4OF0A

Crystal structure of syg-1 d1-d2, refolded
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
246
structure length
230
Chain Sequence
QRIVEAPKDTLAAVGETAILTCRVEHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVKSHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGESRSKFEISQETVIAHVNETTQVESSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPNKIEVDSVKLSLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
molecule keywords Protein SYG-1, isoform b
total genus 44
structure length 230
sequence length 246
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of0A02
1CDYA 5CBAA 2VC2H 1T66D 1SJVA 3QFJE 5EZIL 2W60A 4UV7H 2B4CH 1F6AB 3WS3B 3KJ4B 1J88A 2Z8RA 3GSNA 4JRYE 1AD9A 1KGCD 4WJ5B 5EUKA 2A77H 1RZ8B 2I60L 1X44A 2DQCL 5FO7B 4EEEA 4IEFB 1M05B 3HI6H 4FFZH 4DAGH 4NP4L 3AS2A 4HWBH 5E8OB 1VDGA 3ULVH 4Z7VF 4QOKB 2FATH 7FABH 1R3LA 4M9OA 1OTSC 3MLRH 3RI5F 2HFFA 4QY8A 4HT1L 3GJEA 4PRBB 1H3PH 1C8PA 5E2JA 5JHDE 3NH7H 3OR6B 1WBYB 2VSDA 2D2OA 4KHXL 2DKMA 4C56B 1M71A 4NGHL 2NY1C 2XTJB 3QUYA 3V52H 1XF5A 4LDEB 4PJHF 1A1NA 3KWWA 4RBPK 12E8L 5I17B 4FMFA 5DUMH 5I15L 4ZTPL 3AU1B 4OKVB 3MNZB 4MAYC 3WSQH 4GW4B 4GRWH 4NRYB 4GG6B 5GGSA 3MV9E 2AXJA 2ARJA 4NC1C 3OGCA 5AZ2L 3W11D 3K74B 3O3BA 1UVQA 5TDNB 4H5SB 4BSJA 4KDTC 1NCAH 1RZGA 1R0AH 5ADPL 4Z7OF 1R3LB 1T7VA 3X12A 1MQKH 4PJ9A 4PGBA 1QSVA 1XGTA 2P7TA 3PXHA 4AEIL 3P0YL 4KRMB 1VACB 5DSCA 4JN2A 1RUQH 5ANME 3LSOB 4PRDB 2Z4QB 1A1MB 4KTEL 4Z7UF 3D85B 1RJYB 3TN0B 1CS6A 5KSAB 4QTHB 1AC6A 2QHRL 5D1QA 2ICEA 1AO7B 2IADA 5F7LB 3FRPG 4YPGA 1KCKA 2HFTA 4QHMB 5CJXC 5IOPB 2ITDB 2YRZA 5JDSB 5CFHA 2QSTA 4Z76A 2WLZA 3BH8A 4UV4L 1EHAA 1XF3A 5I0DA 1G7HA 2BDNH 2XA8H 5C07A 4MJIB 1E27A 4LU5L 1QLFA 4S1RL 5FO9A 1QRKA 3D6GA 1FDLH 5I8KL 4PY7A 5GGTA 4F7MB 4FP8H 1UCBL 2X9XA 3RJDA 3CUPA 1YEFL 5JORB 1KXTB 1J1PL 3QCUL 3QO1B 3BIKA 1J12A 5B39B 3O6FB 2APWA 1A2YA 2XN9B 1JZ7A 3BPCB 5I73B 3RAJH 4KZDH 4O2FB 4P5TD 4HEME 3J7HA 3GZKA 4JKMA 2ITDA 3O6KH 1OM3H 4HXAH 1NBZA 4OZGE 3BZFA 1G9NH 1N6VA 3F5WA 2Q6WB 2VQUA 3BP6A 3V5KA 1OAKL 4CUCA 3TESA 3GSRA 3OAUH 2ADIB 3FQXA 5E4EB 1AFVH 2R4RL 4OV5B 1JYXA 1CFNA 1FFOA 3TBYA 2IEPA 3TO4C 4DVBA 3E8UH 1KELH 3SDAA 1IT9L 1ADQH 1HINL 3PQYB 2AEIT 4I48B 4K94H 4ZXBD 2VXTH 4E41A 3ARDB 1FZKB 4YFDB 3S3SA 2ZSVB 4UDUA 43C9B 3EHBC 3S4SB 1A3LH 2CR3A 1OAYH 4GRMA 4KC3B 3B8YA 1AGBB 4JCLA 4XCNB 5FYJH 1F13A 4O2FA 3PJSA 5C0BA 3D0LA 4Y19D 3EYVA 4I2XA 2CLVB 4TN9A 1WICA 3QUMA 3BAEH 4M1GL 3OHXA 4LRIA 3SHSA 1KFAH 2VL5B 4P5TB 2DQJL 3IVKA 2FECL 5DEGB 3T08A 1U8IB 3G6JA 4RFOL 1AQDB 3DWTA 3NZHH 3MJ6A 4OZHA 4PJDA 4YDVB 3CSGA 1MRDL 2MCG1 3FT2B 4M4PA 1ONQA 1CIDA 1I3GL 1YEIL 5C0JB 1JWUB 3KS0J 4X9GA 4JE4B 3CLEH 4NM8H 2PTTB 4S1DC 2LU3A 3HRZB 3WD5L 3KVQA 3HZKA 3MRKB 3T4YA 5I66A 1Z3GL 4B50A 5L8KB 2AEWA 4HFWB 2J8UB 4AH2A 2RCSH 2B2XL 4F7EA 5DR5L 2BDNL 2XA8L 3ALXA 4PJ5A 3O4OC 5J1TC 5EUOF 4PD4K 4P5TA 3RWIA 3B6SA 2ESVD 4ZOAA 3PE9A 1A7NL 1S9WA 2X09A 1MWAA 3PP3K 5E8NB 4XCCL 4U6YA 2D31A 4TUKL 4UILH 5FYLE 3UX9B 3QFJB 5E99H 4JQIH 1Z3GH 3EKCA 1LP9B 2MKWA 5JW3H 5LQBL 3QPXL 3VXRA 3P0YH 2A6KB 4KTDH 5I8OH 3GB7B 2VLJB 3IFOB 1BAFH 4JAMA 5AWNL 3QIWC 4BELD 1HILA 1FC1A 1NCAL 3T2OA 1U93A 3U9UA 1H3TA 2H1PH 4JZJC 4DN4L 3ZL4L 2FR4A 1NGQH 1BIHA 1HCFX 2X1OA 3IU3A 4E0RB 2QKIA 1OCWL 3UTPE 2DM2A 2L0DA 4HUVB 4KV5F 2XTJD 2OQJA 3ZKNC 4X6DF 4ZAKD 2NZIA 1AGCB 5C8JB 2XI9A 5IFAL 3VA2C 4XP5H 4X0KA 3DLQR 5J3HC 3G9AB 1N8ZA 3LKPA 2ATPB 3IF1A 3EFDL 3OV6A 5CD3B 4Y88A 4BFEA 1LEIA 4CJ1A 5D2LF 3BP5B 3L3GB 3CU7A 3T2NH 5F89A 4QOKD 4NWUH 5DMKA 4L4TA 1DDHB 3QFDB 2FYYB 4A6YL 3VI3E 1KCVH 3REWA 2NY1B 4WUUB 2VLKB 3QEGH 5ABDE 3VRLF 4LQ1A 1P84J 3IDMA 3B9AA 4MJ5B 3GMPB 1AD0B 3GMNA 4MNHA 3SCMB 4PJXA 3QDGB 2VZUA 4HUVA 1I8KA 1D5IH 3L3IB 3SDYH 1NGZA 4P2OA 1UQSA 3RVXD 5IW1B 5ADOH 3DSFL 3EYSL 4GUPB 1RJLA 3RKPA 2YD6A 1I8LC 3MV9B 1JVKA 3PP3H 2Q8AL 4G8EA 4D94A 4P3WA 4LSSH 3MLPA 2LU4A 4H0IA 3SCMC 1NDGB 3I02B 4W6WB 1YEJL 3TA3D 3VWKD 4XPHL 3U7YH 3ECBB 2IQAA 3QCUH 2YEZB 2NQCA 4MAYD 4AM0B 2MTPA 3QWOA 2OR9H 4XNYH 2EDBA 1BPVA 4L9LA 3VFRA 4OBRA 2ZSWA 1KB5H 4OFPA 1N0XL 5GS0H 5M7QA 5MEND 1KB5A 5CLTA 5HDBE 2VJXA 4KU1A 1TJHH 2FJFA 3KNBA 5IW1A 4EJ1C 5J6HA 5FF6B 5C0AB 3GM0A 3CFKA 4NKIL 1DBJL 3VXTB 4FNLL 1UXSB 2AV1A 4ELMB 1NCBL 1U8KB 4NQEE 4P0DA 3HPJB 4OF0A 5DJXA 2HVJB 4Z95H 1QFWH 4HSQA 2ZUVA 1UJTA 5E03A 1I7ZB 2AJYL 3FT4B 4PB9L 1T1ZA 1KCRL 1TZHB 2E8YA 4UQ2A 5BO1H 1GGBL 3QWOB 1ZV5A 1JZ6A 1IGFL 2AQ2A 3HTLX 3C6LD 5H37H 4IMLB 4LEOB 4KK9D 4JRXA 4RAUA 4YO0A 3BWAB 2OTUB 3GMMA 5K9QG 1LO4L 4OAWB 3MV7E 1KIQB 1BHGA 5AZ2H 5GGVL 4M1DH 5E6IC 3TNMA 3V6BR 2YKLH 1P5UA 1TVHB 2X44D 3QIUA 5I15H 3HNSL 3LEVH 5GSVB 5H8DA 2FHCA 3LZFL 4DGVL 2VLLB 4P2RE 1GSMA 1S7RB 1CDUA 1S7TA 1KCLA 4BFGA 4L3CA 2HWZH 1ZHKA 4AIZB 1GAFH 5EOCJ 4JY4B 2DTML 4UIKL 2VQ1A 3VI4E 5T1KB 3QO0A 1UXWA 3OKKA 3ORJA 1BF8A 3FO0L 5BRZE 2JK5A 4ZYKB 4Z9KB 4QRRD 4AQOA 2FO1A 2IF7A 3DSNA 5JPMB 2VDKL 4J23A 1I4FB 2GUOA 2ZKHH 5HD8C 5T1LA 3TO4D 3RPIB 3ILPB 1L6XA 4XCEB 1BVKA 3TA3B 3WO4B 2NY5H 4L29B 3DX6A 3MRJB 4WDIA 4D0BA 3WFCL 4FRWA 3R4DA 3GMOA 4HF5L 5E24E 1MJ7L 3KDMB 5F9DC 4Z78B 2NY7L 3DMMA 4O2EA 4NJAL 4CADB 1XGQA 5CEZE 1IAKA 2QBWA 3D1MC 4HIEB 3G08A 1FNEA 1K6QH 1P53A 1F90L 1KLGA 2NZ9D 3IDXL 4EI5B 3WL9B 1I4FA 3RPKA 3ZDYF 2OR8A 1ZGLP 4Y16D 3HCVA 3GKWL 5FUZH 1CXFA 5JTWA 3BGMA 4ENEC 2NXZB 2EDKA 3L5XL 4K7PY 4F9PC 4Y5YB 3IKKA 2P5WD 2EE9A 3DV6B 5F9OL 4LCUB 1Q94B 4YFLF 1MCCA 1FL3A 1YEEL 3P3YA 3KWWB 1LO4H 1QVOA 4TVSa 4ZO7A 3JV0A 1VKXB 5IHUH 2Y36H 4PGZA 1CN4A 1MCSA 4QXWA 1OSPH 3MNZA 2CDFA 4NNPL 3HMXH 1WC7B 3Q5OA 1IAKB 4NN7C 4P9HL 5ACZB 4DGVH 4YHKL 5C0RH 1DBML 3ZYOA 4R6UA 4X6BA 2VN4A 4U1HB 3WL9A 5CIPH 4XP9H 1KIPA 3V4UH 5D70H 3RI5K 4J3SA 3VFUA 3MRBA 2DYPB 5DJYB 4JKPL 4XH2B 4GAYB 4YHMH 4ODVL 1QFWL 5BS0D 5JOPE 1MSPA 5FV2A 2EDJA 3DV6A 4FQJL 4Q58C 4XNUH 4GG6A 4HKJA 3TVMB 2W9LA 3VRIA 1XR8B 3C2AL 1OP3H 3ZHKA 5J57B 3EDKA 1BQLL 2HG5A 1MIML 2YZ8A 1HDMB 3GI9H 5IMKB 4QGYA 2VLKE 1G7JB 2HJLB 1DEEA 1NCUA 3L1OL 5BOZG 2Z31A 4Z0BL 5HHXH 2AK4D 4FTVE 1FSKC 3GSUA 4MQ7B 1KUMA 2Z31C 5CBEA 1ADQA 4UDTA 4NQSB 5D6CB 3WKNA 3V6ZB 1NGPL 2UZYB 3B43A 4NNYB 5C08D 1G6RB 3L9RB 4FNLH 1QG3A 2AJUL 3OF6A 4ETYA 3BGAA 2J6EL 1H0DB 3IU4H 2GCYB 3NPZB 3ZSSA 3JWOC 1YNTA 3KXFD 1BEYH 4JANB 4ZOEA 1SJEB 2LTQC 3SDXF 4ZFOA 3FAWA 3GNMH 4ONGL 4RMRA 4BZYA 3LIZH 1F3JB 3UTZA 2E27H 1ES0B 5D7IB 1EEYA 2EDRA 1S9VB 3DV4B 3NZ8A 3V4PH 3BN9C 3CC5A 3FHQA 1NCCH 4QHUA 4XC3L 3FMGH 1LILA 2GITB 4PJBA 2GK2A 3FZUD 2PW1B 4MAUL 3UTTD 1LE5B 1JPTL 3CLFL 3BP6B 1JYNA 3OXSA 1JZ2A 4I0PA 4JGMA 1NAMH 5ID1A 1KJMB 3MJ7B 5I8EA 3U82B 3IJSA 1YY9D 5JNYA 1V7MH 2R1WB 3FQTA 4NQVA 4ODWB 3HZVB 4XZUA 1A2YB 3QIBD 2OP4L 5D6DA 2R0LH 3DJ9A 3OZ9H 3CGTA 4O5LL 4XNQB 2EDEA 2IMMA 1NBQA 1H3XA 1WSST 1JGUH 2CO7B 3UTZB 4MA8L 2GAZB 4UNTA 3QEQE 3QXTA 4P2QB 4J3WA 2UWEA 3T09A 4P46A 1T03L 1CD1B 4I9WE 1PEWA 4NQUA 4O58H 2IQ9L 4MWFA 1EO5A 3UTPD 5MP6H 5L2JA 1C08B 3QRFM 2Z8SA 1MAMH 3VGGA 2X4NA 5F7DB 2NY0D 3RBSA 3S4SA 3VGEA 1U8HB 2UZIH 2ESVA 4YFEA 5IG7B 2P43B 1J0IA 2Q20A 2V2TB 5SWSB 1DN0B 4PJ7A 2COQA 4KWUA 4AYFA 3FTGA 4DJMA 2L7JA 2GJ6E 3M1BB 1U36A 4HS3A 1ZEAL 5MI0B 4P99A 4YFLI 1K4CA 2X89D 4NJ9L 2M26A 4LARL 1D6VL 1FNSH 4JHWL 3NCMA 1T0MB 5F21B 1YQ2A 3GMLA 2AI0L 2K7PA 1C08A 2BNQA 3HAEA 3QPXH 2F58H 3FFCB 3JUYA 3V6OC 2MCPH 3VH8G 3D3VA 4FZ8H 3O45B 4MJID 4WUUE 3V5HB 4HWBA 3K2UL 4PJEF 4JM4L 1IARB 2D7PA 3QXUA 5ETUA 1MVUA 3B5HA 1CE1L 2YK1L 2YPLD 5JOEA 2XPGA 3EYQC 3MACL 1MVFA 1UJ3B 5B8CA 4KI5D 5J89A 1FH5L 3CMOH 1J0YA 4GRWF 3O8XD 2PXYA 5F7YC 2VLRD 3C5JA 3QRGH 2PXYC 4M61A 5F3HB 1G7IA 2CXGA 4R97B 3QG7L 5E70A 3CZJA 3NZHL 5F7EL 4HIHB 1H5BA 3WBDA 2MNUA 4WI2A 3HE7B 1Y6KR 4N68A 1XH3A 2EXYC 2QSVA 5DRXA 4LPVA 3CXHJ 2G9HA 1T1YB 4IM8A 1B0GB 4KUZH 1VGEL 1T0PB 5ETUB 5I73C 2R1YB 5H94A 5HYQB 3TT3L 4ETQA 3AREB 3REVA 5F9WB 5KVEL 3CFEA 4Z18A 5EORL 3P0VH 5EIIA 3MFFB 5TPWL 4RMVA 5T1DL 2Q7YB 4NWTH 5CAYB 4OLWH 3T8XA 4MJIE 5CGMA 4GOSA 1ZT1B 5B39G 4XMLH 5FO8B 5D1XC 3AROA 2C4FU 2HT4D 3BH9A 4O4YH 3QFDA 3N1GC 3EO9L 3E3QE 4PFEA 2C7UA 5FYJL 1CGVA 1NANI 3D2UA 3P2TA 1D5BB 1KJ2L 1D5MB 1AFVL 2R4RH 4JFHD 4RMUA 1OD7A 2BHUA 4G7VH 2ZCHH 5BJTA 3OAYK 4LVNC 2NR6D 1QR4A 1JFQH 4LLYA 4M3JA 2J1KA 3PWVA 3P0VL 2Q86B 2C4XA 2P45B 2ED9A 4JFDB 1KELL 4N0YL 1IGTA 5DUPH 3R8QA 1QSEB 4UB0L 3UYOD 1JPGB 1IZKA 1ZA3A 1IGCL 4PJXB 4OQTA 2W9DH 4P59H 2JELL 3MC0A 4YZFF 4ODSH 4KK5D 1J7VR 1TTUA 1IQDB 3NMEA 3VXPA 4F3FA 1ZTXH 2UUDH 1J8HA 1NFDA 1A6AB 4LLQB 3SDCC 1P84K 3O3AB 4R8WH 1YMMD 3RTQD 2NPLX 3RWEA 2J8HA 1FP5A 4JY6A 1CQYA 1RZ7H 2I25N 3DUHA 3U4BH 1JBJA 4QRSA 3HC3H 4IS6A 4MNQD 3MLWH 2RQ8A 4HDIA 3V4VH 3RGVC 1Y0LA 2Q87A 4RFNC 1FNGA 1F6LL 1FYHB 3IDNB 2O5ZL 1A6PA 3L1OH 4PRBA 3ZSTA 5HDOA 4P9HC 3BEVB 2R1XA 4APQD 4F80A 2X4RA 5DLML 1JNLH 2ERJB 3Q1SL 3QUYB 5FF6A 3WXWL 4DKFH 2PN5A 3RWCB 3RL2A 1OAZL 3B9KA 2W9EH 3DBXA 2Y6SC 1IGJB 2BSRA 3LS5H 3AS0A 1GC1L 3OGCB 2IBZY 3P9WB 3CDCA 5SWZD 5DJ2B 3W39B 1KTRL 1J8KA 5FHAL 3QSKB 4G8IB 3VXRD 4Y1AD 5C0IA 3QHTC 3SGKC 3BSZH 2BMKA 1FBIL 1L0QA 1RJYA 4U7MA 1ZHKB 4KGLA 1VFAB 5TE7H 2RFXA 3STBA 1A6WL 2FCBA 4FQIH 4LQFL 4YDJA 4MJ6B 2YPVL 4K07A 2P8LB 2M8XA 3UO1H 1MOEA 4M8QB 3S36X 4KFZC 3LD8B 3PWPE 4MJIA 2BSSB 4I4WA 3GIVA 2FD6L 4ZS7L 3KPOA 2ZUSA 1NPUA 4PP1D 4EBQL 4MDIB 4ZYKA 3TF7C 3KLHC 1U3HC 3SEPA 5KJRL 3U4AA 3MLXH 5TE4L 5DTFB 4C83B 4ZODA 3HNVL 5DC9B 1QR1B 2GK0A 3PABB 1M6OA 2DQIH 3BKJL 5E08H 2W0KA 4U1NA 3DX6B 1T0NB 1YY8B 2PW2A 3LEYH 2XG5A 5E9DE 5EO9A 4GG6E 4ZNCD 1A5FH 4R7NB 1WITA 2VISA 4NO0D 2R0WH 3LHPL 3RIAF 3HR5A 5DYOB 2H2SD 2YWYA 4ZUWB 2RR3A 3LKOA 2W1NA 4M62L 2I07A 1EEZB 3GO1L 4ZS6D 4KY1H 1M7DA 2HLFD 2DI8A 1RZIA 1XCQB 4Z7WA 3BZEB 4C56E 1UB6A 1NC2B 2PYFA 3SKOA 4OLYH 4K7PH 3C6LB 2IGFL 4XPFH 5GS2H 4GRLC 2IANB 5AG8A 5I1JH 1QVOB 4Q0XL 4JFOB 2X4OA 2GK0B 2DLEA 3KPQA 3SE4A 4F9LA 5HVFB 2VWEC 3T1FB 3UZVB 1P7HL 3BD4A 4JRYA 4QRUB 5HVHB 3C6SB 1G7MB 1IC4L 4HLZH 1AKJD 1IAII 2VISB 4NZJA 3LN5A 2MFNA 5C0CD 4X6EA 1S7QB 3MSPA 1M7XA 5LCVH 4E9LA 1NC4A 1AQKL 5HHNA 1CGUA 4GG6F 2PUQT 3L7FB 3WIFB 3QQ4B 3TVMA 4RZCA 1H8NA 5F72S 3QT2A 3VWJB 3KPSB 1OAQL 4QOKA 5HI3C 1DFBH 3RWGA 3VG0L 3HE6D 3NVQA 1OGAE 4AMKH 3IJHB 3QZWG 5CHNB 3F7VA 4S0TD 2C3GA 3GSXB 2ZWLT 3EAKA 4D2NA 4HGWA 3CVIL 4XMPH 2CKBL 1Z0MA 4J4PD 2A6IA 4BFBD 3EDDA 4H1LB 4KZEL 4FQ2H 5BS0E 3N0PB 3QQ9C 2HP4A 3EIFA 2EC9U 5ECJE 1FO0L 4N1CA 2VXUH 4YHPB 4PV8A 4G80A 3K8MA 1AI1H 3MV9D 5D6CA 3VGFA 4J8RB 2F54A 1ZWIB 1ZGLA 2MQ0A 3M8OL 4YAQB 4HD9A 1T89C 2EEBA 5CJ5A 2APVA 1TQCB 2NY6D 3HE6A 1WBYA 4HBQA 3TNNB 2DQTH 5DC4B 3P4MB 1U8NA 2WANA 2VLJA 2GHWB 4OZFG 1NGXB 1U3HB 4MB4A 1XT5A 1JNHB 2Y9RT 5DD0L 4Y1AE 1MJ7H 4L9LC 5C7XH 2ICEB 5ILTH 3CCHA 3I75A 4YZFE 3VDCA 1W72L 5ICXA 1JFQL 2IALB 3TO2B 4I3GA 1KCVL 3W82A 3PDGA 3WNLA 3A6BL 4OV6F 1A6VH 2P8PB 4MCYA 4PBVC 4PGBB 4YXKL 5IIEA 4X0KB 4R26L 4A2LA 4K3JL 1S7WA 1HQ4B 4Y2DD 3HE6B 3S3PA 3SE4C 4BZ2L 4K3EL 3WIHH 3ME0A 1EGJA 1WFNA 4LP5A 1M7IA 4QTIL 3QH3A 3HC4L 1VADB 2FIKB 5T1DH 3HMWH 1T6VN 5IHZA 3HE7D 5K59E 5DFWH 1OF2A 5DQJB 3PL6D 5FDYA 5TE7L 3WXVL 5I76A 3DI3B 2Q76B 3R06A 3O4LA 1J0HA 2EDHA 4MX7A 1X5YA 5I1CL 2H1PL 4MWFB 5D2NC 5EOTB 4P4KD 3ZKMD 2OR7A 4JFEA 1PKOA 3FTGB 3RUGF 1ZT4A 3DMMD 3KYAA 4ZPVB 4LSQL 4X99A 2AXGB 4PRPD 4HKXA 4PJ5D 3H3PL 3MRNA 1WUNT 3E2HC 5E1AB 3U0TA 3NFSL 2Z92B 3H0TB 5B8CC 4H26A 1F2QA 4HK3N 2P42B 1FRGH 1FAIH 3BYYA 2YPLB 1IBGL 5IBUG 3GMLB 4LPTA 5GRYA 5GHWL 1KULA 1XEDA 5FGRA 4D9LL 3QWRA 3H7BA 3IS0X 43C9A 1XGYH 1AHWA 2D0GA 4GG8B 2YEZA 3TGXA 1JRHL 3Q1SH 4WFED 1CGTA 5HGBB 1S9YA 1C12B 3D0LB 3BZFB 5FCUL 3CVHB 1DBJH 1FVDB 2AXFB 2NYYC 4ZFGH 1QRNE 4NO0B 3NCCB 5JW4Q 5DF0A 3MBED 4LHQB 3DIFB 5D7LB 4UI2A 5J6HB 5L8LB 3DUSB 5DEGA 3V5HA 5DVMA 35C8L 5J1AA 3U4BL 1FFRA 3OKYA 5C0EA 1DN2A 4G6FD 4K7FA 3V95A 2VKWA 1O7VA 3EDFA 4JB9L 5FYKD 4R8WL 1CD0A 4ISVB 2FX9L 5BMFL 1T21B 1I8MA 2QQKH 1NUNB 5C0JA 2C1PA 1P4BL 4ZFOL 1DVFB 4PUBL 1W72A 2O5XL 4MJ4A 1WT5A 3BX7C 1S7VB 2DQJH 1BFVL 3O2WL 4A6YA 1FVDA 5E2VL 1PW3A 1RFDH 5ALBL 3WFBH 1S7UA 2W0PA 4PRHE 3W2DL 4OF6A 3G6AB 5IWLA 1D9KB 3DIFA 1ETZA 4JO3L 1ZHNB 1UM4L 4R4FH 3BKMH 2VLJE 1GGIL 5HGDB 5K9JL 5DD3L 3ETBF 3AGVA 1MWAB 3CX5J 3MREA 4LBEA 1QLEL 1GL4B 2OSLB 3VI4F 1YECH 5KN5A 4Q9RH 4QTIH 2B8OT 4NFBA 2DQEL 2KKQA 2V6HA 3OKOA 5D4QA 1F4WL 4NN5B 4MA8H 5SWZE 3T1WA 1ND0B 3FQRA 1WEJH 4X6CA 2K1MA 1S7VA 2NY4D 2APBA 5C9KA 3LN4A 1GZPA 2FRGP 3DOSA 5C0AE 4Z5RA 5A3IC 3ZE1F 1UADC 4XVUD 3OKDA 1G9NL 1QLEH 2J8UE 3D2UB 2JE8A 3GSNL 1JPFB 1ZHNA 4ODHH 2NXYD 4WGVB 4I77H 4HJJL 3CFBA 3V9FA 1V7NL 1DL7H 2EIBA 5KVEH 1L6ZA 3UAJC 5MEPB 5FK9B 5EOCH 1JE6A 1H15B 3QUYD 4E5XB 4FABH 5C0NC 3MREB 1FIGH 2W59A 3FONB 4WWKA 3H3KA 1MAJA 4O2EB 4ORGB 5D2NE 3RL1A 1S78D 3LIZL 1T2QH 1LVEA 3CIQA 4LCWA 4N5ED 4U1KB 2X9WA 3BYTA 3MO1A 4JZJA 2OTWB 2VDNL 4PJXE 3OKDB 3CSYA 3EOBA 5F8RC 3H9HB 1T83A 4GBXD 2CDGB 3LKNA 2HTKD 5DJAB 3EFFB 5IMOB 3VXQA 1A6UH 2CJUH 1I1YA 5KOVC 1IEHA 4M7LT 1NMBH 4E42B 1K9TA 4PBWD 3X13B 3V2AR 4WY7H 3H9YA 5D9SA 3S88H 1F6AA 3WS3A 3PWPA 2BRQA 2OL3H 3GSNB 3ZTNL 1SJXA 5EBMB 4OD1H 1OGTB 1BMGA 3HG1D 4X7FC 4XCFL 4G9FA 2CLZA 2DLGA 4U1KA 4P57B 5DMKB 3KJ6L 1G0XA 1NCNA 1UJ3C 3L5HA 2YPKA 3F58L 1J87A 4C56D 1TJIL 1N7ML 5JW4M 4XH2A 1AD0A 4MNHB 3SCMA 2YA0A 2OTPA 5CJXA 2PO6B 1YUHA 2XXCB 5GIRA 5HI4C 2V7NB 1TNMA 3EDJA 3QHZH 1ACYH 3QUXD 2I5YH 4TSCL 4X7DC 2UZIL 4LLUA 4XGZB 1FAIL 3U0WL 5JR1H 3LMJL 2BXZA 1IILE 4NBZB 4PJDE 1P7KB 5EBMA 1CICB 3MNWA 1UXSA 4L3ED 4Z77B 5GGTL 3BHBA 5ACLA 4WW2A 5HDLA 5E2UL 5C2BH 4KJWD 5FYKL 3ULVL 3TBWB 5I1AB 3IAQA 5HYSB 4JQXA 1PBYA 4R0LB 1P4IH 3IFNH 5C08E 1RIVL 4U3HA 2X4SB 2F74A 3N1FC 4KVNH 3O6MH 2RAMA 3HI5H 2BVQA 3MV7A 4K3JH 2XV6B 4TNWF 2FEDD 5A43C 1A14L 4JFXA 4WTZG 1F3JA 4BZ2H 4LEOA 1MI5B 1TZIB 1UEYA 5ERWB 2EE6A 5D1QB 2ILLA 4OAWA 1OM3L 4WU5A 2F5AH 5FCSH 2RBLA 1E4WH 1LE9A 4OI7A 4OCXH 4OSUH 5EU3A 2PW2B 1KJVB 2ZNXA 1JZ4A 2NY5L 4M1CD 4OM1L 1P6AB 2X4PB 4JO1L 2I9TB 4NT6A 5DYOA 2VTFA 3MJ7A 5I8EB 1FZOB 1RUML 2GKIA 4OGYH 3MBEB 3PGFH 1UXWB 2GJ6B 4CBPA 3ARBB 1JTPA 1R5IB 3ES6A 5C7XL 5MEOA 5ID0A 4MHHG 3IDIA 4I0CC 5EO9B 2Y4SA 4XNQA 5I30L 5JPMA 3PL6A 1BEYL 1WJ3A 4CN6A 3QXWA 4YLQT 4W4NA 5E6IA 3QISA 5EZLB 4OLVL 1KTDA 3SDXE 4HK3J 4FQIL 5BW7A 1CU4L 4M48H 5KSUB 2ERJC 1EFXB 3H2WA 4X4XB 3LV3A 3P9MB 3ZT7A 4YGAB 1ZHLA 2ZUWA 3A6OA 4X7SL 5AAWA 3KDMA 4RDQF 3SE8H 1DQMH 3C9NA 4XBEH 1MQ8A 5D1ZB 4P2QE 4JFOA 1KOAA 3G5XB 4YEFA 3RA7H 2EIZB 3L7FA 3WIFA 4I3SL 3VGDA 4XP4L 1BFOB 3VG0H 4JRYB 4QRUA 5CP3H 2X2YA 4FQJH 1FHGA 4XMPL 1N6UA 3MLYH 4G8GB 1T20A 2UVFA 3PL6B 4RGNB 1GC1H 3BP4B 3IFPA 4JM2D 3OB0H 4NZRL 4L29A 4MZ2A 4XCNA 1L0YA 4Y5YA 1NANH 4FQXD 2F53A 4KHTH 5IBTH 3DYPA 3P9MA 4XP4H 1JUFB 4XPTL 5ELIA 5C3TA 3FB6A 1WIPA 2R0KH 3PGDB 1DBKH 4RISH 4ZAKA 2F54D 2WWMC 3S36H 4LOUD 5DK0A 4NBXB 2AEPH 4NZDA 4OGAD 1J0KA 3IJHA 4Y4HB 1JF1A 5BV7H 3I6KB 3TZVC 3NFNA 4ZSOE 4Z0XA 5DD6A 1X6NA 3CSBA 5H2BB 4XCYB 4L3AA 4P2OD 3NGBC 2X6MA 1HOCB 1UJ3A 4YEEA 3T3PE 5I8CA 3GBNH 3ULVE 2DYPA 2DQDH 1J0JA 2E6QA 5DJYA 3W9EA 1WISA 1D9KC 2J5LB 1T5XA 3PNWA 3TH2T 4EI6B 3D0VB 2HH0L 5EU4B 3QB7C 4QXTB 4UV7L 4F7TA 2XZCL 3QUMH 1U6AL 1XH3B 5GJTH 1MHCA 3QJHB 4OM1H 2DQIL 3B6SB 5ICXB 1Q9KB 5FM5O 3PGFL 5E8NA 2OK0L 1E4WL 3L95B 1DQQA 2DJSA 5AEAA 4MA7L 4ZFFB 3OJDA 3MLSL 3LEXA 1YYMH 1WZMA 1UKTA 1L7IH 4AIXA 3VXUA 3MLUH 5I19H 3HFMH 4G7VL 3RNKA 3ARSA 1CWVA 3O11A 3D0VA 1HILB 4KMTL 3G6DH 4NM4H 1U6AH 5F1KC 2AABH 1YPZF 1R3HA 1D5MA 1MY5A 3NZ8B 2O5YH 1N2RA 2GSGB 1CDCA 1CLOH 5AZEH 3QCVH 1IC1A 4X80L 4OLZL 2E9WA 2QSCH 4HKBA 4PJGF 4XX1E 2D7TH 1EZVY 4PJGE 3V5DA 5DJCA 2EZ0D 2YD4A 2YKLL 2FJGB 5J9PB 1Q72H 3L95A 4Y4FC 5J7CC 2OJEB 4X4ME 4EVNB 1VGEH 3O9WA 3LEXB 3SO3B 1EIBA 4GAFB 4NSKB 1LNUA 1LEIB 1BM3L 1QD0A 1A1MA 1XGUB 3AXLA 3VD7A 1XR9A 1GRWA 3UC0H 4MX7B 2Y07L 2FYYA 2DLTA 1G6RL 4YGVB 2BJML 1Y18A 5T3XE 3VH8A 4BFIA 4G5ZL 4XPTH 1YEDA 2DKUA 1LK3H 5I6XC 1T4KB 3QUZC 1V3MA 4JHBA 1MWAH 4JREC 5FYJU 5I1EH 4Z76B 3KPMB 3W5MA 5C07B 5FKAA 1NCBH 4CDGC 5DLMH 3FRPA 1UQSB 4XT1C 5JNYB 5KSBF 4PJ5E 4KKLC 4LRNH 3DUSA 1U9KA 4IS6B 4WVRA 3I6LD 4YPJA 4NKIH 4JKLA 1QPPA 1QP1A 4OCSH 2VDMH 3THML 5JMOC 1CDBA 4KQ4H 4Q9CA 1TJHL 1KCUL 4LKXB 2AXHA 4V2CB 2AXFA 3BIKB 5IEKB 4D0CA 4ONHA 3GJFH 3N1PC 2A9NL 4HBCL 1NMBL 1CDGA 4J7RA 3RX7A 3ARVA 1K4CB 2VDNH 4L9LB 1ZTXL 2PF6A 5IKCA 3VXSA 1EDQA 2WWKT 1IGJA 1BLNA 3GSRB 2JIXA 1V3KA 1VPOL 4K2UL 3VW3H 3OKMB 3OKLA 1JHTB 4ELMF 4LLDB 4KKAD 3WEXB 5HJ3B 3SDAB 3VXTA 5KVDL 1DBAL 1ZVSA 3DSFH 3U30B 5KSAC 5GGRB 3WS6A 4PJEA 3HS0B 3VFOB 1CLZL 1A64A 3B9KD 5K33A 4LBEB 5DT1H 5HBBA 5CKAA 5EU6D 3O0RH 3KYMA 5IFHH 1S7UB 1SQ2N 4YC2B 3M1BA 1RUMH 4YXLL 1ZVHA 5FV1L 2HT2C 1BVZA 3QIWA 1AGBA 1X4ZA 1HE7A 1JTTA 3VGHA 4V2BA 5EOCL 4HUNB 3VWJC 2V2WA 1I1CA 4OCXL 1DL7L 4OSUL 1IAOA 4I77L 4M1CC 3T2NL 2QADB 5CSZB 4F2MA 3GSNH 1YNKL 4IRSA 2BSSA 2YXMA 3TH4T 3TVMC 4Y4FA 4OCNC 5I1GH 5FIEA 1IKFL 3K7UA 1B0GA 4OLWL 3MUGB 4UT7H 4DOHE 3DUUA 5JXAL 3LQAH 1X5FA 3QNZB 1CFQB 4ZPTB 4JG1H 4P3CL 4LDLB 1J8HD 3HNTL 3RAJL 4KZDL 1A47A 5EC1A 1CG9B 4KDVA 4JLRB 1GGIH 3TBSB 4ENED 1CF8L 1ZANH 1NLDH 4X4YB 3WLWC 4IOSD 1RFDL 1JWMB 1VCAA 2V2WB 3T4AB 5IHLB 4WTZA 4X4MA 3BH9B 2MPAH 4PYHA 4HC1L 3HRPA 4JG0L 1UM5L 4QWWD 5CINH 5GZNC 2GUOB 3VGBA 3FB8B 4IRSB 2G9HB 3JTTB 5DJAA 3ULVD 5IMOA 3MGAA 1BFVH 1RZ8A 2J6EH 4PJ9D 1BBDH 4E42A 3MUHL 3F6LA 1CFQA 4PJGB 5F7EH 5HGAB 1CLCA 1HKFA 4JZJB 3MFFA 4D9RE 3L3JA 4N0UE 4ZUTA 2JJTC 4PLNC 2EDOA 3H9HA 3WJLA 3UDWA 2A9NH 4HBCH 5HTSA 4CVXA 4KDTA 3UEZA 2JJWA 4KKCD 1LDPL 1GOGA 5ICYA 3DRQB 5FCUH 1WWBX 2CGRL 1K4DA 2MCPL 1BOYA 1M71B 2Z35A 3FOLB 2J7LA 2A1WL 1IRAY 5IESH 3CXDH 2VDOH 4JFDD 4I1NB 1JHLL 4NDMB 4PG9A 4YHML 2I26N 2PO6A 2APXA 1GC1C 4V1DB 4PJIE 1OTSD 3T65B 3O3BB 1JCKA 2PYEA 2R2EB 3CXHK 1TVBB 4JO4H 1KT2B 3DURB 4LPCA 4LAQH 1DUZA 3E6FA 4I18A 1A9EB 1E6OL 3INUH 5J0BA 3HC0A 3FB5A 1CGXA 2CDFB 4WO4D 3UTQB 4JN2B 4U0RB 4NZUH 3RX8A 2P44B 3MRPB 5IMMA 1CICC 2FX8H 1OQOA 4YIQA 1MRFH 2NY3D 1I9JH 3GSXA 1PKQB 5F7WC 3BN9D 3DX7A 4LSQH 3WXVH 5TDPB 1KIPB 4IRJA 1A3LL 5IBUB 4OZIF 1QFPA 2IADB 4Y89A 5IP4A 1GGTA 5DRZA 4NCC1 1CF8H 1ZANL 2VIRB 4YDIL 43CAB 1I8KB 4U49A 5DEFA 3UMTA 2PYED 3TCLB 1G7HB 5JXAH 1IGML 1QEWB 3BQUA 1CLOL 4GS7C 4ORZC 3OAZH 4XRCB 5AZEL 3PDDA 1OTTC 3MRGB 4M43L 5FYKE 1U8NB 1ODAA 1KIUA 4NO5B 4PREA 4EIZC 4MA3B 3DI2B 4NT6B 1HI6A 4RRPA 2WZPD 3T0EE 4M7ZC 3L5IA 4WI4A 4NNYA 3A6BH 1BVLA 1LMKA 1J86A 4XC3H 5IVNA 2QL1A 4PGCB 1ZS8B 4LCIL 2F53D 1FG2A 4HUUB 4F57H 1A6ZB 3F7PC 4HIJA 5I1KH 5CLWA 1OL0A 2FWOA 3ARGC 3H42L 5GISL 1ZSDB 1BWMA 4QXGH 5MERA 3D9AL 3DV4A 3RKDD 3GIVB 4G8IA 2BNRD 5J1SC 3ELAT 2C9AA 1CDHA 5A2KH 5A2JH 1I7RA 2DQTL 1IAMA 5C71A 4GO6B 1FZMA 5JZ7D 2GJ6D 1NBYB 3GBML 4HAGA 5EBWB 1P4BH 1AKJA 4HIXH 5LVEA 5J6GB 4BH7B 5ICZA 3FT4A 2AK1L 3DPBA 3LKSB 5FDWA 1BVLB 2X1WL 4NQVB 4ODWA 4DKDC 4MJ6A 3QG6A 4YHNA 1MEXL 4TUOB 4B53A 1CT8B 1BFOA 5D7KD 2IBBA 5DHYA 2XQYG 2FEEI 5HHMB 1YPZE 1PEZA 1OPGH 4JRXB 3SO5A 3U2SA 4JFEB 3QHFH 3QUMB 3KPTA 4DUWA 1JGDB 5DJ0B 2GAZA 2JIXD 4QT5B 3KPOB 1D6EA 5DRWA 4K9EH 4P48A 1LHZA 1TTFA 3WKMH 4O51A 5C6TL 1BJ8A 4OZGB 1YN6A 3BZDA 3KGRA 4AJ0A 1Q0XL 1JRHH 5JLZA 3N1QC 3WSQL 3S5LB 5SV3A 3SKOB 1T20B 3OSKA 1RJZA 4UQ3A 2NNAB 4WFEE 5C09B 4LIQH 1RVFL 5I74C 5CUSL 3S6CA 1GOHA 3QHFL 4HT1H 3FB6B 4K8RD 4Z7VB 3C08L 1EV2E 4D0DA 5I1LB 4DQOH 5I1DB 4H0HB 4LCYB 1PZUB 5BVPH 4MNGA 2GTZA 4IJ3B 3L5XH 1AE6H 5EPMA 4M93C 3B2VH 4D0BB 4Y4HA 1UB6B 1N0LA 3C5ZC 1YN6B 2DM3A 4QRPD 4UNUA 1UZ6E 4F7TB 4ISVA 3KPSA 3RQ3A 1Q8MA 2ZOLB 4XMKL 3MXWL 4OLYL 3C60B 3BMWA 3MJGX 5I8CB 3L7EB 4YBLC 3RFZC 1N4XL 3QA3A 2CDEB 2GJZB 4G3YL 4KXZI 3QEUA 5D1XD 5C09E 3MRLB 3C8DA 2BRRH 2AABL 4CN1A 2VC2L 4NM4L 1CL7H 3E6HB 5EO0A 2JB6B 1XF5B 1DQQB 4N0CC 3G5VB 1D5IL 4NO2A 3SDYL 3D9AH 1HHGB 3DX9B 4MS8C 3MR9B 2CRMA 1L7IL 3FAXA 3TM6A 4V1DE 4KVCH 5JIKA 1TIUA 1NMAH 3LD8C 3QWQB 1AO7D 1KJ3L 5E6ZA 4K3GA 3VCLA 5IB4B 3QDMB 2FLRT 5JA9A 5D5MB 1R3HB 4GAGL 4DW2H 5BZWB 4N8VG 3QJFB 4JDZA 2ICWI 2R9HD 3L7EA 1OQXA 3DRTB 2CDEA 1ND0A 1A7RL 4G9FD 1S8DB 3OL2A 1WZLA 1LO2H 2BVOB 3AB0B 1DP0A 1IGIH 2G75B 5E5MA 4N0UB 5T5FL 4PRID 4HX1A 2DIAA 2UY6A 1UCTA 1VFBB 8CGTA 3MRBB 3OKNA 5F1IB 1KXQE 4C4KT 3EOTH 4S2SA 5IOPA 3NTCH 3QDGA 4LQFH 3BEWA 4S10A 2HJKA 5CP7B 5FYKH 4XPGL 4HUXA 3WHE1 3B83A 2NLJB 1EFQA 2FGWH 1RJLB 5D2NB 3D39B 2OJEA 2UV3A 1TJGH 3L3KB 1N59A 3EJZD 3U46A 4YHYC 5TQ0H 2W65A 2R0KL 1KCRH 3RVTC 4TUKH 4UILL 4G42A 3LRGA 3FQWB 5E8PA 2FX7L 4BQ6A 3JV6A 4HX1B 4Y4HD 4M6OH 3PGCA 4P2RD 3OR7B 5DGQA 1FYTE 4GRWE 3CSYB 5HI5C 3RGVB 4OZGF 1YN7A 1YEDB 32C2B 1EXUB 1N7MH 1A22B 4DOHB 1GIGL 1MFEL 2ZCKH 4LMQI 3P0GB 4WFGE 4JZOB 5AYUL 5KTEL 2ADJB 2VN7A 2HN7A 4KMQA 3ARED 4MCYB 1W0VA 5DRNA 2NLJA 5L0QB 2NY2C 3S7GA 3RY6A 4OV5A 4OZ4A 3OG4B 2PR4H 3QXAA 4IRSC 2ZUXA 4JM2B 4PIRF 1OT1A 2C4FT 1ZXQA 3TC9A 4RGND 5IB2B 2NY3C 1MLBA 1HYSC 1MNUL 5J12C 3NPSC 4ERSL 3S9DB 4FG6D 1T7ZA 4H8WH 3JV6B 3OB0K 5JW5B 4WWID 2EDLA 1I7ZA 1FNGB 1KPUA 1BBDL 3EJYD 2FL5B 2X4TA 4NKMA 4M62H 5IWLC 4JDVA 5F7UA 4LVHB 2ENSA 1RV6X 2Y72A 3MV8B 5HPOA 5IFJA 5LWYH 2J4WH 3SQOL 3UJJL 5F93C 1T6WA 1AGFB 3IFLL 4WW2B 2BSRB 4MSWB 5LJYH 4TPRH 4IDJL 2EXWC 4Z7OE 1UA6H 2P5WE 5T3XH 1LO3L 2Q8BL 3KPRD 4ODTL 3S37L 1V7NH 2VXTL 3LB6D 4EUPH 4X5XA 3HNTH 3TBVA 2JCCE 2VUOA 4QXUH 3H9SE 1U41A 5IM7A 2Y23A 1KPUB 1T66C 5C0IB 3MZGB 1DLHB 4JFFE 1EZVX 5B22A 1IAOB 1WCQA 1G9NC 3VE0A 4JQXC 4Z7UE 2PCPA 4PJ5B 2FD6H 3HKFA 3VFWB 1P4LB 2VE6A 1MFCL 4C55A 1QHOA 4RIRA 1F4HA 5AG9A 1GGCH 4O4YL 4MMXC 1YC7A 4KRPC 4D9QE 3MRJA 4HEPG 1MI5D 4ZMAT 5EU3B 1DVFC 3LY6A 5E8DL 4ZPTA 4XAWH 5B3JF 2WQ8A 4NQCB 4F7CB 3ZKND 4D8PB 3CFCL 5GGTH 2C3VA 1NFDF 4HIIA 1IJ9A 4WUKL 2HMIC 3QZWB 4NIKB 2HKHL 2VR5A 2WBJA 4DTGH 4JO3H 4Y4KB 3VRJB 1BQHA 7CGTA 4J3TA 5ESAA 5C0BE 4Y2DB 1I8IB 4XP1H 5HGAA 3T0AA 3U9PH 4GMSL 3EUUA 3O81A 4XP6L 5F9WC 4B7LA 5EU6E 1F2XK 3QIBB 5D8JH 5CZXC 1QFWM 3U30C 4WO4B 4CW1B 1H15A 4E5XA 1JHLH 3SDDC 2OLDA 1SJHA 1CD8A 1ZVYA 4KTEH 5EU7E 3MMEA 3VFPB 5JDJA 3MA7B 2C3VB 2ARJQ 2ZUQC 3GK8L 4MQSB 1Q9LA 1FN4A 3DHMA 3BP5A 3L3GA 4V1DD 4YWGL 5F8QC 4KQ4L 1IFHL 3K80A 2HT3D 2A6DA 3SCMD 3SN6N 1QLRB 1LO5B 2ZNWA 2R2EA 4ZFGL 2F19H 4FFWC 1RK0B 3V4VL 3TA3C 3RWHB 2VLKD 4K8RL 2EC8A 5D8JL 4WI3A 1F6FB 1ZT1A 5FO8A 1IC5L 2QR0A 3P77B 5L7XL 4X4ZA 4XP6H 2RB8A 5FYLH 4NJ9H 2A83A 4X6CE 1UG9A 4APQA 3PF2A 3IRPX 5ACMA 3NABH 4IOFC 1NMCC 5EZOH 3MRMB 4U2YA 5F6HI 5K9KB 4Q6IA 5FUOH 1D5ZA 3RHWF 1H3PL 4QYOA 5MP6L 4RA3A 4XBPB 2WQRA 5F1SA 3RZWA 1JTOA 3ZE1E 4XAWL 1INQA 4GBXA 3LDBC 4M03A 3VWJA 3UYPA 3EOBB 3RWHA 2CK0H 3LS4H 1FVEA 1I9EA 2XWJB 2CDGA 5E0QA 1YJDC 2DYPD 1YEGL 2Q8BH 5T3ZL 4N8CL 4NFDA 1CYGA 2P5EB 2QQLH 4N1EA 4LCWE 2Z4QA 1I1AA 4PJHA 4EI6A 3TCLA 1KPVB 1Y6MR 4XGZA 1A1NB 4K94L 4Y19E 2Z31D 1I7UB 3BDYL 1JGEB 5DVNA 3VMNA 1WWAX 1F58L 1NAML 4NZTH 1Q9KA 1WWCA 5DJXB 1U91A 1YYML 4Z7QF 1RZGB 1IE5A 1B6UA 1T80A 2G5BB 4CGTA 3BGFC 1UCBH 4RA0C 4KAQH 1JV5B 3Q6FA 3QDJB 3JTSB 4WU7B 5HHPA 1P9MA 1ZS8A 3SGEI 1MRCH 1B4RA 4H88L 1NBYA 1CXIA 1YYLH 1TLKA 4BK4A 6FABH 2CMRL 3A6CL 2XZCH 3VGAC 2FH8A 4U6HA 4X6DA 1B4JL 2PR4L 1SY6H 3JVGC 5J13B 2Y5TB 4M93B 2WBJD 4J3OC 3T3MF 1CT8A 3B9KB 5GRJH 3DBXB 1MIEL 5JDSA 1S3KL 3ILQC 3S35L 1TDQA 3WUWB 1VSCA 4NRZB 5I1HH 1E4JA 1NBZB 1CQKA 3KYNA 3SDAD 5JOPD 2VLRE 4L3CB 3PIQA 4Y4HC 5GXBB 2EYTA 1S5IL 4YHZL 3CDGA 1S9XA 3NCJH 1UACH 1TETL 1DUYB 1NBVH 4EVNA 4XPAH 3LAFA 4YHNB 4PY7B 3BPNC 4NSKA 2H6PA 2EKSB 2EDDA 2IAMC 1UH3A 3IDGB 1IM3A 3VFNA 5SWSA 3U2SB 1PGRB 4D3CL 1NQBA 4WU5B 4OZFH 3OKEA 4X6DB 4ZG1A 3MGOB 1OLLA 5DRWB 1XGRA 1M4KA 5IBTL 1T4KA 3TPUB 4NRZA 3LVEA 4P9HH 5IVOA 1ZEAH 5KANG 1PYWA 5J06A 2HFGH 1EGJL 4PJXF 5E00A 3UCRA 2Y36L 2QADC 3NPSB 4ZPVA 1HHIB 4CADA 4X99B 2ADGB 3MBEA 3G5YA 1KTKE 2A9ML 4HLJA 5D2LB 5DA0B 5EPMB 3EJYC 5K59F 1MVUB 4RX4D 3ZE2E 4FQHB 3FO2B 4U1IA 3NFPB 3DO7B 5I1CH 3ALWA 1WFOA 3BQUD 3CK0H 2OZ4L 1QFHA 1VEPA 3JV4B 4PRPB 1IEBB 2WUBH 2YA1A 2PXYB 5IB5B 3FT3A 4EN3D 1H5BC 3HMWL 1URLA 4M48L 2XICA 1K6QL 3B2UC 3DVGB 1GCFA 1QBMH 3DNKA 1U8IA 1AD9B 6CGTA 1F3RB 2ADGA 4R97C 1BQSA 3BO8A 4Y5YC 3V0AC 4DW2L 1RZIB 1XCQA 4Z7WB 3MRRA 5DC0A 2OI9B 4XNMB 4XI5D 2KUTA 2Q1EA 3C6LA 3E6HA 3MJ9L 2L7UA 4MNQB 5EIIB 4BQCA 1DBBH 5ITFA 4FQQA 1NGYB 3N85L 3CJJA 4XMKH 5EFIB 3RTQB 2QTEA 3FMGL 5DD1L 5SX4I 4HFWA 3KPPB 1MF2L 4QCIB 4JAMB 1HK6A 1YPZB 2QHLA 4QXTA 1S7QA 5L2KB 3RU8H 4G3YH 3AB0C 1C5DA 2YR3A 4LKCB 3H9ZA 5IR1B 3RVUD 3KLAA 2DQHL 2ARJB 2WM0A 3P4LA 4CMHB 2ZP0T 4Z0XB 3IKCB 4ODUB 2BCKB 3GBNL 1RURL 3UTTA 3QDGD 15C8L 1HN1A 4OFVA 4WV1C 5C2BL 3ARWA 4IRZL 3F7VB 4ONFH 2GY7B 4WUUD 4OUUB 4R90L 4MQTB 1WIUA 2HJKB 3KPPA 5CP7A 5EU4A 3O11B 1U93B 1IM9B 3BKCH 1T04B 5KS9E 5BO1L 3ARFB 3L3HA 2CK2A 2XACC 3EYOA 3I50H 4OFKA 4NC2B 3MLTA 1K5NA 4OJFH 1R24A 4CU6A 1ORQB 3ARZA 1EJOL 1OGAD 5I1IH 3GMPA 5FGCB 1BBJB 3NCYP 2F54B 2HKFH 4PS4L 2E7BA 3V5DB 3VXUD 4NZRH 1I1AD 4GMTL 1KBGH 4P2YA 4AG4H 4GUPA 1RURH 4RWHA 3MYJB 4FZEH 4PLJD 2DJ4A 4G8EB 2HA1A 2UYLB 4U1MB 4WWKB 4POUB 3RNKB 1S3KH 3S35H 3SOBL 3GIZH 2YD9A 3TEUA 4IJ3C 3MYZA 2DS4A 4WHTB 4NNPH 2BY2A 4MLSA 4J3UA 4P5KB 3HMXA 5DMGC 5EU5B 3GHBH 2OL3L 2X7LA 4X7EC 3I75B 3UDWC 5TH2B 2XN9A 2GSGA 2VABA 3IRZA 1EO8H 2AK1H 4Z7VE 2JCCF 4KV5E 5GJSL 2BNUA 4QXGL 4HIXL 3SE9L 3L3IA 1QBLL 3MZTA 1NDMA 1MCBA 2XFXA 2UUDK 4QRPA 1WBZA 3BE1L 4KRPB 5IV2B 4OT1H 3JWDC 4QNPE 3M45A 5DJ2A 2Z93B 4F33B 4AQ1B 5FA4A 1P69B 1S7WB 2ESVB 5F7KC 2NX5D 3PQYA 3QI9B 5F44A 4HJGA 2BVUA 3F12B 1SMOA 1F58H 1F4XH 4LVOB 1KJ2B 3U79A 4EOWL 3HPJA 3GHEH 4AY0A 2Q8AH 1K2DB 4TQEL 4XVSL 2IQAB 3LEYL 1L9NA 5LGHH 4GRMB 3EYQD 1BOGA 2DLFH 2VXVH 5KS9B 4LP4A 5I76B 1FO0B 3CD4A 4G43B 4JCMA 3PV6B 3MRDA 1FORL 4NWUL 1XF2A 5KAQG 2PXYD 5D7SH 5GIRB 2BNRA 4IMLA 5C0AA 2WUCL 3BKYL 1JHTA 1MREH 2JJUA 3MRNB 2AV1B 1AQDA 4FQPA 2GT9A 2JLLA 1GVIA 5SWSD 4F58H 5K9OA 5KAQF 1CGWA 2APTA 1U3YA 3D18A 4XHJD 1ZVSB 3Q6GL 4DN3H 1MCQA 3ESVF 2ENYA 3GMRA 3S34L 2R29L 3MRIB 3QXDB 1XGPB 4Z7UA 1KJ2A 4TTDC 5D96C 4XAKE 1LD9A 5I1AA 3NN8A 1OARH 4JR9H 3S3JA 3MOBH 2WWKO 1BD2B 3UJIL 1J10A 1YECL 1A6WH 4RAHA 3AFLA 3CSPA 1OWWA 4MLIA 1EMTL 4U1GB 5CEXA 3TO4A 5EORH 3SDAC 1I8IA 5J12B 5EA0H 3U1SL 5EO1B 2I24N 4P2QD 1NGQL 2EDYA 4NZUL 2OTUA 3GMMB 4F2MB 4WHDA 3HZMA 4D8PA 1FJ1B 2YA2A 3MV7D 3BSZL 2YSSB 5DRXB 2I5YL 2QLVB 3KR3L 1Z9LA 3QZWA 4ZUWA 3QHZL 4DZBA 2WIIA 3K0WA 4YHYB 1A0QL 4K7FB 2NTFA 3CVHL 1OD9A 3LQMA 2KH2B 4HS8L 5ESAB 4JM2C 3K4DA 4IRJD 2NCMA 5GGVY 2I9TA 3NN8B 2FX9H 4FFVC 2A6JB 3OKKB 3VXRB 4XB8A 1IKNA 4XCCH 2BVTA 1IKNC 3GB7A 4GAJH 4JFZH 1F45A 5SWZB 3C6SA 4YE4L 4PRPE 1FGNH 2Y7QB 2CGRH 3BXNB 3D69A 3BUTA 2MOVA 3MXVL 5F7NC 4WEBH 4YHIB 5BJTB 1U8OB 2QKIB 2XZZA 2HVKB 5EBLA 2DD8H 1HZHL 4TVPD 2AJZB 1O0VA 2NTFB 4DTGL 4P3DB 5ITBL 4HWEH 3KXFB 1A7PH 1XGYL 3RTQC 1MHPL 2FJHA 3IS1X 4OFYD 3MUY1 2BXYA 2CIKA 2WAHA 4O9HH 1N5YL 4HGKC 3BPLB 2GI7A 5FGSA 3HUJB 1Q0YH 4L4TB 5ACZA 1MJ8L 4JG1L 4P3CH 1G1CA 1INQB 4GBXB 1FIEA 5AAMA 1MFDL 3O2VL 5GGUA 1T3FA 1NLDL 4KJQD 3NIDF 3GMNB 4LEXL 5K9KA 4PTTB 3BKYH 1BIIB 5E6YA 3S34H 5IEHA 3ZTJG 3VFSB 3VWKA 4HJJH 4JQVA 4U1SA 5BS0B 4JPKH 1KPVA 4PR5B 4FTVB 3FHAA 4CDHA 1UA6L 4ZUTB 5GGRY 3FN0H 3DURA 5GGQH 3TT1L 3W0WB 4NKDB 5B3JE 3HC4H 3IDNA 2KQNA 2SEBA 3QXVA 3UTSD 3O2DA 4WWKD 2PO6C 1I3RB 4JFYB 1S5HB 5DK0B 5B4MD 5INCB 4HXAL 4BH8A 3O0RL 2W60B 4I3RL 1F4WH 5DD6B 5H2BA 4XCYA 3DX7B 1G84A 3WHE0 1INEL 1FLTX 1AC0A 4TOYH 1JGEA 3JTSA 4NC1E 2YUWA 1IL1B 5HXMA 4UBDC 4X8JA 1EAPA 4EUPB 1WAAF 1IC7L 5JO5B 2FNBA 5E8OA 2NXZD 4Y4FD 1C5BH 1KT2A 4HZLB 5FUCC 2HJLA 4UOW1 4R4BB 1U2HA 2R8SH 3BWUC 4JDZB 5AWNH 4M7KH 3RNQA 1PG7X 4HG4K 1DJSA 2OS7A 1LEKA 3E1F1 4PJBB 2YBRA 4TRPL 4LSDA 2V17L 2EH8H 5CEYA 2IANE 3DECA 5DWUL 5ID1B 2VZOA 4GAJL 4LSUH 3DTXB 3OGOE 1OF2B 3CMOL 4HGMA 5D6DC 3FFDA 2DWEB 4OLUH 3X17A 4UOJA 3BEWB 3SOBH 4W81A 4JVWA 5TGBB 1ES0A 1PJ9A 5D7IA 1DSFL 5IB3B 4I4WB 2PTUA 4Z0BH 3I84A 3WUZA 1MQKL 2ZUYA 4PJ9B 4JJHA 3HA0A 1DEDA 4CU7A 1JK8B 2DMKA 2H2SC 4FZ8L 2P48B 1DZBA 2PW1A 3QI9C 3G9VA 3GJFB 4HKBB 1QHPA 3VU2A 4ZFZB 4CVWA 4PREB 1PYWB 3EO1B 2EIDA 2R1WA 5KG9B 3VXOB 3FQUB 1T5WB 3RVWC 1TTGA 2F74B 4DGIL 4QHMA 1FL5B 5E8DH 1YC8A 3UJIH 1XGRB 4JFQA 1KV3A 25C8L 4TYUA 4HFUH 3NFPA 4WI8A 5A1AA 4OLZH 3KYOB 3SY0B 2BY0A 3QNYA 4U3XA 4RQQB 3C09B 2BOBB 4PTUB 2FATL 1IC4H 1FZMB 2H8PB 1OAUL 3GJFA 1NC2A 1OP5K 1MH5A 4KK6C 2X4PA 1I7TB 5EG6C 5I19L 3FFCA 1TCMA 3P30H 5IJVA 5ENWA 5M95B 4HWBL 3JWDL 1BJMA 4HIEA 2APFA 1KJ3H 4M7ZB 1V3LA 2J4WL 5ID0B 1RD6A 4A6YB 3HUJF 1AIFA 2IC2A 2BC4A 4Z7WF 1BZ7A 5EU6B 3HCVB 1JGDA 5B8CB 2V5SA 1Z9MA 4QRQB 1U8QA 2AJXH 4GFTB 1D6EB 1CL7L 3S37X 3GRWL 5HHNB 1UWEL 5EZIH 2QQNL 4HKZB 4J12A 5HGDA 5C0BB 4O51B 1XCTA 5MENB 2OMBA 3FO1B 1YDPA 4HF5H 1T0MA 1ERNA 1YPZA 2OK0H 3D39E 2VH5L 3I9GH 4HPOL 4H8WL 1PZ5A 4WIQA 3RUGE 2X89A 3SKNB 2VDRL 5CHNA 3NIGF 1BD2E 3C5ZA 4QRTA 4PRNB 3EYVB 3IKCA 4ODUA 5DQ9B 1ONQB 3OJVC 4P23D 4QHNA 5DXWA 3IFPB 5L2KA 1HHGA 4YXHL 4GAYA 4QRQA 4CMHC 1RVFH 2DQDL 3HRZA 4UAOC 4P4KA 2IPKA 3O2DH 4JFFB 5DDHA 3O9WC 1LQSR 4L4JA 2HWZL 5MENA 3C2SA 4P5TC 2HKFL 5GS1B 2HG5B 3LRHA 2M2DA 3ARFA 3PGDA 4CJ0A 5CJOH 3HE7A 4WENB 4TVPH 1G7JA 5FYLD 1KEML 2FO4B 2OJZL 4X9BA 2CKBH 1YQVH 5SX4H 2YRPA 1ORSB 4J6RH 4Y4FB 4AEHL 1S7XA 1DBKL 2BVYA 1QA9B 2GTWB 3GI9L 4NQXA 3MUGA 5GRZA 1FYTD 3RZCA 1EH9A 4XXDB 4Z7NE 2EO9A 4Y2DA 3I85A 3QDGE 3OF6D 4GW1B 1JI2A 3TBSA 2FGWL 2UWEF 4D3CH 1YNTB 5BRZA 5CWSB 1FLRH 4HULB 3F7YB 3RWIB 4PB9H 1BFTA 3DYMA 4KPHL 3RWDB 3EHBD 4ZFOB 1AGEB 4XBEL 5CZVH 4Z7QE 4J6RL 1KYOK 2OJZH 1A02N 2X70A 1VESA 5CJOL 1UEMA 2XQYK 4TUJB 4YXHH 1S9VA 4M5YH 1HHKA 5LGJA 3PWPB 1FFPA 3GMQB 3E0GA 2R2BA 1EJ6A 4WO4C 5E7BA 4P4RB 2HFEB 2W0FA 1SHMA 3X14A 1CK0H 2VLJD 3A6CH 1M7IB 3MRCA 4JY6B 5C0DA 2B1HL 5H37G 2X7LB 2Z93A 1B4JH 4BJLA 4JPIA 4F33A 5IMLA 3BRGC 4LSTL 4HUWA 4OGYL 2P46B 4XNYL 6FABL 1EXUA 4Q2ZA 1YYLL 3PWJA 2BNUB 2PTVA 4HUXB 3VD4A 1Q9OB 1ZLSL 5I30H 2X70B 2VXQH 3P11L 1K4DB 1C5BL 1ZT4B 3STLA 1EHNA 1JNJA 4BZ1H 1TCRA 2F54E 4M8VA 1FYTB 1MJJA 2NYYD 4G6AC 2ORBL 1J5OH 3Q5TA 2BFVH 2RIKA 1LP9E 1FO0A 2AK4A 2Y25A 3PHQA 4EIGB 5EZJA 1YMME 2PETA 3KPRE 4QYOB 1D3CA 2N1KA 4X9IA 3F12A 3AC0A 3MRQB 4X8XA 4EI5D 5L2JB 3MRCB 1AR2A 3FQWA 3PWLB 3GSVA 2R56H 1QSFB 2GFBA 1IGMH 1NJ9A 4KVNL 4U6VL 2E7LA 3X3FH 3O8XA 2JJTA 2X4SA 3CK0L 1AR1C 4GJTB 5GRWA 3WLBA 1FFQA 2C3XA 4YX2H 1JGLL 4O2CA 2EC9T 3TBTB 1CR9L 4NNXB 5B38B 5F7HA 1BD2A 4ZD3H 2ARWA 4RMWA 3QXAB 3RWCA 1MHHA 2ZPKH 3PHQB 4B0MM 4YDJB 4KMLB 3SDCA 5EZOL 5IK3B 5L2KE 4LASL 4B41A 4XBGB 2NMSA 2CKBA 5CKGA 1MPAL 4QRRB 2YUXA 1KN4L 3LOWA 4IMKA 1QEWA 4RGOL 3QDME 3HI1B 1W72B 3V6OA 1A3RH 3H9SD 1U8KA 1P6FA 2X1QA 4DN4H 2ZSWB 5JR1L 2YD2A 3GUTB 1BAFL 5KZCB 3QIUC 1BD2D 3HZMB 4LFHD 5CJ8A 1WAAE 4JFED 3FKUS 3C5JB 5EWIH 3IDJA 3NCYS 4LNRB 4U1NB 5CCKH 1PD6A 1IFHH 1KB9J 3QQ3A 4YHLH 1KF9B 3VI3F 5ESVA 2VRAA 2WNGA 5DJDB 5C0GB 1FH5H 2Y06H 4P46C 3IB4A 2HTLC 1KIQA 4PB0L 1TQBC 1WFUA 4L4VD 4RMSA 2LFGA 4E41E 4KROB 2P8MA 4QHKJ 5A16A 3O3EB 4L1HA 5IGXL 4LSUL 5SWZA 1E0OB 2PCPB 1G1YA 1IEAB 4K8RC 4IIQC 4YO0B 4HS8H 4NUJB 5JPNA 3VWKC 3PABA 1U8OA 3T8XB 4CVUA 4JN1L 4HMDA 2C3WA 1RZ7L 3MX0A 4G8FA 3EO0A 5AD0B 4CNIB 2JCCA 1EMTH 2C1OA 3HUJA 2IFFH 5F96H 2AJZA 4KTYA 5BV7B 4NKOB 1S7RA 1B6DA 1D5BA 4LIQE 4Z7NF 4PJIF 5T1LB 1QNZH 3IT8D 4HIIB 5GRUL 3MMEB 1PX4A 4GT7A 2ZCLL 2NY6C 1T3FB 3BD5A 4WEUD 4JPWH 1I85C 1KFAL 2DN7A 2JK5B 1IKFH 3CU1A 1CG9A 2PYFB 1QLRA 5E4EC 1ZGLM 2MKLC 4MS8D 4U1JA 2IANA 2E5EA 1NH6A 4WI9A 1R5VA 3RPIA 3SDDB 2SEBB 1ZOXA 4A2MA 3C60C 4JRXE 2YD7A 2QR0B 3P77A 2C1OB 1HHJA 1B0RB 4IDJH 2IG2H 3JZ7A 1R3IL 1T5XB 3BFOA 3IFLH 4K71B 1SJHB 2NW3A 1TPXB 3UJJH 4YXLH 3VFPA 1MCOL 4P2RA 1KJ2H 2ID5A 4ODTH 4LLMA 1I9JL 1IL1A 4O5LH 1FNAA 5MEQB 4Q6IB 3QPQC 2CLZB 4YJZL 1MFDH 1DBAH 5INCA 3SQOH 5FFLA 4LLVB 1DQLH 3CH1B 3IAGC 4RGMB 3DX8B 2BSED 2EO1A 1RZKL 3MNVB 4JPWL 4ZOCA 4LLWA 3T0EC 4H8WC 5HYIA 4BZ1L 5GJSH 4PRDA 4X9FA 2K7QA 1LDSA 1ZMYA 2B7DT 4Y8DC 2A6IB 5IGXH 2JB6A 5K9QI 5JHDB 4LF3A 2CPCA 4NO2B 2AV7A 4FXGA 1VKXA 1NEZG 4NDMA 4AT6A 1QSZA 3RL2B 4ONGH 1HEZA 3FOMB 4BSWA 3BH8B 1YY9C 2A73B 2EEDA 4WW1B 5HYJA 5CD5C 3IU4L 1ZT7A 5T5NG 3L3DA 5T5NF 2DL2A 2N56A 1WTGT 1L0XA 2F15A 2EH7L 4EDWH 3WUWG 3I3EA 2E6JA 3TNNA 1KGCE 4J3XA 3RIFF 2K3TA 4F7MA 5DMJB 2FX7H 3Q3GB 1N3NB 2EDXA 1EJOH 4HV8A 4KK8C 4Y7MA 3QDMD 4XP1L 4YQXL 1KBGL 4GMTH 1PDKA 2DIJA 4HCRH 2F8VA 2XYCA 4L4TD 5ERWA 1BQLH 4DCQA 3WD5H 1TJGL 4IRSD 1UM5H 3UC0L 3T0XA 3CLEL 3IDUA 3WDJA 1BM3H 4LPYA 2OYPA 4GW4A 1I85A 1HYSD 2ICES 3U6RA 1D5XA 1MPAH 4PRHB 3F5WB 2BK8A 1I9IL 4AEHH 2ADIA 3FQXB 1FZOA 1CE6A 1YQVL 2E3VA 1SVCP 1FRGL 3MYJA 1JV5A 2AXGA 4M6ML 4QHKI 3SBWC 3BRDA 1VACA 5DSCB 4OF3A 2NXYB 1EHXA 3D3VD 4PJIB 3MA9H 3LSOA 4GKZA 3MOAH 4S1QH 4KROD 4I0PB 1EVTC 2VZVA 4P5KA 3IJSB 1FZKA 1KNOB 5JHLL 2W92A 1A9BB 4K55A 4DCQB 4LCCA 5C1MB 1YN7B 1OAYL 5T5FH 5D7JA 2XTJC 2E7HA 1FORH 1P9MC 1IGIL 3VXSD 1C12A 3BESR 3AS3A 3DETC 1NDMB 1B9ZA 2W91A 3L5WB 1MH5B 4OF5A 5D1ZA 1SEQH 1DUYA 4WTXA 5LWYL 5HHQB 4NYLB 4WFFD 5BZDB 1DCLA 2QSQA 3GGWA 5FA4B 4BUHA 4EOWH 4HKZA 2CIIB 5ILTL 3U83A 4DGYL 4JM2A 1NFIA 1MCRA 1QKZL 2EKSA 5KOMC 2VXVL 2KL6A 3ARRA 4G8GA 5A3ID 4KI5C 3OWEA 4JY5L 3WFZA 1I9RH 1AIFB 1MUJA 4FHBD 3TZVD 4HMEA 3H7BB 4NRXA 3O6FA 3SGJA 5D72H 4R0LC 3BD3A 3GJFK 5EIVA 5C86A 4LHJB 2B0SH 1L9MA 1EO8L 3BPOB 4WEMB 4M3KB 4NQCE 1DANU 3OAYH 5LKNA 3JWDH 1GPOL 4O02L 4WV1B 3SE9H 4GKOA 4N5EC 3SKNA 5C0EB 3GNML 3QQ4A 4FFYH 4I48A 3I6KA 1NFIB 4PG2C 4I0PD 3QXDA 4Z7UB 2Y5EA 3VFMA 3W11C 4XWGL 5DQ9A 5F71A 1EGJH 2XWBB 2ZCKL 3E2HB 5AYUH 4MNQA 1NGPH 1K8IB 4OM0L 5L88L 4FQ1L 1T2JA 4YUEH 3BT2L 1NGYA 5C09A 4KHTL 3V6FA 4FOMA 2VDQL 3PJSB 3RTQA 1PSKH 4ALAH 1UB5A 1K8DB 2ZOKA 4P46D 4D9QD 2CR6A 2HTLD 4LNVA 4GW1A 1BGXL 1NFDE 4PGDB 3WIIH 3AMLA 2VL5A 3IVKB 2G5RA 2BHYA 1MLCA 1AGEA 4G80B 2CRYA 1QA9A 2EIEA 1BX2A 5DHVA 4NN6C 5FEBA 2OSLA 4ODVH 3LRSB 2A74A 3EGSA 3RWJB 3RWFA 1Z5LA 5D7KE 2R2HA 5CD3A 1RIUH 4FQQB 3FONA 5IVXF 3C5SB 1N6QH 4RNRA 4XPAL 3SJVE 4CVXB 3ZE0E 4M02A 4N1HB 3P4MA 2IGFH 3MTRA 4XPFL 1K8DA 4KK9C 4OLVH 5FB8A 1S9KC 1OSZB 5E56A 4MD0B 4WNQA 4RBPH 1H3WM 4PGDA 2ICCA 4DKAA 4GXUN 1C5DB 3NAAH 4L3EA 4ZSOB 2BNQE 1IAIH 4M7LL 5DWUH 5IR1A 2HVKA 1OAXH 2V17H 3GSOB 4GAGH 1SY6L 1S9WB 4R4ND 1UC6A 4WO4A 1XZ0B 4U6YB 5GISH 3QUXA 3AREA 4MGXA 4M7KL 3T65A 4M5ZL 1X5ZA 4XB7A 3WHXA 2R8SL 1VB9A 4H88H 3MV9A 3F7QA 2DQCH 2R2HB 3MA7A 1OB1A 2A77L 4ORGA 2UYLA 4TSBH 3SKJH 1MCWM 4WRLA 3MRFB 3UTQA 2GY5A 1HNGA 5HD8D 2OTWA 1IAIM 1XFPA 5ALCL 5F6IC 1NUGA 2C7UB 3BPNB 1FYTA 1C1EH 1K5NB 1EBAA 3GRWH 3RZCD 1A14H 4FN0A 5CIPA 3QBTB 4G8GE 3RRQA 4KI5F 2X42A 1KPRB 5LXGL 4PJFE 2FJFB 1QFUH 3GSVB 4PV9B 4RMTA 4FTVA 4A6YH 5T3ZH 5E2UH 5CMAA 4MDJA 1V8HA 2AEQH 2EXYD 4IHOB 1I3RA 2D03H 2YPLA 1FCCA 4XC1L 4HK0A 5IQ9B 3ULUC 4OZFA 4RRPG 1IGYA 4C58B 3N9GL 4Y16C 4NO5A 3UO1L 2NY2B 5IROA 4QRSB 3B9KC 2ZG2A 3CX5K 2XQBL 5IVZA 3MGTA 2HFGL 3WIHA 5I16A 3IXAB 4MYWB 4DK6A 2V7HA 3DGGA 1FVEB 3IDMB 1PFCA 5E9DA 3MUJA 3TH3T 4S1DD 1EAPB 3ALPA 3D48R 4NHCL 4EUPA 1BF2A 1JMXA 5B3NA 3V7AE 2W38A 2P5EA 5HY9A 3UZEA 4UZGA 3UP1A 4PJHB 4K8RH 2XWTA 4U1LA 2HT4C 2FDBP 2GYSA 3K81A 4OCYL 5CS7A 5FYLL 2IFGA 3MLYL 3KLHD 3CFDA 3WN5A 5IB2A 4G8GD 2AJSL 1YA5A 1LEKB 1DSFH 4NKQB 3ZTJH 4XX1G 4J2XA 4IBLT 4OZFB 1U91B 2DAVA 1SYSB 4HCRL 3CFJB 3V7MA 1UACL 3CXDL 1AKJB 5CILL 3ROLA 5D1ZD 1MEXH 1Q38A 4LRIC 2VAJA 1CL7I 1EK3A 2B5IC 3QG6B 3ARGD 4OI9A 3UZQA 3PQYE 5CEXB 5DHYB 3ZDZE 2FL5A 3CNKA 4PJ8C 1QSFE 5CSZA 5D7JD 2QADD 3PHOB 4LAJH 4X5WB 4ZDHB 4XNZC 2UWEE 1E4KA 5JPNB 4MQXC 4MVBC 1FZJB 3GI8H 1BQUA 1HH6A 3KPRB 4LOUC 5E6IB 3U9PL 5JXEA 4U6HB 4ZO8A 5EZLA 2PKDA 3DARA 4DZBB 3BPLC 2YN5A 4AEEA 1JK8A 1WV7T 3GMRB 5KSUA 3VA6A 5BW7C 3AUVA 2R4SH 4B7IA 3MLVH 4P2OC 1Q9WB 2P24B 2HVJA 1DR9A 2ESVE 1BREA 3KR3H 3KLSA 4OCRL 1FGVL 5D71H 3ROLB 4H20H 4GS7B 5J3HD 1R6VA 3G5XA 1KCSL 4LL9A 1X5IA 4XWOC 3UJTH 4PJ7E 5GS1C 3OPZH 2EDWA 5KVFL 1ULVA 1N5AB 3QEQD 4XVTH 4NHUA 4K3DL 3FJTA 2EECA 1TNNA 3BDYH 3LQAL 3BXNA 2UZXB 1HXMA 2EYSB 2H2PD 2AGJL 4KRNA 5DA4A 3KYOA 5I9QC 3KG5A 4JFPA 3WJLC 4APQC 4Y0GA 4WHYH 4I5BB 3MGOA 4OD3L 4PTUA 4LDOB 2RHEA 1YNKH 3JUZA 4GW5A 3DXAB 1HHJB 3ARPA 1MAKA 3AAZA 4JFEE 1RK1B 5CEZL 3HR5B 3L3JB 4XMLL 1B3JA 3QIBC 5IJVB 3FN0L 5EC2A 5EUKB 3QO0B 4NWTL 5GGQL 4DKEH 3HHRB 3BZEA 5F7FA 4MCZA 5KVFH 3PHSA 3LS4L 3MO1B 3UPAA 4NHUB 5DT1L 4U1IB 4Y4KC 3BP4A 3ZZ1A 3G5VA 5JQ6H 4XTRC 5E2VH 3ULUF 5BCAA 1ZAGA 2A0LD 2DQFA 3ARYA 1X5XA 3VFTB 1TMCB 3PNWB 1TVBA 3DVGA 3DX8A 4HWEL 2FJHB 2G60H 3P11H 3NABL 1HZHH 4XVJL 4I18B 2AV7B 3W0WA 5BZWA 5HYEA 3OX8A 3B9VA 1NAMB 2VDOL 3ZO0A 5L7XH 1MHPH 2Z31B 3BE1H 2V5RA 4YR6B 2NW2A 3G08B 3T1FA 3RX5A 4N0CD 5ITBH 5DZLA 3U4EB 2H9GA 4H5SA 3DO3A 1RK0A 4POYA 4XNMA 3QG7H 2P5ED 4Y5XB 1WWWX 2XOTA 1G6RA 2YUVA 4NO3B 3WNNA 1MI5E 2CSPA 4OCSL 3BGMB 3LN9A 3O4LE 4CL7A 1I8LA 3QUKA 4N0RA 1FGNL 4PJFB 4Q7DA 4UT6H 1AGDA 4HGWB 2YD3A 1QFOA 5EUOB 1EEYB 4D9LH 5EOQH 1F4YL 4HZLA 1F3DH 4JO2H 4EQ2A 5CCKL 1YMMB 2ADFL 4LKCA 2GITA 5JIIA 4NHCH 4CVZB 4NM8L 3HE7C 5IB1A 2O61B 5FHBH 3N06B 5J9PA 2D0FA 2R69L 4Y5XA 1LP9F 4H1LA 1A1OA 4DEPB 1ZHBB 4RWYH 3UBXA 2XQBH 4YPGB 3UBXI 5DI8A 4FABL 3MOBL 1MCNA 2OZ4A 4TSAH 5E2WL 3RY6C 2IPUK 3DVNA 2DI9A 4RAVA 1CGSL 1FL6A 4BUGA 4R7DB 4LCCB 3T77B 3WNKA 4LASH 5E2TH 1FFPB 2H32B 1FVCA 1JJUA 3O2DL 3CFIC 1LO2L 5FO9B 2UWEB 4KHXH 1YEKH 4N90D 1GGCL 2NY4B 5KANI 3NCBB 4BA8A 4QXUL 4JJ5B 5JORA 3UPRB 1JNHA 5FKAB 3I6GB 3NA4A 3VFVB 3MLUL 4WHYG 5JW5A 1CFNB 4JPIB 1UGNA 4OZHE 4NP4H 3QDJA 1HQ4A 4M7JL 1QACA 3MLSH 3ES6B 5DI8B 3FN3A 1XGUA 3WO4C 4X7CC 2I60H 3GHEL 1J18A 1XF4A 4HPOH 2Q6WA 3MOQA 2XG4A 1JPTH 3SJVD 2AJVH 2WW8A 1NGWA 3UYRL 3EYFA 3LQZB 4UIMB 2CQVA 5IHZB 5C0BD 1PY4A 1T1WB 3ARDD 4NYLA 4XHJC 4X7TB 2VABB 1EFXA 3MPCA 1HKLL 2A38A 4TULL 1UWEH 4N0FA 3X3GL 4N8VB 1N4XH 1X5KA 1F4XL 3P9LA 5JLZB 4NUGH 2BNQD 1LEGA 1JGVH 1OAXL 5DJZA 4QHLA 4JHAH 3C5ZD 5IV2A 3NAAL 3OKLB 1JHKL 3JXAA 1ZK9A 5FGBC 1VGKA 2VLRB 1U8LB 4G6MH 4FQCH 3NA9H 4X83A 1B2WH 4LSTH 1FO0H 1CTNA 3VFNB 4D0CB 5KS9F 2OMNA 1K2DA 1JIBA 4QOKE 4D0DB 5I1LA 3BIBX 3TIEA 3G6JB 1CFVL 3V6FB 1NCDL 1U8JB 4ZAKC 1DE4A 2E8ZA 3KLDA 3FO1A 2VDPH 3QAZC 3W9DA 4NO0A 3GBLA 3LB6C 4LLDA 5HHXL 5T33L 2C3HA 3MV8D 1Q0XH 2CRIA 1LK3L 5CZVL 3SKMB 1MLCB 4NQDB 3VXMA 3PV7A 1DQDL 2MHAB 1RIHH 4NOFA 1ED3B 4Y2DC 5ISZB 2CO6B 1H3VA 3P4NB 4YHKH 4ZXBC 5C0RL 4I9WD 1F3DJ 4WI5A 1HIML 4HXBH 1RAMA 1LD9B 4L5FH 4GH7B 4KRPD 4OJFL 3TN0D 1UWXH 3EOAA 4XWGH 5FECB 4JPVH 5IB5A 4ZNEE 1U92A 1U8JA 1F5WA 4MXWH 1JWMA 1RU9H 3WDIA 5IB4A 3VCLB 1CBVL 3QQ3B 2DJUA 3EOTL 4FXKB 2YD1A 5JOFA 3LRSA 3TCXA 4JHZA 2MSPA 1YMHB 3BT2H 2BNQB 3HAEB 5TJWK 1TETH 4XWOD 2VUYA 3BO8B 4OCLC 4OCMC 5GRVL 3SJVA 5F6HJ 4YK4B 2IWGA 3PWVB 2G75A 3IDXH 4UU9B 4C57C 1MF2H 3PP4H 2WLYA 2JKXA 4TRPH 3G6AA 5CZXD 4NUJA 5DS8A 5LBSL 3RU8L 4TULH 3IU3B 4E0RA 1L7TL 3OJ2C 3QULB 3VXUB 2DLHA 1DBBL 2VDRH 5EFIA 4X6CB 1TQCC 1HWHB 5KW9L 1OGAB 3CPLA 1DQJB 3AY4C 1MCIA 1F90H 2CLRB 3H42H 3H8NA 3UTOA 5TQ2H 2J12B 1A3QA 3B9DA 1QYGH 4JEGB 3KPSE 5LGJB 4X98B 2PO6D 3I3DA 4LCIH 4HCRA 5KJRH 1NFDB 4LLQA 2KDGA 4P4RA 2NY7H 3UROR 3HB3C 5CSBA 5H94B 5HYQA 1F02I 3PG2A 4ZS7H 1YJDH 5HVHC 2IH1A 3BISA 2F5AL 3REWB 5IMLB 4HUKB 1R5VB 32C2A 1BZQK 3GRWA 3VJ6A 3ZLQC 4YDIH 1KPRA 2AK4E 4FTVD 4IOFD 5MEPA 3MA9L 3F8UB 3MXWH 1Q9OA 2FBOJ 3R0NA 1YEGH 1T83C 3FQNA 4PP2A 2KBGA 2Z8WC 2ZZUT 5BV7L 3EYOB 4PV9A 4PD4J 5L2KD 3B2VL 2AK4B 3M07A 5GGUB 5JHLH 4WJ5A 4JPVL 1MFAH 5J56B 1NDGA 3U0WH 5AUMB 2HYMA 4HK0B 1NCTA 2DF3A 5CJQH 3SPVB 1OP5H 3DGCR 1DANT 1U8MA 3PUCA 4G9DB 4KXZH 1IGTB 1RIHL 1X5LA 1A9EA 4F15B 1EPFA 4JFHE 5E9DB 4AZ8A 1HSAB 3ZYZA 3VXQB 2I9LB 5I6XB 3BGFB 5IESL 4NFCA 1IC5H 1RPQA 3ARFC 4QKXB 3EW3B 2RFXB 5DQDH 4I3SH 1T1ZB 1TZHA 3ABZA 5C0CB 3TJHC 5EZJB 1J8HB 5HSFA 1B90A 1MFBH 2FB4L 4OKVA 4YQXH 5A2LH 1JPSL 2WIMA 4PY8I 3D2UD 4EN3B 4GQ9H 1A6ZA 4GXVL 4HIJB 5TF1L 4UOW0 1CLYH 5HI3D 4PJDF 4L4VB 2VZ1A 1H9VA 1H8SA 1N0XH 2IH3A 2EYTB 1O5DT 3CDGB 3CFJA 3BQUB 5HJ3A 2YPKB 4OQTH 2P5WB 2ZJSH 1EA9C 3QNXA 4WGWB 2H3NB 5DD5H 1NC2D 3QEHB 3BHBB 5H35A 5GSVA 5F1NB 4XVJH 3IGAA 5FM4A 3ZKXB 5IJKC 3KYMB 3GEWB 2IMNA 3TBWA 2G60L 1H3UA 4IIQA 4R0LA 1A7OL 4JY4A 4L4TE 3U36A 1U2CA 2XZAL 2OR9L 3LKRB 5GPRA 4GMSH 2BVQB 3MV7B 3QR2A 4AENB 2DLIA 4GBXC 1T1XB 5E08L 4XBGA 1AY1H 4XXCC 3TPUA 4XPHH 2FWOB 3U7YL 4W6XB 1VHPA 2DWEA 2AKRB 3PDOA 5FM5M 1XF3B 5DJDA 2AJVL 4EZMA 4L4VA 5HYSA 2R23A 4JFPB 5ISZE 2XY2A 3WYRA 1NEZA 2Q7NA 4OTXH 4PG2A 4YBHA 1FIGL 1LE9B 3G5YB 1R3IH 1ZLUH 3MRIA 1KJVA 3I2CL 4OIAA 5F1NA 1INEH 4JR9L 2YRLA 3B5GA 4NZTL 4JRXD 4MB3A 3WFHA 2E9JA 4IIQB 4JFXB 1MELA 4NQEB 1V05A 2R29H 3LKSA 5B39A 1MFCH 4ELME 3ILPA 1C5CL 2EYRB 1X7QA 2YD8A 3O41A 1RJZB 1RIVH 3LKRA 4MXVE 4M43H 3K8LA 1JZ5A 5DO2D 1OLZA 2DQEH 1IEBA 4Q9RL 1KLGB 4JFQB 1T22A 5C0GA 2AKRA 3NIFF 4KJYB 5DUBA 3U7AA 2DICA 3ULSB 2R9HC 2X9YA 5FUOL 4KI5E 3OPZL 1MRFL 2ZG1A 1Q9LB 1F42A 4LCYA 5IROC 5GRXG 4MNGB 1WAAA 5TFSH 4LCUA 1P1ZA 5E6ID 3O2VH 3SDCD 2G2RB 1RZKC 1ACYL 5HHVH 1K85A 2DBLL 2B1AH 4JN1H 4PPTA 4N90E 1A6TA 1JF5A 4JO4L 2AS5M 3VW3L 2O5XH 1CLZH 3B4NA 1FPTL 3O9WD 1M6OB 3KHQA 3SGKA 5ALBH 3WFBL 3ZL4H 4UTAL 1OAZH 4P4KC 3ZKMC 2H9GB 3ROOA 1X5HA 1F11B 1BZ9A 3DMMC 5DD5L 1HH9A 1ZLWK 4R7NA 4ONOA 4JM2F 1K3IA 2H32H 4N9GA 1RY7B 3MACH 4M9PA 2QQKL 3NIFE 4GXUM 4YHPA 1UWXK 1X3DA 5DR5H 4OZHB 4PJAB 1PQZA 3KHOA 1FAKT 2K9UA 1RQ5A 1R3KA 5E9DD 3VFMB 4JVUA 3BDXA 3TN0C 1ZLUK 3S96A 4NO3A 3M17B 2HLAA 3FB5B 3DXAE 2Y06L 4H0GA 2JTDA 5B38G 4YC2C