2J4WL 2BXYA 5IVNA 2Y72A 2J1KA 1Z9MA 4OGXH 3U9PH 7CGTA 2H1PL 3CVIL 3U0WL 2VZVA 3VXNA 4CRPA 1NDMA 3MBED 4JB9L 1QSFA 3FQRA 5KSBA 1IAIL 2HVJA 1CBVL 3KXFB 5JA9A 4OZHF 3OAUH 2APTA 1I9RL 1BQLH 2A6JB 1Q9OB 1E6OH 1N7MH 5GS0D 1KIRB 2D7TL 4N0CC 1SJHA 5I19H 3N9GH 5T1DL 4XP6L 3RNKA 4MCYB 5JQ6L 4KUZL 5D1QC 4FFVC 1HCVA 3TZVB 2NMSA 5E9DE 2YPLA 3ARFC 4WTWA 1BM3H 2XOTA 5LBSL 4UINH 1WUNT 3MOBH 2X70B 5FA3A 3AFLA 4MNQB 1IGCL 1J87A 5BQ7B 3VRLE 1AHWC 4MDIB 4HCRA 1MCWM 3SGEI 3TNMB 1HYSD 3ARBA 2AGJL 3QDJE 3ZLQC 1BFVH 1NUFA 2H2PC 4OD2A 3T0XA 1B2WH 5K9OA 3INUH 1NANH 1XZ0B 3W0WA 4M7LT 5C08E 5DK2A 3G6JE 3G08A 1L6XA 4R9HA 3ZDZF 8FABA 4NO3B 4PJEF 5C6PB 4MNGB 3S36H 4O02H 4I2XB 1CFSB 2C1OB 2BY3A 3SKOB 3ZTNL 2XTLA 1FGNH 3QIUD 5B4MC 2D0HA 2PXYD 2DWDA 4P3DA 3LPGA 3CDCA 3P4MB 4XNZB 5DEGB 3NZHH 1BVLA 1M4KA 5F9WC 1JWUB 4N8CL 2KKQA 1BZ9B 1IC7L 4G6JH 2YD1A 1AXTH 3NCYP 4NCC2 4M93C 3SDDD 1KPVB 1DVFC 5EORH 1LO4H 2EDDA 4FFYH 2QQQA 3T09A 3O6LH 4Z77A 5DXWA 2G75A 1BQSA 3VH8G 2Y6SD 1F90L 1T4KB 3L1OL 3HE7C 5DWUL 1DEEA 5ID1B 3CFEA 3VFRB 3IRZA 1MCPL 2GT9B 1KT2A 4R97B 1DE4B 2RFXA 5CEZH 4XWOC 2VXUH 4ZXBA 3GSNH 2XFXA 1H5BC 4YHPA 5KOVC 1LD9B 1FVEB 4MAYC 3BT2H 3QXTA 4J8RB 5KVFL 3OMZA 5F97E 1AQDA 4FTVD 5GQBA 2A6DB 3SKJH 4Y5YA 4LSUL 1XAUA 4PV9B 5ESVA 1PY4A 3DXAD 2CKBH 2ZSWA 4X80H 2P8MA 3MLTA 5C0IA 2RJMA 4I5BB 2IH1B 1MRFL 2APFA 2HG5B 3U82B 4OGYL 3OJVC 5CGMA 3DO7B 2CQVA 4PJGB 4UOW0 1CLOH 2R15A 1CFQA 2NY6B 1G7PA 1MUJB 1CG9A 1VFBA 1DLHA 1KBGL 3BDYH 4M9PA 4IOFC 3TGXA 4ENEC 1PZ5A 4KKNA 5T3ZD 1TTUA 3WCYA 3BE1H 4N9OB 4YBHA 4XPHH 2Z91B 3S3SA 5D72H 2B0SL 3BKML 1IGFL 3CPLA 3HTLX 4ZFZA 4D3CL 4JFQB 4LPUA 2AABL 3PQYA 1CGVA 5DDHA 5TE4L 4P2QA 2A77L 3L3GB 2YA1A 4PRIA 5DMYA 4QRUA 5L2JA 1P7QD 1KC5H 4JFHD 2NY4C 1Q9LA 3PABB 3EDJA 4ISVA 2J3SA 3RWHA 4DTGH 1YECH 3LS4H 4UAOC 4HUVA 1MH5B 1X9QA 3VH8A 2CR6A 1VERA 5E5UB 2J8UB 3DUHA 4D9LL 4NHUA 4MHHI 4XP1H 5BZDA 3U0WH 1TZIA 4KJPC 4HKZA 4OI9A 3WJLC 1UCBL 1AO7D 1N6VA 1T7ZA 1MCCA 4N5ED 3MR9B 4PJEA 1IAIH 2WBWB 3WN5A 3ZDXE 4DUVA 5L0QB 1CBVH 3P0YH 3ISWA 2VKXA 4MJ5A 4WU5A 3WEXA 3MLPA 3V52H 1JFQL 5EZLA 3AAZA 1T5WB 2D7TH 3ARWA 4AQ1B 1ROWA 1HXMA 2DQIL 4HGMA 4P5TB 5T1DH 1GC1L 1K2DB 3W39A 4H0IA 2NY3B 3VFVA 3PGFL 5I1CL 3GSXB 2W0PA 1S9WB 2AJUH 5JQ6H 4HAGA 1H3GA 5IG7A 1KIPA 1DANT 2GUOA 4IRSC 4F7EB 1WVZA 4WGVB 1E27B 4U6YB 4MVBD 1MOEA 1RJZA 4G9FE 1UA6L 4XTRD 3HNTL 3TV3L 1X5HA 1XCTA 1A7PL 3L3HB 3WUWG 5HYQB 4RMTA 3D48R 3GNML 1C1EL 1MCOH 3FFDA 4Z76B 2BY2A 3DYOA 4M1CD 1OPGL 4YC2B 2Q76B 3S35L 3TESA 1U8HA 2AGJH 2VDOL 3QDJD 5E5RB 3VXMD 4G43B 4YQXL 4JM4L 1DZBA 1J88A 1MLCA 4BA8A 5C3TA 2A6KA 2UUDH 5MENA 1GXEA 1RZGB 4C83A 3L3DA 3KLAB 3I50H 4L4JA 4YLQT 1KJ2L 4QRRA 5B8CC 4M5YH 2CD0A 2IF7A 4RGOL 3S35X 3EDKA 3ULUF 1RZKL 4MD5B 3ZTNH 1F97A 4FQQB 1IEBA 5ERWB 1FORL 3RP1A 4YHZL 3WFZA 2GYSA 4JFPA 1T83C 4R4ND 5ILTL 3N06B 4HGWA 1M6OA 4N8CH 4QWWC 3V0WH 1P2CA 1HZHH 2NY5C 4FOMA 4WUKH 4LLDA 4M7ZB 1KJMA 3LN4A 4MQSB 1BZ7A 1ULVA 2XTJB 1VENA 2HA1A 4PPTA 3BZFA 2VDQL 3UTQB 3IT8D 3G5YA 5F3BB 4YHLH 2R1WA 3QIBC 3WNKA 4UDTA 3L1OH 5DWUH 4I0PB 3K2UH 2C4FT 4U1GC 4JRXE 4LRIC 2PW2A 4ZFOL 3B5TA 1U41A 2FDBP 4HS8L 2OR8A 3ULVF 4MS8D 3D3VA 4LPYA 2AJZB 4HZLB 2W07A 1XGYH 1RQ5A 5JPMB 5L8LB 1QSED 3SGKA 1Q1JH 5HVHC 5I1EL 1HDMB 3VWKD 1RV6X 3WUWA 1U93A 4O2FA 3D39A 5FK9B 2PCPB 1EO7A 4NQCD 5KW9H 3OR7B 3ARXA 3O6FD 4ZD3L 3MRNB 4J3WA 2AP2A 1IM9D 1NL0L 3HUJB 5E8NB 4FQXA 5A3ID 1ZT4A 4NO5A 1DR9A 3FQXA 5TGBB 4MX7B 4OGYH 2F53D 1PY9A 3NGBC 3MTRA 3C9NA 1P7HL 2W9EL 3V9FA 4AEEA 5BV7C 4HIIA 5BVJA 4X7FC 4GH7B 1RIHH 2B1AL 1WBZA 4QHNB 2P48B 4GBXC 4PGEA 1DBJL 3NCCB 4GKOA 3ME0A 1N8ZA 3JWOH 3OKYA 3QWRD 4UQ3B 5C09A 5FUZH 2B0SH 2HT4D 1IGFH 3DSFL 5FM4A 3TIEA 2AABH 4AMKL 4E5XA 3ZE1E 2OK0L 2A77H 2A74A 1I3RB 1LEGB 3MACL 4OLEA 1EH9A 4OLWH 5DFVD 1UWXH 3E6HB 3HMXL 2CRMA 4GRLD 1DDHB 4X5XB 5FKAB 5JXEC 3PGCA 3IDJB 2DLEA 3SE9L 5I8OH 3WKMH 3FB6A 4U6XA 4HG4K 2JCCA 1MFBH 5BXFA 2GEEA 3BGFB 4I3RH 4LU5L 3STLA 1YC8A 1FZOA 4HC1L 3TYGL 2W60B 3FT2A 1FFPA 4JM2B 2N56A 5DRXB 4DK6A 5DRWA 1PW3A 4PFEA 4A6YA 2OL3B 4OQTA 2FBJL 4H0GA 5JHDD 1WBYA 3GJFA 1ZVSA 2BVEA 4AIZA 5FCUL 1GGCH 2OBGA 1JFQH 2D4DA 5FA4B 3NPSC 4PY7B 4HBCL 3U79A 4F7PA 2QR0B 4QOKD 2DQIH 4JM2F 5F9OH 1GC1H 1I1YB 1QSVA 1TQBC 4GQPH 5D4QA 5I1CH 4ZS6C 3U30B 5F72S 3MGTB 5EUKA 2BSRA 4PG9B 1YEKL 2COQA 4CJ0A 4OZ4A 4BH8A 4QT5B 1CXLA 4X6EA 2AK4D 1HQ4B 3QJFA 2NW3A 1A0QL 3ECBB 1NMBL 1SJVA 4ZUWB 2ICCA 4K3DL 4JRYE 1F3DJ 4PGBA 1FIGL 1ORQB 2ICWJ 2PTTB 4WHYH 1C1EH 4FQJL 4DGIH 1YMMB 4K7PH 3S35H 3BZ4A 4TPRH 2B7DT 5DT1L 5AUMB 2MQ3A 1DQQA 3MLVL 3D85A 3BPOB 4WGWB 3A6BL 3RL2B 2C26A 1FC1A 3OZ9L 1CXEA 2IGFL 1KJ2H 2OMBA 3G9VA 2HFFB 2NY1B 1RZKH 1MIMH 4DAGH 1S5HA 1R3HB 5AAMA 2UZXB 2RQ8A 1E28A 4Z7VE 1QBML 4ONGH 1J0IA 4NQEB 1A9BB 1RI8A 2DBJA 4JY5L 4JFZL 3I6KA 4DWHA 4HSQA 2IEPA 4F8QA 2XWBA 4RQQA 2VDLH 5ILTH 1ITBB 1LO5B 4U1JB 4Y4FD 4YK4C 5DQ9A 5DO2C 3JTTB 2BVQA 5FYLH 3MV9E 1DQML 4OTXH 4HLZG 4TNVK 4P4KA 2N4IA 1LE5B 5HDQL 5D2NB 4JGJA 2VDQH 3P9WB 4WI7A 3LRSB 4AM0A 5C1MB 2DS4A 5C2BL 4LCYB 3QCUH 4BQBA 2EE3A 3MNZB 4I18C 4MD0A 1G7HB 3DVIA 2EDTA 5HHME 4NM8L 5FDYA 2I25N 5E08L 4S1DD 4JZNA 3WIIL 5HYJE 2WBJB 4N90E 1LE9A 1NMCC 4H0HB 4P2RA 3P4NB 3L7EA 1YEJL 2W9DL 2Q86A 3WNNA 4P2OD 3GSVB 5FGRA 3CFBA 1IKNC 2KQMA 4D0DA 3FB8A 4OUOA 3QIWB 4N0UE 1RHHA 1C5DB 3HG1A 1NL0H 3MO1B 5HSFA 1IEAB 2G2RB 4XXCA 4OJFL 5CHNA 1GZPA 4ZFGH 1UH2A 3EYQC 5FDWA 2B39A 3CXHK 4ZOAA 5TDOB 3QRGL 3TT3L 2GJ6D 3QFJD 1HHHA 2VH5L 3A6CH 3C5JB 4NZUL 1OGTA 4MAUL 4YHML 5IV2B 1ACYL 3GSUB 3OKDA 4GRMB 3RAJH 3LSOB 3NBNA 4DN3L 1FJ1A 5LXGL 5DSCA 3RQ3A 4X4YA 3G6AB 3RUGE 2OJEA 2MNUA 4QGYA 3VMNA 3K1DA 5ICYB 2H9GB 3MRGA 3GSNA 3GIVB 5GGTL 2CIKA 1WAAF 3HC4L 3M1BA 4O51B 1A3LL 4RCAA 5JOPE 5EO0A 4HKXB 1TDQA 3MREB 5GRVL 4XI5D 5EU3B 3SDAD 2OTWA 3QEQA 2CKBA 4LU5H 3TVMC 5HYFA 1UWEL 4HDIB 4HC1H 1NKRA 3I3EA 3TYGH 5BMFL 3FO2B 2A6IA 3B6SA 1A3RL 1F4HA 3JWDH 3RTQD 4QHKI 5D1XC 4NKOB 3SKMA 5C0JB 1FL3B 3BFOA 1QBAA 5DD6B 4PD4J 4WI8A 2B5IC 3EYVA 5IJVA 4AIOA 1C08B 2NZ9C 5EN2A 1IQDB 5FCUH 5JNYB 1R5IA 3JUZA 4WY7L 4HKBA 5DJAA 5E6ID 4BZ2L 4V1DA 4MMZC 3HE6D 2NY2C 3OKOA 3QDGE 3H9HA 1IQWH 1XGUB 3UTZA 1GOGA 1QRKA 3ZKSD 4RMUA 3QCVL 3QEGL 3QZWG 4PJ7B 3K8MA 2ORBH 1ODAA 4OCRH 4NZJA 4DKFL 1WTGT 1NMBH 1ZHBA 4KZEL 2VXSL 1SEBB 1TJGH 1FIGH 2GCYB 5KAQF 3ILQD 3PWLA 1U8QB 4PJ7F 4GW5B 4TOYH 1O0VA 4X7TA 3KHQA 5DT1H 3RI5K 2APXA 4DEPC 4FMFA 3MLVH 1KJ3L 4K71B 3PHQB 4LVOC 5FYKE 3V6BR 3MGAA 2L0DA 2XQYG 1SJEA 4OFYA 2IGFH 3GMOB 1F00I 3JV0A 2V5MA 1D6VL 1FYTD 1S8DB 2GK2A 4GKSA 5T1MA 4DGVH 5C0EB 5IMOB 3DV6A 4O2EB 2FGZA 3E1F1 1BWWA 2M26A 4WV1C 3HS0B 4U1SA 4TULH 3J8F7 3DLQR 3WFDL 5I16A 4CMMB 4HUKB 5TPWL 4RGND 1P9MA 3N1QC 4WWID 5B3NA 2J8HA 1C16A 2YXFA 1DQMH 3WXVH 2FATL 4L9LC 4GKNB 3PV6A 1V3LA 5FO7B 1T7VA 3RWFB 3VRIA 3UJIL 4HWNA 1MFEH 2MJWA 4L8CB 4TSCH 1NKOA 1K8DB 1JGUL 2ZSVB 5A1AA 5F21B 5L8JB 5C2BH 5LGKA 3DX6A 4PRHB 2H8PA 4LVNB 5GRJL 3QZWA 2IG2H 4ETQB 2E7LC 2DQCL 4NM8H 2WANA 4LARH 5LGJA 3WIIH 2XZAL 1CYGA 4NHCL 5J11C 3B9KB 2CK0L 3CLFH 3SE4A 2MFNA 2P5WE 1YEJH 2PYFA 4L9DA 2W9DH 4RRPG 4R7DA 3ALWA 4JFFA 2MTPA 4PGCA 1BLNA 5F6HJ 2VLJE 4Y4KA 4DFHA 2BSTB 1BX2B 5J1AB 4DVBB 4XVUD 5TE6H 3GMPA 3QO0B 4LMQE 3BWUC 2R29H 5CEYB 2ZOLA 5DD3L 1QUNA 2VAAA 4HMEA 3P4LA 1QFUL 3IKCA 4C55A 2VIRB 2R9HC 4YPGB 1JGDB 2X4QA 4HH8A 3RGHA 5D7JC 3LIZL 4NZUH 1PKQA 5D6DC 4MAUH 3FN3A 1ACYH 1CU4H 1X5JA 3M17A 1QSFD 1AGCA 3MBEC 4JFOA 1MHPL 4HAFA 1Q0XL 1X44A 1CFBA 2HRLA 1U6AL 1IAKB 2OLDA 3SBWA 1DBKL 2ZOKA 5J12C 3ELAT 3RWGA 5GS0C 1A3LH 4F3FB 1CDHA 1NGZB 4TSAL 3O11B 1A2YB 1YNLL 1YNTA 1NC4B 5DRNA 3LQZB 4I3GA 1CE6A 3OJDB 3CFKB 1KN2L 2P4AB 3D9AL 5HHPA 5E95B 4V2BA 4P5KA 1KCVH 1CL7H 2YPLD 4PRBB 4LLQA 1CVSC 1UWEH 3AM8A 3T0EA 1XGTA 2QHRL 4E9LA 4NM4H 3VXUA 4AY0A 4IS6A 4LCUB 2EYTA 4LEOA 4CJ1A 3NAAL 4N9GB 5C0BB 3C2AL 5ADOL 1CICD 1KPRA 3CH1B 1ES0A 3ARBD 3PP4L 5EZJB 2X5PA 4KQ4L 2NLJA 3EZJB 4NN6B 1UM6H 3RHWK 4J7RA 3TBVB 3L6FB 1D5ZB 4WY7H 1ZAGA 3DRTA 4NCC1 4BZ2H 3IJSB 2CH8A 3W0WD 1XF5B 4F15C 5GZOC 2O5YL 5DTFA 5AZ2L 4WW2C 1YC7A 1UB5A 1DBBH 5TF0A 4GMSH 3T4YA 2X4NA 3U46B 4LLYA 3RZCA 3EFDL 3QCVH 1T80A 1ZS8A 3IFOA 4KHTL 3QEGH 4PJ8B 2DWEB 5CZKA 1NGWA 5GS3A 4AYFA 3RIAF 3BW9B 1AIFA 4N0RA 4N8VB 4NUJB 1UG9A 3MNWA 3IJYA 1FZKB 2PXYC 3G5VA 2MPAL 1QEWA 5CSZB 1FH5L 2PN5A 1W72B 3SCMC 2PYEB 2VZTA 3LKNB 3QUYD 2XG5A 4Z7QE 3WFEL 4CVXB 1BECA 2FHFA 1UENA 1A6UH 1X4ZA 4A2MA 4O5LH 4ELKA 4PREA 3RPIB 4OSUL 2NXZB 3U36B 3CSYB 5E99L 4FABL 3LOWA 1D6VH 3BQUA 2DL2A 3FFCA 3CIQA 5D5ME 4LLMB 2VQ1B 5JORA 5LGHL 1KTLA 5BJTA 1I3UA 1R5WB 4LLUA 4DZBB 4ZXBD 1NC2B 4GUPA 2HTKC 3ZKXB 1B0RA 1KJVA 4GAGH 2VDPL 2ZCKL 1PBYA 2QHLA 4L3EA 5FO9B 1T7YA 2MKWA 4X9IA 4D2NA 5J1SC 2AK1L 2GAZA 4P59L 3NTCL 2JTDA 4FQ2H 3L3JB 1XF4B 5EO1A 1MPAL 2X40A 4FS0A 7FABH 4RBPH 4QRQA 3WFDH 3OR6B 1WSST 5TPWH 3RDTB 2A2QT 5J8OA 4LPXA 1KCKA 1O7VA 1U3HC 1VACB 2F54E 5E2UH 2BERA 3VGBA 3TM6A 1ORSA 2IPKA 5F7KC 3ZE2F 4KJWD 3D25B 4XGZB 3PDGA 5TQ2H 5IVXF 1NGYA 1F6FB 1JGUH 4QHUB 4MCZA 1G0YR 1BD2B 2RCSH 1X7QA 1G7MA 4KK9C 4X6DF 3QUXB 3LEVH 3RU8H 4L4VA 4YZFF 2R2HA 2ZUSA 3HN3A 1WCBA 1PLGL 2I07A 5HPOA 1I1AB 1UVQA 1BIIA 1HSAA 1KJ2A 3SE3C 2CK0H 4M7JL 4CADA 5DJDA 4P2QD 1MRCH 2W0FA 1TQCC 5EUOB 4PRID 5DQDL 2LE9A 2GW5A 5IBUG 1OARH 5D1ZA 4KJYB 5DURB 5LCVL 2IAMA 2LQRA 1A6AA 3LPFA 3PDDA 1K4CB 4HFWA 3QISA 2H6PA 1I4FB 2IBZX 4JFEA 3QQ4A 3C60A 1UXWA 5BVPL 3VDCA 2EIZB 4YAQA 5IQ7L 1HOCB 1QFUH 2DJSA 3MRBB 1L9MA 3K74B 3LIZH 5E5MA 5I6XB 3BDXA 2P44B 4TYUA 3GEWB 1M05A 3H42L 1XFPA 4G6FB 4I4WB 2IBZY 1RZJH 3FT4A 1U2CA 3N85L 4Q58C 1MHPH 4WFHE 3NPZB 2WV3A 1Z0NA 4G7YH 4LQFL 2HKHL 3NIFE 1U6AH 3HI1B 1D7FA 5CJQL 1T66D 4WHDA 4ZUTB 3MCKB 3H9SA 1X5KA 1OGAB 3QUZA 4QNPF 1HILA 5ID0A 5AAWA 1C5BL 5ANME 1S9VB 5HYIA 5DMKB 3VFNA 4FQIH 2W59A 3J7HA 2VLRE 1CI5A 5C8JB 3HC3H 1XIWC 4LGRB 5I15H 2H3NB 1DUZA 1YNKL 3NAAH 4BFIA 2XPGB 5HDBF 1E6JH 3TNNB 5C0GB 1JPST 2FJFA 4KQ4H 5CWSB 2VLKA 3WE6B 3P9LB 3HFML 1JPFA 4QHLA 1IC4H 4R6UA 1T2JA 3VGDA 3LV3A 5MEND 2O5YH 5AZ2H 1NMAL 4M7KH 4YX2L 4QRRD 4Y19B 2ZJSL 4K8RC 1HHJA 4S10A 3CX5K 4EVNA 4KHTH 1CF8L 1B0GB 4YGVA 3U0TA 1QKZL 1R3IH 4OBRA 4UU9A 2E6PA 2BVOB 5JW4R 1JGEB 3F7VB 4HQQH 2FYYA 3KWWA 4ORGA 2QKIB 1RD6A 5IVXA 3NACL 2A0LC 3NIGE 4LIQH 1H15A 1MJ7L 1IGJB 1HH6A 4UT7L 4APQA 3VI4F 1G9NC 4HEPG 4YXHL 4X6DA 4HC1A 1FSKC 5GS1C 1C7SA 1FAKT 4KROC 3WFEH 5KS9F 3FO1B 4F9PA 3KR3H 1YMHB 3ALPA 4KDTC 4OAWB 4QRTB 4XX1E 4KI5C 1CD0A 4LLWA 5IESL 5KVGH 3ZKNC 1JF5A 5FUOH 1MI5B 1Z0MA 3TIDB 4FABH 4HWBH 3SGEH 4PLNC 1HHIB 1SYSB 1S7RB 1DBMH 3D3VD 3MRPA 1A9EB 3IDMB 4PRPB 4OT1H 1AGFB 2R0LL 2AK1H 1A6TB 1T7WA 1HEZB 4Y5XB 3ARGC 2OJZL 3KS0J 2HWZH 2VUYA 3D1MC 4NKMA 3VWKC 2LVCA 3K81A 4EI5C 3PXHA 4CMHB 5K9QG 3NN8B 3EGSA 1N6QH 3BP7A 2Q7YB 5HI4C 3RVVC 3LN5B 2GY5A 4XBEL 2LTQB 3QG6B 4FQXD 2V5TA 5B21A 3AREB 3B5HA 3DRQA 2BJML 2Z31B 1I3VA 1SJXA 3CFJA 4WVRA 1M71B 4GG8B 4JE4B 5LG1A 3U48A 3T2NL 1S3KL 1GL4B 2E3VA 5I1JH 3RNQA 3VA2C 1INDL 4HG4J 1N2RB 2ILLA 4H8WH 1PLGH 3DX8B 5C09D 4JQXC 4M7JH 1CS6A 1E4XI 1G7IA 1IGTB 5M95B 4TUJB 5DQDH 1F4YH 4UTAL 3T8XB 5LCVH 4KRPD 1IFHH 2XN9E 4ODHL 3PWPE 1TETL 5IMMA 4JPWL 3W5NA 5FYJE 5BVPH 4XPTL 1ZA3B 4UT9L 4G5ZL 4MXQD 4JO4H 3VFUA 4MJIE 3MV11 1MCHA 5IQ7H 1GHFH 3MUJA 1OSZA 1T1ZB 4LGSB 5ETUB 1CFVL 5J06A 5ESQB 1H5BB 3OKLB 2AEIT 4NC0B 3H42H 1IL1B 4OCLC 3TA3B 3ULUD 4NQXB 4U4BA 5DUPH 2ITCA 3N85H 2EH8H 4OM1H 5L7XL 5A2IH 3QI9B 4NWUH 4KI5E 3BP4A 4LQFH 2HKHH 1GJIA 4KC3B 2IANA 1A6WH 1EO8L 4ZMAT 1VEOA 3NZ8A 2VZSA 3B8SA 3AU1A 2YKLL 4J23A 2IMMA 3LH2H 3MRMB 15C8H 4YXLL 3KPMB 1MFCH 4G6MH 4PJDB 2G9HB 2HKFH 5KS9A 2I9LB 1A1NB 3H6JA 5C0AB 1SYVB 1G7JA 3V8OA 1MFAL 1C5CH 5CJ8A 1FDLL 3JV4B 2YD3A 1P69B 4NSKB 4M1GL 1SBBA 4M8QA 4LF3A 4G6AC 4HV8A 3SQBA 4HFUH 5F1OB 4PJDF 3FONA 1NDGA 1XCQA 3GKWL 4Y1AE 5EB9A 2BNRA 3D85D 3SKNA 3L3IA 2PO6B 4IHOA 4UAOB 3OKKB 4JFXA 4DZ8B 1NMAH 4QXTA 4HJJL 1IGMH 2ZJSH 4U1MA 4RFOL 2KH2B 2UV3A 5A16B 2HJLB 5E00B 4MLIA 1QKZH 4PUBL 4FZEH 2AJSH 2YOCA 1QO3A 4QRPE 5DMGC 1EEYA 4O2CA 5T5NF 4L8SC 3MUZ1 4NQSA 2VXTL 1PAMA 3VRJB 4J1UB 3NACH 5EPMB 5TQ0L 5IW1A 2DI9A 3DMMA 4UT7H 1CK0L 2LU7A 2H32B 4HUUA 4M48L 3MLUH 2X42A 3D2UD 1NGQL 4HUMB 4JEGB 3FRPG 2FH6A 4Z7WE 4XNMB 2BNQE 2EIDA 1UJTA 4P4KD 1EJOH 3RWIA 3QUMB 2C7UA 5DUBA 3O9WB 1OAXH 4PJHF 3VFPA 5I75B 1JHKL 5IESH 2HLFC 1N0LA 2YC1A 5E2VL 4FA8A 1FZMA 5FECA 2VDKL 1U58A 2XA8L 1I7UA 3FO0H 2AJ3A 3O4OB 1J11A 1ZLVH 2GY7B 2Z93B 3CXHJ 3I6GB 3C5SA 5FUCC 4P2RD 1EV2E 1NLBH 4XP9H 1QPXA 3BXNB 2F74B 2OJZH 3UXFA 2W91A 1HINL 1J5OL 4FNLL 3BHBB 1MVUB 4DCQB 3TO4B 3GJFK 4ZTOL 4WNQA 3VXQB 4Z7OE 2CLZB 3EJZD 3HG1D 2C3VB 1QLRA 3QPQD 2W65B 3EO1B 4G8FB 2AV7A 4FQLH 5I8KH 5KZCB 2AXGA 3R06A 2J5LB 5DEGA 1JHLL 2RHEA 4P46A 1JF1A 4Y4HA 2ARJQ 2UVFA 4ODVL 5D7IA 1B3JA 3VGAC 3WL9B 3MLZH 4N8PA 3T2NH 1S3KH 3PWNB 1AP2A 2IC2A 3ILPB 1INDH 1KACB 4TQEL 4FP8H 2C5DC 1LO0L 1TNNA 2ID5A 2HJKA 4QLRA 1ONQB 4BYHA 4H1LB 5DJ6A 3MROB 1VGKA 3CXDL 2WLYA 5F3HA 4R0LC 3UBXI 4Z9KB 5HHOB 3DETD 2DQEL 4NPYA 5SWZB 4DFIA 3FRPA 4L29A 2FL5A 2I60L 2XN9D 1MHCA 4ODHH 1TETH 1QFOA 4JPWH 2BXZA 3U7WL 1A4KB 2QSTA 3V7AG 4C56A 4XMLL 4G5ZH 2YPKA 1KFAH 4P9HH 4ODUA 3UJTL 3QEQD 5INCA 2DMBA 3SDAC 1Q94A 5C92A 3IXAB 2ARJA 4M61B 5HD8C 5H37H 3HB3C 1U95A 4X6CE 4YDVB 4PV9A 5TF1H 2WWMD 3QDMA 4JDZB 4X4XB 4P5MA 4G42B 3DX9A 4RIRB 5ISZB 4PJXB 1B0WA 5GJTL 5L7XH 2C4FU 2V2WB 5IHZB 1ZHNB 4PJGA 1OOAA 4MXVF 3ZYOA 4L4TE 4V1DD 1EO8H 4LAQL 4MDJB 2DN7A 2NTFB 4LPWA 5T5FL 2BP3A 4W4OA 1U8IA 4HXAL 1RUAL 3MOAH 2YKLH 4P23B 3VXTB 4N1CA 3UTOA 5FUCE 3KYKL 4JREC 3SDCA 4TVPH 1KN4L 4MQXC 4XXDB 5F8RC 3AS2A 3IDIA 4PJHA 1IGYA 4BQ9A 5BZWA 1URLA 3DIFB 5IMKA 3GMNB 2CIIB 2APVA 3PABA 1MSPA 3TN0C 4FQCL 2P24B 1I9IH 4KVNL 1B90A 3ILQC 3MGOA 3LDBB 5C0CB 4IOIB 2DIAA 2NX5B 1CGSL 1W72L 2M2DA 1FPTL 4LMQI 4YHOH 4E41A 2FJHA 3BRDA 4HK3N 4JZJC 2I24N 4X8JA 5F6HI 2OR7A 4NQDA 3F5WB 4LKXB 4Y16A 4WO4B 1D3CA 2NXYB 5IHUH 4OFYD 1GRWA 1KLFA 2P43B 2YSSA 3TJHD 1OTUC 2GKIA 1T5XB 5C0RH 1DFBH 3CFCL 4RWYL 4MWFA 1WITA 4AENA 4QRPD 2QJDA 4XZUA 1NCBL 1MHEB 3NIDF 1S7SB 1YEGH 1QSZA 5HGDA 2VL5A 2VXTH 3TPKA 3JV5A 4XVJL 4UOW1 1RK1A 4AJ0A 3S3PA 3K4ZA 3MYJB 3KLHC 4XPBH 1FVDA 4M48H 1YQVH 4PJBA 1Y0LB 5HVGB 4F7EA 1NFDB 4HIEA 1D9KC 2CJUL 1REIA 5LQBL 5J0BA 3CZJA 5L9DL 1TQBB 4HWZA 4K2UH 1T03L 2DQFA 5HYEA 4HULB 4WI4A 5IVZB 1T0PB 3VFMA 3GMLB 3TLRA 5F89A 5H35A 1DLFH 1F42A 3PL6A 4ZNEE 2XA8H 4GMTL 4ZYKB 1QOKA 4V2CB 1NFDF 3WO4B 3W9EA 3NFPB 5KG9A 5KANG 3OXRA 4YPJA 3UROR 3BI9X 3QAZC 4JFFD 4Z7UA 1H3UA 1J5OH 5F7DA 1LMKA 4ELMB 2YK1H 1AKJA 4Y4KD 1S7QB 4ZTOH 2F15A 3QA3A 4PP2A 3C5ZC 4WUUB 2EYSA 4JFEE 4OZFB 5IMLA 4F7CB 1RZ8A 1WC7B 35C8L 1I8MB 5K33A 5HI5C 4OF5A 5IROC 1T04B 1JHLH 3MV7E 5L2KB 4ODVH 4ZO9A 2D9CA