4OF0A

Crystal structure of syg-1 d1-d2, refolded
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
246
structure length
230
Chain Sequence
QRIVEAPKDTLAAVGETAILTCRVEHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVKSHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGESRSKFEISQETVIAHVNETTQVESSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPNKIEVDSVKLSLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
molecule keywords Protein SYG-1, isoform b
total genus 44
structure length 230
sequence length 246
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A02
3CX5J 4JDTH 5EULV 1D5ZA 2XPGA 3DVFA 4M00A 4MJID 3GK8H 1R0AH 2AQ1A 1SEQH 3KPRA 3NTCH 4K2UL 5J8OA 4H8WH 2V5YA 4MNHB 4R4BA 3QDJA 4ODXA 1MI5E 1QLFB 5FHBH 2DIBA 5EU6B 3MGOA 2GQHA 3F62A 4Q6IB 4YC2B 2PF6A 1JFQL 1PAMA 3EYOA 3FOMA 3AAZB 4HW6A 2GTZB 3QO0A 3PQYB 3P0YL 1INDH 4U4BA 1EJ6A 3RUGF 1CD8A 5IF0A 1CXLA 3D25B 1GL4B 1NBVH 4GMSL 1LQSR 5F7DB 3D39B 4YQXL 5IFJB 3QUMA 4JKWA 5K9KB 1BFOB 1WIPA 4KTEH 1FVDB 4NNYA 2XZQL 3UAJC 5E8NA 3TCXA 3O6ML 4G6AD 4GLRI 3BZEA 3IRZA 3TH3T 5AZ2H 2E8ZA 3K4AA 1KN2L 4PJXA 4M7KL 2HTLC 2D7OA 1FBIL 4JO3L 1FL5A 5DRZB 4J4PC 3VFVA 4P3WA 4R8WL 4BSVB 2ADJA 5I9QB 5E2UL 4ZAKC 1RZGB 1D5XB 1CE1H 4W4OA 3OAZH 2M1KA 4RFNB 4WEUD 1CD9B 4L9LB 4YDJB 3D3VB 3QFJA 4MB4A 5MHSD 3DV4B 1UA6L 3IS1X 4PJ5E 4L1DA 4PREA 4XXCC 4PG9A 4FQ2H 4ZQKA 4XNUL 1RJYB 5HDOA 4NQEB 4NQED 2DKUA 3O2VL 4YIQB 3PV6A 4QF1B 2ZOLB 4ZUWB 4DK3A 5I6XC 1T5WA 3V2AR 4JM2C 2NY7L 1QQDB 1EAPA 1QEWB 2XTJD 4PJCF 4RMRA 4KKLC 1QSZA 2HJFA 5IW3A 2UVEA 4N9GB 1JI1A 2VDPL 2CKBL 1EO7A 5CILL 3VDCA 4AL8L 5D7LE 3IYLW 1CG9A 1KJVB 1BBJB 4DTGH 3Q48A 4DKEH 3AY4A 2FATL 2Y25A 4LL9A 3KYNA 4PRNA 1MJJB 4NCDA 4WW1B 4APQC 1MPAH 4U1NB 1WBYA 5DD3L 3NZHL 5LQBL 3D39E 1F4WH 5CUSH 4YHOL 1HSAB 2NXYC 4ELMB 2YKLH 1DQJA 2WSKA 1EUUA 4H0IA 1CL7I 1LDPH 4XCEB 2B4CH 4GW4B 4OM1L 3HE6C 1I3UA 3FJTA 5D1QC 2B20A 5A16A 3LMJH 3T04D 3NAAL 1A3QA 5ID0A 3LN5B 3WV0A 4HV8B 5HY9A 1E4JA 5E24E 3EW3B 1F4YH 2LQRA 4NM8H 1U95A 2AKRB 5D70H 4HT1H 4XVJL 2AS5M 4S1RH 1U8LA 4ZUTB 5IT2L 2ADJB 4OCLC 5IV2A 2A83A 1IC1A 2XRAH 2FHBA 4LIQE 1KIPB 5IROC 4KRLB 3ECBB 1BQHA 4UNTA 3K4DA 1BLNA 1MAML 1MCJA 2P42B 4QOKB 2IC2A 4PJIF 1QBLH 1RMFL 5E6ZA 1Z9LA 1AD9A 3B8YA 3ARGB 4M6OL 4S11A 4JDZB 1KCRL 3P73B 2I5YH 4HC1H 2NPLX 1YDPB 4XP9H 2V9QA 2E6PA 2H32B 4Y89A 1OGTB 4RMTA 5D1ZD 3OKNA 5DFVC 4K3EH 1JNLL 4F15B 4MAYA 3FT4A 4HXBH 4IRJC 5KSVB 4ONGH 4IOSD 2KZ1B 4ORGA 2B1HH 3MRFA 2VE6B 4IBLT 5ICXB 5HHQA 4YZFF 3MA9L 1T1WA 1WV7T 1ZVHA 4LAQH 2APXA 4WGVB 2AJSL 2V5MA 3QXDA 4JVPA 3NCJL 4L9DA 4OLZH 1DBKL 5I1DB 4ZMAT 5CJ5A 1T04A 3PWLB 5J1AA 1WISA 5FXCH 3GIVA 5K59F 1FQ9C 3AM8A 4EI6A 2VDOL 1KN2H 2Q87A 2EDJA 5D1XC 1QVOB 2FECL 3ULUE 4LEOA 4LLYB 1HEZB 5E2UH 4MJIA 3LKPA 3DXAB 4IMLB 4PTTA 4YR6B 3MRIA 3CDFA 4HF5L 5E8OB 4QGYA 5CIPH 43C9B 1C8PA 3V7MA 3WSQL 2OTUB 2V5TA 5MEOB 4LCUA 5IB5B 3H3PH 1YPZE 3FFDB 5DDHB 1E4WL 3N1GC 4N0FB 3GSOA 2JJVA 4M02A 4OF8A 4C58B 5FUCE 4U2YA 1U93B 5CCKL 1HWHB 5HHME 1BLNB 3BGFB 2C3VB 2Z31C 4IRSD 3BZ4B 4YUEL 1NCDH 5CBEB 3IDNA 4O9HH 4PJDE 3VRJB 1V8HA 5DVOA 3VFGH 3D0VB 2GJZA 3FTGA 4G6JH 4O02L 3QIBD 3VWKD 1VFOA 3KAAA 2I26N 4YHMH 4TSCL 3GO1L 1N5YH 4YX2H 5L2KE 3RX5A 5EU5A 2QR0B 4Y19B 2XKNB 5DO2C 1WTGT 4XNUH 4GBXD 3NH7L 4OZHE 1L0QA 1X5ZA 1QFPA 1SYSB 3PDDA 5IBUB 1AFVH 3SDXF 1F00I 1KTDB 1VFAB 5DR5H 1NANH 2Q6WA 4JM2D 2YD7A 4MJ6A 1HYRC 1YMMB 4U1GB 1YEDB 4L8BB 2V7HB 5DGRA 3VXMB 2ZJSL 4ZOAA 5DQ9A 4IHOB 4H0HB 1IAMA 1RU9L 1B0GB 2VLRB 2E9IA 1EHLH 3TWCH 2ESVD 1CF8H 1I7ZB 4YHIA 5D70L 4ERSL 3KYKH 2ZUYA 1PZ5A 3QUZC 3DLQR 5F70A 3GMQB 1RZKC 2XRAL 3LKPB 4ZAKD 4NO3B 1R0AL 5J7CC 1MIEH 1NKRA 2BJMH 3FO2B 3FO9A 2I9LA 2A77L 5K93A 1EVTC 3WDIA 1MFBL 3STZB 1W0VB 3BPLC 3E6FB 3QBTB 4WFGD 3VFVB 4KU1A 2UYLA 1XMWA 3W39A 4KK6C 5JW4Q 3V5HA 2VLJE 1M05A 1A14H 3MMEA 1CBVH 3LSOB 1NEZB 1INQA 5IBTH 1CGWA 3GJEA 3LN4B 3MRRB 4KJPC 4CNIA 5EZLA 1G1YA 4G8EB 2Z4QA 4V1DE 2NY3B 4XMKH 4NM8L 3E1F1 4POYA 3LQZA 3QPXL 3BSZL 1TVHB 3TBWA 3WBDA 5BQ7A 4LVNC 1S9VB 1GGBL 1YUHA 3T0XA 2J6EL 2ERJC 4PRPB 1FZMA 3QG7H 3DROB 5T5FL 1C5CL 1U41A 3DVGA 1XFPA 3S3JA 3IDUA 4NCC1 2HKFH 3GSNB 1G7QB 2QTEA 2R1WA 4PJIE 3GHEL 3MCG1 1L9MA 1DANU 3C5ZB 5CSGA 1YYLH 4JFDB 4XNMA 5HYJB 3EOYG 1CVSC 5BV7B 3OQ3B 4H1LG 1KJVA 2YPLD 3SGDH 2A73A 4XCCH 1OTTC 2J1KA 8FABB 3RA7L 3MRCA 4PRIB 1PX4A 4K7PX 5HJ3A 5DA4A 1ZHBB 3LVEA 2HVKB 3VXME 3V4UH 4WW1A 3SJVB 3KPNA 4LHUB 1N6UA 4QHNA 2EXWD 1QTYT 1JYWA 1JI2A 5HDBF 3TYFB 5KS9E 3SDDC 2P46B 4QRPD 5HPOA 4U49A 2ICWA 2Z92A 2AABL 3F7QA 5BJTA 3DX8A 1CCZA 3NA9H 5GS1C 5INDB 4PJ9A 3BMWA 3LRSA 3FO2A 4G8IB 4JFYB 3X14A 4QHUB 5EO1B 2VDOH 3SE4C 2R8SL 1WBZB 1Z6JT 4QRUA 4BQBA 2BMKA 2H3NA 4LSTH 4CUCA 5T1LA 3FT3B 5F1KC 5JNYB 3W9EB 2RHEA 1F11A 2XY1A 3GRWA 4IRZL 1UJTA 3GSVB 4G6FB 4NJAH 3GJEB 3S5LA 4JM4H 4PJFA 2EYTB 1AE6L 2DWDA 5EZLB 1DQDL 3M45A 5CUSL 4YHOH 4FFZL 3ZKQD 2BNRB 2YKLL 5GISH 2AXJA 2RGSA 4L8DB 3RTQA 2YEZA 3SGJC 4XX1E 3BKCH 2AK4B 2CK0H 2D2OA 2BSTB 1HKLL 4GSDH 3B43A 3MRGA 5GGRB 3ROLB 3SE9L 1WT5C 4P3DA 3UBXB 1NQBA 5ADOL 4P4KD 4GRWF 4HUUA 2Q8AH 4GRLD 1LO3H 5E6ID 3ISWA 1A9BB 4KJYB 5IT2H 1WZ1H 1G7HA 1QSEE 4GAFB 5JXEC 2VUOA 4PYGA 4J3WA 4ETQA 5GZOD 3SDXE 2CO7B 4OGZA 3TWCL 3AGVA 3X12B 3PNWB 4F33B 3DTXA 4LQ1A 3S4SG 2ED9A 4P9ML 5JO5B 4YGVB 4OZFA 1ZLWK 4YX2L 4NQTA 5EU6D 3RWCA 3FZUD 1T1XB 2V2TA 3ZE0F 2I5YL 4Y16C 3PWPA 4P59H 4F7CA 1H8OA 1MY7A 3VU2A 5K9OA 2OSLA 2MCG1 3WFCH 4EUPA 4HAGA 5DD0L 4YXLL 2A9NH 2VXQL 3D5OF 3VXSD 1JHKH 3FQXB 2CK2A 1U58B 5D2NA 5SWQB 3OJDB 2XI9A 1CGTA 1T7WA 3MLSH 3QWOA 1BVLA 3PQYE 5IEHA 4I0PB 1KV3A 5I71B 4LLUA 4G8IA 3X14B 2N7BA 4JG0H 4PJCA 2HKHH 5EO9A 1EZVX 5HGDB 2OTUA 4NO0D 5EUKB 3C5JA 4G8GD 1MCPH 4KK5C 4HWBH 4BH8A 1MCCA 5C0EA 1CFTB 1I9IL 1W8NA 1YPZF 2PTTB 1CGSL 4NO5A 3S3PA 4OCXL 2DD8L 3GUTB 3KGRA 3QG7L 3TZVD 1ZVSB 4I1NB 4L5FL 2ESVA 2BNRE 2AEWA 1QSFD 4L3CA 4I2XA 3KLHD 3QB7C 4U1LA 5ITBH 5C6TL 3HUJF 4JRWA 4K9EH 4NRZA 4R4FL 3MX0A 3CZFA 2ZSWA 3LRHA 4ODSH 4RX4A 5BV7L 5CGYD 3VGFA 1CD1B 4EVNB 5J6GB 4KY1H 3QDJB 2GHWB 1KYOK 2VLKE 2P5WE 1Q8MA 3VFMB 3H7LA 3W0WA 1XGTB 4FQQA 4J23A 4YBLC 2Q3ZA 5HPMB 3RIFK 3JV6A 4OUOA 4ZD3H 4ONFL 2HT3D 4PJ8C 4XC3L 2X4QA 4HH9B 4NC2B 4KKCC 5F7DA 2Q6WB 4ZSOA 2IANB 1I7UA 3W9DB 1LP9E 4KUZH 5K9KA 3V0WH 3C6LC 3PL6D 3U7YL 4H25B 2VDKL 4MCZB 1F3DH 1J1PL 1BEYH 4PRIE 3TPUB 1H8SA 4NN7B 5BVPL 4LLDA 4JG1L 2AK4D 1ADQH 1I8LC 3SPVB 1GPOL 3KHQA 1KBGL 1K6QH 1GIGH 2R9HC 3MYJA 2NW3A 5C0AB 3RJQB 3PGCB 4R96B 1LE9A 4PJIB 4JFFD 2IEPA 1I9EA 2DS4A 1KXTB 2DLHA 3QFJB 3K8MA 2YN5A 1X4ZA 1BF2A 5T1DH 2CK0L 1DR9A 4RCAA 4Q9QH 4ZQKB 5A1AA 5IJVB 1FL3B 4NJ9L 1J05B 2P44B 4YLQT 4AEHL 1T83A 2PYFB 3EZ8A 2ICWI 4PJ5B 4AENA 5JORB 2NY6C 2W07A 1RHHB 4OF6A 3RNKA 1YEIH 3TP4A 5HHOE 1FSKB 5D7SH 4DCQB 1HHJB 3OJVC 3TBWB 3HPJA 5DQDH 4GG6B 4XXCA 5MHSE 2Y07L 5IUSA 1FFRA 1MRFL 4JQVC 1BBDL 2LU7A 2P5ED 2QSCL 4ZFFA 2HMID 4J4PD 5ICYB 1C16A 3WNKA 1UJ3A 1ZEAH 1D6EB 3O9WC 3QUKA 3EYSH 3GSRA 5BRZA 3VXOB 3OKMA 3MOAH 4TOYH 1EFQA 1P2CB 1HI6B 5HDQH 1HSBA 4QRTA 3B2VL 5JOEA 4Y4HD 1R5VB 3CFCL 4NQCD 1VGKB 3QQ4A 2W65A 4IRJA 1QYGL 4KV5F 2BY2A 4NHCL 4J6RH 5C0JB 5EPMA 3CH8A 1E4XH 3MR9B 1OF2B 1TZHA 3MV01 2QKIA 3NACH 1A1MA 4UNUA 1PBYA 1FAIL 3KG5A 1C12A 1A6PA 4HDIB 3UTSE 2DQDH 2HWZL 3QDMA 1JK8B 2P5WA 1FH5L 2FGWH 1AI1L 2CR3A 2XN9D 1JGUL 2DM4A 4K9EL 3H9SA 5FCUH 2VR9A 5IQ7L 15C8H 3WFCL 2BX5A 3WUZA 4NYLA 3ARFA 2QSVA 3UTTD 3SKMB 2IPUK 5E9DD 5BV7H 5CBAB 2JCCE 4MD5A 4OZ4B 4WFHE 5IHZA 3ARGA 5F89B 4CVUA 4J12A 1YDPA 4HIJB 3TBSA 3T08A 4WHCA 3S88H 4RBPH 1BJMA 3UTZB 4LLAA 4O51B 1RQ5A 4DCQA 1KCUL 2P5EB 3G6DH 5IESL 1A5FH 4P2QA 5KVFL 2K1MA 3ULVL 1WWWX 3ARED 3UBXA 3CDGB 4BK4A 1PKQE 3MRBB 5ENWA 1DJSA 1A6TA 2LE9A 2VERN 3QXDB 1MFAL 3P9WB 3PHQB 5MENE 1VACA 1E4XI 1G7HB 2VLME 5KVDH 3WUWA 3LOWA 3RQ3A 3VE0A 4GBXB 5IF0B 4Q9RH 1F13A 4QTHA 5CP3A 4QXWA 4PJGE 4C56B 4YBHA 1NMAL 4XWOD 1QSVA 4FMKA 4HPOL 3W2DH 5DYOA 3UX9B 2W0FB 3FQUB 2BSSA 2HG5B 1KLUA 3C6LD 3PL6C 4MHHI 3TA3D 4NJ9H 5I16A 2D7PA 4AEIL 3QEGL 3MLYH 4PRHA 1IAOA 3T0ED 2F53E 1QBML 3QH3B 1JIBA 2CDEA 1S7XA 3PE9A 5D72H 5KSAC 3BGMB 3U4AA 3GB7B 1J1PH 3QUYA 1E6OH 1U93A 7FABL 1CXFA 3SGDI 3QXWA 3CK0H 4PG9B 1ZA6A 4BH8B 3ARFB 4HWZB 3Q5OA 2VRAA 4TQEH 5JPMA 1HOCA 3LEYH 4BH7A 1I8MB 3JTTA 3BH9B 4MMZC 3EO0A 2GIYA 2JTDA 3J7HA 5JQHC 3MZTA 5FA3B 2JIXB 1QLEL 3UPRB 2Z8WC 3GJFH 4K3HA 4L29B 3P2TA 3VXNB 1HHGB 1HHHB 2NXZC 2OMNA 2FO4B 5ESVB 1I75A 3RGVD 1IGFH 3T1FB 4WEBH 3RPIA 4XRCA 3MRHA 5D93C 3NAAH 4JPWL 2ZG1A 4S1QH 4MWFB 2EDRA 2GJJA 5HDQL 2DF3A 1M7IA 5J11C 2LAAA 3VXQB 1MCQA 1DANT 5IFHL 1LO5A 3MUGA 3LKOB 2MNUA 1NCTA 1I7UB 3W9DA 4Y0GA 4G6FD 4S1DC 2ICWJ 3SDYL 3MLRH 1KACB 5CJQH 1E28A 3K1DA 1WC7B 1RJCA 3X13A 2WWKT 3CUPA 4WGWB 3OGOE 5ALCL 5ACZB 3SY0B 1MI5A 1TITA 4HXAH 1NKOA 4HXBL 4Y2DC 3GSQA 4Y4HC 5MP6H 4WY7H 5F6HI 3CMOH 4KI1A 4QT5B 4OZIA 3LKQB 3S88L 1K4CB 3VWKB 5FUCC 2O5YL 3GMLA 1IAKB 4KDTA 5DJAB 2IQAB 4Q2ZB 3DUUA 4MA7L 4U6VH 1DBAH 2WBJD 3CLEH 5JPMB 3KDMB 5DJYA 3NFPA 3LQZB 4NN6C 2VXUL 5D7KE 5DRNA 1TQCB 4N0UB 5C09D 5H2BB 4LFHG 2P45B 2IQ9L 4R4ND 5MERB 2PN5A 2HWZH 3MLTA 1MFAH 1J11A 4WDIA 3HZMA 2H32H 5CJXC 1NSNH 1ZLUH 1A7OL 4NQDD 4U0QB 3MRFB 4XNMB 4GG6A 4OF5A 1MUJA 4MNHA 4P46C 4NQSB 1CT8B 4N1HB 1ZLVH 1WUNT 2GK0A 2PYEB 2FH6A 4Z78A 2GSIB 1AP2B 5B39G 5F7KC 5IJKA 5DD5H 3TZVC 3LQAC 5FM8A 4I3GA 4MXWL 4R0LC 4DGYL 5GXBB 3D0LB 3W81A 5GRJH 1L0YA 4NZTH 1OT2A 3ULVH 3K2UH 1KCSH 1S7SB 1YEFH 3MRDA 1XGQA 2FWOA 5HYIA 3CXDH 2VC2H 3OPZH 1BPVA 4Z5RB 2GJ6B 1XR8A 3FQNB 4S1RL 5IFJA 1D9KA 4GAGL 2W60A 2EYSB 2C4XA 2CPCA 3REWA 2FATH 1U8PB 4ZODA 1QR1B 3MRIB 3WXWL 3M8OH 5DJ6B 1MPAL 1U8QA 5KS9A 4GKSA 4PGDB 5DSCA 3BWUC 3CC5A 3LV3A 2ZUWA 5D6DA 1MI5B 4FQPA 3FRPG 4Q9RL 2QKIB 4P5MB 1S8DA 3EDKA 4XNXL 3WNLA 1FFNB 2AXHA 1ZXQA 1I9RH 4V1DD 1BQSA 3OGCA 1I1AA 4LSRL 1HIML 2H2PD 3VFNA 3RFZC 1A4KB 5L7XH 4MD5B 1X5AA 2DJUA 1TPXB 4Y4FC 5GS3A 4OD3L 5FDWB 4GRMA 1A6VL 3SDCC 4PIRF 5E5MA 3GMMA 1TCMA 1MFCL 1T21A 3NCJH 4CW1B 4Z7NE 4P57B 3JUYA 4UDUB 2GSGB 3QNZA 4Y1AA 4G43A 3QO1B 2XKNA 3HE7C 2F53A 4D0DB 1MWAB 4PS4L 4ETQB 1FV1B 4X6BA 1T66C 2Z93B 4HFWA 4X83A 2AEQL 3PP4H 1JGUH 5FCUL 4JHBA 1FFQA 5CSZB 5F9OL 5EBWA 5HHVL 1ZHLB 1YEDA 1EX0A 4PLOB 5I76A 1A14L 3BHBB 3WKMH 1CBVL 5IKCA 1AJ7L 3QNYB 3H9SE 1MRCH 3U6RA 3DGGA 4I0PC 4KKBD 1F8TH 4NN5C 5I71C 2NXZB 3KYOA 4EI5C 1NMCC 2CLZA 5MP6L 1U3HB 4LSSL 3MROB 2XOTA 5JQ6H 3D9AH 2W60B 2OLDA 5C0AE 2PXYA 2OTWA 4X6FB 5A16B 2BHUA 5D2LB 2W0PA 4QHLB 4RA0C 1P5UA 1MFDL 3NPSC 5T5FH 5C0BD 5I1JH 2F8VA 5CD5D 4LPCA 3RWDA 5FOBB 2V7NA 1UB6B 5B38A 3O6FB 4LLVA 4TUJA 4K8RD 1QRNE 2W59A 2PTVA 3EOAB 5D6CA 4Z0XB 2PTTA 3VFOB 3O0RH 4P2OD 3GUTA 1IEAB 4JY4A 1QR4A 4TN9A 4YHZH 1NH6A 3I6KB 4ELME 1WBXB 3QEUA 1DEDA 4NC1E 1S78C 3VXSB 2OJZL 1AO7E 5T3XH 4YXKH 2PTUA 3OKOA 1AD9B 5INCA 3O4OC 3P73A 1JGLL 4LIQH 3OAYH 1Z9SA 1JPSL 1VEOA 2D3VA 4NZRH 3QZWB 4B0MM 4EBQH 3D3VD 1PZUB 4F7EA 4Z9KB 4HWNA 4HZLA 4UDUA 2ZCKH 4ISVA 2P8LA 1AGBB 3QEGH 1SJVA 5DRXA 4DGYH 4R9HA 3CPLB 4P5KB 2EE9A 5F1SA 5I73C 1JTOA 1TJIH 1J0KA 4W81A 1OLZA 4GO6B 2A6IA 2NY6B 5F7HA 1KJ2H 3ORJA 3MRQB 3BP7A 1JV5A 3T8XB 4I0KA 3C60D 4L8SA 4OLWL 1RULH 5ISZB 4YDLB 5DUBB 4CADB 2AJUH 2BVQA 5C0DB 1T83C 4TSCH 4HZAA 5KSBB 4BZYA 3WXWH 1E27B 3KPNB 2WV3A 3FB6A 4LHUA 4WI2A 5I18L 3L9RA 5TE7H 5DK3A 3DGGB 2DLEA 2M2DA 1L7IH 1J8HD 3KYOB 3M17A 4P2RE 5SX4H 3HRZB 4JPIB 4XAWH 2BNRD 1A2YB 2X1XR 5DZLA 1JRHL 5C0CE 1REIA 4M43L 3A6CH 4YHNA 5AYQA 4U0RB 1OGAE 2F5AH 1I1RA 3LS4H 2CJUH 2KKQA 1VADB 4LCCB 3FKUS 3WIHA 3D85D 4X8JA 1BIIA 2BNQD 3MJ9A 3IJHA 5CGTA 3GSVA 2MHAB 1NBQA 1I8LA 3O6LH 4FQJL 1HQRB 3TH2T 2DQJH 4LPYA 5HHNB 5CD3A 2EKJA 5J12C 3S35X 5D7LD 3EO1B 4F37K 4QRPB 2CDGB 4OZFH 1T1YB 2OQJA 2YD3A 3D69B 3I3BA 4XVSH 1OAZH 2BSTA 5DT1H 4CRPA 2VQUA 1QO3B 1R3KB 3O8XD 1UWGL 1ZTXH 2HFEA 4LU5H 2GY5A 3MLTB 4LSRH 1EUTA 2R1XA 4JFEE 4ODTH 4YPJA 3WDHA 1NFDA 2UZIL 5HI4C 3O9WB 4LCIH 1MEXH 1XZ0A 1BZQK 1NUDA 1S5HB 3CMOL 3RZCD 4MQ7A 5GJTL 4Y19E 2UV3A 2R9HD 2HKHL 4IIQB 2RFXB 4XCYA 2GI7A 2OM5A 3C08L 3RVUC 4MJ6B 4MQXD 1OHQA 4YZFE 4DKAA 2DKMA 4WTXA 2YPLA 3G5XA 4K2UH 4RA3A 4DGVL 4KHTH 3ETBF 1OCWL 3EYVA 4G7VH 3RWGA 1WJ3A 3GI8H 4RAHA 1G0DA 2RCSL 2ZWLT 1JFQH 4PRAA 1B4RA 2DN7A 5D71L 1ORQB 1DL7H 3BQUC 1G9ML 1OAXL 3D85B 3PABB 3NGBC 3GKZA 3WIFB 2AK1L 2GYSA 4FMFA 1AE6H 3N50A 3LS5H 3HI5H 2B1AL 3LN5A 5HI5D 1CL7L 4KRMB 4F7MA 3K7UA 3P4NA 1Q94B 1HKLH 5D7IF 4U6XB 1RZKH 4M7ZB 4LSSH 3SKMA 1CQKA 1EBAA 2NY4D 4JFZL 4P4RA 1S9KC 3D2UD 5F89A 3O11B 1J8HB 3BW9B 2HLAB 2X1PA 1J0HA 2W0LA 2X1QA 2G5RA 4H26B 1LK3L 4AM0A 3Q5YA 1S7UB 4I13B 4O58L 5I1HL 3PQYD 3MUJA 3NPSB 1U9KA 3D87B 4N5EC 3OKDB 3THMH 1QO3A 5MENB 5C0BB 3PL6A 2DYPD 5ICZA 4M7JH 1RIHL 5JIIA 4HK0A 5DVLA 4MLIA 2H2SC 1KPRB 5BMFH 3QIWD 1CI5A 1TTGA 4R2GD 3QDGE 1FO0L 5DMGD 3WFHB 1IILE 3GMOB 3MV9E 3TBTA 4FFWD 2VXTL 5E94A 4L3EE 3SE9H 4K3JH 1F42A 5T1DL 3MJ8B 4JFEB 2WK2A 3MUZ1 4PRIA 5EC2A 4P23B 2JJSA 1IKFH 1QRNA 1MLCB 3HTLX 1N64H 2Y5TA 3A67L 2CRYA 2WLZA 3HNSL 2EE6A 3JUZA 4BUHA 2VDPH 4NZDA 4D2NA 1OGAB 2Q3AA 4OM0L 4D9QD 1B2WL 1T2JA 1SY6H 4OLWH 2VXVL 4X9GA 5HXMA 4P5TA 1QFOA 3T65B 3WMSA 2LVEA 5E2TH 3LQAH 4HUMB 4PLJC 1CYGA 3WS3A 5F6IC 2FYYA 3GMPB 4OD2B 1YA5A 1GYAA 3KS0H 5FHBL 5ITBL 3FN0L 1C08A 1NAMH 3UJJL 1B3JA 1Q94A 3CFJA 1GAFL 4HWUA 2A9NL 1U8KB 2VXQH 4OUUA 3MREB 5IJVA 3KPSA 1ZTXL 4F15C 3DV6B 4U3CA 3TIDA 4LU5L 2BP3A 1EMTL 4LSDA 1FFOB 1J8HA 4Y5VA 5DFTA 4BZ2L 4KKAD 2UZIH 2BNRA 4YQXH 3HG1D 3PHOB 1OOAA 3K80A 3WN5C 5L2JB 4DW2H 1ZANL 4UQ3A 3RUGB 4RGND 2XWJA 3G04B 4QRRD 1Z5LA 4XMPH 2R4SH 4YNYA 2DD8H 2WBWB 1X7QA 2XA8L 4QHKJ 4Y4HA 1NAKL 3JWDH 1ORSA 3QFJD 3WLWD 4K7FA 2VDKH 4HIHB 4Y5YA 4K71C 1G9NH 3AAZA 3I6LE 5I8KL 4UUJA 4U6HB 4OLXH 1C16B 3LEVL 3EO9H 3WJLA 1DQQA 2HJKA 4NO2B 3PNWA 4F33A 4NHUB 3ZSSA 3NCBB 3X11B 2R56H 4X7CC 2VLKA 1SQ2N 5KW9H 1OAXH 2DLFL 1QRNB 2V17H 4ZFGH 5IEKA 1U3JA 5E8PA 3WFBL 5JZ7D 1YZZA 2ZUVA 1QA9B 4R7DA 1J1OL 3G6JE 4PRBA 5ESQB 1WC7A 5FUOL 2QQQA 3EYUH 4NKOA 5D1QD 2OSLB 1K2DB 3M1BA 1Z2KA 5MI0B 3T3PE 1OM3L 5DRZA 4P5TB 3OJDA 2G75B 3VGDA 2CKBH 3QUML 1GC1C 3BKJL 4LKXB 4PJCB 4FQXC 3DX7A 1WEJL 3SKJL 2GTWA 3IF1A 1OCWH 3E6FA 3BKYH 4XNYL 5JPNB 4HJGB 4JKMA 1CFTA 3L3DA 3SCMB 4FFYH 4ZUUA 4S2SB 3MRMB 1ZLSH 1F2QA 5IIEA 5LQBH 4P99A 4MB5A 4B50A 1RJLB 4U6YA 4OCNC 4OZGE 2WIIA 3BE1L 4U6TA 3TBVA 1Q9LA 1U8NA 3IDXH 5L8JB 4NCC2 1FE8L 3PGFH 3OB0K 5GGVY 1JHTB 1LO0L 3IFLH 5IK3B 2WUBL 4J3OC 4RRPA 1V3KA 3R0MA 3MNVA 4EVNA 4KDTC 2WQ8A 2IFFH 4K7PY 4R0LB 2QHLA 3QUXA 4N8VG 5GRUH 2CJUL 1TPXC 3FT2B 4G42A 2P8MA 4HIHA 3MXVL 2NY0C 2QBWA 5KTEH 1BQLH 1S5HA 5EOCJ 2DRUA 3KYNB 4HLJA 2R23B 3TV3H 3UPAA 5EC1A 2X44D 2GAZB 1WBYB 2Q20A 3HFMH 4D3CL 3I9GL 4NPYA 3RVUD 1I1FA 2ZUUA 3GSWB 2DQJL 4F57H 1DQML 4LCWB 4TQEL 4TNWK 2DTMH 4P9HL 4LNRA 3DI3B 4WHTB 1A6AA 5BS0B 2DICA 2P24A 2WBJB 4G5ZH 3HB3D 2Q7YA 3VDBA 1G7PB 3C09B 4NQCB 1EEQA 5T5NF 3UPCA 3C2AH 1YN6A 5DEFA 1CS6A 1IC4L 3GJFB 4K3JL 4OGYH 4WUKH 2A6DA 3NMEA 5HHPB 3VD5A 4LMQI 4HS6A 2NY4C 1S8DB 1IKFL 4E0RA 3EHBD 2QHRL 4NNPH 4Q6YA 3UZVB 4KROB 2ED8A 1LNUB 2GFBB 4OZGB 1ZT7B 3OF6D 4HKBA 3BZDA 2VXSL 4P4KB 4JM2A 4ZXBD 4YBQD 2ZOKB 5AG9A 2EIBA 4U6XA 5JNYA 5E9DB 3L5WA 4N8PA 5I15H 4WNQA 1DUYA 1DVFA 4JM2F 1SJEA 1IGTA 3QFDA 5E5MB 3T77B 2PYED 4LARL 1OSPL 3QXTA 3DYOA 3D39D 3ZKNC 3VFUB 2Z8SA 2DMKA 1ZVYA 3TA3B 5IK3A 2X89D 4WJ5A 3UCRA 3OHXA 1UCBH 2PETA 4Y1AE 1UXWB 3MV8D 4JVWA 4Q6IA 5HGHA 1UCTA 3O3AA 5DMGC 3ZKXC 2VLLA 4ZFGL 1NGYB 4JRXA 4JEGB 5ALBH 4P2QD 3P9LA 2Y9RT 5BS0D 1OL0A 5GGRY 1ZANH 5EZOL 2ICEA 1CDUA 4QYOA 5KN5A 1A5FL 2XQYG 3MV7A 1QVOA 1PY4A 4EDXB 5CJBA 5JDJA 4CL7A 1DCLA 5I1KL 3O8XC 5H94A 5C8JA 1BFOA 4L4VB 5ANME 1HDMB 2F5BL 1XCTA 35C8H 3O2WH 2WBJA 1ZT1A 4NNYB 3DXAA 2IPKA 4NQVB 5DFVD 7FABH 3P77B 5DI8A 4PB0L 2XWBA 3SKJH 1VGKA 4G6JL 4JZNB 4U33A 4Z7WB 1K85A 3I2CH 4OLXL 5EA0H 5A2IH 4OFDA 4YHML 4NP4H 3SY0A 1XEDA 2GUOA 1R5IB 4X6CA 4XCCL 5LBSL 3L3KA 1V3LA 3GMRB 4BKLA 1OF2A 5BXFB 4FQHB 2VISA 3T0WA 2UWEE 3RY4A 2A1WL 2WP3T 4I0PA 4MA1B 1SVCP 3R06A 4EI5A 2QEJA 3ARSA 5IVXF 2X05A 1OQOA 3BZFA 3N1MC 5K9QG 3MBEA 1R5WB 4Y88A 1CWVA 3QQNA 2AABH 2DQEH 1N64L 5KG9A 3NFPB 1KFAL 2OTPA 4M5ZH 2UUDK 2J88L 3SKNB 3IU3B 4JANA 4M8VA 2ZPKL 4M6NL 1P1ZA 4L3CB 1AO7A 4K7PH 5F3HA 2UZYB 3DO7B 3QI9B 4K07A 3ARDA 1G6VK 2FJFA 1AGBA 2P8LB 3R1GH 5IB4B 4POZC 4LHQB 1UM6L 1HNGA 3C87A 4P2QB 1XT5A 4JFHD 4KFZC 4U1SA 1BMGA 4NQSA 4S1DD 3E2HB 1UACL 4LK4A 5JW3H 3DURB 4WWKC 5CJ8A 5D1XA 1WFTA 1GAFH 3VXRD 4Y5YB 3ZDZF 2APVA 3T2QA 2F54B 3FQWA 5KSAD 3ZTJH 2M26A 4JB9H 4M7LH 2VR4A 4YK4B 4HH9A 3T0AA 3BIBX 4EDXA 2MSPA 4QTHB 1CLYH 4U0RC 3HRZA 4FOMA 3FRUB 3NN8A 5SWZD 5E8PB 4FXKB 4PP1D 3BSZH 1S9WB 2FD6L 3T0EB 4DEPB 3VCLB 4KTDH 5IVOA 2YSSA 3QUXD 1G7MA 3VH8G 1ZT4A 1IAIH 3BFOA 2CKBA 3Q1SL 3SKUD 5I8EB 1FFPA 4JKLA 4LF3B 3IKKA 3ME0A 4P3CL 5C0ND 4YPGA 5GGUA 4H8WC 4JZJB 3GBNH 2JLLA 5DMJB 2BNUB 3ECBA 1B0RB 2FBJH 5IW1B 1ETZB 5EIVA 4UIMB 1UWEH 3OKKB 1MWAH 5F3BA 4QRPA 5D96B 2WP3O 4BH7B 5DJXA 5KG9B 1I8MA 5CFHA 3QDJD 2FHFA 4MA3B 3BEVB 1B90A 1F3JA 2D9QB 1LK2A 1JN6A 1OGTA 5DVNA 2GITB 3PG2A 1Q9LB 1U8NB 3OKEA 1HHGA 4P2RD 4UINH 3U46A 2DLGA 4N0CD 2IADB 3QDGA 2OS7A 1MWAA 5SWZE 4QEGA 5AZEL 1ND0A 1ITBB 1B6UA 1JWMB 5J1TC 5LGHL 3FT2A 3S8WA 4YDIL 1Q0YH 5FUZH 2E7BA 5DJDA 3KJ6H 1CE1L 5KVMC 4HUKB 3UTTB 1VSCA 4KROD 4EI6B 1JF1A 3IXTA 3NGBB 2RIKA 1LO5B 2UUDH 1G7JB 3D25A 3QCUH 3GNML 3QUKB 4M48H 3D39A 3IU4L 2CLZB 2ICWB 1FP5A 2Z92B 3TJHC 1Y6KR 3PGDA 3ZDZE 1NMBL 5F9JB 3O6KL 3O45A 2XXCB 3G6AA 1QZ1A 2NY7H 4KKCD 4QHUA 3ZE2F 1HCFX 4GS7C 2VL4A 5JIPA 1YECL 2DQEL 1M7XA 5TDPB 3U9PL 4PY8J 1WCBA 3T2OA 5LJYH 2FHCA 3QHZL 4IDJH 4RGOH 3HFML 4D3CH 1IEAA 4CGTA 2ATPB 2NY1C 3OG6B 3MFGB 5D7JB 3BD5A 3AFLA 1KIRA 3N1FC 4MNGE 4PREB 3GI9L 3DYMA 1NDGA 1DDHB 1FNAA 4P9HH 3QCTL 4GRLC 3P9MA 3KLAB 1UXSA 4OFIA 4MA3A 4N0UA 2ADIB 5E8EA 1ES0A 1IC5L 1IGTB 2ZUSA 4K9EC 1ZSDA 1FRGL 3BISA 1V7MH 5DD0H 4YXLH 2LU3A 4WUKL 1CR9H 1WF5A 3CAFA 1AJ7H 1MJ8H 3WFZA 1ONQA 3L3HB 3TFKD 4N0RA 4X98A 3EFDL 4Z0BH 2DQGL 3I3EA 1XGUA 1JWMA 2ZPKH 4D0CA 4CADA 4HWBL 4KTEL 4EN3A 4ODHH 4JQIH 1T7XA 1MLCA 3VA6A 3KPRD 1MLBB 3H0TB 1S7VA 3HMWL 1DBML 4QXTB 1QACA 4ESKA 1CDJA 1FNLA 4H1LA 1A1OB 2OK0L 5C8JB 3FQRA 4OCMC 3SE4A 3C5ZD 4KMTH 1CDHA 3T65A 4KQ3H 4GMTL 1X9QA 4ELKA 2CO6B 2GT9A 1H3PH 4LSVH 3ULVE 4KJWC 4JZNA 1P69B 2W0FA 3FQUA 1U91A 1FZJA 3EGSB 1BFTA 5FYKD 1GHFH 4JB9L 4M7LL 1VFUA 2GUOB 1CGVA 4PJ7F 4WFHD 1NBVL 1LEGA 3HMXA 4FQHA 4GUPA 1MCSA 1RJZA 5IMMB 1OP3K 3BRDA 3D9AL 5IGXL 5ALBL 4NKMA 4NZRL 1BIIB 5GSRA 3R06B 1NEZA 1RZJH 3G9AB 5HI3D 4Z76B 3RZCA 1IAII 4UOJA 4XPBL 1HHIB 5ERWA 1HQRA 4P5TC 2ZCKL 4LRNL 3MBEB 4OF3A 4HIIA 1XF2B 4QOKA 3OXRB 4W6WB 5I19L 2VMFA 4BFBD 3RDTA 3BUTA 2OI9C 3JTTB 1X4XA 4AL8H 2O61A 1FAIH 3IU3A 4LGSB 1BEYL 3RGHA 3OKNB 3DROA 2FGWL 2IANE 4JFED 4P57A 4KC3B 3DXAE 2Y7QB 3SDAA 1TTUA 2XPGB 4N9OB 4OAWB 4PYHA 3R0NA 4JO4L 4HF5H 3QDMD 5HYJA 4YHLL 4L4TA 2J8UA 2RJMA 2DQTH 5HGBB 4GQ9L 4PR5B 4NHUA 1H3GA 1E4WH 2K7PA 4AT6B 5GIRA 3PXHA 5F88A 3ZYIA 1MLBA 2XFXA 3A6CL 3HZKB 2BSRB 3SO5A 3P0VH 4S1SH 2YPLB 5DEGB 2FZ3A 4X4YB 2XV6B 3OB8A 1P6AB 4N0CC 4NO0B 3MOBH 3V8OA 4LEOB 1IKNC 4LLYA 4P2RA 1QSFE 4OV5A 1S9WA 3KPQB 4DVBA 4GKNB 2HT2C 1EIBA 2D4DA 1IGMH 3GMNB 3MNWB 2FGZA 5D7IB 3JV0A 4HWEH 3KYMB 4S0TD 3FOLB 4G3YL 3CXHJ 1FL5B 2ENSA 3SGEH 4UT9L 4LLQA 4M48L 3GSQB 3W9EA 5DJ8B 5EU3B 3U2SB 4YXHH 3F6LA 2VXTH 3QIUB 5DURD 1MCOL 3CX5K 2NY5C 4JVUA 3GJFK 3VFSB 5IW1A 3L3OB 5DJAA 3I02B 3PWVB 4HHAA 5DEZA 3CH1B 3KDMA 2DL2A 3MO1A 4EDWL 1XF4A 3OKOB 4HLZG 4BA8A 3MLYL 4RRPG 2ZSVB 3HNSH 1FLRL 4XVUD 4Z7VE 1ZGLA 3HPJB 1WLHA 4F80A 3UJIH 2YR3A 5D7IE 3HZMB 4IRSC 4Y8AA 1KPRA 5EU5B 2VDLH 3E6HB 1VDGA 4A6YB 3D48R 2FJGB 1SM3H 3RHWF 1DBMH 3BRFA 32C2B 4YHYC 3P4MA 2J8UB 1RZ7L 1FPTL 3GBNL 4HC1L 2J5LC 4HIEA 12E8L 1YNKL 3LN9A 1KJ2B 4RISH 2D7MA 3C09C 1UWEL 3HE7A 1UZ8A 5E4EB 5KSBA 1ODAA 5FGCB 1A3RH 4TSBL 2AVGA 1MEXL 2Q1EA 4WFFE 2WBKA 3PWPB 1GHFL 4MDIA 2ZNWA 2BC4B 1R3IL 3QG6B 1XGQB 2FWOB 1NEUA 2ZKHH 3WUWG 4TULH 1J7VR 2GJ6A 3FQNA 1DQJB 1NBYA 4WHYH 1TMCB 3MRJB 1DSFH 1PG7H 3C08H 3MCKB 4JFZH 3TO4B 3IDGA 2IWGA 2W92A 1XCQB 4HUVB 3UTPD 5C0RL 3GI8L 5FOJA 2BDNH 1WCBB 1FCGA 3N85H 5EU3A 4O02H 4WI3A 3SDYH 1LE5A 3EO9L 4EKXA 3KWWB 5EZJB 2VDRL 3ULUD 4YHKL 1DE4A 3TO4D 2ESVB 1BZ7A 2ITCB 2IAMD 2WINB 1BECA 2PO6A 3AS1A 1CICA 4U1MA 5CZXD 4L8CA 4PJFF 4FHBD 3TA3A 3CVIH 3DOSA 1CFSB 1J1OH 2EKSA 2ATKA 4YDVA 2XWJB 3ULSA 5C08A 4WUUB 1FIGH 5GJSL 3U0PB 1OTSD 1I85C 3KPOB 1ORSB 4AQ1B 2HFGL 1RUML 4PJBF 3FT4B 1Z3GH 3PWUB 3VI4F 3QO1A 4LMQE 4A2MA 4MD4A 2QADD 1HH9B 2CIKB 2X4SB 4F58H 3MRNB 3C6SA 1XR9A 3MBEC 4HFUH 3QHZH 3BKJH 4HSQA 5CLTA 5H37G 2FEEL 1JUFA 1MCNA 1WFNA 2H9GA 2O26U 3LQAL 3WLWC 4AEFA 3TT3H 2B4CC 1VFMA 4DZBA 4H25A 1I3RB 5EZIL 1P7QA 1ZGLM 4KV5E 3WLBA 4PRBB 5JDSB 4UZGA 1ULVA 2Y23A 4QXUL 3U6RB 1C1EL 4WW2A 4DOHE 4Z7WA 5T1LD 4JN1H 4MNGB 4UT9H 3X3FL 4AY0A 1K2DA 4NOBA 2NY1D 1IGCL 3C2SA 5HVFB 4PJAB 4AH2B 4MSWB 1FE8H 2NW3B 5E0QA 1A7RH 4I18B 2X70A 2CGRL 2EDEA 4PGBB 1YY9D 1OT1A 2FIKA 3BPNB 1K8IA 4OKVB 3LD8C 4HULB 2ZJSH 1I4FA 1X6LA 1F90H 1LD9B 4BK5A 3QISA 3KYKL 5T1LB 1VCAA 2HRLA 3TNMB 3DSFL 1EFXD 2DL9A 3H9YA 1YNLH 4JANB 4KRPC 1NAKH 4TRPH 3ULVF 4J3UA 2X41A 1FIEA 2JIXA 5AD0A 4ALAH 2RR3A 2WIIB 2VIRA 5E7FA 4HIIB 3AM8C 4IOFD 2NXZD 4OZIF 1MCWW 4G3YH 4CN1A 3I3DA 1P7KB 1HHJA 2O61B 1BF8A 3MLPA 4HKXA 1YNKH 2A9ML 1OARL 3P4OA 4XXDB 1UWXH 2BOCB 1AC6A 1JZ2A 5T33H 4F7EB 5D96C 5EU6A 1ZKAA 3FHQA 4XGZB 4R90L 4OIBA 3STBA 4XMKL 4MD4B 4XPFH 1M7IB 3BIKB 1NGXB 1OSZA 4G80A 1U3HC 5D5MB 3LAFA 4HKZA 3BIAX 3MRKB 2GTZA 2K3TA 3ALWA 3QO0B 4UTAL 1GZPA 5HHMB 1MNUH 2DM3A 1JPFA 5DC9B 4D0BA 4KAQH 2O5YH 1DP0A 1HH6A 4LCWA 4GT7A 2NY0D 4JE4B 1N2RB 2HP4A 4DVRH 4MQSB 3NA9L 2F58L 2NY1B 4P23A 4K23H 4WU7A 3LPFA 5F7FA 3AMLA 1T1XA 1RK1A 3HZKA 4PJDB 2H8PB 2ZP0T 3VGAC 5H35A 4YDLC 1I8IB 4KZDL 2Z31A 3B9KC 3K8LA 1NJ9B 4PJGB 1NUNB 3JV4A 3TNNB 5LVEA 2FIRT 4ZPVA 5IMOB 1KJ3L 5A2LH 5SWSA 4BYHA 1QOKA 4OV5B 2X4OB 4O2FA 1RV6X 2V6HA 3HMXH 4GAJH 4QTIH 1Y18A 1WAAF 4HDIA 5LCVL 3EKCA 2I9LB 3H7BB 2J4WH 3O4OB 3RNQA 2L0DA 4UU9B 4KVCL 1NDMA 3ZT5A 1C08B 3BQUA 3OWEA 1YY8B 4ONOA 4LCCA 5C3TA 2LAGB 4LEXH 1JE6A 3F6IA 5E95B 3L5WB 1YEEH 5IHZB 1FNGA 3RVWD 1T2QH 4JN2B 2IFFL 3ZE2E 2WMPA 4NDMA 5IM7A 2FH8A 5AZ2L 3PIQB 4X99B 2GJ6D 5FCSH 3G5VB 2C4FU 3MV7D 5AUMB 1U92A 4PRDA 4HFUL 1JGDA 1D6VH 4ENED 3O81A 3WEXA 3N85L 5L0QC 4XXDA 3MLWL 4LCYB 3UBXI 1CGUA 1YN7A 1E4KC 1FVCB 2FJGA 2A1WH 4AJ0A 1NGXA 4LVHB 5BZDA 3OR6B 3OX8A 3BOVA 2AEPH 3MCLH 1KEGH 3W5MA 5EBLB 4M6AA 1JWUA 3CFKB 1HXMA 1R24A 1J0JA 4X4XA 4GRLA 1IEBA 4OSUH 1FYTA 1XR8B 3QUYC 1Q9KA 1CFNA 1Z3GL 2PKDA 1KFAH 4M5ZL 4GW4A 1HDMA 3WFDL 4H88H 4FFVC 1KCVL 3BPCB 4YBQC 3HAEB 2GK2A 1TJIL 2QJDA 2Z31B 4XT1C 3VXUD 3VRIA 5I1CL 4CVZA 1UFUA 3IDYC 5EIQA 1TQCC 1PQZA 4NKDB 5EOCL 4GXUM 2WW8A 4MYWB 4AMKH 2VDLL 4BSJA 4PRHB 5DQJA 5TGBA 1SM3L 4JFQA 3IRPX 4FG6D 4TRPL 3LRSB 2XQBH 4H8WL 3ARBD 2X4PA 2FB4L 4LASL 2Y07H 1KIPA 5C0GA 3B6SA 1XCQA 3QYCA 5DWUH 5KOMC 1H15B 3CSYB 4DKFL 1EZVY 3X3FH 2BERA 5F7YC 5DK2B 2AJ3A 1U2CA 1OD9A 1INDL 1EGJH 2E27H 3NCMA 3HUJA 4GH7B 1G1CA 3BW9A 4I2XE 4PJ5A 3ULVC 1FCCA 2EYRA 3SN6N 5JQ6L 1INEH 3KLSA 3QAZB 1IZKA 1JHTA 2OJEA 3TZVA 3KPRB 4KTDL 5ICZB 3MOQA 5KJRL 1CD0A 1W0WB 3KS0J 4WUUA 4X6BB 4RWHA 2NTSP 4U1KA 5ICXA 5MEPB 3KPOA 2ARJA 1J1XH 2VAJA 1CLCA 1FBIH 2ARWA 4KUZL 2OI9B 3VJ6B 4LARH 4NZUH 1GOGA 1PKOA 4UDTA 3R8QA 1OAKL 3Q6FB 1OAZL 5GRVK 3QNYA 2GAZA 1BFVL 4Y2DA 1FH5H 3U36B 2AV7B 1R24B 4X5WB 5IQ7H 1C7TA 3MJ8A 2OXGA 3QWRA 5F9WB 3KNBB 3U1SL 4XVUC 2X4TB 4QHMB 4NQXB 3OKMB 3T3PF 4AIXA 1A6AB 3O6FD 2YMXH 4QRTB 4LLMB 4X6FA 3RTQC 5HI4D 1HNFA 1V3JA 2D0GA 3SBWA 3VRIB 3ARFD 1YN6B 3O3BB 3O3EB 2CUIA 1MNUL 4KDWA 3IKCB 1I7RA 5EUOB 2X4NA 1T0PB 2EXYC 5A43C 2F15A 1X6NA 2ERJB 3CD4A 3KPRE 3WNPA 5IMMA 1LEKA 4BSVA 1J87A 4E0RB 2NX5E 2DJ4A 2F5BH 4M6NH 3H8NA 4PBVC 4YDJA 2PCPB 3UZQA 3F58L 2FBOJ 3I75A 4HS3A 4WI4A 1LWRA 3BP6B 4URTB 4X6DF 5EA0L 1XF2A 4JFOA 3FO1A 5LBSH 1MHEB 4NN7C 4FQXA 3BZ4A 2A6KA 4P49A 5HI5C 3HMXL 3QXAA 1YC7A 1CK0L 3AS2A 5E08H 4QTIL 1OLLA 1EO8L 5TE7L 2EDHA 2W9EL 5DMIL 2BY3A 5DJ2A 1BBDH 4LCWE 1DBBL 2VIRB 2IF7A 3IU4H 5TF0A 4Y16A 4XCNB 5CZKA 4MLSA 4EQ3A 2BRRH 1GZQA 4OFKA 1S7RB 4UQ3B 3IGAB 3RUGA 3RZCC 3V7AG 3U7AA 1W72L 4XP5L 1SYSA 4M61A 5DHXB 3UJTH 5FGRA 5TQ0H 4ZS6C 4PR5A 5CS7A 1P53A 2VLLB 3MOAL 2Y6SC 4FZEL 1UKTA 1GGYA 1YMMA 2NXYD 3PHQA 1L0XA 3P9LB 4LPUA 1KLGA 3D0LA 5J1SC 1YNLL 3RY6A 4PJBA 5FHAL 1OB1B 1JPFB 4X5WA 2I07B 1AR2A 1NPUA 3QIBC 1SJHB 3LHPH 1MQKH 3LEYL 4B5EA 3VWJB 4D9LL 4PJHA 3SCMD 3UTSD 2DBLL 3VMOA 2C1PB 3O2DL 4PGDA 5DSCB 1TIUA 5I1IH 5IHBA 1RSFA 1IBGL 1MWAL 3L3KB 2AEIT 3SDCA 3VXUE 4CDGC 2UYLB 3PGCA 4LCIL 4R96A 4FFVD 3O41A 3CFBA 1FFNA 3WFDH 4Z0BL 5HHOD 2OR9H 5E6YA 1QSEB 1INQB 1PYWB 2Q86A 1JCKA 1KIRB 1NFIB 5CD3B 1KG0B 1IAIL 1SY6L 5F7MC 1YNTA 2DQHH 5EOCH 5IESH 3V6OE 3C5SA 4FNLH 3TVMD 4LPWA 1G7IA 4FS0A 1R3KA 5IIEB 3BRGC 3TM6A 4Y2OA 1AH1A 1UZ6F 4I5BB 3UYRH 1JF5A 4AENB 1PG7X 5BV7C 4LHJB 1FYTE 4Y16B 1RHHA 3FHAA 4ZFZA 1H8NA 4HD9A 2LVCA 5IW6B 2FRGP 4M3KB 1NAMA 1BWWA 3IGAA 4PJ7E 3T1WA 4X9IA 4RAVA 3C5ZA 4UQ2A 3FN9A 2H6PB 4ZNEE 2NYYD 1E0OB 1SBBA 5IBTL 4ODXB 4KVCH 2LFGA 1T0NB 4NBYB 3MRCB 3ILQD 4EN3B 4HQQH 5FYJD 2YMXL 1SEBB 1ZHNA 2HFFB 4JLRA 5B8CC 1ZHLA 1CE6A 3LKRA 3MA7A 2JJTC 2F54A 4JAMB 1WITA 1JWUB 3PQYA 4MS8D 5GS1B 1OP5K 2I07A 2E9JA 4X4ME 3TYFA 3M07A 5JOPD 1A1OA 1FJ1A 1IQDA 1MQ8A 5KZCB 4JO2H 3B2UC 3JBG7 2D7TH 3DX9B 2PXYB 2XYCA 3THML 2IMMA 3X13B 1VKXB 1YYLL 1PEZA 3KJ6L 2W0KA 2CMRH 3MJ7B 5GPRA 1XGPB 3T2NL 4LCUB 5IB5A 2WBJC 1R3HA 3VG9C 3LIZL 3ZTNL 1AC0A 2MMXA 1QRND 1ZWIA 4Y2DD 4OZIB 5A2KH 4X6DE 4P4RB 3SO3C 1FVEB 1QSEA 1X5KA 3H9ZA 5F93C 3JSSA 3ZO0A 1DE4B 2RBLA 4Z8FL 2HLAA 1EEUA 3GMLB 1N26A 5K9JH 1RVFL 2ITCA 3CSYA 1IQWH 1BVKB 4X4ZA 3T0VA 2ENYA 2HT4C 5ADPL 4MXWH 4QNPE 2X7LB 4WFGE 4YWGL 4N8VA 3ULVD 4RMSA 3UDWA 3IFOB 3VD3A 2IAND 1WWCA 3G6JF 4KHXL 1WEJH 1Z9MA 2MFNA 4ZAKA 4DZ8B 2XTJE 2Y7QA 4LSTL 3RKDC 2QR0A 1OWRM 1UT9A 1VFBB 2IG2L 4RAVB 4UQ2B 3QDGB 1PLGH 4R7NA 2FB4H 4LASH 3MJ6A 5CIPA 2PO6C 1RFDL 4JM4L 1SJXA 2DI7A 2VZ1A 3EOBA 1BGXL 4MMXC 5C2BH 3I85A 2L4OA 3T0BA 5JO5A 2O5ZL 5TPWL 3E3QE 3WL9A 4PJGF 1MJJA 1MH5B 1PFCA 4JAMA 4L8BA 3LRGA 1JGEA 4YDKL 1IGJA 1W72H 1S7TA 2O5XL 4XPHH 3WKNA 2DQGH 3VG0H 2E3VA 1J8HE 5TQ0L 1P4BH 2VH5H 4WY7L 4P2RB 4BSWB 2MOVA 5GRUL 1U58A 5D2NB 4JQIL 1FLRH 1UADC 2YUWA 4KUCD 1HYSC 4XPBH 2JE8A 2FYYB 4MXQD 4WCYH 3L3IB 5IFHH 1T22B 2UWEF 3JWDL 3ZDYE 3KYMA 4QHKI 4IS6B 4U31A 5C71A 2X1OA 3LH2L 1KB9K 3EDDA 5JUEL 5SX5K 4XPGH 1H3VA 1H3PL 2KDGA 3I75B 4HS3B 1A47A 3HR6A 3RA7H 3L3OA 5F1NA 2NMSA 3MODH 1XH3A 4XPTL 2MQ3A 4PY7A 5HYEA 4U1HA 1KSRA 2IFGA 4WVRA 3MLSL 2X7LA 1TVHA 2ADFH 5FDWA 1P6FA 1DN2A 4HEME 2JK5B 3GSUA 5I30H 3EHBC 3C8KA 3IJSA 3O3DA 5IWLA 1AIFA 1NEZG 1BAFL 5KVGH 2A74B 4XGZA 3QI9A 4PJ9D 3LEXA 5SWZB 1PG7L 1VFBA 4RFOH 3FAXA 1M6OA 1LO2H 3P0VL 1P9MA 3OF6A 1S5IL 32C2A 5M7QA 4UUJB 5IFAH 3BVNA 3P0GB 5CIPB 3BJLA 1MJ7H 2Z93A 5E1AB 4L5FH 4F9LA 4D0CB 4LDEB 2YPKB 3D2UB 5D7KD 5IB1A 3DETD 3NIGF 4LVEA 4B7LA 3BHBA 1FC1A 1KLGB 1OP3H 3VXMD 2DMBA 1ZLSL 3GSNH 2R0ZL 3R8BB 1YYML 2VDRH 2QSQA 2B2XH 3WHE1 5C9JA 3K1KC 1A8JH 3VFRB 5C07D 2J8HA 3BE1H 2QADB 3BEWA 4P2YA 2FCBA 4TUOA 1X44A 3VWJA 1ZV5A 3JVGC 3O2VH 3ARPA 3L3JB 2A38A 2BFVL 1F3DJ 4PJ8D 3ZDYF 2NTFA 2XKSA 5HD8C 4LFHD 4R2GB 4ZTOH 1X5IA 5IHUL 1FIGL 5DJCA 5GJSH 3ZKND 5J4MA 4FTVD 5FKPB 3K2UL 1F6FB 4JREB 2H3NB 5JPNA 4FZEH 2VC2L 3OPZL 4HBQA 4Z7VB 2JCCA 5FGBA 4YWGH 5I1KH 1I8KA 2I24N 2E5EA 1CZ8L 3NIDE 1IGYA 2ICCA 5E5RB 4KHXH 1HHIA 2EDLA 4X9HA 3VD9A 3S96A 3QDME 1G84A 4P9MH 5HHMD 2BK8A 3LZFH 3AC0A 4UOW1 3F8UB 2I25N 2JB5H 1R3LB 5FYKL 5GRWA 4W6YB 5I18H 3V9FA 4K55A 3U4EA 2VLRD 4PG2C 4JJ5A 5H2BA 4Y5YC 4NSKA 1T5WB 4I5BA 1ZLVK 1P7QD 5DRWB 2EDYA 3C60C 4M1GL 4ZFZB 4H20H 4BJLA 4C57C 2HJFB 1HQ4A 5DRXB 3CU7A 1QD0A 4Y19A 2JELL 2CGRH 5DUML 3U46B 4YDKH 4XBPB 4EDWH 3LMJL 3IXAB 1AKJA 2ZKHL 1TJHH 3CFKA 4XBEH 1K3ZA 5HGBA 1EEZB 1ZK9A 2VXSH 2HMIC 1YPZA 3IS0X 3DTXB 1SMAA 5IR1A 5DD6B 5IBLC 2FL5A 1KF9B 5DHVA 4PRPD 3SOBH 4OZGF 4LNRB 4EEEA 2CQVA 2DLIA 3RWCB 5HDBE 4R3SA 1U8MA 4F7PA 4U1NA 5DS8B 1N0XH 4JO1H 4KQ4L 4Q74A 3DSNA 3O4LB 5EWIH 4OF0A 4MNGA 4CVZB 4YHIB 4W6XB 2CXKA 5ECJE 3NCYP 12E8H 3IFNL 1FZOB 5B38G 1WGOA 4Z7UE 4S10A 4OQTH 4XVSL 3MLVH 3NCFB 5DT1L 1FNSL 4HC1A 1N5AA 3O45B 1UWGH 3WS6A 4WHDA 3W0WD 5EU7C 5HYQB 4KGLA 1K8DA 1KPVA 2W91A 3HS0B 3P0YH 5I74C 2P5WB 4XCFH 5HY9B 3A6BL 3C5JB 1GGUA 3T09A 3UMTA 3PWPE 1NGPH 2R1YA 3QDJE 4JJHA 1N4XH 4JZOB 3L7EA 3CVIL 4NQEE 1U8LB 1P4BL 3MREA 5CBAA 4YK4C 3L95B 3DV6A 4GS7B 3QIUA 5F7EL 5I1LB 4FN0A 4ONFH 3GBLA 2D0FA 5L9DL 5KVGL 4QNPF 5BCAA 1NL0H 1DUZA 1CIUA 3PWVA 5D4QA 5GGQH 3PHOA 4NHCH 1LO2L 1I1YB 1R3LA 1TTFA 4JO3H 2D7TL 5L2JA 5JHLL 3CGTA 1JZ3A 2ORBL 3HKFA 2X09A 4H5SB 3CSPA 4KZEH 1ZSDB 5C9KA 1T21B 1JTPA 1FG2A 5HDLA 2APFA 3CJJA 1U8HA 2Z31D 4F9PA 4YHPB 4NC1C 4HX1B 3V6ZB 4P2OC 4FQ2L 1XZ0B 2CDFA 4XPTH 2V2WA 4WWKD 1NGYA 4JRXB 5HYSG 4Z7WF 5L2KD 4QRRB 5I1GH 4MA8L 2WAHA 4PB9L 5CJOH 5FYLD 1EEZA 1CXIA 3RIFF 1CL7H 8FABA 5DD6A 4XI5D 3KNBA 2BVOA 4KVNL 4YO0A 4NUGH 3PWLA 5J1AB 5IEKB 4NQXA 2H1PH 3WD5H 5DK0B 5AWNL 1JGEB 1RHFA 4R97C 2NZIA 5TFSH 3PXJA 5EU6E 3ZLQC 2D4FA 4GXUN 5IHLB 1HCVA 1A0QL 2EIEA 4EJ1C 3OR7B 5J11B 1HEZA 4O58H 5I1HH 4BKLB 3SDXB 1LEIB 1ORQA 1CZ8H 5IP4A 1Y18B 3HE6D 4PJAF 4O9HL 1JZ6A 4QHLA 5EO1A 1BREA 1U91B 4JFFE 1IKNA 2EDNA 3WYRA 2R1YB 1FNEA 1F4WL 2R29L 1H5BB 4RIRA 5C2BL 4HJGA 3FB8A 4GG6F 1BIHA 3B8SA 1IFHL 4PGEB 5GS2H 1H3WM 3VFOA 3EIFA 4NWUH 2AK4E 1JNHB 3RKDD 4Z76A 3MQIA 2EYTA 3S34H 4U7MA 3F7YB 4E41D 5SX4I 2E7LC 4U6YB 3ZKMD 1CFQA 4POZD 4PJ9C 4XP4L 1WICA 3ZMRA 4PJEB 4PRDB 1D5ZB 4RMQA 3HG1E 2D03H 3AREC 1I9JH 4LGRB 2GJZB 4P3DB 3CVHB 1T89A 2C7UB 2PXYC 4FTVA 3TCLA 4AEEA 1QLFA 1YMME 3ARXA 4HK0B 5CEZD 5L6YH 3BO8A 4R26H 1E4XL 4UB0L 1A9BA 3H9SD 2G5BB 5KSUA 2OL3B 4U1JB 1QUNA 2P5WD 4BQCA 3OX8B 4P3CH 4KHTL 1AQKH 5I1EH 3LKOA 3MUGB 5KVEL 5HGGS 3T0DA 1D6EA 2X4UA 1U3YA 5EC2B 4OZFB 3FRUA 3OV6A 1OTUC 4Z95L 1Q9KB 4XCFL 5F9AC 2B1HL 3F5WA 4AYFA 1G7PA 2W65B 2BVUA 1I7ZA 4M8QB 2FR4A 2PNDA 3RGVB 4LAQL 4EXKA 4TUOB 1TZGH 5EO0B 5EH1A 3TBYA 3ZT7A 1K8IB 2XICA 1GGBH 5IFAL 1JVKA 2A0LD 3VWKA 1KYOJ 4OLYH 2Q86B 4ZPTA 4UV7L 3VFPB 1D5IH 1EERB 3IFNH 4CU6A 2CKNA 5FM5M 3IFPB 4CJ1A 3NPZB 3VFWA 2D9CA 5GGSB 4ODUA 4QRPE 2NY2C 1XIWD 3RL1A 4LSVL 3IDIA 3LS5L 5EN2A 5BMFL 2ZCHL 4E5XA 3VG9B 3GNMH 2R56L 1QHOA 2AJYH 1CFQB 1FO0H 2V17L 5FDYA 3GGWB 4OLUL 1XF4B 1FGVL 1T1YA 2OQJB 1P7KA 3D69A 5D5ME 3SDDD 2BFVH 4HPOH 5IGXH 3DVIA 4MQTB 1ACYH 1QPXA 3K46A 1MUJB 4OTXL 4O4YL 3MRPB 1ZS8B 2VN4A 4ZDHA 3TCLB 1OTTD 2EICA 1GRWA 3DVGB 1AP2A 4ZG1A 3ES6A 1G7QA 3DMMD 1UYWL 1WZLA 1IC7H 4J3TA 4X5XB 5DJ0B 3TJEH 4H88L 5SX5H 5E1HB 1JPGB 5D5MA 1IM9B 1ADQA 4CAGA 3QUZB 3JV6B 3BXNA 3TN0C 2XTJB 1FJ1B 4JZJC 3ZKSD 1F97A 4DK6A 1ZHBA 3C5ZC 4C56A 3JWNC 3O2DA 1NSNL 2H8PA 3ZL4L 1IC5H 4NKOB 3N9GL 2HG5A 1AFVL 3WO3B 4G8FA 5ESAA 5MEND 5B8CA 4DAGL 1KIUA 4Z18A 5F7UA 4APQA 3CNKA 5DR5L 3ARUA 4OZHA 2X4OA 3BDYL 5GSVB 5EUOF 4NUGL 5HTSA 3CVHH 3W11C 3F65A 5T1KB 5I8OL 4LP5A 5M95B 2CLRB 5E99H 4UAOC 4R6UA 4LSUL 5DLMH 5F7NC 1BQHB 1MCWM 1A0QH 3VFPA 5JW5A 3P4NB 4R97B 1B2WH 4ODHL 4DW2L 2VXVH 1IT9H 5C3LD 3DRTA 5FEBA 5LKNA 4JPKH 1W72A 3ARBA 3HNTL 4GW1A 3KXFA 4CMHC 1K4DB 4HGMA 3VXSE 1HINH 4Z7QF 1DQMH 1MAJA 5JR1H 1F3RB 3BPOB 1I3VA 2W9DL 1X5XA 4TVPH 5HD8D 4OJFL 2AV1B 3L5JA 4G43B 3MV8E 3RL2B 3P30H 2ATKB 2EEAA 4G5ZL 1EV2E 4U1IB 4YDVB 4KK9C 5JHDE 2UWEB 1OAYH 5GGRA 3ROLA 3ULSB 1MI5D 4OCWL 1T1WB 4HUUB 4Z95H 2VAAB 1FVCA 2DQUL 1N4XL 4GKZA 2AXGB 3B9DA 4QRRA 3I50L 3C6SB 4NNPL 3QPXH 5EBLA 4NQDE 4C56E 4XVTH 4QXTA 4WO4A 1EJOH 4PJBB 5L9DH 1I1FB 4GJTB 4MAYC 1I9JL 2ZUTA 2KH2B 5HHOA 5J3HC 3V6BR 1FYTB 1U3HA 2R15A 3U30B 4AIOA 3A6OA 4JHWL 3LCYA 4RAUA 2HA1A 4YR6A 3QZWG 1SEQL 3NTCL 3CUPB 5BO1H 1OGAA 4KTYA 1FZJB 3EGSA 3QWRD 4UT6H 3SQOL 3GJFA 4AH2A 4UTBL 5C7XL 3O6FA 4LLVB 1D5BA 4TUJB 1BOYA 3O41B 1HXYB 3U1SH 5IG7B 9CGTA 3B9KA 1QSFA 4YHLH 3GSOB 3SGEI 1LNUA 4YPGB 1JNJA 4PB9H 5FUOH 5E4EC 2EDBA 3QEQB 4HG4K 1CTNA 3QEUB 1FGVH 4CN4A 3EJZD 2R2BA 4HQQL 5E6IA 3VXSA 1LO0H 2HVJA 2WQRA 3IFLL 5DK2A 4NQEA 4AZ8A 3HNVL 2WWMC 8CGTA 1UKSA 2AJZB 3MZGB 4XP6L 4KK8C 4ZXBC 3JVGA 2EO9A 1Z0MA 4HUWA 3RWEA 1QP1A 2A74A 1NC2A 4L3EA 2H45A 3S36L 4X4MA 2D31A 3HC4L 3CZFB 1NAMB 2DWEB 4TUKH 4U1IA 4HKXB 1Z5LB 4CN6A 2FNBA 3F12A 2C3WA 4JRYB 1UENA 3MFFB 3SCMC 1KBGH 2BVQB 5C0DA 1KTLB 3F7VA 4NKQB 4FQ1L 1TLKA 4YXKL 2EDOA 2EXYD 1PD6A 3MA7B 1A7PL 2VLMD 3MRKA 1NGZA 2BRRL 4O2EB 4MJ5B 5IQ9A 4HUXB 1JGLH 4LIQL 5DD1H 1NGQL 2AV7A 1MHHA 2HJKB 4XP5H 4EI5D 1G7JA 4DFHA 3L1OH 4DQOL 4YFLF 5D8JH 1FNHA 1X5YA 4PJXF 4NT6A 3GMQA 4MCZA 1XCTB 4NQVA 1YEGH 4J3SA 4OD3H 5DYOB 4LLDB 1KUMA 3JV4B 3TNNA 3M1BB 2NNAA 5EUOA 2QSTA 1HN1A 4YAQB 4DKEL 4ZO6A 4UB0H 5C0AA 3TBYB 3VGAB 4M62H 1LEKB 3HE7D 1MVFA 3QH3A 1Q9WB 4OIIH 1QSFB 4PS4H 3KHOA 1OSPH 3BGMA 4MZ2A 3VRLE 3NZHH 4KI5F 3WIHH 2PCPA 3ARDD 2EC8A 1UACH 5JW3L 2XZCL 2YD9A 4G8EA 5E8DL 3SDCD 4PGZA 4OGYL 1HOCB 2EIDA 3LKSB 1Y0LA 3BDYH 2AJZA 5BQ7B 2PYFA 1ES0B 4XX1G 4IMKA 1VHPA 1RJLA 2EDTA 3K2MC 2EH8H 1XAUA 2DQUH 3QFJE 5F3HB 4EUPG 2JKXA 1TZGL 1HHHA 3BYYA 4PJBE 1XGYL 1IT9L 4NQDB 3CFCH 5C0IA 1JF6A 3MNVB 3O6MH 5TQ2L 3MGAA 3C6LB 4WCYL 5EFIA 1AKJB 1ZS8A 1CXHA 5I75C 4IIQA 1UVQA 2ZCLL 3O4LE 5E5UB 5FO8A 5DC0A 1JZ4A 1QFWI 4Y4KC 3CXHK 1RMFH 4Q9CA 4FABL 3SJVA 1FLTX 4R4FH 4HG4J 4ZFFB 3I2CL 1U36A 3DIFA 3E0GA 4PV8A 5KSBF 1HXMB 3MV8B 3RIAK 1OP9A 4NGHL 5GGTL 1MVUB 2PW2A 3DPBA 1IAIM 1RURL 1N6QL 3RWIB 3QUMB 5J9PA 2RAMA 2EDXA 4HLZH 1UKQA 3OJ2C 5FIEA 5BS0A 1NUGA 3AU1A 2IH3B 1N5AB 3TESA 3IDGB 4MAYD 1JPSH 3EAKA 3RDTC 2GEEA 4EBQL 2SEBB 2R0WL 3T4AB 5C0JA 3AREB 4NNXB 3RHWK 1FFPB 3FT3A 4X6CF 5TGBB 4PGCB 3ZE1E 4G9DA 4WV1C 3MLUH 1YEKL 3L95A 4XP6H 3V6FB 3ZT6A 3QDMB 3SDAC 2IGFH 5CEXA 5C0GB 1CN4A 2BNUA 4PB0H 2DWDB 5FK9A 1BZ7B 4G7VL 2J8OA 4JG1H 5F1NB 3PWNB 3OXRA 1S7UA 3REVA 4IRSA 3HZVB 4MX7A 3ARVA 1PLGL 4J7RA 5DRNB 1UB5A 3IDNB 1F3JB 1T5XB 4JN1L 4WFFD 2X9XA 1NC4D 4Z77B 1BJ1J 3KJ4B 2VL5A 5AYUL 2K7QA 1RZKL 1W8OA 4U3XA 1XR9B 2A6IB 1GJIA 3SGJA 3WN5B 1YECH 3QAZC 3VJ6A 5ISZA 4PV9A 3WJJA 1J0IA 1A7NH 5DA0B 4RQQB 2DQFA 5EU4A 1CDGA 1SEBA 1VACB 5GIRB 1MJUH 2KL6A 3LPWA 3P40A 4OGAC 4PV8B 1TVDA 1D5MB 2QQNL 4NWTH 5BOZG 4RSVA 4PRHD 3V5KB 1PGRB 1HSAA 4ELMA 1N59A 1DVFC 5JXEA 1EA9C 2W9DH 3KXFE 4G9FB 4N90E 4FXLA 4FFWC 3DUSA 5J89A 1LEIA 3HUJE 2X70B 3DX6B 4I18A 1NUFA 5DZOA 5IJKC 1HHKB 3WDJA 4UT7L 1J8KA 3T2PA 3KPPB 4LVHC 1CQYA 3CLFL 4W4NA 4OSUL 1IAOB 4OIAA 1HXYA 5D8JL 1E6JL 4G9DB 3V5HB 4TOYL 1ZLUK 1OPGH 2I9TA 2N7AA 4Z7VF 3ILPB 4N0YL 1I1AB 1NBZA 1FFOA 1EHLL 4OM0H 5JA8B 4JHAL 3X17A 4XC1L 2FX9L 4EN3D 1PSKL 4MX7B 3O3UN 2ID5A 3EO0B 2Z8VC 2VQ1A 5B3JF 3IFOA 4KZDH 5TJWK 4Q9BA 5DJ2B 4N5ED 2HFEB 2A6JB 1P1ZB 5LGHH 3WXVL 1FZMB 4M1CD 3MBXH 4G9FD 1KJ3H 3L7FB 3W82A 2J12B 3LDBB 5JW4N 5D71H 3DJ9A 4JFXA 5DMKA 2AK1H 2YK1H 4NRYB 3CFEB 1XGTA 4R7NB 1KPUB 1Q0XL 2NY4B 1YPZB 4X6EB 1HH6B 5K9QI 1RUPH 5CSZA 4GXVH 3VW3L 5GRVL 4LSPL 5J13B 4HCRH 3GIVB 5IHUH 5DS8A 5IQ9B 4I9WE 1ZA3B 2F74B 3RWFA 2FECI 2R4SL 5DXWA 2DQCL 2DYPA 1BD2B 4JFPB 1A02N 2YN3A 3UO1H 3BKML 4NUJA 4E41E 3OB0H 3FMGH 5SV3A 2BVEA 3DX8B 4GAYB 1RK0A 2ORBH 5ACMA 1NCDL 1MCHA 5D2LA 2IQ9H 3QIBB 2YSSB 4MXVF 3VFGL 5I66B 4NFDA 3TA3C 3H7BA 4XWGH 1YYMH 3QSKB 4C59B 1VESA 4LKCB 4NOFA 2VITB 3BYTA 3I6GB 2YBRB 4X9FA 1LEGB 4GUPB 3MLZL 4TSAL 4WHYG 2Q8BH 4GBXC 2DDQH 3VFWB 1N0LA 4MQXC 1GXEA 2AJXH 3ZDXF 3V4PL 4Q97A 2NR6C 1N7MH 1T4KB 4S0SD 4Z7UA 5GS0D 2R0WH 4H26A 1RD6A 1MFNA 5HYJD 3OZ9L 1XF3A 4AEIH 2F54E 1LILA 3RVXC 4HGWA 4NIKB 3AY4C 3VWKC 4QF1A 4ZUWA 3PL6B 1MF2L 3GM8A 3O8XB 5CKAA 1YEHH 1JN6B 4F7TA 1QQDA 1Z0NA 4J8RB 4G7YH 5GHWL 3OKEB 4HX1A 4X5XA 1M71B 4KQ4H 4KJYA 2V9TA 5C0CB 2YUXA 3WFHA 2CR6A 3JTSA 3S9DB 4FFYL 1AHWB 4QRRE 3QHFH 3HE6A 1CG9B 1EFXB 2WIMA 5IVNA 3FN0H 3TGXA 4FFZH 1AQDA 4RDQF 2BHZA 5DVMA 3OXSB 3HC3H 3GDBA 2JELH 2P24B 1WSST 4TVPD 5DUMH 3UC0L 3IETA 4BZ1L 3KJ4C 3G9VA 2EXWC 2DYPB 3BWAA 4JFPA 1VGEL 2E6QA 3HI6L 5B8CB 5KANI 1PQZB 1A7BA 2QQKL 5EPMB 5IROA 1PZ5B 4OGAD 2HTKC 1G9NC 5GSVA 3CU1A 4PGBA 1BVLB 5IEHB 3TN0A 3TV3L 3J8F7 2GFBA 4OZGA 1Y6NR 4LRNH 4DUWA 4XBGB 2SEBA 5E00A 4WTZA 43CAA 1J1XL 4NNXA 3I6GA 4TTDC 5L0QB 2MCPL 1FYHB 1MQKL 3DWTA 2ARJQ 5ID1A 2Y36H 4JRYD 3IT8D 1MHCB 2FJHA 2XNAA 3H2WA 1ZWIB 1J5OL 1JNHA 1FPTH 2BNQE 3KXFB 4G9FE 4PP2A 4XB7A 1DVFB 1F6AB 1A6ZB 1QFWH 3O2DH 4RNRB 4Y5VB 5KVEH 1SYVB 5GGTH 2D0HA 4N5UA 3REVB 3TC9A 4Y5XB 1JHKL 5EBMB 1M1SA 3RP1A 3VXUB 5JW4M 4YNYB 1UXWA 5DRWA 2YD6A 4JDVA 1I3GL 2BOCA 3QJFB 4Y4HB 5MEPA 3MRBA 5ENWB 1A6UL 1T7ZA 2DM2A 1O7SA 3HB3C 5KSVA 5D2LE 4G8GA 1ONQB 2FX9H 2AXGA 1CGSH 3U30C 3IXAA 3ZYOA 1AGDA 5IWLC 2VE6A 2BVPA 1PY9A 1T3FB 2IGFL 1XF5A 4X5LA 3QI9C 2VABB 3BKMH 2EECA 1IE5A 4NO2A 3EOBB 3UYRL 4OF7A 2X4QB 1U8OB 3BKYL 4XNYH 5DHVB 4ZSOB 5F1OB 3OKLB 5CEYA 3WHXA 2O93L 1J12A 1G6RA 4RAUB 1A7OH 1IGML 4NJAL 4N1EA 4F9LC 4FQIH 3BUYB 3O4LA 1DQDH 3QG6A 4KY1L 3MLZH 5B3JE 5CJOL 4ZPVB 2X4NB 5IMOA 4EUPH 3GMRA 3MRJA 5I16B 4UILL 2IAMA 2VISB 4YXHL 3FCTB 5JHDA 5FB8B 3TO4A 4Z7QE 4I0PD 1BJ8A 4UV4H 4XP1L 1ZE3C 5E8OA 1HHKA 1F2XK 1MCLA 4Q0XH 4AG4L 3QQ9C 5C0FB 3FFCA 4ZPTB 4HUVA 4M5YL 3LKNB 3ESVF 3G5ZA 2HVJB 1MJUL 3KPLA 4KMLB 2A6KB 4ODUB 5ISZE 3HC0A 1B88A 3M8OL 1HK6A 3O6FC 3VI4E 3QRFM 4DGIL 3FL7A 1T66D 3QEHB 4L29A 1GIGL 4RFNC 2F8OA 3NZ8B 5DZNA 4E42B 5FECA 4XRCB 3GSUB 3PP3H 3F7PC 4UT7H 3U0PA 3C2AL 5JMOC 5D1ZB 3NA4A 3S34L 1X5HA 2Z91B 4HZLB 4JFFA 4HMCA 4ZO9A 3RI5K 2Z0BA 3V6ZA 3SO3B 2IH1B 2OBGA 3FOMB 1E6JH 3SEPA 1T80A 1NANI 4JG0L 3Q5TA 5E99L 1VGEH 2P7TA 1RUQL 4Z6AT 5I8CA 3UXFA 4MCYB 2F9BT 2BVOB 2G60H 4KRPD 1I9IH 3PF2A 1P2CA 3S4SA 3FB6B 2IG2H 3HNTH 4PD4J 3MNZB 2R2EA 2E7MA 3GBML 5C9JB 2X89A 1JMZA 1YQVL 5D5MF 4EUPB 4RMUA 2AEQH 3PP4L 1U42A 2EE2A 4JPIA 1MELA 1SVZA 4RX4D 4F2MB 4RGNB 5HYJE 3EYQC 3CFBB 2NTFB 3HC3L 5EOTB 4TSBH 3QXUA 1WZKA 4OD2A 2X4PB 2YOCA 1DLHB 2COQA 4KK5D 1JK8A 5DJCB 5I0DA 5AAMA 2HLFC 2WUCL 3D3VA 5FA4B 1ZEAL 1B0RA 1R3IH 1FNEB 3H9SB 4OLUH 1H15A 3VG0L 2EC9T 4OFPA 5D1QB 4NYLB 3L5HA 3W39B 5KS9F 2AJ3B 3ARGD 3B9EA 4UTAH 5BRZD 3C9NA 3AVEA 5IMKA 4B7IA 5A3IC 4ODVH 2ZOLA 3DXAD 1UEMA 4L4JA 2AJSH 4JCMA 1U8JA 3Q0HA 1KGCE 2YD5A 3OHXB 1S9XA 1W0WA 3QPQD 4OFVA 4NFBA 4EIGB 2VN7A 4LP4A 4UT6L 3SQOH 1AR1D 1KNOA 2VZTA 2YD1A 1OGAD 5JW4R 1GPOH 4OT1H 3GSNA 5D7LA 5EZIH 3AXLB 3MBED 4KK9D 1IZJA 3SDDA 3UEZA 1B9ZA 4QXUH 4ZNEA 2QADC 2DDQL 3HE6B 4EIZC 5GS1A 1TJGL 3VD7A 4R2GC 3DMMA 4M6MH 1BAFH 2EE3A 2VB5A 2D7NA 4R3SB 3S4SB 4L4VA 1YEJL 1RK1B 4IIQC 3MGTA 1T2QL 4R7DB 4LLMA 1TQBC 4GFTB 3G5XB 3S37H 1PW3A 4WV1B 3RWGB 4Y4KA 4PJGA 4ETYA 5J3HD 4Y8DC 5MEQA 4LGPB 4OCYL 3HI1A 3ULUC 4C4KT 1TCRA 1F58H 1KTRL 2YC1B 2F8XC 1U8IA 3R1GL 5C92A 2G75A 4XMLH 4ZS7L 4GRWB 1B0WA 3TT3L 3O9WD 1S7QB 4KPHH 1KTKE 5IV2B 5EOTA 1FC2D 3K4ZA 4QGTA 5IVZA 3WJJC 5TE4L 4JFDD 1KCKA 3DX7B 3MLWH 4XBGA 1L7TL 5L2KB 1D9KC 1JMXA 4UU9A 3QEQA 3BP6A 4K8RH 4MAUH 4DAGH 4XNZB 4XAWL 2VDML 4HKJA 1MHEA 4NQUA 3NH7H 2P8PB 3G08B 3D18B 5I74B 1EHNA 4N8VB 2HH0L 3W2DL 4WI7A 4XP1H 4NRXB 2X42A 5FA3A 1WIOA 1DUZB 3MV7E 3QEQE 3VFTA 3RWEB 4Q0XL 5F1IA 3TBVB 4RDQG 1DLFH 3LD8B 3QA3A 1ACZA 4KUCF 5IOPA 3L3HA 4KK6D 1L6ZA 4XVTL 1QBMH 1RU9H 4C83A 3QUZD 4JDVB 1CGYA 2HAZA 4M61B 1FO0A 3CSBA 1NCWL 2L7JA 4ZTPH 4LBEA 3BP4A 4K94H 4LRIC 3OJMB 5EC1B 5J12B 3EDJA 4J4PA 3FAWA 3HCVA 3EZJB 4HUXA 3LDBC 1OARH 2XXMB 4X7DC 5E8DH 5DUPL 5T33L 5BRZB 4R90H 2Y5TB 1H0DA 5IB3B 5DK0A 4LVOB 1KB9J 3QUXC 2AW2A 3U82B 3HAEA 1CU4H 4HJ0C 3KPPA 3RU8H 1CTOA 4P23D 1IARB 3WE6B 3U4BH 2C26A 1A9EA 4AIZA 3QDGD 1CDCA 2CSPA 3JV5A 1UB6A 5B38B 1VA9A 4UINL 5DQJB 5JHDB 3SOBL 3G6DL 5DMYA 2NQCA 3IDMB 5IVZB 3I84A 2ZCLH 1OAQL 3I6KA 4UI2A 3UDWC 1G0XA 1YQVH 3CFDA 5JW5B 1X5JA 1KG0A 5B22A 1UM4L 1XH3B 3HPLB 5F6IB 1JYXA 1ZOXA 5E9DA 2NZ9D 4FABH 4KMTL 5I8KH 3E8UL 1DL7L 4YIQA 5FYLH 1IL1B 4LAJH 4P48A 1NGWA 3ZSTA 2NY5H 2LTQC 3L6FB 2B1AH 4LLWA 3BQUD 2DQIH 1T6VN 3VFTB 1N6QH 1I1CA 4HXAL 2B5IB 1IVLA 2Z35B 4PUBL 4X6DB 3MCLL 5FYLE 5A40E 4HIXH 2I27N 3IVKA 4L4TB 3C6LA 5E56A 1ND0B 3HN3A 2ARJB 4U05A 5TF1H 3QNXA 4YJZL 4DWHA 4D9RE 1YEJH 2IH1A 4GG6E 4AT6A 4HH8A 1I7TA 1YEKH 4FA8A 1PG7W 1SMOA 1GZPB 3LB6C 2X4RA 3RVVD 3U83A 2F74A 4NBXB 3VE0B 1JGVH 3ARZA 1RIHH 2L7UA 1AY1H 3KR3L 5CP7A 3TH4T 1BD2A 4IJ3B 2X4UB 3RWIA 5H94B 1QNZL 4KPHL 4TVSa 2QV2A 4DOHB 5TDNB 5TE4H 3Q3GA 3PDOB 2IH3A 1FG9C 4XZUB 4QRSB 3ZE1F 4K8RL 4M8QA 1KC5L 1TJGH 1DBJL 3INUL 4X6CB 2VDMH 3L5IA 5FKPA 3RGVA 4FQXD 5JZ7C 3HG1A 5DTFA 5EO0A 5TDPA 4P5MA 1UG9A 4HUNB 1TNNA 5DJ8A 1EGJL 2E27L 3MJ9H 3A67H 4V1DA 2NX5B 4S1QL 4Y16D 4JRXE 3QDHA 4ZYKB 3QUYD 3MRRA 5D7JA 1WTLA 1NDMB 2GTWB 3IF1B 3IAQA 2G9HA 2R2BB 3N1PC 5EUOE 2VLJA 1DDHA 3DBXA 3DECA 3D6GA 2CDGA 2Y72A 3TO2B 3TVMB 1BWMA 3MRMA 3DHJA 3QXAB 1KCLA 3HZYB 5KSBE 4XHJC 1F6LL 2P43B 3GRWH 1YUHB 2Z8RA 3S5LG 3UPRA 4NM4H 2G2RA 5JORA 3LHPL 2B0SH 2DOCA 5DWUL 4I3SH 3ARBC 3O9WA 4HEPG 3SE8H 1U8JB 5C0CA 5F7LB 4XNXH 2ZUQB 1QRKA 4D0DA 2F19H 2YRPA 4X98B 4NWUL 4NGHH 1FV1A 3P4MB 4JY5H 5I0ZA 5DUPH 1IBGH 2YD8A 4MWFA 4OD1L 4OI8A 5HJ3B 1LVEA 5EBWB 4HK3N 1QPPA 4FRWA 25C8L 3VGGA 5MI0C 5FKAB 3VH8B 3DI2B 5IKCB 1GH7A 4LCCC 2D03L 1T20B 3GIZH