4OF0A

Crystal structure of syg-1 d1-d2, refolded
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
246
structure length
230
Chain Sequence
b'QRIVEAPKDTLAAVGETAILTCRVEHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVKSHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGESRSKFEISQETVIAHVNETTQVESSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPNKIEVDSVKLSLRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SYG-1, isoform b
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
total genus 44
structure length 230
sequence length 246
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A02
3X3GL 1L9MA 1OP3K 1RQ5A 1CE6A 3JTTB 4MNQB 1EMTH 4NYLA 1RZ7L 3QO0B 2PO6A 3G5VB 4NM4L 1ADQL 3IKKA 4KK6D 4Q9BA 4P2QB 3LDBB 4XBPA 3MLXL 1FVDA 3RGVA 5HPMB 1MCPH 1QFUH 1HYSD 2XKUA 1LO2L 3HC3H 3OHXB 2NY5H 4WFED 2V2XA 4JM4L 2DLFH 3C6SA 4XVTH 1JNNH 2IBGA 1RUQH 4POYA 1LDSA 3E3QC 4ALAH 2R8SL 5HVHB 1T21B 1QLFA 2EZ0D 5EU4A 5DEFA 5B38A 3SE4C 2CRYA 5C08E 3KPTA 2VLKA 5DR5L 3UX9B 3P9WB 2DQJH 4PJ5A 3TBYA 5C2UB 5D72H 4OFYD 4PJGE 5CP7A 3B8YA 3MV7D 4QRQB 1OGAA 4LARL 5CEYA 5LJYH 1AR1C 4HKXB 1P5VA 4GKSA 2V7NB 3EJZD 4JM2C 4PJ7B 3ARDD 4YUEH 4Z0XA 3S5LA 1CFQB 3HC0B 3CFJB 5I71B 1ZLSH 1E4WH 5DJCA 5MEND 5AZ2H 1LEGA 5ACZB 4JDTL 1AXTL 2AXHA 4GAYB 2CLZB 1WLHA 2R2BB 5IJKA 3PNWA 3WL9A 5J11B 4M61A 2DQDH 3BRFA 5MERA 3MV7B 4AT6B 1ZTXL 1T7WA 3E8UH 1AGBA 1DBAL 1D9KA 3BKYH 5C0BD 1A6WL 3ARDB 3HRZB 4IJ3C 3UPRB 4H26B 5D71H 4YBLB 4XVJL 4YDJA 2OMBA 1MRCL 2W91A 4X7EC 3WN5B 3D0VB 5MENB 2M1KA 1I3UA 1EO8L 4NC1C 3D9AH 1F58H 3BGMB 5CBEB 4MJ5B 1CDBA 4Y4FD 4MMZC 1TITA 3ZLQC 4UU9B 4LCYB 5CUSL 1G6RB 4LBEB 5FB8A 4NFBA 2FIRT 4UIKL 3ZE0F 3IDMA 1FE8H 1HZHL 4ORZC 5BRZA 2NZ9D 5C0BB 5BV7L 3L7EA 2VUOA 1CBVH 3HE7D 4LGPB 4I48A 4MB4A 3RIAF 1QBBA 3MUZ1 5H35B 3FFCA 3TH3T 1JPSL 2IJ0C 3VFPB 3MV8D 4OLWH 1UH4A 3DNKA 4JFDD 4I9WE 4RBPK 4TQEL 1J86A 4PGCB 2Y06L 4HKBB 4PJDE 4HUKB 5DD1H 4Y4FB 3ZTNH 4OIIL 2BNRA 5K9JL 1NDMA 4IOSD 2I9TA 5IBTH 1T0MB 2VWEE 2CKBB 3WO4C 2R1XA 1J05B 4LCCC 3DVNB 5ERWA 3ZKND 4ODHL 5DMKB 4GG6B 6FABH 1G7LA 3D39D 3HE7B 3V79C 2ED7A 3T0DA 3HR5A 3OKEB 1KELH 3J7HA 4OT1L 3VH8G 3C6LD 1LEKA 4GAGH 3MV8B 3O3EB 2IPUG 4IDJL 5DVKA 3VXQA 4JFDB 4Y5XC 5EUKA 4ETYA 1YEKL 3HPJB 4LLVB 5T1MB 1NKRA 1RZFL 3MNVA 4RAUA 2YBRA 2FEDD 1U8MA 1A9EB 1H3PH 4NZTL 3RPIA 4UUJB 3LCYA 2PO6C 4XHQA 4UMGA 3CUPB 4CADB 4G7VL 3OJDA 3U1SL 4G8IB 4KDVA 1DZBA 3D39B 3TT1H 4R8WL 3T3PF 3RGVC 1RIUH 2NW3B 3UTTE 1RY7B 2ORBH 1F02I 4E41E 3C6LB 3TBVA 4F37K 3MA9L 4PRID 5A2JH 3FO9A 4Y19E 3VRJA 3SY0A 1LDPL 3LB6C 2EYSA 4WUKH 4LAJH 4DKFH 1F4XH 1FPTL 1Z9OA 3IAQA 4ZS6D 3U46A 5HYJE 4I8DA 1NDGA 3RVWC 2X4OB 4JN1H 3P9MB 4X99B 3RDTA 4S10A 4UT7H 1I1FA 3GNMH 4NP4H 3TH4T 2QTEA 5F6IB 1AIFA 4RSVA 5EU5B 3EOAB 4U1LB 4ZTPL 4AEFA 5FYKU 2E7CA 3KXFE 1A14L 3MUHL 1WT5A 4PRIB 3MMEB 1XFPA 1JN6B 4NO3B 3HA0A 4JM2D 5DHYB 1WF5A 2F5BH 1DSFH 2HG5A 4ZSOB 3X12A 1TJIH 4YHZL 4LPUA 5HHNA 4M7JH 1QLRB 5F7DB 3VFSA 4K8RC 2IAND 4M9PA 5IHUH 5JQ6L 1INQA 4PG2A 3T04D 1NFDA 1W72H 5INDA 3LN4A 3RBSA 3VXRD 1NMCB 1H3VA 3VU2A 3AS3A 2EDDA 1UGNA 5IJKC 4HWZA 3TT3L 2FECL 4N9OB 3GUTB 4JKPH 5SWSD 3BFOA 2IF7A 3Q3GA 2YA0A 4G9FA 4HHAA 1I3GL 3MNWB 2JF1A 3DRQA 1EX0A 1IMHC 1D9KC 4JM2B 3BKCL 1U8KB 5L7XH 5FOJA 4BH7B 1GVIA 1U3JA 1UENA 2XTJC 3UPAA 1MVFA 4OTXL 1K6QL 2P46B 1D5ZB 4P46D 2IANB 2OXGA 5IMLA 4YBQD 1LO3L 1KEML 1JWMB 3TFKD 3VXRB 1LO5A 1BFVH 3ZHLA 1NEZG 1TQCC 4JGUA 3C09C 1IC5H 5C6TL 1DBBL 4FQIL 3EHBC 5SWSB 2A9ML 1A6TB 1EAPB 1RJCA 5FYKH 1YEHL 5C0EA 1YEGL 2XA8H 1ZAGA 1ES0A 5CWSA 2BSTB 4HWBA 4DUWA 4LLYA 4JRXA 5C3LD 1U58A 4JJ5A 4HFUL 4GW1B 3QO1A 5MHSE 3GHBH 5JW5A 4NUGL 3S35X 3D18B 1U92B 2FSEA 4P46B 5F1IA 1KSRA 2P47B 4GRWH 4S1DD 5E8NA 2DQUH 3MLZH 4K7PX 2ZOKB 1DN0A 4KHXL 3GJFB 4DUXA 3BVNB 3UAJD 3IAGC 2AJXL 1IAII 1T1WA 4P5MB 4FNLL 3D2UA 4M6OH 1UB6A 3IFPA 1IAOA 5E56A 2EEAA 2BSRB 1C7SA 3WHE1 5C09D 3U30C 1U91B 3EZJB 1DVFD 1H8NA 4X5WB 4MD5A 4PY8I 4PLJC 4MS8D 1KCKA 2N1KA 4HV8B 3FB7B 4QHMB 4ODWB 5E24E 5T3XL 2IQ9H 4OZIB 3VFMB 5AG8A 4PP2A 4XBEL 1L7TL 2DL9A 3DV4A 1V3KA 2HH0H 2BCKA 5CJOL 3S96A 2LU3A 4DGVL 1IAIM 1QSFE 4BZ1H 2UZYB 1OHQA 2O5XH 4P3CH 1R5WB 5C09B 3TIDA 4DKEH 2ENYA 1DVFB 1JGLL 5LGHH 4U1NB 4WCYH 3N0PB 5BO1H 1T1XA 5EBMA 5C0GB 3RWDB 5KJRH 4NT6B 5DEZA 4Y5XB 2K7PA 4NZUH 5HDBE 5CEZH 5H37H 3IVKA 4NGHL 3PF2A 5C0DB 3LB6D 1P84K 1EO5A 1L0YA 3S35H 5E00A 4NYLB 15C8H 1U6AH 4OD3H 2P43B 4M1CC 3RDTC 1QFHA 3WE6A 5L6YH 4IRSD 4OAWB 4K7PH 1A3QA 3QWQB 3O4OC 3VD5A 4X6BA 2VITA 1FVDB 4F7TA 3OKLB 1ZANH 1GGBH 5GGTA 3S9DB 4XMPH 1CD8A 1WT5C 5C0NC 2B7DT 4AEHH 1HI6A 3ZL4L 2C9AA 1OSZA 2AJUH 3DIFA 4PGBA 2F9BT 3RVXD 2J8UA 2EO1A 4FFZL 1NGQH 3O3DB 4J3TA 4KH2A 3F8UB 3G6JF 3VGGA 4YHIB 1D5IH 4HK3N 4PG2C 3VH8A 3EYOB 3G04B 5EU4B 5I76B 3V52H 3B5HA 4LMQE 4JKLA 4MAYD 1BFOB 4IRSB 4X8JA 1YNLH 4QRRA 4GKOA 5DEGB 4M7LT 2VLKB 4OFIA 5ID0A 1N6QL 4MXVF 5I15L 5I1IL 5DRWA 1KTLA 3HAEG 3EJJX 4O2CA 3STBA 1F3JB 2YRPA 4P5TA 5IHLB 5JHDE 5IJVA 5EUOE 2CDFA 3CDCA 1DEEA 5E94A 5SWZE 5JR1H 2DQGH 4QRTB 3OMZA 3BDYL 2ZJSL 1UADC 2W0FB 4JO3H 5DQJB 1WBXB 4MAYB 5I9QC 1NAMA 1B3JA 1CK0H 3MFGB 1OTUC 3PNWB 2G5RA 5HGHA 4G3YH 1WIUA 1KLGB 1YY8A 4JFFD 4MNGB 1DQTA 2K1MA 1TJHL 4XTRC 1CZ8H 1MHPH 4OFKA 1PZUB 1AGBB 2FO4A 2X4NB 3L3KA 1NBVL 3MRKA 1IARB 3FN3A 5DUBB 3NA9L 3DJ9A 1SJHB 4WFGE 1EO7A 1MCQA 2VXVL 5DJAB 5FGBA 4YDJB 4Z7UB 4OB5H 1A21A 1JGVH 2VXTL 2A83B 1HILB 2UZIL 3VFWB 3RWHA 1CIDA 1MRFL 4RAHA 2YS4A 4ZOCA 3BEVA 4Z76B 4HC1A 5F96L 2C3GA 2NX5D 2XRAH 3T2QA 4JFFB 5HHQA 1XF2A 3AFLA 2RQ8A 3GBMH 1R3IH 3I84A 3LPGA 1MRDL 5BQ7B 2XWJA 2MTPA 4E0RB 3HMXA 1TTGA 4FQHB 3EYVB 4ZYKB 3VXME 2CUMA 1VFUA 3MRJB 4XNUH 3WJLA 3FB6B 3L7EB 3HMWH 4LASH 1GZQA 2ZPKL 5BV7B 3P40A 1JGUH 4OZGA 2AV7A 3D6GA 3QFDB 1FFOB 2AJVL 3CDGA 4GO6B 4WHDA 4XC3L 3V95A 1RJLA 2YD7A 4M43L 4D2NA 4XXCA 3VXUE 4RMVA 2KDGA 5L8JB 5C1MB 5GHWH 3ROOB 2Z31D 5DK2A 2V6HA 4HULB 4YEFA 1JZ2A 2BNRB 1V05A 2NX5B 4LFHG 4P4RA 3BGFC 4MMXC 2QV2A 3WFCH 4PRDA 2J6EA 5E08L 3NFNA 1NGPH 5HY9A 5JOEA 1F4HA 2WMPA 4YHPB 1CDIA 4IRZH 4XMKH 3FTGA 3KPSA 3V7AE 3QHFL 1XGTA 1S5IL 2BY2A 4HJJH 1ZLWK 1ED3A 1CU4L 1Q1JH 3PGFL 5F72S 5EZIL 3R06B 5GRUH 1IRAY 5EUKB 4FQCL 3M1BA 1S7XB 2ED9A 3BKML 3UTZA 2Z31B 4HIHA 1VADB 5TE4L 3GMNB 3IXTB 1AD0B 2OJEB 2Z91A 1NCDL 3BP5A 2R0KL 4TVPD 3TYGH 4JHZA 4YDVB 5B21A 4ZFGH 5AUMA 1T04B 1BD2D 1A3LH 1GC1C 2Z4QA 3U83A 1KC5L 2GKIA 5CGYD 2AAVA 1EFXA 1E28B 1I85A 12E8L 3O8XA 3CLEH 3U2SB 4XXDA 1JE6A 5I1HH 1UACL 1ITBB 1YQVH 2VLRE 1CR9L 2AEQL 5GJTL 1HKLH 2YSSB 2KQNA 5F3HA 1N3NA 1SEBA 1IC1A 1JHTB 3P9LA 3CMOH 4YDKH 2RIKA 1WZMA 5HYFA 4U1GC 3T4YB 2EEDA 3EZ8A 5JQHC 3AS0A 3EKCA 1BD2B 5HSFA 4YFLI 3LKPB 4UTBL 1I1FB 2I60L 4R90H 1H3GA 3AU1B 3DVIA 2PNDA 1L6ZA 1Q9OA 3FQNA 5E8EB 1A1NA 1DBJL 1DEDA 1T1ZB 5IW6A 4KUZH 3QUYA 3EYUL 2B8OT 1Q0XL 3N1QC 3U36B 2LABA 2QSQA 4AYFA 1CG9A 2L0DA 1M6OA 2EDWA 4OJFL 1LD9A 5HHNB 1W0VB 4XGZA 2V5MA 4O58H 1CF8L 4JO4L 1KJ2A 4TNVF 3REVB 1A7OH 4OD1L 5HDQH 5H8DA 4BQBA 5E9DD 3P4MA 4AIOA 4KVNL 3RL2A 5B3JE 2VAAB 5F7HA 4EZMA 4YH6A 4LLMB 4G5ZL 1QHOA 1PQZA 2ZG2A 4L4VA 1AXIB 1I3VA 1T0PB 2V17H 4H88H 4L4JA 2NR6D 4KC3B 1RIHH 2HP4A 4U05A 4XTRD 5DA0B 4ODSL 3G08A 2GJ6D 2V9QA 3DV6B 1U8PA 4JQIL 3X13A 3DX6B 3BRGC 5D7IF 3LHPH 5J89A 3MR9B 5FGBC 1YEIL 4LSRH 3WUWB 1ZS8A 3O4LA 3REWA 4HWBH 5D1XA 1FZOA 1YA5A 5E6IA 3IDXL 3OB0K 1MEXH 1T2QH 1H0DA 5E9DB 3OGCA 3DOSA 1OAXH 3ISWA 4XP9L 3QDJE 2VLMD 3K2UH 4OFDA 4TOYH 3FN0H 4IS6B 2X1XR 5IT2L 1QRKA 2VO5A 2IFGA 4OZFG 2Y4SA 3PDGA 2BMKB 3KS0H 4HLJA 2GJ6B 1RJZA 5F9DC 5CWSB 4JVWA 1CXFA 3QSKB 3WJLC 5J12C 2YPKA 3LMJL 4YZFE 3RTQA 5DI8B 1UCBH 2AJSH 4WV1B 1OLZA 2PYEE 5EFIB 3OL2A 5TE7H 3O2WH 3WDHA 8CGTA 4XXCC 1QFUL 4X7TB 5D7LD 5T3XD 5H2BB 3HC3L 4AQOA 3HAEA 5C8JA 4GW4A 1IAIL 5JLZA 4HW6A 1BPVA 1FLTX 3OG6B 4AL8H 4YDLB 4XVTL 5EO9B 5JW4N 4GG8A 3SE9L 4Z0BH 3IFPB 2R0WH 3MJ6A 1RUQL 2W59A 3GSWB 4ALAL 3OG4B 5M94B 1ACZA 1F3RB 5EZOH 5CKGA 4OLZH 3V4PH 4R4FL 5CKAA 5ICYA 5BS0D 4H1LB 4LNVA 2JKXA 1FDLL 4KK5D 4XCYB 3MRDB 2RR3A 5EDXA 3TWCH 3U9UB 1MHCB 3OKNA 4PY7A 5D72L 3PDOA 2H8PB 4IOIB 5D7LB 3RZCA 4LIQE 3V5HA 3QFJD 1IEBB 2AK1H 4MJIE 3WLBA 1N8ZB 2XOTA 3Q6GH 3BPCA 4BUGA 3EJYC 2F5AL 4YUEL 4OV6F 5IB3B 2LTQB 3DV4B 2ICEA 5FM5O 1ZHKB 3S96B 3SDYH 1M71B 1GGTA 1MCFA 5F8RC 1ZLSL 2A0LD 1QUNA 2CR6A 4R4BB 1E4WL 1LNUA 3VFGH 5GGRY 4AEEA 5EU7C 3BHBA 3V8CA 1U3YA 4JANA 5BS0B 1P7HL 1I85C 3AB0B 3O8XC 1UEMA 4LKCB 1T1XB 2B5IB 4GT7A 4U3XA 4POZC 4OUOA 1KYOJ 3RKDC 4J7RA 4LCWD 5DJ8A 2DICA 1NCUA 2IADB 3RUGE 1S78D 2HT3D 2OR7A 3BKYL 4Y16D 2Y07H 1AO7E 1SVCP 4JB9H 3NTCH 2JIXA 2HVJA 1J8HE 4WTWA 5D71L 5L8LB 1FIEA 3IDJA 3QXVA 1JIBA 4JZOB 5ILTL 5E8DH 2DM7A 4OZ4B 1T20B 1FG9C 1X5IA 3D9AL 5ADPH 4WWKD 4HMCA 4PRBB 2V2TB 1OVZA 1A1OA 3JTSA 3OV6A 2R29H 3G5ZA 3BN3B 1WBZB 5SX4I 3QUYC 2GK0A 2A73B 2NTFB 1HI6B 4JM2F 2VH5L 1OSZB 2X1QA 2AXGB 3DIFB 4LCWB 3BUYA 2NQCA 3VRLE 1CGXA 2OL3B 1JK8B 4QRPE 4Y16B 1FZKA 1CBVL 2DAVA 4U1GB 1YPZE 3KPLB 4M1DH 1UFUA 5FKPB 4OLWL 4JREB 4PJXA 4X8JB 8FABA 1ZMYA 1UM5L 3RIAK 4WWKB 4YE4L 3ETBF 3B9KA 1PG7X 4IHOA 1MHEA 3MBXH 2W1NA 3ZTNL 4ACPA 5D93B 1NAMH 5CSGA 5HD8C 4Y1AE 1FZMA 5IBTL 5KG9A 3VFVA 3PGCA 2JE8A 4S1SL 3JWOH 4K3EH 1MCCA 1TNMA 3L5IA 2APBA 5F1NA 4B5EA 6FABL 5IJVB 5LXGH 1BOYA 1UZ6E 3SGDH 1C1EH 2VR4A 5D1XC 5MEOA 5E6IC 3W9EA 1J18A 1KELL 4HUNB 3TIEB 3AAZB 4JCMA 4GAGL 1MNUL 4N68A 1KIUA 5DS8A 4JDVB 1WK0A 4PJAE 1JNLH 4KUCF 2VL4A 4NQEA 4OF0A 5E7FA 5IGXH 1IFHL 3IB4A 5F7LB 1T5XA 1H8SA 3HUJE 1FO0A 1L4IA 3AGVA 2LV4A 4RAVA 2YRLA 1XGYL 4YFLF 1RUML 2P8LA 1H3PL 4GRWF 4HC1H 4R9HA 5DFWH 1KCSL 1PDKA 5IF0B 3INUH 3UROR 3VG9C 2P1YA 3RTQC 1XR8A 3C87A 3NBNA 4G6KH 4HZAA 1FAIL 3HMXH 1CD9B 3L3DA 1MJ7H 3CXDH 3QWOB 3TPUB 2OZ4A 3U0PB 1C7TA 5IBLC 3BAEL 1KGCD 1J12A 1G7HB 3WYRA 4YHLL 43CAA 1RHFA 3BEVB 4LMQI 5CJXA 3UBXB 2PUQT 5BZDB 1XF2B 4WUKL 1A3RH 1EH9A 3GMPB 4Z5RA 1F4XL 2CJUH 3EYSH 3H8NA 3QUXD 2HMIC 2UYLA 1T5WA 3T0BA 3KPNB 4JN1L 3CVIL 5D2NB 1NQBA 2J6EH 2OI9C 1OAQH 4PGEB 2BVTA 1ROWA 1PG7H 4XH2A 5KSBB 3OPZH 1KB9J 4JY6B 4HS6B 4BA8A 4D0CA 3S8WA 3RZCC 4G6JL 4ZODA 4KY1H 3HNTH 3PWVB 5EOCL 5FUOH 5DK2B 4JAMA 2F5BL 5EWIH 1S9XB 1DSFL 1T89A 1TJIL 3T0VA 3QUXB 4I3RH 4M7JL 3KAAA 5DFTA 3F12B 1A6ZA 1MJJA 1W72L 3Q6FA 1MCJA 1JWUB 5I1DA 4PJEE 1R3JB 3O8XD 5I0DA 5E2VL 1GGCH 2W07A 4NZRH 3H42H 1W0WB 4POZD 4OZFA 4ZAKD 2XN9A 3KYNB 4C56D 3HI6H 1UB5B 3M1BB 5FYJU 1L0QA 4D9QD 1BFTA 2FDBP 2GTWA 3MCG1 1IGCH 1Z5LA 1NMBH 4QOKA 3LKQA 4FQJH 1RZKC 3V6OE 1B88A 2WAHA 1IEAA 2NY3C 1INDL 2JB6A 3L95A 1A1MA 3QI9D 3ZZ1A 5I73C 4MJ4A 3O8XB 2X2YA 2YXFA 4BZYA 5DDHA 4XXDB 1BFVL 2XFXB 4CVZA 5T3ZE 1FVCB 2YA1A 4PRHA 4ZAKB 5I18H 4C56B 3O6FA 5IVOA 3H6JA 4L8CB 2XA8L 5I1LB 3QXDA 5C70A 4NQXA 3TO2B 2F8OA 3S97C 5F88A 4Z7OE 1MELA 3VG0H 4QXTA 4GQPH 1T3FB 5ACMA 1I7RB 4HKZB 3QI9B 2FX8L 1YN6A 2OXHA 5ESAB 2X89A 2DQUL 3MLZL 3QG6A 2EC9U 3B9KC 1KJ2H 1H15A 2PR4L 1U8OB 3QPQC 3MX0A 3ZYOA 1JTTA 4QT5B 3QQ3A 4M6OL 2G75B 2FO1A 3SDXA 3MLRH 3VGEA 2H26B 4Q2ZA 5FYJH 5B22A 3GMQA 5HYIA 1VHPA 5IVXA 2BHUA 5C0CE 4MSWB 3CDYA 2DWEB 2BNUB 5FGCB 4PJ8A 5AD0B 2IQ9L 2YR3A 3MREA 1BLNA 4JG1H 4GW5A 1IGFH 3QUMH 1CXEA 3GMMB 5EG6C 1FSKB 3RI5F 1A4KA 4YXKL 2FHFA 1EPFA 4ZUSB 2HH0L 1NC2A 5K9QG 2OTUB 3X13B 2BHYA 4I0PA 2O5XL 4P3CL 5DD5H 1M05A 3QUZA 2SEBA 4DKEL 2VLLA 5LGHL 4WCYL 3ARGC 3LQMA 1IC4L 3LRGA 1S7UA 5KJRL 3HZYB 2PW1A 2OSLA 1W0YT 3C2SA 5CJXC 4NZUL 3SDDD 4R7NA 1XZ0A 4OF7A 4ZUVB 5L0QC 2P49B 4L8SB 3RHWF 3L3GB 2BOCB 1Q94B 1Z6JT 4J8RA 4JPIA 4X6CB 3S35L 3HAEH 2DIBA 1N4XH 4WFFD 1U6AL 4OD3L 4WI8A 1JL8A 5JPMB 1CLOH 4LSVH 1FNGB 1QEWB 3BIBX 2YD2A 2QLVB 4WUUD 2DIJA 1YMMD 5GIRA 4DN4L 3QEQA 2V2WA 1ZANL 2WP3T 3T4AB 4AEHL 4Z7WE 5DO2C 2AJUL 3KPQB 3BYYA 3GMRB 5D5MB 3EFFA 1GJIA 1TMCB 1I1AA 3QJHB 5EIQA 5JMOC 3MLWH 3BQUA 3KDMB 3IF1B 1T89C 2VE6A 3OJMB 3BO8A 3LKSA 4B7LA 3H0TB 2XWBA 1D5IL 4FXGA 3HE6D 3MRRB 4X9HA 4HS3A 5J8OA 3SKJH 5C9KA 3V52L 1YNLL 2OI9B 1YMMB 4ELMB 4FQQA 5BXFB 4ZNCD 1SJXA 1U8JB 5GGQH 5F7MC 4Y2DD 1F6AA 1CL7H 3D0LB 3MV01 3BPCB 4NQSB 2V5YA 1QSZA 1S7RA 1QO3B 3U4EB 3L1OH 3M17B 4CDHA 3SKOB 1HIMH 3H9SA 1BF2A 1CD1B 2NY3D 3RNKB 3GSQA 5ID1A 4R7DA 1PEWA 3BHBB 5MP6H 5JOFA 1CK0L 1KPRB 2Q7YB 1U41A 3AC0A 4G3YL 3BEWB 4NO2B 4F57L 3WXVH 4Y4KD 1UXSA 5D8JH 4H8WL 3D3VD 3PUCA 2H9GB 4Y2DB 3C9NB 3O6FC 1CZ8L 2GK2A 1MHPL 1XF4A 3U82B 1GAFH 4EI6B 3MRNA 2Z92A 5F97E 3RWIB 4X80H 1NFDF 5JHLH 2XY1A 4PREB 1MIML 3MFFB 1F2QA 2NY3B 4HWNA 4OB5L 4XVSL 1JGVL 4GRLD 1A5FH 5B8CB 5I73B 1IL1A 2VZVA 2R2HA 4PJBB 2DJUA 2XRAL 1HHKA 4Y4KB 3GBML 1R3IL 2G2RA 3D3VB 5FM8A 4UAOC 1NLDH 1PG7W 3KPMA 4YGVB 3MRQA 2I26N 4M03A 4O00A 3FO2A 4XP1H 2VLJA 3WIHA 4H25B 4NRXB 4YX2H 5LQBH 4XNUL 1LK3H 3HMWL 4LASL 5SV3A 4Z7VA 1JGUL 4LCUA 1DQLL 4XHJD 4HBCL 3IJYB 5HHVH 1XMWA 4PJ8C 2FZ3B 1IILE 4GRLB 5C0AA 3F62A 2ZCKH 2AERT 1GZPB 4Z7QF 1R3KB 2VDPH 5GHWL 4YHOH 5ESVA 3MJ7B 5SWQB 2BSSA 2ERJB 2EKSA 1FZMB 3F7VB 4WNQA 4NQDA 5D2LA 3WFCL 4NO5A 2NY1D 4EI5A 2APXA 4LHUG 3VXSE 1UEYA 3UDWA 2B39A 5IB5A 1FO0H 1I8MB 3ECBA 4I0PC 4LKXB 4XMKL 3SDCD 1BZ7A 3TJEL 3QUZC 4RMTA 2QSTA 3W9DB 4YXLH 3GSVA 3O2DH 5EIIB 2AEPH 3FHQA 1UH3A 3OBAA 3OR6B 4HJJL 5E6ZA 1P4IL 3ARGD 4W70A 4UDUA 1UXWB 5GRUL 3CFDB 3VFNB 2DKUA 2OZ4H 2FL5B 1P53A 4P2YA 3GIVA 3OKDB 1PZ5B 4NKDA 4N0UA 1Y6NR 3G5YA 1IGMH 5C08D 2RCSH 1H9VA 2Q6WB 5GISL 5FOBB 4OI9A 3DHMA 3TYGL 2P8LB 2BX5A 2FEEI 2NY1B 3TPKA 1X7QA 1A3LL 4X4YB 4HDIA 1AKJA 1XH3B 4X98A 3SDCB 4MLIA 3VWKD 2LAAA 4L9DA 2NLJA 5GGRA 3MJ8B 4X4ME 4EOWL 5I1HL 2CUIA 2IH3A 3ARGB 1YQVL 4HPYH 4HIIA 2CXKA 4JPWL 1HQRA 4QHLB 5GRJL 1I1AC 5FO8A 4HF5L 3DSFH 5ANME 1HOCB 3BQUC 4YDKL 4S2SA 3U48A 3WNMA 1A7NH 4D0BA 3WLWC 5C08B 3MGTA 4PJHA 2GJZA 2UYLB 3OKOA 3N1PC 5F9JA 4PJGB 3CSYA 4Q9RH 1PY9A 2VXUH 3NMEA 1NH6A 4M6NL 3SBWA 4JDZB 5DGQA 3VWKB 2P4AB 1AP2A 4K07A 3SQOH 1YNTB 2YC1A 5JHDA 2H6PB 2VDRH 3HRPA 4LQ1A 1L0XA 4OZFH 4LRIA 3TN0D 1SJEA 3K0WA 5EULV 3FN9A 4CN1A 4DZ8A 5C9JA 4QYOB 2X6MA 5FK9B 5FECB 2BVPB 1A7OL 3PWNB 1K9TA 4KGLA 4HFWB 3I02B 4TNVK 3LKRA 2J8UF 4EDXA 1BQHB 4WEBH 2DRUA 2V17L 1RIHL 1T6VN 1KLFA 2ZCLH 4LP5A 2BFVH 4HUVA 4PLNC 3RAJH 2ZG1A 3ZDXF 3TN0B 4I9WD 1FFRA 3ILQD 3LHPL 1IT9H 4M6AA 4WO4D 1OD9A 4ZTOH 3BZEA 1LVEA 2I07A 3BKJH 4HWBL 3NIDE 25C8H 4X6DE 1SYSA 1MEXL 4LSPH 1OAXL 3ZE1E 5E5UB 4TOYL 3K2UL 2FX7H 2R2CA 1XR9A 3BPLC 4CBPA 3CNKA 3FQUA 1S8DB 2GFBA 3UTSA 1EGJA 1QRNA 1D5MB 2EE2A 2HTKC 4YR6A 4OQTL 3W11D 4DOHE 1WGOA 4WO4B 3SKNA 1UCBL 5GRYA 4PJDB 4QXTB 5JORA 4L9LB 3O2WL 1NGYB 4DW2H 5I66B 1EHNA 4JG0H 2VZ1A 5HGDB 2HT4D 5B39B 4AM0A 4AL8L 1G7JB 4ONOA 5ALCH 3QIWC 2R0WL 4EI5C 4P2RE 3UDWC 3UTTD 3V7MA 5IQ7H 4E41D 3DUUA 5EZOL 4XNYH 4OLZL 3V4PL 2AJZB 3ARSA 4PV8B 5HGAA 3WHE0 4WHCA 4FTVA 1GHFH 2DKSA 1HXYA 2D0GA 2OBGA 4YPGB 4Y19D 3TWCL 2BNQE 1P9MA 1AQDB 2EE3A 3KR3L 3MV9E 4OBRA 5HYJD 1CL7I 3QUKA 3I3EA 3L3IB 3SE8H 4ZNEE 4GW5B 3CU7A 3Q6GL 4WRLA 5KW9L 2VDOH 1EAJA 2DOCA 1DDHB 1YDPA 3VI4E 3BP6A 4OZGF 1BZ9A 3D85D 4DFIA 4OGAC 4E41B 3KXFD 5EO0B 2X41A 1HSBB 3O6ML 1GRWA 2FWOB 3IFNH 1MCDA 3OKKB 4MCYB 4XP6H 5GGVH 3QUZB 2DBJA 2E9JA 3U0WH 2YD3A 4DGIH 4I4WA 5GGUB 4Y19B 2BXYA 4NBXB 2ZUSA 3KPRE 2B1HH 3PABB 3QZWG 4QWWC 5HYJB 1VFOA 4JFZH 1NGZA 3KS0J 3VE0B 2UY6A 1PGRB 5DLML 4V1DA 5H94A 1OAZH 1FP5A 1URLA 1UM6H 2B4CC 2DQHL 1KG0A 2F54A 2Y07L 4UQ2A 4F33A 1IKNA 4M8QB 3PWJA 3UYRH 5E8DL 3D85B 2XNAA 2YD8A 3KXFB 3WKMH 3SBWC 4U1IB 1NC4D 4M8VA 3DXAE 2W65B 2C7UA 4R0LB 9CGTA 5ADPL 2BC4B 4XB8A 4P23D 2V2WB 1YMHA 4RQQB 2R29L 4G43B 4AY0A 3P77A 1E4XH 5B4MC 5C2BL 1AXSA 4L3CA 5JDSA 3AM8A 3T0EE 1KN4H 5HHOE 3LQZB 5D7SH 1O5DT 4LHUA 4YO0A 1MFCL 4NDMA 2QJDA 2YPLE 4LRIC 4G42B 4LOUC 1NCTA 5D70H 2J4WH 1VENA 4AENA 2C1PB 5HBBA 3QBTB 4ZFZA 5FKAA 4HUXA 3EDDA 3F7YA 4M1DL 1YN7A 4GRMB 1VGKA 2UV3A 4F7PB 4AEIH 1NC4B 1KB5H 1N5AB 2GCYA 1BVLA 3D25B 4P23B 3IETA 3MBXL 2XV6B 1NAML 1VB9A 3G5XA 2R0ZL 3NH7H 4N8VA 1ZWIA 5MHSD 4LAQL 4F2MA 3JWOL 1WBYA 4K3EL 1FZJA 1M7DA 5GS1B 4MQSB 2CIIB 3W39B 3NFSL 3D69B 4HH9A 1CE1L 2OQJB 3P4LA 2DMBA 3S34H 5LXGL 4EIZC 1PKQE 4O4YH 3GRWH 3QDMA 5DHVB 5D1ZA 1GGIH 3MLUH 1JNHB 3C08H 2PW2A 1BF8A 5ELIA 2VERN 2X1PA 5AYQA 3HKFA 1JNLL 1ZLUH 3FO1A 2ADGB 5HGGS 5IGXL 3LQAH 3MXVL 1D7FA 2JB5H 1AI1H 1NGWA 3O41B 5A16B 1B2WH 1XF4B 5DRNB 3DBXB 4N1EA 3MRNB 5MEPB 4GH7B 5GZOD 1JTPA 5EO1B 4NPYA 1KPVB 4Z77A 1QLEH 4ESKA 3HMXL 4TYUA 2FHBA 5E0QA 1MJ7L 2FBJH 3WIHH 1I7ZB 1FYHB 3WFHB 5IM7B 1QSEA 4I0CC 3QAZB 2GITB 4XPFL 1CS6A 5EBWA 4BSWA 1QSFD 4JR9L 4UV7H 3SGKA 4XP4L 5TQ2H 1A3RL 1S7SB 2F15A 2EIZA 3QIWD 2CJUL 3EYSL 3QXTA 1U93A 1JGEB 3EO9H 3NGBC 3G6DL 4LIQL 1UZ8B 2J6EL 2XYCA 2JELH 5MEQA 1OAQL 4PG9A 1KENH 3T65B 1P9MC 1PG7L 2QQKH 4LVHB 3VA2C 3OPZL 3UO1H 4UV4H 1OAYH 2B0SH 5C0JB 5BVJA 5I75B 4KY1L 4QGTA 3HNTL 1QSFB 1MCSA 4B50A 5ESVB 5DJ0A 5GGSY 3SO3C 3QCVL 4L4TA 2EO9A 3QIWB 4D0DB 3FCTA 4F58H 4I3RL 3HZVB 1IM3A 5FXCH 1CFNA 4MQ7A 5ICXA 5GRVL 4KZDL 2E3VA 4PRPA 1JZ7A 4V2BA 3S4SB 4NZRL 1AD9A 4FFWC 3NCJH 2QHRH 4WW1A 1P7QD 1Z9LA 3I6LE 3RUGA 1FL3B 3ULSA 5C0FB 3IDYB 4X0KA 2W0LA 5FO7B 2X42A 3LKOB 4ONHB 4RGNC 5CEXA 2RFXB 2BY0A 1BQSA 1IGCL 2HKHH 1NBZA 4UNTA 1IKNC 4FQJL 2FEEL 4CVWA 3BZFA 3T1FA 2YWYA 4BH8A 2NY0C 4XBGB 1P7QB 2PF6A 3DGGA 3AM8C 1RVFH 5SWZD 5I18L 1LK2A 2ARJB 2WWMC 3QDGE 3F5WA 3MODH 4M4RA 2R4SH 2DN7A 4DUVA 2MPAH 3O45A 3AY4A 5KBNC 3VG0L 4QF1B 1ZHBB 3LD8C 5HI3D 4EEEA 5T5NF 1YC7A 3BXNB 3UYOD 4Y1AA 3P0YL 5MI0C 4QHUB 4PJCA 5FUZH 1OQXA 1KJ2L 3KNBB 5F21B 3DECA 4LDEB 4WFGD 3BW9B 5JHDB 2O26U 1NCAH 5EUOB 1YNKH 5IEKA 5IB2A 5SWZB 4UTAL 2IWGA 4OLEA 3MLRL 4OF8A 2WANA 5EBLA 1Y0LB 5FYJL 2XXMB 4HXBH 3ROLB 2YPVH 4JRYE 3MGOA 3WSQH 3VJ6A 5C9JB 4OGXH 4XPHH 4PJFE 4TSCH 5F7NC 5DD6B 3VFTB 5JA9A 4NJ9H 5I1GH 4P9MH 2GY5A 4P3DB 3GMOB 4NNXA 3DLQR 4OCSH 4JG1L 3VXMD 2VIRA 3QUML 1YUHB 4P49A 4XCNA 1DE4A 4LSSH 1C12B 3MLTA 1R5VB 4BKLA 2HFFA 3RWJB 4OM1H 2ZG3A 4OUUA 4HS8L 4KI5E 4TRPH 3O0RL 3QDAA 3E6HB 3JWDH 3RI5K 1CLYL 5T1DH 2XZQH 3VXUD 1HQ4B 2AKRA 4PJXF 2I5YL 1EGJH 5C07E 4RNRA 2APVA 4KQ3H 1N6UA 3VXOA 4ODVH 1G0YR 1OP5K 5IMKA 1YZZA 3T1WA 1ONQB 4M6MH 4CU8A 1GYAA 2VOTA 3NFPB 1T22A 1NCBH 3VXTA 5CHNB 2PCPB 5DJYA 4QXGH 1BMGA 1XR9B 3VXMB 3SGKC 2YN5A 2CK2A 2UVFA 3FQUB 4MDIA 1MFAH 2P42B 2ADIB 2IMNA 2VSDA 1KIPA 3PXJA 1CGSH 1CLOL 4LSVL 4OCXH 2FJFB 3VXUB 3WNKA 4HUUA 2W0PA 5DJZA 4NRYB 3PP4H 1DQDH 4P2CG 5DA4A 3RVUC 1PSKH 1WIOA 4ODBD 5F3BB 3MLWL 4P57A 4ONFH 5D1QA 1A6AB 4RIRB 2G5BA 2VLRD 3SKJL 2Y6SD 1VA9A 3NCYS 5ESQB 3EGSB 1CFSB 5FO9A 3DYOA 1SY6A 5GGQL 3E2HB 1CL7L 5F89A 3V6OA 1R5IA 2B2XH 3KHQA 4PBXA 4TNWF 3DSNA 4FQ1L 5EU6E 4XPAH 4MZ3A 3IU4H 1ZK9A 3FOLB 2WUBH 2DBLL 3BP6B 4IMLB 1C5CH 1N59B 2F53E 2QBWA 3RWGA 5JPNA 1RFDH 2VLRB 3HG1A 4QY8B 1N2RB 5L2KA 2DQIL 4HIEB 2C3VA 4YHKH 2Z93B 1I1CA 4ODUA 3RA7H 3WXVL 3BZ4A 1U95B 1RZIA 1VFMA 2DLGA 2AABH 3RWCA 1EJ6A 5DRZA 5H94B 5J9PA 1REIA 4YBHA 4ONGH 2ITCA 1QFWM 4B53A 3PWPA 3FQXB 5GQBA 5K9KB 4X80L 3AY4C 4JFYB 1TJGH 5DRXA 5JHLL 3RGHA 3T77B 1M7XA 4FA8A 1NANH 4MD0B 3CPLA 1LP9E 5DT1H 4BZ2H 2ZKHL 1RJYA 2PTTB 3T8XB 2ATKB 2Q1EA 2H1PH 4ZMAT 3ULVC 5FA4B 4GUPA 3MA7A 4P5KA 1U3HD 1WITA 1X5AA 4XP1L 5FDYA 4GKNA 4YX2L 4X8XA 1LK3L 2MCG1 3QDJD 4Q58C 4PLOB 3UC0H 1C8PA 2NXZC 4ZOEA 1ZT7B 1WCBB 5EN2B 1QSVA 3BWUC 4W4NA 1YN7B 2WWKT 3BP7A 5HHVL 1S7QA 3RQ3A 2F74B 2WQRA 5F9OH 1G7MA 2BDNH 4KK8D 5MI0B 5CD5D 6CGTA 2ADFH 1MCEA 4YHOL 2A9NH 4A6YL 4HK3J 4N8VB 5DK3A 1ORSA 2DTMH 1R24A 1VESA 1E0OB 1FFPA 1E6JH 5I16B 1WAAA 2PYED 4IRJA 1NCNA 1FZJB 1CICA 5IB4A 3V4VH 4KROC 1FO0L 1U3HB 5DC9B 5LWYL 3QDJB 3O2DL 2AEPL 4S11A 3B2VH 1SEQH 4OSUL 3ZE2E 4U7MA 5EZJB 2CKNA 2DIAA 4ZD3H 5DMGC 5T1KA 2GIYA 2QEJA 3WNNA 4RGMB 3I2CH 3FO1B 3GSRA 4H5SA 1N6VA 3SDXF 3TBWA 3FRUB 4NWTH 3IDGA 1I1YB 1IGML 1K8DB 3GSNH 2RCSL 1BQLH 2EYTB 2PYEB 5JXEA 3WEXA 3PJSA 2CR3A 3LH2H 3KYMB 5J4MA 5IVXF 4N5ED 4NHUA 3E6FB 5DK0A 4HUWA 2VDMH 4N9GB 3VFRA 3HLAA 2OLDA 2W60B 4MJID 4HQQH 4PR5A 1ZKAA 3I6GB 3CFIC 3NVQA 4CW1A 3IGAA 4HPYL 5IESH 2Y5EA 4JY4A 2NW2B 5DJXB 3FKUS 3RVUD 1QR1A 3DSFL 1R3HB 3B6SA 1MQ8A 2H32A 5D1QC 4C55A 5F6HI 1HHGA 1A7NL 1GOHA 2XIDA 3QQ9D 1HH9B 5K9QI 2LAGB 1O7SA 2NY4C 1I7UB 1J10A 4NSKB 4R96B 1DN2A 3NCFB 5D6CA 4WTZG 3T2OA 5E1AA 3O6KH 2L7UA 2WV3A 4X4XB 2WINA 4Y5VB 5JZ7C 1AO7D 3DMMD 4LEXH 3PWUA 3QEUB 2DYPA 5IEHB 3V6OC 5FYLH 2VDRL 1J8HD 3MPCA 3PQYE 5TDNA 2ZUXA 5HHPB 3X11A 5I30H 5I6XC 1MCBA 3CFKA 2R9HC 3FCTB 5CLWA 3STZA 1FYTA 3BPNB 4LCIH 1OWRM 5CD3B 3E1F1 4XCCL 2WIIB 3LN5A 3FT2A 4GLRH 1CFBA 1P4LA 3RNQA 4K3HA 1B0WA 3MBED 3Q5OA 4QRPD 3RUGB 1X3DA 1LE9B 1AO7B 4LEOA 3DMMB 4WEBL 2D4DA 5KAQG 3BT2L 4HGWB 1U3ZA 1J8HB 5CEXB 4PTTB 4LPTA 3GMLB 5F93C 2LU7A 3K7UA 3RAJL 4PJIA 1RZ8A 1QP1A 3TYFB 4UIMB 1S7TB 2XZZA 4YJZL 1CYGA 3DYMA 2DQCH 5TF0A 4ZTOL 2W38A 1CT8A 4I2XE 2DI9A 3TBSA 1N5YL 5TE6H 2E5EA 2PXYD 4Y1AD 2BOBB 2EDRA 4UT9H 5IB1A 3CMGA 4LSPL 2IPUK 3TVMD 3UZVB 2X4SA 2JCCA 4NKOB 5DJ6A 2HYMA 2FX7L 5TPWH 4QRPB 4BFEA 1MWAB 1YPZB 1U8LA 4Y4HD 4JPVH 1FJ1A 1BEYL 5KN5B 5JO5A 3A67H 2HJKA 2D31A 1XGRB 4NBYB 3VRIB 1HINH 4WEMB 3MLYL 2PXYB 4Y1AB 3TNMA 4DW2L 1FNEB 4BQCA 5K59F 3KPPA 3GSOB 4JG0L 3ZE0E 2I24N 4LVOB 5AG9A 3G6AB 4U2ZA 2GTZA 4BYHA 1X4YA 1XAUA 3SJVA 2DLTA 2IQAA 4OLYH 5ALCL 1CICC 1MVUA 3BESR 3HI1A 1I4FA 1JPFB 4Y4HB 1OTSD 5IQ7L 1BVKA 4XNYL 4A2MA 3CFEA 3VW3H 1ZHLA 2HLFC 1B4RA 1DUYA 4PJAB 3IXAA 1GHFL 4KJYA 1PEZA 1ETZA 1INEH 4YNYA 2BVQA 5AYUH 2ILLA 3HUJB 4JY5H 5I1CH 1M1SA 1BBDH 4GKZA 2JJUA 1C08B 1UVQA 2OTWB 4OIAA 4RGOL 4L1DA 2CUHA 3JZ7A 2VDOL 3C2AH 4WJ5B 1AGEB 3MLTB 2HFFB 2OK0H 5JXEC 2X10A 1MCHA 1OLLA 2MCPH 1OTTC 1TZHB 3C5JB 3VXPA 2A6KB 3OJVC 4Z7VF 2D9QB 2AKRB 3IFNL 3U0WL 1KNOA 3W2DH 1X6NA 2EDYA 4YK4B 5D9SA 1LEIA 5IMKB 4QLRA 2YKLL 1CDUA 5DC0A 1A4JB 2B1HL 4K3GA 4DZBA 2H2SC 2AXFA 3P4NB 4JFZL 2C4XA 5D2LF 3H9HA 3X14A 3IDNA 1OAZL 3OXSB 4MXQD 1ZSDB 1UM6L 3V6FA 5CP3A 4NJAH 3U7WH 2CDEB 2VABA 1J1OH 1F4YH 3T3PE 3U6RB 1Q8MA 3EFDH 2EDKA 1NANI 3IFOA 2E7LA 4M48H 4P2OA 4AZ8A 4LU5L 3WKML 4JJHA 5ALBH 5I74C 4HUUB 2GAZA 3NIGF 3R1GH 2FRGP 4JZJA 5IV2A 1RK1B 4K2UH 4QCIB 4M93C 4U2YA 2DWDA 1FH5H 3R8QA 1KN4L 4EXPX 1D5BB 4POUB 3RIFF 2AK4E 2Q8AL 3MNZA 1YEDB 3BUTA 2K3TA 4OGYL 3ARXA 5D70L 2J4WL 4YC2C 4PJEB 3IJHA 4XVUC 1FC1A 4RMUA 5T3ZD 3JV4A 3QXUA 5FF6A 5GSRA 1XGQB 4FQXD 1OGTB 1U8QA 2DDQL 3CVHB 3QQ4B 1KB5L 3LSOA 5K9OA 4K7PY 3OX8A 3P4OA 3GHEH 4XCFH 4Z95L 3IU3A 1VEMA 2A77L 1R5IB 3H7BA 4TUOB 3UZQA 3MRFB 4PJHF 3I75A 2EDTA 3L3JB 4UDTA 2NY6D 4LFHD 2MHAA 1UWXH 1ZVSA 3S34L 3HNVH 4O4YL 4ZFOB 2EH7H 3GRWL 3L7FA 3OF6A 3QIBA 1EFQA 4YHNB 2YHGA 3QEHB 3MLUL 3C08L 4K71C 5DQDL 4TSAH 4FQXB 5A3IC 4RWYH 1Q9WB 3ARED 3MSPA 3LQAL 4MB5A 2JB5L 1AI1L 1J0IA 3ARBA 4ODUB 2IAMD 2V7HA 2QKIB 2HVKA 3Q48A 2P5WA 3V5DA 3RWCB 4M62L 4C54A 4Y5YA 5C0CD 1IVLA 5J0BA 2NY6B 3OB8A 4KQ4L 1J1XH 4GXUN 1A6UH 1QLEL 3PGDB 1KBGL 2Y36H 5FA3B 3DO7A 4RFEA 2FBJL 3WIHL 1LWRA 3MYJA 3QULA 5DHXB 4W4OA 3WFDH 3AREB 4UV7L 4L5FH 4I1NB 4XNZC 2HAZA 3DETC 4YHML 2IAMB 4HJ0D 2PTUA 5IFJB 1FFQA 3WHXA 4O51A 3QWRD 4N0CD 2XQYK 4EVNA 2AV1A 5C0CB 4KKLC 3P11H 4P0DA 5DFVC 3PV6B 3B8SA 1D5XA 1N64H 2IFFH 4OZHA 1JVKA 2QQKL 4ODXA 3UO1L 4UV4L 2R15A 2B0SL 3RL1A 1G7MB 3D87B 4JFEA 4NN5C 2ZUQB 1OL0A 3EOBA 3JTTA 4QGYA 5IMOB 5F7EH 2VMFA 3Q2CA 3RRQA 2AJ3B 3QO0A 4A6YB 1FFPB 3G5VA 2R69H 3VD9A 5IB4B 1OTTD 2Z35B 1SVZA 4O2FB 4P2QA 4OBSA 4XX1G 3MROA 1MCWW 5CGMA 1FL6B 5HPMA 2DB8A 4GLRI 2V9RA 1YC8A 4JGMA 3FQRB 1BAFH 4LSQH 4ERSH 3OHXA 3LRSB 1TCRB 2FNBA 2EICA 3LVEA 3GIZL 2WBJD 1RHHB 3BN9D 4UBDD 2BRRH 1T21A 3NABH 3DXAA 2HKHL 4U6HB 2MWCA 1NMAH 3L6FB 4HIXH 3CD4A 3WEXB 3PJSB 2H32H 2E7LC 4P2OC 5E2WL 1V8HA 4Z7WB 5GPRA 1SJVA 4JZJC 4WDIB 3IGAB 4NNYA 4PJ7A 1NBYB 3KLDA 2EH8H 2F58H 1CFQA 4OQ1A 3HC0A 1RVFL 3IFLH 1IC7H 2WBJB 3MODL 2R4SL 4IOFC 2MPAL 2HFEB 3C60D 1QD0A 2OCFD 5ACZA 1HHIB 3OXRB 4GAYA 2CLZA 5HI5C 2R2BA 4C83A 3FOMB 1AY1H 5I74B 4OFYA 3L5WB 3GKWH 5FUZL 3MV7A 5JXAL 1WTGT 1TLKA 3CAFA 4JPKL 3ZT5A 4KMTH 4RCAA 5KSAD 3UZEA 3NN8B 1NCAL 3ARDA 3UPRA 1YNKL 4H26A 3G6JE 2XPGB 4O2EB 4P4KD 1UCTA 5FGRA 3WN5A 3D0VA 5MENA 2YPVL 1KXTB 3C60B 3QIBC 3WSQL 2HJFB 3B9DA 2DKMA 3BGMA 3LIZL 4OGXL 4XPHL 4D8PB 4MJ5A 1DUZB 4NN6B 3GZKA 2VQ1B 4UU9A 4LCYA 2KL6A 5DMIH 4KAQL 4NJ9L 1G6RA 5I1GL 4LBEA 3FHAA 2AXJA 4G8GE 4MXVE 1MI5E 4OCSL 3ESUF 3ARBC 4LLWB 1JI1A 1K85A 3STLA 4WGWB 5IR1B 1F13A 4BSVB 5KSAB 2C4FT 4LSSL 4NQVB 5C0BA 4Y5YC 4OM1L 4I3GA 1B4JH 1RV6X 2FD6L 5DJ2B 1K2DB 3MRLB 5FUCE 4G80B 3UJJL 3JWDL 4P4KB 3WIIH 5T1DL 4CDGC 2W9EH 2XZQL 3VFPA 1KACB 1EGJL 5JMRA 4PGCA 1RUPH 4HKBA 4KQ3L 4Y4FA 5DGRA 4W4OC 3Q1SH 4M6ML 1JPTH 4MX7A 1NCBL 1T0MA 3VXSD 4QXGL 2AQ1A 1VERA 2CKBA 2DM2A 5F6HJ 3UTQB 3OSKA 5CAYB 4FQ2H 4JHAH 1J05A 3DVNA 5DMKA 4GG6A 3HTLX 4N8PA 4I13B 1T66D 2XZAL 1FJ1B 5FHAH 1CGSL 3UJTH 4JFHE 2EYRB 1YJDC 1IGIH 2HJKB 1TETL 2P5EE 3MV8A 4U1KB 5I19H 4JFDA 3LEYH 4K7FB 4ETQB 5B38G 3KPOA 3PP4L 5JW3L 3HPJA 4LLVA 5T1MA 1DQDL 4YZFF 1A9EA 3JV6B 3VXSB 3BIKB 3I9GH 2GTZB 1YQ2A 3PP3H 4UUJA 5FV1L 5L2JB 2IQAB 4ONFL 5HI4C 3CUPA 2WBKA 32C2A 4R97B 4CADA 3S88L 5LAXB 4G8IA 1BVKB 3CK0L 1LE5B 4R4NC 1ZHLB 2NW3A 4O9HH 2Z9TA 4G8EB 4OCMC 3C6LA 2GSIB 4YHYB 3QEGH 3EO1B 4HCRL 1JP5A 5I17B 1ZVYA 4GKZB 1UVQB 1O0VA 1WZKA 4E9LA 2CH8A 5A2IH 1OSPH 1X9QA 5TDPB 4M1GL 3TBTB 3O2VH 4XPAL 2X4OA 3IU4L 1OY3B 3P9MA 4X99A 3ZHKA 3GBNH 4KK6C 2WUBL 3VXPB 4TNWK 1WWBX 1C5CL 5J3HD 5EU5A 3EOAA 1RFDL 2E9IA 4U1LA 1P1ZA 1VFBB 3CH1B 2CRIA 2DI8A 2BRQA 2FX9H 1HYSC 3BH8B 4YHKL 4PRIA 3MMEA 4KJQD 5ANMB 1X5JA 2O5YH 1LEIB 3RA7L 1JN6A 4NO3A 5DHYA 1S5HB 4DZBB 4LLDB 3CH8A 1TPXB 5HJ3B 5I71C 4ZSOA 4U6XB 4HKJB 3VFOB 3OQ3B 1DTUA 1QLRA 2CD0A 4KTEH 4ONGL 5F7DA 4DVBB 2IALB 2EZ0C 1TJGL 3GK8H 3WIFA 1G7IA 1GPOL 2AI0H 2EE9A 5J11C 5I8CA 3GUTA 4ZFFB 3RUGF 1S9WB 1FNFA 2ESVE 5B3NA 4EDWH 3B9AA 4WUUE 5IW1B 3MNWA 4HD9A 2H1PL 3EJZC 2DWDB 4C57C 1G7PB 3ARDC 5TDOB 3LRHA 4EUPA 2H41A 1U8KA 4BH7A 4MCZA 1D5ZA 3WN5C 3VGAB 2EIEA 2IANA 3ALPA 3N9GH 4M5YL 2M8XA 1FV1B 5CMAB 3GB7B 4OI8A 3G9AB 3VXRA 2XKNB 4L3EE 1TVBA 5FF6B 4OM0L 3HB3D 5DZOA 4NQCE 4CVXA 1T2JA 5SWSA 3TZVD 5F9OL 4F9LA 2BDNL 1EAPA 4JLRB 2ADFL 2Q3ZA 3ZKMD 3ARBD 1LQSR 2A9NL 4Z7NF 4HLZG 3QYCA 3IU3B 2OX5A 4ZXBD 1E6JL 4OD2B 3I75B 4GW1A 2R1WB 3V4VL 4X6DB 4XAWH 5DTFA 3D18A 2VTFA 1U92A 4P46A 4GSDL 4R2GD 4XC1H 3U79A 3UP1A 4PJCF 2ZOKA 4RMQA 3GJFA 4Y4FC 3HR6A 5I1KH 4XT1C 1SEQL 5KVDH 3QXAB 4P2RD 4P5MA 3TZVB 3ULVF 5DVLA 2QQNH 3MRGB 1UZ6F 2D9CA 4XRCB 4F8TA 4LHQB 4W81A 3ARBB 4NWTL 4XWGH 2BSRA 5D7IE 2ARJQ 4DOHB 4JEGB 3GSNL 1BQLL 4ZXBB 2A1WH 2BNQD 1U91A 4X5WA 3B5GA 3ULUH 3LH2L 1JZ5A 3MV9D 3P0GB 5DVNA 4HV8A 1RZJL 3FB7A 3AUVA 4R2GB 4S0TD 4QHMA 4BSJA 2E7HA 4HQQL 4ODWA 4LLAA 4ENED 4NNPH 2BXZA 1V7NH 3MYJB 4OZIA 2IBZX 1YJDH 3VFMA 5IESL 1H3TA 4P2RB 5EOQH 2YD1A 1K4DB 3ZKNC 3TC9A 5A2KH 2FIKB 1R5WA 5C09A 2BNQB 2R23B 1DVFA 3KPRD 2R1YB 4U1NA 1ZGLP 1K5NB 3C6LC 5C0GA 3RWDA 4ZG1A 5CZXD 2OS7A 3O6KL 1OD7A 4Q74A 4J1UB 4Y5XA 1ZA3B 3JVGA 2ICWI 4LEXL 3QG7H 3RL1B 5EA0H 1YY9D 2FEDC 3WXWH 5FYLL 5C0DA 3EOBB 3VWJD 2VC2L 3CJJA 2VXQH 1O7VA 4AIZB 5IFAH 3DXAD 5KS9B 2YEZA 1FAKT 4KKAD 1JF1A 4OAWA 4ZQKB 5F6IC 1TVHB 4I77L 3NACH 1QOKA 3WUWG 3ZDYE 3MROB 4LCIL 3OKLA 3T0ED 5HHOD 3W0WE 2YPLD 5CLTA 1NGXA 2X4RA 2AQ3A 4D9LH 3O3DA 5ISZE 4K9EC 3BP4B 3MCLL 2O61B 5CJ5A 3QH3B 1TQBC 3VWJB 4ZS6C 4YHIA 3ARWA 2R56L 4L8DB 1I8IB 3DXAB 3EYOA 3G04A 1YEEH 3MYZA 5IBUB 4B0MM 1NMCC 5I76A 4F7MB 4J3VA 1BFOA 4IRSA 4TUKH 4ELKB 1U8NB 5DEGA 5FHBH 5TE6L 5FEBA 4U6TA 4UT9L 3T0EB 4CUCA 1Q9LB 2YPLB 3DHJA 3V0AC 4WW2A 4JQXA 2YD5A 4FOMA 4BFGA 3E3QE 4NNYB 1UJ3C 5ITFB 3CIQA 4M7LH 1BVZA 3FQWB 1F3JA 4JPVL 1A6VL 4JFQB 3PIQB 3LS5L 4QRTA 2W0FA 5DQJA 1OF2A 1WBXA 3KGRA 4MAYA 1VPOH 1HINL 2ZNXA 5E5MB 4C83B 4DN3L 1KLGA 4MNGA 4F9LC 3DX9B 1HHHB 3TO4D 5LG1A 3HS0B 4LHJB 1KPUB 2YMXH 2ADJB 1G6RH 2X4NA 1PKQB 4OLYL 1Z2KA 5DUBA 1LHZA 3ZMRA 1SJHA 1ACYH 4OKVA 5DJAA 4WI5A 2D7PA 5KOMC 4Z7UA 2LVEA 4P46C 4JRWA 4XNQB 3WNLA 3D48R 4YBQC 3TFKC 1AFVH 2A83A 3V4UH 1HILA 4ZO6A 3VFWA 4KK9D 3WFBH 4PJ9D 4JY5L 2XKSA 1ZLUK 4TUJA 2R4RH 4Z76A 3J8F7 1Q0YH 1BBDL 5IG7A 1XIWD 1WUNT 4JFFA 5DD3H 4WVRA 5GS2H 2CRZA 3TO4B 5DYOB 5BQ7A 4E0RA 4FQHA 3STLB 1JGDB 1OCWL 3EYVA 4IIQB 4ZYKA 3QNYB 4YWGL 4J2XA 5GS0D 3B5TA 3C2AL 3MRJA 4Y8AA 3FB6A 2OK0L 2CKBH 4OLXH 4PP1D 4ZS7L 4GMTH 1MPAH 4NC1E 3QFDA 3GM0A 1G7QB 1FFOA 3KLHD 5FYKE 4S1DC 5DUML 1JFQL 3W2DL 5DSCB 1TTFA 4XZUB 4R26H 3UAJC 3ROOA 2A74B 4PJ9B 1FG2B 4MX7B 2NX5A 2D7TH 3MQIA 1XIWB 4J3WA 1FGVH 4WU5B 1XGPB 4GRWE 1WAAF 1F11B 2N7AA 5JOPE 3WS3B 4U1HB 4NJAL 1F45A 4YHPA 3V0WL 3KWWB 1BZQK 3C5SA 1DVFC 1KT2B 3I6LD 1TZIA 4MS8C 1HCFX 4FN0A 3DX7B 2LQRA 2VQTA 3R06A 3R1GL 1CFVH 3JVGC 3KPOB 1QZ1A 1S7XA 3EOYG 4TSBL 4HZLB 2Z31A 4HPOL 1VADA 1KIQB 3GMNA 3IXTA 1AD0A 2OJEA 3U7AA 1EEZA 3H3PH 4YDVA 1KXVC 1MAKA 1T04A 2JTDA 3SPVB 1ZOXA 32C2B 5LCVH 3ARQA 1MY7A 2ZCHL 3RIFK 2ARWA 1N7MH 2FCBA 1E28A 3RJDA 1FBIH 3U2SA 3FFDB 2IGFL 1Y6MR 4Q9QH 1FGNL 1L6XA 2YSSA 3MACL 3MV11 3QDGD 4XI5D 3I85A 5EOTB 1NUGA 4G6FD 1JHTA 3GHEL 2VR9A 3DPBA 4XCFL 4FZEH 1BOGB 2VXSH 2VDNH 2WUCH 3T4YA 1BD2A 3MLSH 4K9EH 4IRSC 3LKPA 4EN3D 5CEZE 1WEJH 1MY5A 1BJ1H 4UOW1 3AU1A 4ZO8A 1MLCB 5E8EA 1P1ZB 3L5XH 1T1ZA 1L7IH 4TSAL 4RWYL 1NLBH 4WW2C 4JQXC 3U36A 2B1AH 2HA1A 3QDGB 1BBJA 4JVPA 3RVXC 4HGMA 5AWNH 3VGFA 3GKZA 4M7KH 1G0DA 3BH9B 3ES6B 3MRIB 4G6FB 4JRYD 3UBXG 4P3WA 2WBWB 2VL5B 5BMFH 1W0VA 1J8KA 1TQBB 2VLKE 1Z9MA 4S1QH 4KXZH 1J1XL 3REVA 4PJ5E 1A6UL 4MAYC 4I5BB 1QTYT 5I1EL 3WIFB 2OTPA 1G7IB 2Y36L 3C5ZD 4H0HB 4F3FB 5L9DL 1OGAE 2VAAA 5CINH 5I8CB 4LLMA 3HFMH 4MWFB 4FQLH 4H0GA 2CLVB 4PPTA 3TCLB 4KI5D 4MJ6B 4N90E 4L5FL 3UMTA 3DV6A 4EUPB 1UJ3B 4JRYB 2Z8SA 3DX6A 4PJIF 5HVWA 5C07D 3GDBA 3SCMD 1CTNA 3MR9A 4PJFB 4MCZB 3WUWA 2VDQH 4WI7A 3MO1A 4J6RH 5ENWB 3ALWA 1N64L 5E9DA 5E2TH 3IJSB 4QTIL 3C5ZB 2FB4H 2JCCF 1TVBB 4PB0H 4IS6A 4CVXB 1JNJA 2X70B 2EXYD 2GQHA 5F7EL 2BMKA 1PKOA 2DQEH 3HNSH 2XTJE 2BJMH 2GJ6A 3ZKXB 3QHTC 4DGYH 3CFCH 5C07B 4K94C 2R69L 3SCMB 4DQOH 5BV7C 5DI8A 3L3OB 5I8OH 2GT9B 4WV1A 5DTFB 5EFIA 4NWUL 1JJUA 4NHCL 4ZOBA 5EORL 1QFPA 4LPCA 4X7TA 4XPTL 3O3AB 4UT6H 1BAFL 4LSQL 4ERSL 1T83A 5H2BA 4K3DH 1H3XA 3PHQB 1DQJB 3N1MC 1CDGA 5BRZE 1OAUL 4PIRF 5EO9A 3MRBB 2DD8H 1DQQB 2EIDA 3GSWA 4DTGH 2BRRL 3WDJA 1HWGB 1MFDH 3FFCE 3NABL 2EDQA 1NMAL 4H1LA 1UM4H 4XCYA 3TV3H 3MRDA 1MLBB 3VI3F 3T08A 3U9UA 1MHCA 2P8MB 2DQFB 3QQNA 1VKXA 2BNRE 4N1CA 2H8PA 2X4TB 2HN7B 4IOIA 2H2PD 5D7LA 4QHNB 4RX4D 1IEBA 5EU6D 3F7PC 1N8ZA 3KJ4B 2Z31C 3BD5A 1K3IA 3PHOB 5IB3A 2EH8L 1IC7L 1ZHKA 1MUJB 2F53D 4GAJH 4PV9B 1M71A 3VMNA 3RWFA 1QKZH 1QPPA 4FFYH 4AK1A 4R4BA 4CVUA 5BS0A 2VNCA 3TCXA 4HXAH 4H20H 2QQLH 4N1HB 3DI2B 4LKCA 4ZUTB 1B6DA 1AY1L 3FMGH 1KLUB 2VZSA 4UNUA 3DUSB 1G1CA 3GKWL 4Q6IA 4KKBD 1BIIA 3QFJA 5EU6B 1VCAA 4KMTL 3MLXH 2IADA 1HHJB 3RVVD 2NCMA 2F53B 2XQYG 1LO2H 4JZOA 2YEZB 4OZ4A 1JF1B 1P6FA 2VDKL 2H45A 3OAZK 1T20A 2P8PA 5CGYC 4EXKA 5LGJB 4PRBA 2V2TA 3P2TA 5BZWB 4ISVA 5E8PB 3E0GA 1WBZA 1DLHA 5DMIL 1SBSH 2A73A 2NTFA 1KIRB 2AXGA 4LCWA 1NGXB 4YAQA 2X4RB 2AS5M 3CSBA 1ZGLM 4J4PD 2OL3A 4JZNB 1JK8A 4KMQA 4Y16A 4WI6A 4LARH 1RUAL 1X5YA 1LP9B 1B4JL 3KPLA 2AEWA 5E4EB 3WIIL 5FKPA 3TESA 1MHHB 3C8KB 5CBAB 1S9VB 4JHBA 1RUPL 4K8RH 4WWKA 3VXNB 5I2IB 3VCLB 1I75A 4CU7A 1JPTL 2G60H 4MA7H 1F00I 4JDTH 4WW2B 3ARUA 4CMMB 1S9YB 3DURB 1VACB 5GZND 4FQ2L 4JHAL 1S7VB 1NFDE 4RA3A 4R3SB 3DTXB 4RZCB 3ZE1F 3UJTL 3TIEA 2X4PB 3AAZA 1A6WH 1OF2B 1XF3B 2DLEA 4GOSA 5DWUH 4JDVA 5I19L 4G9FE 3LEYL 1LO0H 3BOVA 2WIMA 2ICWJ 4XVJH 1MRCH 4XPBH 4NO0D 5BVPH 3AVEA 2N7BA 2NR6C 1HDMB 3QA3B 4HK0B 3HN3A 2ZSWB 5IF0A 5C92A 4YFDB 5J6GB 3QIUD 4DEPB 7CGTA 5CUSH 1SBBA 4OKVB 4WV1C 4UIKH 3O3BB 1J88A 2EDBA 4O9HL 3QWOA 3TPUA 3U0PA 1DR9A 4K94H 3V9FA 5BV7H 5KZCD 3U0TA 4D3CL 1G7HA 4QRUA 1T83C 3QEGL 1OP5H 4Z7QE 3MTRA 5T5NG 4U1JB 4TUJB 1QA9B 3UBXA 5BZDA 1JPSH 4NO0B 4YDLC 5IG7B 5AEAA 3ULUF 1UYWL 4DVRH 5IFHL 3RWEB 3NA4A 3GMPA 4JRXE 4TQEH 1WCQA 3L9RA 1PFCA 3O2VL 3KPNA 1NEUA 5D2NA 3QIUB 3GBNL 1FNHA 4NIKB 4PGEA 3QRFM 4KPHH 4OZHF 1H5BB 5KSBA 3IKCA 5J1AB 4EKXA 5KAQF 1II4E 4HS6A 4JY6A 3PQYD 4C4KO 5KZCB 4JFOB 4MA3B 4GXVH 1KJVB 3PWVA 4MD4B 2O5YL 1ORQB 4L29B 1K4CA 2LTQC 1PX3A 1WFNA 1S9XA 4N0FB 3EOTL 4IDJH 4HLZH 3QUXA 5F7KC 4KTEL 1RZFH 4KXZI 3F12A 2RB8A 1JWUA 3C5SB 3GK8L 3AB0C 4KK5C 1A02N 1R3JA 3WUZA 1TZIB 2AI0L 2F19L 5F9AC 2B5IC 2OJZH 3VFUB 1W0WA 3B3IB 3KYNA 3PQYB 4Q6IC 4B7IA 4EDWL 5IQ9B 3SHSA 1WZ1L 3V2AR 1UB5A 1JV5B 5GGVY 1LO4H 2R39A 1S9KC 2VZ3A 3MA9H 1EEZB 4PLKC 2A0LC 1NFIB 4UZGA 4X5XB 1DBKL 1CXLA 4TVPH 4FABH 1A8JH 1J5OL 4N0RA 1TENA 1ZEAL 3CCHB 2XFXA 3IDIB 1FVCA 3HZKA 4PJ7F 3HC4H 4ZAKA 3IT8D 4C56A 3UCRA 4RFNB 4L8CA 4Z18A 2ATPB 5I1LA 3RP1A 3TO2A 4ZTPH 1S78C 2HT3C 4Y16C 4I18B 3DROA 5L88H 4I2XB 5FCUH 2P24B 3ARZA 3WFEL 2LFGA 4PD4J 1T3FA 1I7RA 4JREC 4HKZA 3NZHH 3QI9A 2A6IB 4NFCA 3O11B 5ESAA 1ND0B 4WWKC 4YHZH 1RMFH 1JYXA 4GMSH 5D93C 2J8UE 1U8OA 4PGDA 3A6OA 5INCB 3V5KA 2E27L 4QT5A 1RULL 2G75A 1BBJB 1C5BH 3ZDXE 4XWGL 2H26A 1EHLH 3ZT6A 1I9RL 2FH8A 4OV5B 5HXMA 4QRRE 5A43C 5F1KC 3ULUL 2D7QA 4LLUB 2VYRE 3SQBA 1WVZA 4MSWA 1SM3L 3BKCH 2AGJH 4PRAB 2DWEA 2BNUA 5AD0A 3MRPA 4C58B 1CTOA 1FVEB 4NNPL 4OTXH 1OAKL 1YJDL 5I8EB 4XWOD 3GMMA 3HHRB 3TJHD 5EOQL 1WC7B 5CSBA 4ZUSA 4YEEA 2D3VA 3TM6A 2WLYA 3HZMB 3R0NA 5HYSB 2OTUA 4MZ2A 1DBBH 4FQIH 4X7DC 3QJFB 3PL6D 2PN5A 4FXKB 1YEHH 1YEGH 3F7RA 3MO1B 4ZUUB 5CIPB 1BJMA 3R4DA 4MLSA 3HZYA 2ED8A 1T6WA 4NUGH 2L7JA 3OZ9H 3QG7L 4ZUVA 1J9CT 5EA0L 3WXWL 4L8SA 1BQHG 3L3GA 2BOCA 4XNMA 1Q94A 4GG6F 3MRMB 3OKMB 2HT2D 3BE1H 4X6CA 3IS1X 4KHXH 1EMTL 4Y8DC 1OW0A 2AJXH 1KJ3H 5D2NC 5IFAL 5JPMA 4WIQA 1FNGA 1QEWA 2IH1B 3PL6B 1CVRA 2XTLA 2Q86A 2OP4H 3NACL 3ZO0A 1FC2D 1BHGA 5FCSH 4LGSB 1MCPL 5F1SA 2AK4D 3TF7C 3T4AA 1K8IB 1HK6A 4UQ3B 3CFBA 3KPQA 3GMRA 5D5MA 2NY5L 3QJHA 1KV3A 2DLFL 4MQTB 3SDDA 4WI2A 4D9LL 3KDMA 3IF1A 1JNNL 4Z9KB 5T3XH 3QUXC 4WEUD 3H0TA 2V5RA 4OZGE 5EC2B 1XGUB 3MRRA 3NPSC 1YEEL 3BRDA 4G6AC 2J3SA 4UINH 4WUUA 1L7TH 4KHTH 1I9JH 1YMMA 4ZPTB 4ELMA 5BXFA 2DQJL 4DK6A 3FJTA 4KKCD 3QCTH 4MHHG 1VKXB 1U8JA 3FZUD 1J1PH 2RAMA 3LV3B 3LOWA 4Q0XH 1OPGH 1DP0A 4QXUH 2AK4B 1ZT1B 3D0LA 4KJWD 4M9OA 4J12A 5TH2B 4NQSA 3WS6C 4Y7MA 3AS2A 1QO3A 3T0AA 3WKNA 3U4EA 1UG9A 3KPSE 5B39G 5ITBH 3M17A 1VEPA 3MOAH 2CO6B 4NM8H 5T1LD 3RWFB 5IVZA 2Y9RT 3SKOA 1CD1A 1VEOA 4PLKD 1IQDA 3RNKA 5C71A 3HE6A 5AZ2L 4F15B 2YUXA 2HJLB 1W8NA 2EDOA 1GC1H 1KPRA 2Q7YA 1RIVH 1SYVB 4LVNB 1JPGA 5KVMC 3EYQD 3BEWA 4NO2A 4P59H 5TGBA 2YK1H 2DQDL 4ZAKC 5GRXG 4U7KA 4Y2DA 2H9GA 4Q6IB 3C9NA 2KPNA 2X7LB 4KTYA 3E8UL 1BIIB 5GGTH 3QFJB 2X4QB 4EI6A 1G6RL 3GJEB 3K8KA 2N56A 2DS4A 4N0YH 1C5DB 3RWIA 5EU7E 3SO5A 1UWXK 2P7TB 1JCKA 1ACYL 4PREA 5T1LB 3MFFA 4RISH 2OL3H 4FFZH 5IIEB 3QI9C 2C26A 3B2UD 4CN4A 2P8PB 2UWEE 1AFVL 3V4UL 5B8CA 1F58L 3DVGB 4ISVB 3WFBL 3B9VA 3H2WA 1U8HB 2R4RL 1DLHB 1XCQB 1EIBA 4PJBA 1OOAA 1Q0YL 4MB3A 4Y4KA 1FFNB 5F7UA 3BWAB 1YECH 3HPLB 3D3VA 1FE8L 4YGVA 3H3BC 4YAQB 5EPMB 4H25A 4NRXA 2C3HA 5EC1B 2X4UB 4OLXL 4GMTL 2EDEA 2ZNWA 1MPAL 5I15H 3OKYA 3LEXB 3IJYA 1Y18B 3O81A 2FZ3A 4GRLA 2COQA 5CCKH 2RHEA 1GZPA 5DD1L 1R3KA 4U4BA 5SWQA 3MJ7A 1FSKC 1HYRC 1JF5A 2D7TL 1IM9D 3F7VA 1FGVL 2YD4A 2JK5B 4PBWD 3S6CA 2IEPA 3F6LA 1I8MA 4LKXA 4XCEA 5IKCB 3CX5J 3W9DA 4NC0B 3GI8H 1XF5B 3NOIA 5EIIA 1FLRH 3OR6A 1NBVH 3NA9H 1GIGH 3FT4B 4L4VE 1UXWA 3CFDA 5FYJE 2QR0A 1CFVL 2IMMA 5C0RH 3VFNA 1T2XA 4WU7B 5HDOA 3ELAT 2FL5A 3OKDA 4L8SC 1PZ5A 5IOPB 1KFAH 1B6UA 1IM9B 1MJUH 2UZIH 5FOBA 2Q6WA 3H3PL 1MRFH 1OW0C 3O4LE 3KJ6H 4X4YA 3GI9H 4ORGB 1XH3A 4LPYA 4JCLA 5LCVL 3SDCA 4Q97A 1JPST 2E9BA 1N7ML 3TT1L 1FBIL 5F9WB 1RIUL 3MJ8A 2HRLA 2ORBL 4OZIF 3ARGA 4TTDD 4Q9QL 2B20A 4F80A 3U0TB 1T4KB 5GGSB 4QRUB 2ZPKH 4V2CB 4QHLA 1QVOB 4BFIB 3SDDC 2VUYA 1HOCA 1RURH 4M43H 1XCTB 1JUFA 4FZEL 4DKFL 1N0XH 5C08A 2WUCL 5SX5H 3K4DA 3L9RB 1X5GA 3MLSL 4PJGA 4G6AD 4UT7L 3GNML 4JDZA 3VWKA 4NP4L 3B83A 2Y1VA 1NAKH 3IKCB 1L7IL 1YNTA 3QNZB 1UWEH 4U31A 1I8KA 2H6PA 1NLBL 3B4NA 1RUKH 3QHFH 2B1AL 5AWNL 4APQD 1S5IH 4M7KL 3QNXB 1K4CB 4NCC2 3SE3A 1CU4H 1P7KB 1A2YB 4U0RC 2J5LC 5BMFL 1KULA 1DBMH 3L5JA 5IHUL 3HE6C 4MDJB 4QYOA 4S1QL 5FK9A 1QBMH 3HCVB 1JHKH 1VDGA 2BVPA 3PWNA 4TPRH 3SDAD 5FECA 3NPSB 4G8GD 5CZVH 1MI5D 4HFWA 2NNAB 3I02A 4NBZB 1CI5A 4WHYG 2J1KA 5CINL 1RZGB 4JKPL 3HFML 1TNNA 1BQHA 4FQLL 1KC5H 4W6XB 4Y2DC 1ZLVH 4KWUA 4APQB 1M7IB 3TN0A 1CR9H 5L7XL 5A2LH 3SEPA 4LSDA 4DWHA 4J6RL 3SDAB 2VKXA 5B8CC 4G8GB 1MI5B 5E2TL 5KSVB 2WNGA 3LKNB 2FB4L 3X3FH 4WW2F 1IC5L 3GBLA 4Y4KC 3V6ZB 4UTBH 1S8DA 3HZKB 3K2MC 4UILH 5FYKL 4JFHD 3SOBH 2DQEL 5IMMB 2P5ED 1OB1B 1D5MA 2GW5A 4DGYL 3CFCL 3DROB 1BJ1J 1Q0XH 4WO4A 3GHBL 5I8OL 1U8IB 4PJDA 1I9IH 3ZSTA 1NPUA 4L9LA 4HJGB 1IGTB 1NGYA 5I66A 4GRLC 5HHME 5CSZB 3KYOB 1JWSB 5BOPA 5KVFH 1CLZH 5HGDA 4K3DL 4FFVD 1A9BB 1CF8H 2ERJC 4PGDB 5HVGB 3V5KB 5B39A 4LP4A 1G7JA 4KVNH 4PBVC 2BERA 2DD8L 3DGCR 3SGJA 4KKNA 4DTGL 1MFDL 2P5EB 4Z7UF 2AJZA 4PV8A 1OWWA 1E4JA 5BOZG 4PJXE 4MNQD 1UM4L 3THMH 3TV3L 4YPGA 4XHJC 3UXFA 1AQDA 2APFA 3ZKQD 3MUGA 1JRHH 3MRPB 2QADD 2XA3A 3L3IA 4WHTB 3RX7A 2Y7QB 4ZO9A 5JNYB 1B0GB 1Q9KB 3PP3K 2J8OA 2BVOB 5I1AB 5A1AA 3RY5A 4GAJL 1DDHA 2NY1C 1QKZL 1Z0MA 2DLHA 4FFYL 3UTTA 4BZ1L 2XWTB 4E41A 5IT2H 3QP3A 5EO0A 3SDCC 1HSBA 4ODTH 2FWOA 4PYHA 4MCYA 1PYWB 3OKKA 2PYFB 4HXAL 4H20L 2QQLL 5GGUA 4Y19A 1AGFB 4NQEE 5BO1L 4HEPG 4KRLB 3FMGL 1B0RB 3PABA 3LMJH 5HYJA 2QADB 4NQUA 3VE0A 4U1MB 2I9LB 2YXMA 1DQMH 4MVBD 5CEZL 5CJQH 4XNMB 4M8QA 3FB5B 2FJGB 2MKLC 15C8L 2QQQA 4NKMB 2C1OB 1EERB 1IAIH 2ESVD 3D85A 3ABZA 5L6YL 3KXFA 4K7PL 4U1IA 3VWKC 2W65A 3QR2A 3SE9H 4MA1B 4R0LA 4PD4K 2Q86B 4PTUB 2BC4A 5DF0A 1SHMA 4RQQA 3O9WD 4G43A 2Y23A 1GGBL 2VSCA 4RMWA 4R4FH 2CIKB 4XMPL 3GGWB 5EU3B 4ZUWB 1SBSL 5LVEA 1FDLH 4BK5A 3IRZA 3CFBB 3LQZA 3EYFA 3SE3C 3SDDB 1NGQL 1T1YB 4G42A 2NYYC 5HGBB 4JKMA 4L3ED 2C1PA 1DJSA 2XG5A 4NQCD 1LMKA 1CN4A 1I7TA 4C59B 3KLAB 2F5AH 4GRMA 1BP3B 2ESVB 4F7PA 4KDWA 4WUUB 1NC4A 1UQSB 3ILPB 1N5AA 4K8RL 3D25A 3ZDZF 4P23A 4AH2B 3QCUH 3NCBB 3O9WB 1DCLA 2G60L 4MA7L 5IROA 5AAMA 2V9TA 1X5KA 5GS1A 2CIIA 3TN0C 3W39A 3D69A 2OQJA 43C9B 1IJ9A 4U0RB 2CLRB 4O5LH 4RMRA 2J5LB 1XT5A 4L3EB 3SGDI 3V7AG 4XAKE 5IVZB 5DHVA 1IQDB 5JR1L 2DQGL 4NQCB 1JNHA 3HE6B 4HIJB 1KUMA 3TLRA 3IRPX 4JO3L 5DWUL 1RZKH 2XN9E 1BM3H 1LO0L 2XACC 2J7LA 4JGJA 2ADGA 4HX1B 5ILTH 4XPBL 1JPGB 5TGBB 5BVPL 5J13B 4GJTB 3O41A 5A16A 4BQ6A 4QOKE 4E42B 1ZGLB 5GS2D 3L3HB 3UBXI 2CGRH 5DRNA 3DBXA 5MEPA 5EO1A 4F7CA 4YFEA 4IDLA 2ZSVB 1KPVA 3ILQC 5FM5M 4WO4C 2VH5H 2D03H 3ALXA 4L9LC 3NZ8B 1I7ZA 3WFHA 3T2NH 5IM7A 4Z6AT 2GITA 1PLGH 4K94L 3LS4H 2VWEC 4PRHE 1VGEH 5D7IB 2FJHB 4DVRL 5C86A 1S7SA 1UM5H 3SGJC 1FL5B 1S3KH 2E6QA 4YE4H 1D6EB 1JGEA 1QR4A 4E5XB 1UZ8A 3W11C 3W82A 4KTDH 4QNPF 1P2CB 4S1SH 3T65A 4KPHL 5GSVB 5GRZA 1YEJH 4FS0A 2FGZA 5C0JA 2R0LH 3PWLB 4QO1A 1I3RB 3SGEH 4GXVL 1X4XA 1S7WB 4LL9A 1QSFA 2HT4C 2OMNA 2Y25A 3LZFH 3S3PA 3SDXE 4PUBH 2YZ1A 1MNUH 3V0VB 5D7JD 3QIWA 4D0DA 5CILH 3I3BA 1NGPL 3HZVA 1IFHH 5IVXE 1A7BA 1OT1A 4IRZL 4XCEB 3W0WD 1NJ9B 5TFSH 4MNHB 2FGWH 3LEVH 3P30H 5BJTB 1XGYH 4ZPVA 3S4SA 1RUMH 2OJZL 1KCSH 5ISZD 1Q1JL 3BGAA 3BIAX 1FL3A 2EDLA 5C0FA 2D0FA 3DX8B 3P3YA 5C6WH 1FN4B 1FAIH 2QR0B 5FO7A 3LKOA 4ONHA 2RFXA 2HFGH 1LO4L 5T33H 4N8VG 4P9HC 4OCYH 3BAEH 4PYGA 5D7JB 4YHLH 4ZFGL 3MCKB 1JBJA 3FT3B 3W0WB 4W68A 4R0LC 4TVPL 2W0KA 4FABL 2CDGB 3CLEL 5FV2A 4XBGA 2YZ8A 5ISZB 3CVIH 1P7QA 4X7SH 2ITDA 3HC4L 1AGCB 1HKLL 2ARJA 4QTHB 5DD0H 3CMOL 4G7YH 2NYYD 3JBG7 1JUFB 5L88L 3GSXB 5FCUL 4G6JH 1AR1D 4QF1A 5EOCH 1ZHBA 4CNIB 3QEQE 1MOEA 3BXNA 5IK3B 2A2QT 3NZHL 5J1TC 4QHUA 3FONB 4R90L 1RMFL 4UOW0 4P23C 2UUDH 3KNBA 4GMSL 5LKNA 4KUZL 5IROC 1I8KB 2GI7A 3BW9A 5EUOA 1CFTB 5E2VH 5E95B 5SWZA 1C5BL 5GS1C 1R0AH 1EHLL 1Y0LA 3ROLA 2APTA 1GL4B 2Y5TB 4O58L 4Z8FH 5DD6A 3VFTA 3CX5K 5HDQL 1IGYB 2AGJL 3M8OH 2W9LA 4ZDHB 4W6YB 4LGRB 1W72B 5J7CC 1JRHI 1P69B 4P3DA 3GMOA 5ETUB 3MXWH 2D7OA 3MRCB 1INDH 1YUHA 4OCLC 1T7VA 5DVMA 2XT1B 4H88L 1C12A 1R5VA 4H8WC 3RWJA 5FYKD 1BX2B 3H9SE 4U6VH 4OI7A 1D3CA 3E6HA 4N8CH 1HQ4A 2OR8A 4KUCD 3ZYJA 4LSRL 5DC4B 2OYPA 3TNNB 3QAZC 5K59E 1T2QL 1ONQA 4IJ3B 4DFHA 3NFPA 1R3LB 4ZO7A 2CXGA 2HRPH 5EZLB 5CHNA 5JOPD 2PCPA 1FNLA 1IGJB 3FN0L 3VXMA 3OZ9L 1OARH 2FX8H 1F42A 3BE1L 2ADIA 4LNRB 5C7XH 3U4BH 3CC5B 5GZOC 2PR4H 1KJ3L 2FR4B 3RPKA 5KS9E 5IUSA 3WNPA 1IAKB 2FJFA 3PV7A 4QRSB 1NCCH 3VXUA 5A2FA 1P4BH 4OQTA 2AJSL 4YIQB 2OP4L 4LVHC 4NRYA 5TE7L 2MJWA 1E27B 1WWCA 2WLZA 3MOBH 4G8FB 4GRWB 1MCKA 5I75C 3ARFA 5J6HB 4JFPB 3QT2A 2AJYH 4BFBD 4YGAB 5F3BA 2G9HA 1L9NA 2VLJE 2FATH 1A6AA 1HEZB 5E1HB 4Z0BL 4F7EB 1FORH 4RIRA 4Z7VE 3K74B 2D7NA 3I3DA 4YXKH 4UINL 3FB8B 5ESQA 2CK0H 5C0AE 3EGSA 4KHTL 1I9JL 1NSNH 1CFSA 4KFZC 5TQ0H 3QCTL 3WO4B 2PO6D 3IDYC 4OFVA 4DKDC 1J1PL 4Q0XL 5HYQB 1OPGL 3CZFB 4LCCB 3MUGB 4CAGA 4QXUL 4X6EA 2MQCA 4NQDE 5D2LE 5GJSH 2UVEA 2AK1L 3RGVD 5E2UH 1Z0NA 5CEZD 1IC4H 1A7RH 5ITBL 2FBOJ 2WWKO 3MOAL 5L8KB 4NM8L 3SDYL 3FOLA 2MFNA 4Y89A 3UTTB 4IMLA 4A2LA 1N59A 3VFGL 2VLRA 4P9HH 5KSBF 4QY8A 1N2RA 3NIGE 1CE6B 3VDAA 4HIEA 1GC1L 2Z93A 1RIVL 3SKMA 3RVWD 4FMFA 3EO0A 4P59L 2PO6B 2YK1L 1U95A 4N0UE 2VLKD 4DN4H 2MMXA 5GGTL 2X9WA 4PJ5D 4XBPB 4U6YA 3RGVB 1J0YA 2CSPA 1DANT 4N0YL 3FQXA 5K9KA 1V3JA 3AMLA 4JB9L 1OGAD 4JFYA 3NTCL 3T77A 3IDUA 5K33A 4RISL 2OL3L 2V2XB 4MD0A 3C6SB 1IEHA 1EV2E 4HSQA 4OIBA 4CN6A 4N90D 2CMRH 2PTTA 4QKXB 3T8XA