4OFBA

Crystal structure of human brca1 brct in complex with nonphosphopeptide inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
209
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Peptide Library Approach to Uncover Phosphomimetic Inhibitors of the BRCA1 C-Terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Breast cancer type 1 susceptibility protein
total genus 67
structure length 209
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4ofbA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4ofbA01
3I0NA 2ETXA 2COKA 3EF0A 1T2VA 3T7JA 3T1NA 4BU0A 3L41A 3U3ZA 2K6GA 3UEOA 3SQDA 2COUA 3PC8A 3PD7A 4IGKA 3PXEA 1JNXX 3OLCX 1T2UA 2JW5A 3K15A 3PC6A 3PXDA 2AZMA 2VXCA 4JLUA 4BU1A 2HTFA 5ECGC 1OQAA 4OFBA 1N5OX 1T15A 3I0MA 4BMDA 1KZYC 3L40A 3K05A 3KTFA 3COJA 1IMOA 2ADOA 1Z56C 3K0HA 3SHTA 3L46A 1L7BA 2M2IA 2K7FA 2EBWA 3AL3A 1IN1A 1GZHB 2EP8A 3II6X 3PC8C 3HUFA 4XPZA 1L0BA 3HUEA 2D8MA 2LE0A 4Y2GA 2EBUA 3JVEA 3K0KA 2L42A 2INGX 3T7KA 3SHVA 3T7IA 2VXBA 2DUNA 2E2WA 2XNHA 4Y18A 3AL2A 2WT8A 3K16A 3FA2A 1Y98A 4N40A 3SZMA 2R1ZA 2NTEA 4BMCA 4IFIA 4U4AA 2XNKA 1CDZA 3PA6A 1WF6A 3PXAA 3QVGA 3PXCX 3PC7A 3EF1A 4ID3A 4XQ0A 1T29A 3PXBA 2COEA 3UENA 3QVGB
chains in the Genus database with same CATH superfamily
4MKIA 1TAHA 4I9FA 4ZO7A 3H87A 3L8YA 3U0BA 5KPJA 1OIWA 3FX2A 2I6GA 4D9JA 2FQXA 1SXIA 4E7OA 4O33A 5G0TA 3H13A 3K2BA 3LOQA 2WQZA 2XQVA 4HT3B 2W2QA 1IZZA 1TTTA 3V4FA 5A6VA 1AMUA 1H6AA 1PL0A 1E2HA 1C0KA 5D7NA 1DUVG 3AFGA 3H65A 1A04A 3OOWA 5IJZA 3LUGA 4JC4A 4IEEA 4FE4A 4TLLB 1KPGA 2HLPA 1IHDA 5JNSA 1T24A 4DZTA 1KSHA 3UB3A 3V7FA 4RESA 1EI9A 1G8PA 4AL4A 3CZCA 3G89A 1SHTX 3BWEA 1BS2A 3CO0S 4G81A 3O90A 4KXNA 1CQIB 1E2DA 3AY6A 3RRJA 1V1JA 3A1UA 2R11A 1JLKA 4IQGA 2OHXA 4BNFA 5CA1A 1FE8A 5EHNA 3B6KA 4ACAA 4LJAA 2ZROA 1XTQA 1Z8NA 4II2A 1OH7A 1H6DA 1B43A 1WM1A 1ZK0A 2CN1A 3PG5A 5C0OE 3PNLA 2XAAA 1V3TA 1YIDA 3L1VA 4HOYA 2Q9UA 5EJ7A 1OZFA 1J8DA 3WMGA 3KQHA 1KBZA 2AI2A 1PHRA 1POXA 1B1AA 4JODA 1X7XA 1MORA 2J0SA 3FTCA 4AS1A 2I55A 3A6JA 3E5NA 3QPBA 1I7LA 2B4RO 3LCCA 3E9MA 4MI3A 4ZOLF 5TJ9A 1OLOA 3GRFA 4NDZA 3HFRA 2VPWA 2VF5X 3G68A 3SEQA 4FK8A 3QGMA 4RH1A 5SZIA 2YYAA 3UUFA 4B74A 4XX0A 4MSUA 3VXKA 5B30A 4X44A 1RPAA 3DOIA 1GG2A 2GD2A 4KN8A 1H8HA 3GDFA 3LF2A 5FUWA 4K1LA 3ROPA 1TIKA 3D3WA 4F5WA 1ZGJA 3DF7A 4QZVA 4P92A 3CG0A 2MSLA 3GLHE 1WDTA 1Z6XA 4TUYF 4E5KA 4YHHB 2EIXA 1W76A 5DXJA 3RT7A 4Y1RA 2WKRA 4IIHA 1IPEA 4RPGA 5IM4F 3QPCA 2EEZA 4B8ZA 1R4NA 4B85A 1OILA 4NBVA 1OBCA 3Q98A 2FR8A 3DE7X 4M46A 1G2PA 2NUPA 5KCMA 4JL6A 2IDZA 3MMNA 3WK9A 4F71A 1C9EA 3T7AA 2PR7A 1JS1X 3W2EA 4B4UA 2XUPA 4XJVA 4OP1A 5HK8A 3BJIC 3OEHA 3V55A 4ZQHA 1LDEA 1GJRA 1VYHA 4K6HA 2XRFA 1B42A 3FNGA 2G5GX 4RMHA 2NPFA 3TG2A 2ZYRA 3PQ7A 4EPXA 4F5YA 2HFJA 2ZCJA 1E20A 1MNQA 3NHYA 3SZOA 5DMXA 5JAZA 5ABPA 1CC1S 4Q4HA 3CY6A 2E48A 4K9MA 5K3FA 4HNRA 3EPHA 2PUDA 1Z3CA 1IXKA 3EVZA 4FBLA 3HXLA 1SU4A 4CKYA 3OUTA 2P6UA 1E1NA 1GFIA 5ALIA 4MULA 3T9DA 3VMMA 4J0FA 1IHYA 1A9PA 5DNDA 5K0BA 4FHZA 4R2LA 1W4CA 3L0PA 4I1OA 3ZK8A 2B9VA 3AEXA 5IN4A 2VP9A 3ZHSA 2HB6A 1EJBA 1JBQA 1MF7A 1RAFA 1ZUNB 5FBQB 5TT0A 1KWGA 4PR0A 3UH0A 3U4DA 2IY8A 1W5BA 4Z86A 4ZXFA 3UN1A 4FYHA 5BYBA 1NQOA 1B6SA 2XF8A 3IT3A 5FJJA 3JARB 2Q7OE 4P82A 2C0QA 1FFCA 3DE1X 4C5BA 1B15A 4EA7A 2X5XA 4K9QA 1PTJA 2BM1A 5LMNB 1EUCB 1AM4D 1BHSA 5BV7A 4KDRA 3HY6A 1P5FA 3ROGA 2PA0A 3CUYA 2QRKA 4QLAA 1RJFA 1JSXA 2BTOA 1ZI9A 4JJ7A 2EKLA 2PYZA 3HY3A 5DLDA 1WG8A 2Y1OA 3WGIA 3W5BA 3OZCA 9LDBA 1E3JA 1EQUA 4ER5A 1A8UA 2WTBA 3BFPA 1K8ZB 3F96A 3S6JA 4KWIA 2QVGA 3LKBA 1K75A 1M2WA 2Q7DA 4TLDA 4CMHA 5GADl 3DVAA 3GR6A 5CK4A 1NULA 3L8MA 2WWFA 2HTFA 3OQPA 4GECA 4M1TA 2FFHA 2JFHA 4K9SA 4F2HA 3DDCA 2QPAA 1FUUA 2R97A 5CT5A 3X1ZA 2WJIA 1MHPA 1PD0A 4AMYA 1X7ZB 1XZ8A 2JEYA 3BK2A 1O9HA 3KFVA 4IUBS 4YP9A 4MW2A 4O4LA 3L0BA 2D2VA 4BLVA 1JP7A 1J0DA 2XYHA 4P36A 4BLUA 3ZEIA 3R5FA 2WSLA 4GI2A 2OBFA 1XHLA 1LEHA 4DA0A 3LVFO 2SKCA 3G1TA 2ODQA 3IP7A 4DSNA 4ALNA 4QECA 5CLFA 2J09A 5BSHA 4HFRA 1TQ2A 4I4TB 3ASUA 1E7QA 4P22A 3RHSA 4BX8A 1VECA 3EOBI 3VBCA 4PANA 1MT0A 3BOSA 3H2GA 3A1EA 1A4IA 1CRLA 3KB2A 5P21A 1UXKA 5I7OA 4F6CA 1VJ1A 1ENOA 2A9QA 4W8GA 3GLSA 4JC0A 1XRJA 1K2WA 4HEQA 2AHRA 1UT6A 2H4WA 3F9CA 1EHCA 2PZFA 2X8JB 4JB0A 4RTKA 1C8VB 1J90A 1ZN8A 1XCMA 1FDSA 4S0ZA 3NM5A 4C1BA 2H1LA 1XTIA 4RDXA 5L95A 1RZVA 4R8VA 4Z7NB 4C89A 4BEJA 3DB1A 1KEKA 4TOIA 1J56A 5D5HA 1AF4A 3RHFA 4PPYA 1FMFA 3Q3HA 4M1SA 1VLJA 1UQRA 2XE8A 3L7NA 2APJA 4ZARA 2N9UA 3Q8XB 2AN1A 2AKYA 2ZYDA 3BHJA 2GSDA 3LIPA 4WL0A 4X8LA 3WRXA 3RU7A 4DLBA 1BW9B 4MR7B 3DGEC 5EIBD 4F4UA 2NUBA 4MRPA 3CH6A 5TT1A 1A77A 2GZMA 2H5LA 2HPHA 2WW8A 4GXRA 5G0UA 1E1DA 2WPNA 5CVUA 1E1RD 2WYWA 3LV8A 4GPEA 4G9EA 3GHHA 4FGZA 1NVTA 5C8YB 3THYB 5CCDA 2YUIA 4JITA 2D7CA 4L27A 4MP8A 1GWNA 3THXB 5A2GA 5AHXA 2EFHB 1MTZA 3RFXA 3H6HA 4IHJB 2X2PA 4WMLA 1WB9A 3ZHXA 3TZBA 2ZJ4A 1X7WA 3H5VA 1EFKA 3OWXA 4BO2A 5ICCA 1RWPA 4LVOA 3LH5A 5DW3A 2R8RA 5B1DA 4DLUA 4FHGA 4HAVA 4X71A 2PS9A 1ZR2A 2QYOA 3B70A 1ZYUA 3GZNB 3BFJA 2DMRA 2R4TA 3LKVA 1GUAA 3L7JA 5J5CA 1A0OA 1O1YA 1VI2A 3K6SA 1T8RA 4KZKA 4EO4A 3P9KA 5JAUA 2CLIB 3C6MA 1VOTA 2QV0A 2XADA 3N75A 3ADDA 4FYJA 2F3RA 1JQ3A 1Q1AA 1US8A 4ZO4A 3O03A 3KQNA 3BC1A 3E48A 3K9LA 1CIPA 1QIJA 1Q91A 2BKUA 1JIVA 4BFZA 2F3SA 4XRGA 3AVUA 2BEUA 3KTOA 3T99A 4V0MA 1JPNA 4CJXA 3E3LA 2L19A 3VC2A 1Z8HA 4ARZB 3FI0A 4CRWB 3EPJA 1Y8ZA 1XIVA 1CVIA 4TMYA 4HGPA 4HN9A 3FPEA 5INTA 5AUPB 5IVPA 4NEGA 3EC2A 2C82A 1E4EB 2FCAA 2JKZA 3OKAA 4X7RA 1U2DA 1Y5IA 3I5XA 1MIOA 5CLIA 3PXXA 1WCIB 1Y7LA 3GJ8A 4Z4HA 3Q0TA 3BSSA 4ES6A 4MV6A 4YT2A 3B9BA 3DMDA 1KZ6A 3FH0A 4DQ0A 4F6LA 3U62A 1KK0A 4A03A 2Y1DA 4TSRA 4QEKA 5E9JA 1KI6B 3AR8A 3ZQ4A 1Q7GA 1SBIA 4OKSA 5ER6A 3QXSA 4QQKA 3IEMA 5DWDA 1J0AA 1XEWY 3MB5A 5T6MA 1PUIA 2XMCA 2DEUA 2BR5A 2V98A 3KWMA 4RAOA 4J0JA 1JE1A 1J39A 1ZK1A 3RV4A 2Q0QA 2QF7A 4PAGA 2FPSA 1SIOA 3IBTA 4S24A 3PICA 4DV6B 3FCXA 3FF1A 3D1JA 3LU1A 1NUAA 4L5IA 4KFUA 2HBZA 5JRJA 3F49S 5KYKA 6ABPA 2JLUA 3DBVO 4QGBA 1C9NA 4LECA 5ENVA 5L3SB 1D6SA 3FOEC 3FVTA 3VYTB 1RXIA 1E1LA 4BTLA 2VJDA 4BE4A 1WHSA 2OZKA 3AGPA 4LVCA 2FRXA 2VG8A 1UXOA 3PLNA 3G9XA 4ENPA 2O14A 1CEYA 1IHUA 2A78A 1CE8A 1EVJA 1ZU5A 3L0YA 2ZULA 2R8XA 2CK3A 4D8UA 1W75A 3AL2A 3LUFA 4UFOA 1WB5A 3CJRA 2OMKA 3I01A 2EJVA 4HPWA 4F60A 2E6UX 2IEAA 1HO3A 4FMDF 4HAIA 3ZWOA 5EMMA 1M8GA 3RGWS 5KOJA 5F9MA 4EITA 2H3HA 4LG1A 5BXYA 1JIJA 3DHYA 1AKQA 3KCNA 1D8TA 1ZK2A 3R0ZA 4QG7A 3HCOA 1DPFA 4KRYA 1PX0A 3ZU3A 3JQ7B 4B0OA 5B64A 1OLSB 2HRBA 2XAUA 6AT1A 1IATA 2GUWA 1J7JA 4HX9A 4J43A 4CMEA 3CW8X 2BZGA 3A6HA 2OD2A 3THSA 1CEEA 2WM8A 3L7AA 3CNEA 1EM6A 3M9LA 3O4IA 1KMHA 4XCVA 4E12A 2DY1A 2JJ2A 3AHCA 4ZO8A 5JY6A 2BFBB 4YXWD 1JIIA 4LBZA 1C80A 4QXPA 4U9HS 5FHRA 1K97A 4WNIA 4XGRA 2NO7A 3VVBA 4EKGA 3OTWA 3GJ6A 5EZYB 3WP1B 2AVNA 1F1JA 4HNUA 4TYYA 1ESMA 5TMPA 4TS4A 1N2CA 4GGOA 1RPTA 3FLMA 4NQZA 1E9RA 1PZNA 1WU8A 2Q6VA 3P0JA 1QNFA 1CS4C 2XLCA 3I6IA 3MCWA 2UVDA 3LD9A 5JAIA 1VB5A 2XBLA 1E6KA 1PVVA 4KK3A 4TN5A 5EXTA 5M04A 1GARA 4WTOA 5DNAA 4KWTA 4Q4JA 4ZZ0A 5BSEA 1KFEB 4D8YA 1ZGHA 1X1EA 3LP5A 5T41A 3ZJYA 5BV8A 2LNDA 1YZGA 1KXJA 3AEQA 4L5AA 4AB1A 4LMBA 1EUZA 2PV0A 1G38A 4KXMA 1E3DA 4UTNA 1Y6GA 5LA6B 1L5LA 3QTTA 3WB9A 1KOFA 4EABA 2GD1O 1TA0A 2M6SA 1RQXA 1H2WA 3CLSC 5T57A 4XEUA 1K7FB 2J3HA 2P4QA 1LLFA 2GZRA 2Y0PA 5E6RA 4A26A 1YI0A 5BYJA 2GEFA 3C1AA 1WBJB 1B0PA 4LJ9A 5KU1A 5CNIA 3RBZA 3EFHA 2IKSA 2NZWA 2OCPA 4MB0A 4NS4A 4K2AA 3JTEA 1VE6A 4LX8A 5DHFA 1TE2A 5KINB 2O8DA 1SCNE 5HFJA 4QREA 3LPLA 1NV8A 1TKBA 2VATA 2GJSA 3NG1A 4NU5A 5KNCH 2LR0A 4RCZA 2CV1A 5EI5A 3KB8A 4A8TA 1OWPA 1D0IA 3K6JA 3RASA 4IJVA 1G21B 3V1KA 3TFQA 5LOVA 3KR2A 4GOOD 4C9BA 2OGSA 3K1AB 1GPWB 2AMLA 1QHSA 2G1KA 2IOQA 3LLUA 2AC2A 2BT4A 1MJNA 4H6XA 2C2YA 1T9HA 1CD5A 2GD0A 1RWVA 1ID1A 2O2IA 5FI3A 3KQLA 2OBNA 2E87A 3PE6A 5FFNA 3D6JA 3TPFA 3EZNA 3KUDA 3UJDA 2XECA 3L4EA 3ZXXA 4I6JA 2YWRA 3KR1A 1SKBA 2WOJA 3DE5X 4DPMA 3GVHA 4XJTA 5AIAA 5JD4A 4JUCA 5IHXA 4QM7A 1LSSA 1C3XA 4GUAA 4UCXA 4YUYA 1P62B 1T8WA 1WB6A 2J7KA 2Y77A 4HNAA 3WGHA 3GT0A 5L4SA 3P2KA 5HF9A 4V03A 3IT1A 2BGRA 4I66A 4YQZA 2YZKA 1CR6A 3PQDA 5I9BA 3BXGA 2VCHA 3W06A 3SHQA 4TV9B 4MVJF 3OQNA 4EI7A 4G5YA 3QPVA 4R0VA 5B1HA 3N86A 5BSRA 2VCEA 5EY5B 4NX2A 1NVBA 2L17A 2Z2KA 3GT3A 1TIPA 2VBIA 2ZSJA 2ZUCA 3D2BA 3U4AA 4ML3A 2R48A 2DHEA 3A8TA 4E09A 2O8BA 1YJAA 3ZY5A 5I7HA 3EVTA 1G98A 3R3WA 4ZICA 2W37A 2IOYA 2P9BA 5I01A 4P38A 4QX6A 2IPNA 5BWLA 3FHJA 1ZRSA 1IOZA 3LPNA 2PRSA 1O0SA 4IUCS 1A69A 1N77A 4X1OA 5IX8A 2RC6A 3UY4A 4IFBA 1E2MA 1VKRA 4MCIA 3SJAA 1E60A 2ZU6A 4PLFA 5GTDA 5J4LA 1EBFA 3IEXA 4D9BA 1CY6A 1FF9A 1SCQA 3F9IA 3FYUB 1YDEA 5DBGA 1I10A 4PNEA 3A0RB 2X5JO 4CLRA 4I8XA 1VSVA 2ZSKA 1VE5A 2G5TA 1DIOB 4ZC8A 3GRYA 1KMMA 3IO3A 4HLCA 4RY0A 2XXBA 5KOYA 4MR7A 3IUPA 3IDFA 2V03A 2MYUA 3F2IA 1D2GA 2GPTA 2E82A 1XWWA 1AGPA 3HHPA 3SOPA 3INYA 1QIEA 3PGXA 3QSGA 3FUCA 5E3JA 2HSJA 5LZ2A 3X2EA 4IDAA 3AFHA 4OXQA 3IB3A 1VBKA 4HVTA 3EB9A 5LVAA 2JLXA 1P91A 1PK9A 2CUKA 1UJBA 1QMGA 4HB2A 5CB0A 4QU5A 3JXEA 1AHIA 3G9UA 2LWIA 3I2YX 4X24A 3IAM1 1NLUA 1S8OA 3CQ9A 4IV8A 5C3MA 3GNLA 4JC8A 4DRXB 3T4EA 4UDOA 3K1TA 3RTDA 4P7BA 3CLUC 1MJHA 1D2AA 3BRWD 3ZLBA 4IIFA 4MDFA 4MB6A 3VPSA 3Q11A 3TW6A 2OESA 3DO8A 4P4LA 5KVQA 3HVJA 2A1UA 3DTYA 2LUOA 3KHSA 3U4MA 5H83A 2IDMA 4KXFB 1FW6A 4GBJA 4GZLA 3TZEA 1C1HA 4G4GA 3W3ZB 5IUJC 1I5EA 1KKMA 5JMTA 1DINA 1SKYE 2K2WA 1RHMA 3I2FA 3ZE7A 2R4QA 1C7JA 1D0SA 3WL7A 4NNOA 2V0NA 3MIIA 4KI0A 4BX3A 2I3AA 1SU8A 1KY3A 2CXSA 1WVIA 5JSKA 4P7GA 1QO9A 2NZ2A 2J3IA 2XGOA 3ELBA 3HLKA 4G0VA 1KHTA 1XU4A 2PKXA 1L9KA 2F7SA 4RVCA 4BNWA 4GBGA 1HM5A 1ZGGA 2VR1A 5EZQA 3K09A 1GDHA 4KO4S 5JYDA 4KAFA 3PA8A 1TX4B 3UWMA 4CG1A 2GEJA 1EP9A 3R41A 1MQSA 3GLGB 4U7DA 1N5MA 3RTBA 1ZISA 3MCAA 1SUEA 3H8VA 3WQSB 4R9SA 5FFFA 4YWHA 3UJBA 2JIZA 3HDJA 3QFRA 3NYIA 4WJZA 1KWKA 4J07A 5DBOA 2GN2A 1FSFA 4ZQFA 2UUCB 1Z2DA 4Z9XA 3TR0A 2CC2A 3ZV4A 2WA1A 3MAGA 1HE4A 4RJ2A 5FOTA 3VHRA 3A9WA 1VZ3A 4P4SA 4UU0A 1UAGA 1P0MA 4ZYYA 2V5VA 2VJYA 5AP9A 3ZWBA 4IWXA 2JVJA 4P9NA 3E7WA 1HZZC 1QO7A 5BNIA 1HYBA 2XB9A 1JIQA 1FS6A 5FWXB 1PF7E 1FSZA 2E85A 2IQIA 4R2MA 2BUBA 3ND8A 2RHHA 4G63A 4L4YA 1MABB 1N5IA 1QFXA 4TROA 2AQKA 4K6KA 2JHGA 3PR2B 4EYSA 2YN4A 4AECA 5AI5A 1KI6A 2DKFA 3DMRA 4ROTA 3QI2A 3FFAA 3PDJA 2C04A 3AG5A 1YDHA 4DV1B 2ZQ5A 4D3ZA 2ECPA 1KC3A 3IP3A 4MYUA 3FJOA 1GZVA 4RH0A 4GQBA 1Y7PA 4IJQA 4AP9A 4CIYA 4DUZB 1SG9A 4BB9A 3OPXA 3D6NB 5IP5A 4W9MC 2KBFA 2D54A 3WRYC 4WKGA 4EHAA 4O2BF 1KPIA 5JCPA 4XCXA 4F06A 1ZDMA 3ACBA 3GFFA 2CLCX 5GZ6A 2ZS7A 3G82C 1C3OA 4NK5A 4CE6A 4RHCA 3FB1A 3AVTA 4GS5A 2H1SA 3WYAA 2R6R1 4I1UA 1VPTA 5E8JA 1RMQA 4A2WA 4ARZA 2YY6A 1FB5A 1RJ9A 2BUAA 3FHLA 3FFBA 2O59A 2AG5A 2BGUA 1XKXA 3FRHA 1Z0KA 4F4FA 5K0TA 2QZSA 7MHTA 4ZVMA 3GD5A 3DO6A 5GONA 3W04A 1Z4IA 1P7ZA 2ODAA 3BIWA 4TMZA 1A50B 4CF6A 2O3QA 1X1RA 1IM2A 2GFQA 4PLYA 2HLNA 3IMKA 1HZJA 3IEKA 4FX2A 2ZM5A 3L8CA 2WSSA 2BMAA 2X3UA 3LP8A 2F6RA 4GZMA 3ZV7A 1TM1E 1S9HA 4LZOA 3PRJA 1HRKA 1KNXA 4HTFA 1V48A 4Q03A 1D7AA 1YT5A 2HIHA 3GZNA 3LUBA 3FFXA 2YW2A 4NP6A 3T3GA 3ZIDA 1ECBA 3WK6A 3QPUA 5AJUA 4GKJB 4FZJA 3B89A 3PCTA 1XZNA 2NV0A 2DFNA 4HZIA 1JHDA 3DDOA 2ODPA 3HYNA 1RC0A 1VGVA 5HGJA 1VBFA 1GNSA 4CMCA 1X92A 3BCSA 2PGOA 1UWKA 1IZ0A 3ME5A 4XIIA 2GYWA 4L8FA 1Q19A 4ZAZA 3RFFA 2ZK7A 2QZ4A 4ESHA 3ZWVA 3H2SA 3SQXA 3CG4A 1F3OA 2ZJ3A 4DWJA 2VJBA 1MFZA 4KBYA 3ZJ5A 3OEHD 1K5HA 5KC8A 5F35A 2J48A 3DFZA 1Q3TA 4XI9A 4YJ2A 4GSLA 1ECPA 4LMPA 1KI9A 4NS1A 1L7RA 4QDTA 3VH1A 3IJPA 3ECSA 1TTPB 1IEWA 1BX0A 3W9UA 4FSHA 1TUBB 3AIIA 3UOAB 4HPJB 3I8SA 3OCXA 4O63O 3LA6A 5JLAA 3SEZA 3H97A 3Q7QA 3P5BA 4UCWA 3ZD6A 4N5LA 4PBSA 3COVA 1E0SA 5F3WB 3A9SA 4NG4A 4YCBA 4YV0A 4YAEA 4JYPA 1JLHA 3MILA 1O95C 2GPAA 4YECA 1JQBA 1H1DA 2HZ7A 4RHYA 3G5AA 4CYMA 4HX5A 1PJ2A 2OWDA 3IXLA 4IGIA 3Q5EA 3RUCA 4V1CA 3RB8A 1DAMA 5GY7A 5HJ5A 3UV7A 2PJRA 5CU7A 5ADVA 2HWXA 2B8WA 4Y2SA 3IEPA 2HT1A 2HGSA 2LKDA 1W36D 1T0UA 3IGFA 4BMCA 1U81A 4TV8A 5D00A 4C7KA 4DCVA 3HUUA 4ZODA 3NU1A 4LNUB 3C74A 3G8YA 1UFQA 3RTGA 1AQNA 2Q3FA 1EJ0A 3LTEA 2AH5A 1SKMA 1CP2A 3DOOA 5CBKA 4MR9A 5CFLA 2QP3A 3NT2A 3DA8A 3ESDA 5LCXA 2R6DA 4PRKA 4TTPA 4DLYA 4TWJA 4AICA 2GM5A 1TGYA 2CK3D 3B9QA 2NACA 3EOZA 4WOJA 4ED9A 1G8FA 1SOAA 1I4OA 1OC2A 2RBEA 5E1BA 5SZKB 3U1TA 1EA7A 1FQKA 3OUZA 3BIJA 5ARBA 5HIMA 5BV1A 3EG5A 5IZCC 2GBLC 3DEYX 5L4LA 4W5RA 3W8FA 4Y1GA 4FQ7A 5AUQA 2HSZA 1NI4A 1G3QA 3AESB 4OLFA 1DCFA 4YJKA 2E6KA 2NXEA 1LX6A 1TAGA 2FP4B 3CE6A 3HO6A 4DMRA 1YONA 3Q72A 3KWFA 3GQVA 3O3NB 1Z39A 2PAAA 1QYIA 3QX8A 3RYHA 4DHWA 4EJ6A 1AQJA 2M98A 4JBHA 2QSUA 4Z0NA 3EBOA 2ZUVA 4BPRA 3KJGA 4KE9A 1XCLA 4KR7A 5JADA 1CUJA 2HK9A 3JAKA 3V5NA 3H2ZA 4NCJA 2EQAA 3R9IA 5BMOA 1WBBA 2OK8A 5K0ZA 5AQ1A 1VGRA 2FPPB 1J9ZA 1JSZA 3JPWA 4XJXA 1KETA 2LTAA 3DDNA 1U0GA 1NM5C 3RHZA 2LV8A 3CVWA 4L0MA 2CHFA 2PMDA 2BI7A 4OBXA 4XW2A 4YJGA 2WHPB 2YXBA 1CJCA 1W9MA 1K0FA 4OHWA 3AP2A 2W8BB 4MW4A 2PKCA 1D5WA 5DXAA 2OYCA 3RF7A 2J9GA 2BL4A 3GZ4A 3IVMA 5J1SB 1M1NB 1EEXB 2GERA 3JSXA 3I9OA 1Z8DA 1YR3A 4N0QA 4RGBA 3ZWWA 4RFLA 3UCEA 4DBLE 3HACA 5CLGA 2D0IA 2HJVA 1GXSA 4G85A 3HWSA 3T9AA 3GLIB 1GGKA 4XVQA 2PGLA 1ZOPA 2OFWA 4ZZIA 3P52A 1NFFA 4JLDA 2M1XA 4KXQA 4UVHA 3DZDA 1P7CA 3OPNA 1TOAA 4FR0A 2W6JA 3IAHA 1ZNXA 2VSYA 4OATA 3VU0A 4QD3A 2Q6TA 5ERXA 4D4IA 1WZCA 2EHDA 4Y98A 2XITA 2CNBA 3BHMA 1XYVA 3CKKA 2YFYA 5K7SA 3P1JA 3SFTA 4B4KA 1Z25A 4JQCA 4YVFA 3THOA 4RJLA 4D79A 1LS1A 1SHUX 1YWGO 3VPBA 5C5CA 1KAEA 1SMKA 5E0KB 1P29A 3STYA 3ZX4A 9LDTA 4RETA 2F43A 3DTVB 1YOVB 3MC1A 3P9RA 4KNYA 1EDZA 3AEKB 1NASA 4PAQA 2VK4A 1NP3A 1W35A 3FE2A 3NRJA 4D98A 3G8AA 2WIAA 5JARA 4KYVA 1FU4A 3VSBA 1PJ4A 4C3ZA 1KI2A 1Z82A 2JF0A 2FPIA 3VRHA 4Y18A 4ZVOA 2B69A 1DU4A 1Q7TA 1YMQA 1Z2CA 4PZLA 5ALOA 3VZPA 3AIOA 4A7PA 2WWTA 1VHJA 4D8XA 1K4KA 1O9GA 1KGDA 2BEVB 2BKAA 3VO8A 1GKKA 2H07A 4GXQA 3FROA 1OFVA 2EZ8A 3TFOA 1O6CA 1NMXA 2E18A 3HH8A 3HO1A 3DT6A 1QP0A 4ZT3A 5IAJA 2HU8A 3I2GA 2GTPA 2AG6A 1RWQA 3E61A 4JEHA 3PNYA 1U0TA 3Q6NA 1ISMA 1IZYA 1XDBA 4FFVA 2IQ5A 4BO3A 2AGVA 1B8UA 3FNBA 4H7DA 4UNPA 3GLHA 1ETHA 3KB6A 4JGGA 5LC1A 1U1CA 4U3JB 5I7VA 2JAHA 1O9BA 4V2IA 3TLGA 4UMDA 4CTKA 4UW9A 3CHYA 1NBWB 1PEDA 4NK4A 1LBHA 1Z4PX 1BWPA 2G5CA 1CUIA 2HPZA 2YWXA 2QVYX 3E6AA 5HFAA 3RVQA 1FC0A 1JSRA 4Q3AA 4EEKA 1X1AA 3MWLA 3SS7X 3PWKA 5GONF 3DDWA 3T1VA 2FZ4A 5CIWA 2ARKA 4CCSA 3SX0A 2V6GA 3DUFA 2DTXA 4GVLA 4JQZA 4PTYA 4MS3B 4RD4A 4U7PB 2WRZA 1D2CA 3SE7A 4V38A 3OE1A 1JHPA 2OORC 3VKGA 2E3JA 4CM6A 3PBKA 2B7BA 4H3HB 3OJOA 4I3GA 1ZIXA 4WOCA 2ZIFA 1L1QA 2CYCA 1V8PA 1CERA 2CNWA 3AJAA 3INRA 1LJLA 3LRPA 3K9GA 1CZNA 1T3LA 1UP6A 1V1MA 2XMDA 3Q3IA 4GOKA 4N7JA 2AB0A 4U6QA 4ESEA 2CMFA 5LLSA 3WA6A 4CV2A 5JSFA 1O94D 4R2HA 3DNFA 3AK4A 3LYUA 4P93A 1G8HA 2YMPA 5AM3A 5DN6A 1U04A 2Q5FA 1RXCA 1X19A 1B00A 1GTG1 4J94A 1MNAA 2O7RA 1KH3A 4IILA 2HCJB 4UU7A 3MBKA 3K0FB 4MQBA 3WYBA 1RNLA 4BEBA 3IILA 4JXJA 2VSOA 1YUNA 3L7CA 1WUHS 5CCBA 5LKRA 4TT3D 1EZ4A 2FMIA 4UBKA 3I3OA 4OJNA 2XT0A 4BNUA 1A5BB 2XB8A 5IKXA 4MDEA 5H5JA 1YMVA 2H2GA 3MJ4A 4M49A 5JEDA 2CYBA 1NJGA 4FSDA 4UUOA 2LPMA 2WM2A 1YRHA 2OFOA 3QVTA 4KVFA 2EVWX 1ZLXA 3ZI0A 4ZHQA 3FRJA 1T5DX 2Q2OA 1P2BA 4MAAA 1C30A 1ZOLA 3EIEA 1QTNA 3EZ9A 4JBYA 2HTEA 3QBTA 5K51A 3AUYA 2TMYA 4AJPA 2OLJA 2WU1A 5B36A 3UJNA 1W4AA 2JAUA 5GJCA 3UFBA 4PZPA 3W5IA 1ZHFA 3HU1A 3II6X 2CKDA 3PC8C 1KIMA 4IL5A 4XLZA 5LLDA 1WCYA 3UF0A 1B73A 2IKQA 3JQBC 4UJ5A 4BAGA 2H17A 3BXFA 4G0OA 5E6UB 2C5SA 3SS9X 5JTUA 1GTVA 1YJ5A 2P8SA 1YRYE 3DM5A 4PZUA 5JAMA 1Z6AA 3DEHA 4LSZA 5JCOA 3WYCA 1VG9B 1ECFA 2ZRHA 3JASA 4Q3EA 4U6SA 3WWDA 2IYLD 3OX2A 2GVDC 4BASA 1AUVA 3CB2A 3QFFA 4G24A 3IR7A 3O73A 3H1EA 3RUEA 3ESAA 2HXYA 5JZBA 3KQOA 3P2YA 2O6LA 1HE1C 2V7PA 3C7AA 1DTSA 3VNAA 1G18A 4B33A 2PD3A 3ODGA 4QHYA 3PX2A 4HN2A 5T5QA 5CB4F 3AHGA 1S5PA 4RTMA 4DA4A 4GPIB 4O4HB 1DBQA 1OPRA 3ZDRA 5EXEA 2GN0A 2I7VA 2G0TA 3GLGA 3TRFA 1YQDA 1YAHA 4UQLA 3OJFA 4G8BA 5K8VA 1ODCA 3HKCA 3TMAA 3L07A 4FE3A 2JCXA 1VJGA 3MSCA 3OA2A 3MPOA 3NGLA 1AY0A 1EMDA 1R4MB 3CRRA 3LQQA 2OCGA 2IYPA 2QS9A 3C3AA 2XUJA 3F78A 3GJZA 2GHIA 1OI3A 3P97A 1UQUA 3GAZA 5TE9A 3MLBA 5G4LA 1JFFB 2B1JA 4PSDA 4AZ0B 3BGDA 3UBTA 1CLUA 2FUG6 3EFBA 2Z5LA 5CB8A 1VLLA 2GKGA 1DTWA 4IYRA 1MENA 1IN6A 4DJFC 1D1TA 4UATA 5AW3A 2R6FA 4ESOA 3ZHUA 3O2SB 4UBMA 4EY4A 2V3WA 3QOYA 2X9QA 4OD0A 2QRGA 2YX1A 1L4MA 1B0ZA 3NYQA 4CU5A 3H2KA 4URUR 1SR8A 5KYWB 2NO4A 5EZ5A 3NT5A 5CDSA 5BWCA 4MCAA 2QSZA 2C4TA 4KPFC 4KQWA 2FW1A 1O6BA 2WU4A 1L7PA 1ODSA 3KEOA 3MG9A 1Z2PX 3P4YA 4J4BA 1Z88A 3P2OA 3RE1A 2GK6A 3DLAA 2BR3A 2H2FA 1X1DA 3C6XA 4W5TA 4CGYA 4A0QA 1FSSA 2J0EA 2GARA 1X7DA 2GLTA 5K0CA 1H8HD 1QIIA 1QANA 3BGVA 1OZ0A 3IP5A 3RCBA 4DUPA 1NNLA 1ZONA 5KCZA 3NBKA 5K4AA 1L3CA 1HKUA 1NW3A 2P9TA 3ED5A 4U63A 1DXYA 1DAKA 4D6PA 3DHNA 3L02A 3LBAA 3MTQA 4EEZA 1DRJA 5IU6A 1JHAA 1UMBB 1DXQA 4ASUD 2NTYC 1RTKA 1XLVA 3FGPA 1G2QA 5TJHA 1HK7A 3IV7A 2FNAA 4OU4A 5EKXA 1FFGA 1QYWA 3PI7A 4LK2A 2J5RA 5AUOB 3VZQA 3FVRA 4QICA 1DKMA 4NMMA 4A0RA 4EY5A 4B3CA 3OM1A 1N9GA 5E4TA 2FX2A 3EH1A 3KUCA 3RIMA 2BKXA 1TA9A 2V0CA 3BMQA 4KBFA 5T8KC 1OWOA 3L7OA 3EQ7A 5C7OO 6Q21A 4NWIA 3UMMA 1C8KA 4MKHA 3AVPA 1Z47A 1B26A 1TVCA 3LUDA 4JEIA 3BGWA 2GUGA 3SYKA 3UZUA 2G9VA 4F5ZA 3GLFA 1FIUA 5EIAA 1II0A 3HSYA 3LCUA 3SC4A 3MOIA 1YR6A 1G8MA 4LRWA 4PC3A 2Q50A 2AOUA 3H5IA 3HC7A 4M22A 4O5AA 5EEGA 5HYVA 1AA9A 2ZITA 3HA7A 5I7SA 3BA6A 4OI4A 3WWCA 4GKBA 4R8LA 2ZWIA 3UMBA 2DJIA 4LJ7A 5B57C 3GUUA 2PZKA 2YWBA 4NMXB 2H51A 1Z9BA 1QUEA 3H7AA 3HB7A 1PJ8A 3D8SA 3KPJA 3TTXA 2Z04A 4CG3A 3GT4A 3OF2A 4ZEVA 4AQ7A 1QOQB 1EXDA 3NTRA 1JDBC 4XB6B 3NGMA 2QNBA 3I39X 3GEPA 5KYTA 1AKEA 2E9SA 1T3GA 4CMBA 5AH0A 5LOVF 4IJUA 1GR1A 4CMEC 2B78A 2EX1A 3WRYA 1T4BA 2JGDA 2FPGB 4R2KA 3DNMA 3KCQA 3LZDA 5CVVA 3JYLA 4OL9A 3ILHA 3V1MA 1W96A 3DEZA 3NHLA 1IWOA 1JPJA 1CPYA 2A0XA 2ETVA 3JAWA 5MN4A 2XNKA 2YN0A 3KJFA 4E88A 1XN4A 3WLTA 1DB3A 1FRNA 4M8SA 1FLDA 2BF4A 2NV6A 4X1IB 3LTNC 4M4SA 4XQ9A 5DN6D 2XWSA 3CX3A 2Z09A 3PUKA 1CQPA 1KQ3A 1XZHA 4BO7A 4D3YA 4K9OA 4JLKA 4DIBA 3NM4A 3OESA 3AY7A 3QEJA 4E5MA 1I8TA 2HW8A 1J8VA 5KAMA 3DKKA 3MLEA 4Q9LA 3O92A 3TINA 3WGKA 1CZUA 5IF9A 2FI1A 4AURA 4FOSA 2IYVA 2VYCA 4Q02A 3T3OA 4DSZA 2E4XA 2X8LA 1YJXA 1YV9A 3EZFA 4ZI3A 5ICMA 3DQQA 1FYDA 1GSOA 2FR8C 3HA2A 4GZ6A 4N6OA 1NF9A 1UDBA 3TYXA 4F4JA 5K8TA 3A1DA 1T4CA 1DQYA 1G3UA 5GINE 4CVNA 4E3WA 1C50A 5A0VA 2E4WA 3ZWNA 1YR9A 1BCSA 1XTZA 1NF8A 1OA1A 4RVDA 3VHXA 1QP8A 4K40A 1ZD5A 4NG5A 3LY9A 3JZIA 3RVMA 3GQBA 1JDUA 3NM6B 4HLUA 3X1JA 2QJOA 4LHXA 1IY2A 2HK8A 4MPRA 1CUWA 4NIMA 1U7ZA 1JR6A 2KW5A 3QFCA 1I0LA 4TM8A 1P1JA 4EJ2A 4WKCA 4BCBA 4QRHA 4KWEA 3HBJA 3AERA 4ZU6X 1I51A 1RBZA 1ZOSA 3GGPA 4KFCA 4DT1A 3DE2X 4QYWA 1RXUA 1DC4A 1P19A 3OECA 3WL4A 4H1WA 1GGEA 5DM70 4NF2A 5CHEA 1I1NA 1W49A 3DKIA 4NTZA 4B6GA 1VI6A 2BWJA 4ND1A 4X7BA 3WNVA 3N8HA 2GF2A 1ZEJA 2KI5A 3AZPA 1JDBB 3KQMA 4NENB 5FBZA 1FFWA 3AR2A 3WFZA 2VJLA 3NDIA 1QQ7A 3BUSA 3G5UA 2E4YA 5E4JA 1WXHA 4EIWA 3NATA 1QGYA 1YS2X 4QATA 1KZ4A 3A7EA 4QSHA 4D4GA 2X42A 1ORWA 2V5UA 1RXWA 3KPVA 1P0FA 2XCOA 2PWPA 1OXXK 2ODEA 4PC2A 2A0FA 5AKJA 5DPMA 4E2FA 4WRRA 3L5OA 4B1FA 2Q3HA 3P0HA 4C07A 2XODA 3BWXA 2EF1A 1GA4A 4UNRA 3EMDA 4QTUB 3FFWA 3O38A 1VDZA 2BEWA 3GJ7A 1C0PA 1C41A 3F2VA 4D8WA 1PKXA 1GNRA 4DM4A 1JTEA 4XB2A 1OUMA 4ZXPA 1ISGA 3S70A 5L7TA 2EKQA 1S7GA 1U6JA 2WVHA 3ZD7A 4CMGA 4M0FA 1GL6A 1XQ1A 5BN1A 3K9QO 4DV7B 5LQCA 4RACA 5DHQA 3WLOA 3G0HA 2IHJA 2ZE8A 2OAGA 2PAFA 2C2ZA 1DOZA 4FC7A 5L3SA 4W63A 3K8QA 3A28A 1JR3A 2WOOA 3ETJA 4S0XA 3EVDA 3ZYCA 2VF2A 3CPJB 4ZRDA 3AEZA 4YDRA 3K35A 1TEHA 1HEIA 5JC8A 3OFJA 1VL0A 3H9BA 4MGYR 4TPKA 1T1GA 4ZVLA 1V5WA 5KREA 1LC3A 4DQLA 2ROQA 1VJTA 3AFMA 3N8NA 4MA5A 4U4AA 4ZEXA 1WF6A 2IYWA 2IHVA 5JH7A 1Z73A 4AXXA 1P17A 5DI3A 7MDHA 1NU8A 1XAGA 2OVBA 4DPKA 2IU6A 4J90A 5CA0B 2JCYA 2OBMA 5A0TA 4YB8A 4KFTA 2WVGA 2GK3A 1EGVB 4A5OA 3CR7A 2FHSA 3H3FA 4MV0A 3BJZA 1BQ4A 2BGGA 3P9CA 4HGRA 2Z2JA 3R0VA 1YCFA 3DJYA 3CINA 2H85A 4MRAA 4KDEA 4X20A 4DM3A 2ECQA 2P3SA 4I46A 3GDHA 4OAQA 4YRKA 3BF8A 5AKYA 4B6QA 2ZWVA 5FOVA 1G5FA 2X14A 4RW0A 4EFDA 1FJGB 3I45A 1CS0B 1NAHA 4C0WA 2PFSA 2WFLB 3Q9SA 4JBGA 3N07A 2BFCB 2W2NA 1XVVA 1ZJ6A 1M1YB 1E2FA 1O03A 3PFHA 1F38A 1OREA 1Q22A 1N6PA 1UPCA 4QUHA 5BV2P 1PW5A 3ZIUA 2P2SA 3FLAA 2P27A 1WP4A 2HV8A 1ZG3A 3W3AA 4MCJA 2WB2A 1X1CA 4BXOA 1KP3A 1OTXA 1QHXA 2I7CA 3DE0X 4HDNB 1OR8A 3X1XA 2YN2A 3C1UA 3JQCA 3LK7A 5CX1A 1IY8A 1JYSA 3K71B 1P7VA 1A9SA 1SZCA 4Q7LA 2ZJ6A 4KH1A 2C78A 2O0HA 2ZPAA 1OWNA 4MKXA 3GJ3A 1VSQA 4YJ3F 2QTFA 5JQGA 2GXSA 3NWOA 2ZCUA 2RKBA 1M5TA 4CLOA 1OVGA 3DQPA 4WNAA 4EPWA 4YUVA 4JV5B 1KY5A 2ZS8A 1R4ZA 1MB9A 2G4VA 4FFPA 2ZAIA 4DUGA 4CIDA 3EFOA 1E8NA 5H0IA 3RRZA 2IYZA 4LSGA 3HEMA 3RM3A 2H1FA 1VE9A 4AN1A 3ZDBA 4M0EA 5ITSA 1NR5A 4ENQA 2UUPA 3QFHA 4XDGA 2DE0X 2WG0A 3UG6A 3TSZA 2E7ZA 2HY7A 1JWBB 4LX0A 4IHJA 3KJIA 1ZSVA 2F3TA 3BREA 2VNAA 3UATA 2VXOA 1G5QA 3NOVA 1QLJA 1TI7A 2VDWB 1SRQA 4X84A 2Z4SA 3C24A 3WNBA 1P73A 2PX5A 4NPCA 3CGWA 2PV7A 3AU9A 3G5MA 2DSNA 2WWWA 3MXOA 3NRBA 3ZW7A 4X90A 5FORA 1HQYE 1NPDA 4R9VA 3A9TA 4HUJA 1K98A 2JD2A 1OKKA 3DXYA 1POWA 1IHPA 2PU5A 4HDSB 5C31A 6LDHA 1KU0A 1PNQA 1T34A 4BKOA 4GMHA 3PQ2A 1TPYA 1S4MA 4PZZA 3VYSB 4BKPA 3H1FA 1DLJA 2PH5A 3O2JA 4QDJA 3BSFA 4TKZA 5AKXA 1QIHA 2HBQA 3VYVA 3ZQJA 2Q5JA 2YXLA 3DPUA 3NIWA 1USGA 1KAGA 2Q1WA 1BVYF 3ND5A 2D8MA 1JR2A 5ALRA 4M8NE 1DIGA 5SYMA 3ENWA 2V74B 2Q0HA 2JGEA 2M9MA 4YX9A 3GC6A 3JCZA 3HEAA 1E2EA 4L9SA 1EK6A 1WUTA 4UU1A 2VNSA 4OK5A 2XQJA 3OUUA 4WE3A 3H5LA 3H0CA 3H6KA 3EXHC 3KR9A 4DYDA 4EJSC 3B7WA 5LQMA 3NS7A 5B3KA 2CXPA 1AS2A 1O57A 3OIGA 4PRYA 3CZQA 3KC2A 2NNWB 1JFVA 3ROQA 4CMAA 2XWBF 2QXTA 4OQLA 3VZBA 1N2CB 3R44A 3TD6A 1X7YB 1EFRD 3TL6A 3WE7A 5LYYA 2VPZA 2JCGA 1SVNA 5A5EA 4A82A 1H93A 4ZREA 2Q1XA 4N7BA 1O4VA 4M8IA 4WZBA 3QU4A 1E3WA 2XDQA 3R40A 2WTAA 4E5UA 5BYAA 1QRRA 3OQ1A 3PEUA 4LI3X 1I2CA 4WN9A 4AZ3B 4D0NA 1RRGA 1XLWA 3IODA 1G5HA 3LE8A 4M2LA 3RFUA 4QYXA 2YOFA 2IV3A 4PN7A 1IUOA 2HGZA 4B2LA 1Q6YA 4IZHA 5JIBA 1QM5A 4BNHA 3W8DA 1R10A 3I12A 5DCLA 1YZTA 2AG1A 4JOBA 2PUBA 4J0DA 3P9ZA 2IWHA 1RDFA 1DBRA 2BAGA 2QMQA 2RGXA 2XCUA 4OMUA 4X6UA 4WVLA 5BSTA 3U09A 4HCJA 1F7VA 1N34B 4HEA1 1R6VA 1L5FA 3IOYA 3K5IA 4FOPA 4KQFA 4RF3A 1T9ZA 3JYPA 4JDPA 5F2KA 4GVPA 4EF6A 1GTRA 1S9DA 2XB4A 2QN7A 1VE1A 3HNRA 3D4OA 4M0DA 2ZXUA 4D82A 3BD6A 4YJFB 4B9AA 1OIXA 5IFLA 1UPAA 2NSHA 2QPLA 1X8KA 3RVNA 3VOSA 3WISA 3R9XB 3O93A 1CYEA 1FVOA 2WSYB 4YAFA 3AKZA 4AY4A 4GSKA 1CB0A 2FPIB 4XCQA 4D3XA 2FRDA 1W73A 1X7HA 3ASVA 5D87A 4N03A 3NTUA 3VO2A 2OLKA 3TZKA 3AIKA 1QE3A 1OE0A 2I2FA 3RHTA 3UC5A 5DX1A 2VF4X 4CT5A 1DX4A 4NC9A 2VJCA 1XL1A 3FMFA 5JMPA 4KZPA 3TB4A 4PG8A 1M73E 1R6BX 3AWDA 3MAAC 3UJCA 2C3MA 4BE7B 3IKVA 2ZRAA 4I4NA 1QDEA 2XDYA 4FNMA 2BCGY 3F9RA 2CHUA 2VTKA 3N2EA 4ZMSA 3HCNA 5BR1A 1PZXA 2JB9A 4YA6A 1JFTA 2QW0X 3VSAA 1JQEA 1L7NA 1F06A 1OFIA 4HDMA 3KVYA 4N5IX 1PNOA 5CVDA 4MMZB 1FK8A 1G66A 1ZVMA 5CDFE 4HBGA 3BERA 3EXHB 2XE6A 1AA6A 2VPPA 1QS0B 4U2GA 2C4WA 4NLLA 5T3UA 4HMPA 3ZJ4A 5IXSA 4IG4A 3ZBQA 2IXDA 1MVOA 2ACEA 2YHIB 3HR4A 1NWCA 3ZHQA 1LVHA 4JVOA 4MCHA 1VA5A 1ZGBA 1V47A 4BDTA 3AC0A 2FN7A 4DCCA 2Q9CA 2WD7B 1ZSNA 3P2MA 3U3RA 4F46A 2I2XB 2Q62A 4WJLA 4HGOA 2HA7A 2QI9C 4YDHB 4QTTB 5SYAA 3DAFA 3ZDDA 1VHDA 4QOIA 4QAJA 1N2GA 1NYTA 3BFXA 3GG2A 3HL4A 3I9NA 4RVFA 3E23A 1L7DA 4ZCTA 2JVIA 1P5JA 4M76B 2WD8A 2A5DA 4DY6A 3VV3A 2QY9A 5C46F 1Y8CA 5CT9A 1LPPA 1UP4A 1E3WB 1ZCZA 2OXRA 1XDUA 2AOTB 3EFEA 4ZCPA 4EGCB 4FFRA 1DHTA 4PLCA 2G9RA 3D0RA 1B7GO 4RUKA 1PWYE 4AT1A 1Z6ZA 1XNGA 2BDUA 2LRHA 3CM0A 3MJDA 4TKMA 4ZO9A 1FTSA 2MMGA 3NBYC 3L4BA 1FVHA 1RRKA 1S3SA 2H4XA 2E2WA 2ZVQX 3OTGA 4X85A 3WADA 3S2YA 5ALSA 4IQ4A 2P3QA 3CMMA 4YDQA 2NYAA 4PBTA 5DRYA 3F7NA 4YJHB 4A4DA 2OEPA 5H4HA 1SU7A 3KOOA 3G2QA 1M67A 1T2AA 1KO5A 2Q27A 4P0PB 4ZRMA 4UUMA 2YV5A 2ORVA 5DSTA 2ORED 3E15A 5CCEA 5JWHA 3QU7A 1R50A 1ZR4A 1HMYA 2HYIC 5AM5A 2VHJA 1EE2A 1T6XA 4L5BA 2GVZC 1YRWA 1FXWF 1Z6PA 3GNSA 3OPQA 4JUIA 2FMFA 4WA8A 5THKA 4DR1B 3JZAA 5CXQA 4YRQA 1ORTA 3PTZA 5JECA 2RJOA 2J32A 4FYMA 4MROA 2R85A 1ZIYA 2WFMA 4HAUA 4XUDA 1A1SA 3FVWA 1A9YA 3KKEA 2HJHA 3FDJA 4HUQB 4O02B 1IDOA 1M2JA 4Q19A 4QUEA 2CBXA 1PX2A 2FPLA 1VE7A 4GM0A 5E4YA 4E2XA 5U4XA 4B5KA 5JJLA 1E2GA 3TZ6A 1SKUA 1Y6QA 3HSSA 4F72A 4ZT7A 1M5UA 3RKRA 4FZ5A 2PVPA 2V5AA 1BD4A 4OXYA 4DEYA 2QRVB 2IC5A 2H4HA 2CDBA 1USKA 2X8JA 4MZXA 1GGMA 3F67A 5LPNA 3B6IA 4PLZA 1L1FA 4BV2A 4R2IA 3U3MA 3V7NA 2QN9A 4BKRA 4W5WA 4RM2A 1XLTC 3H1PA 2QI9F 4LHSA 3TW4A 2OCDA 2PT5A 5ICSA 1DTEA 1TU4A 3W1VA 4D5GA 4QELA 2Y76A 1PG0A 3FMPB 3H6GA 1Z4NA 3IIKA 3K31A 4Q00A 1A88A 1H0SA 3SE0A 3HLYA 1XRRA 3LPDA 4RE6A 4NOMA 3KOMA 3X1KA 4JBIA 4NJMB 4M9RA 3MQ4A 3B8HA 4BYMA 2IH2A 4OLBA 5CIQA 1BXRA 4Q4DA 4ZT5A 3M34A 3A31A 2Q4OA 3ABIA 1JTFA 1QTIA 4F2DA 3M49A 4H60A 1JR3D 4LYEA 4L4RA 4LY6A 3FUTA 2EZTA 3R09A 2P9QA 3JRWA 4FN5A 1TGVA 1OT3A 1L5RA 1KI1A 1V8FA 2EBFX 2O2CA 3C7TA 3RVOA 3V4LA 3ZU2A 3RT1A 4ER6A 1E4YA 1ID8A 1DWUA 1N33B 5ALFA 2ZWMA 3B8EA 3FDIA 3FXAA 3QX7A 4WBSA 1A3CA 1AGYA 2ZZKA 2Y9MB 2YR0A 1F1BA 1JTVA 4JMPA 3U7JA 3ZDCA 1Q84A 2AL7A 2P4EA 1CY1A 2YVKA 4NBKA 3I73A 4EKNB 3NAGA 5G53C 4C6RA 4OGKA 2W42A 2FR1A 3BE6A 4IOLA 3K9WA 2VOEA 5MGBA 3DKVA 3LUKA 4G5XA 4OQNA 1G20B 5SZJA 3VNVA 1O5TA 1G3MA 2VH5R 4KI7A 1QDLB 1KJYA 2BMEA 1HYQA 3KJHA 1R6XA 4BV3A 2FCRA 3KOUA 3VJLA 4NYIQ 3WG9A 4IDHA 1QYVA 2FW6A 4WPGA 4WK6A 4WXPA 3VTKA 1JMYA 4KMSA 2XGSA 1V5GA 3QJ5A 4ZOQI 5JWRA 1P8AA 4N0PA 1R88A 2A59A 4TQGA 3RABA 4BQEA 1FX1A 1W2HA 3G8CA 3URMA 4QASA 4PZAA 4QBFA 4X93A 2CMKA 3E8SA 1DJNA 3Q40A 4FYWA 1AU9A 4NAHA 3ICPA 1BZYA 3KIPA 2FN9A 4YCAA 4B34A 4DJAA 1FFYA 1ORIA 2MSCB 2H5EA 1IWBB 1SUPA 4GP9A 4QDZA 3S2EA 4M1ZA 3LXXA 4QEZA 1LSJA 1BFDA 3TQOA 3U2QA 2CGEA 4IMIB 4QOGA 3PA6A 4EG8A 2D00A 3FSRA 4YP0A 2DR2A 1WZUA 1TQ8A 3OT4A 5B4VA 3M6WA 1ES9A 3ABOB 3DCJA 2BM9A 4ZRNA 3OIDA 4J9UE 2A84A 2NZYA 2ZRJA 1BRTA 3AH8A 3KZOA 4BTVA 2DFKB 5LZ9A 3E9NA 1FBTA 2NVOA 2BZ1A 4X95A 2CY0A 3IHKA 3QYPA 1N8NA 4Q21A 4LNUA 4G84A 1C1DA 3J7AC 3EXIB 1DO2A 2YJNA 1FPQA 2W9XA 4MVJA 4GXNA 3NBUA 3DLPX 4X1YB 3F97A 3JQ9C 4S12A 2IVZA 4QSMA 2ZVJA 3LFHA 3LGAA 2H0AA 1OYYA 4XGIA 3PT5A 4YLEA 3TNJA 5JJKA 1XPRA 3S2IA 1EX6A 2VK2A 3N2YA 4PINA 1NE2A 1TLFA 3HN6A 3WV4A 4ZDIA 3ICQB 4JELA 4K26A 5DM0A 4F9EA 3A05A 1F5SA 1FXSA 1DDOA 3BIOA 3LMKA 4L0DA 2YUTA 4UEJA 5BOSA 2ONZA 1CJTC 3U3DA 2HNAA 1JZQA 1E79D 2ZSBA 2REQB 2F48A 3GMSA 2PHZA 3D4NA 3TLAA 5L3QA 3FETA 4WXMA 4RHUA 3LLCA 3KQVA 3FPJA 1I1QB 4L4UA 5DBEX 5A7GA 1N7GA 4RSMA 3GAMA 3RROA 1MPXA 4BVBA 2YVUA 5D1HA 4EVSA 3C85A 2OQVA 4RSHA 1GV1A 4N5MA 3PENA 2FWBA 2VKTA 3OFNA 5F76A 1C8LA 3LX5A 5EL0A 4AC9A 4EHJA 1UDWA 4JX8A 4JR1A 1M74A 4BHTA 2ZI3A 3VPXA 1CV2A 4HXEB 5A2QA 5LA6F 2B7CA 1BCSB 3OO1A 4L8VA 2CMGA 3SSNA 3ZGXA 2I9KA 4ZCRA 1XD2A 2AZXA 1PDOA 4J3NA 1GY8A 3PNPA 4DMKA 1OFHA 4Q66C 3VDRA 5FPKA 4HDOB 3GL9A 3G02A 5C2JB 4L02A 1U7UA 1JA0A 1MXHA 1BWRA 1P0PA 4C08A 4HWRA 3QYFA 2IOHA 2I71A 1G4HA 1KH2A 1NX6A 1XFDA 3C6BA 1IQ0A 4K87A 1MUUA 3BXPA 4WN3A 4AJ2A 1BXRB 1QGUB 1TC1A 3QLTA 2GK4A 3T7RA 1VCNA 2DUWA 2IHTA 3CZ5A 4IGEA 4DLSA 3A36A 4A0GA 3DONA 3TTVA 3KTAB 4PC1A 2AN5A 4B83A 3LHFA 3ULKA 3EEBA 4DMMA 3OD1A 3WZMA 3QWHA 2FHPA 4GI1A 2W7TA 2Q8QA 3V7UA 4A23A 5HHTA 4HTFB 3H9QA 2WFAA 1KRWA 4U2FA 4J6EA 2GF9A 4PAMA 1R74A 1M76A 1CR1A 5ALKA 4D81A 2O3JA 2BGNA 4X61A 4BGIA 3FOBA 4PGFA 1LV7A 3KSAC 1IPFA 2GAJA 4TS1A 4ARSA 3COZA 3HP1A 4CNBA 3A11A 3AEQB 4ARCA 3DUWA 2L42A 4ENVA 5JOQA 1ONOA 1SBHA 1K4YA 2V4ZA 2YXNA 3QUCA 1IRIA 2VUIB 3RFCA 5IYZA 1CQXA 5JW6A 5D2CA 4GLJA 1TLTA 2ZPTX 4MYRA 4PO9A 1EUDA 2X58A 3KQWA 3WZ2A 1U99A 2WWHA 4HUQA 3ZIAD 3U4IA 1S2OA 2CXHA 2JGFA 2Q6IA 2WY2D 4G65A 1W7AA 2GEDA 4XAQA 4WQMA 5ALDA 3RDPA 4JJZA 1CDZA 3FYDA 1IBSA 1SHZA 3FJYA 1U31A 1U2EA 1ZNZA 4KLZA 2AZDA 3KU4A 4H17A 4REMA 3EBLA 2YQ5A 4UE3S 1UC4B 4XWGA 4YRGA 4N7MA 1F12A 5EIFA 4PSKA 5CVCA 1P4JA 5HS6A 3VR3D 2CUTA 4JDUA 3QH4A 4NL4H 1IIRA 3RIXA 1MVLA 4WLNA 2W6PA 2OO3A 1E92A 4KDCA 4RK7A 3V7YA 4YAGA 1F0NA 3FD8A 1SVUA 1OIVA 2VDJA 2WIFA 4H2DA 1I4TD 1ZD9A 4GW3A 3GARA 5FD8A 5JRDS 2H16A 3RBVA 2YJ5A 2ODNA 1XVTA 3KSUA 4H7KA 4GYWA 1NT2A 1RVV1 1DWPA 4G1FA 5AW0A 1KE2A 2H1VA 2AK3A 3D6VA 2AFIA 3DD5A 4PHFA 5SYNA 5JS7A 1RACA 4W99A 5IVIA 3UKJA 2GPYA 3P0RA 2QUBA 4EGJA 5JQGF 2AKAB 3GGGA 4MYTA 4IF6A 1AJEA 2AI3A 4R4JA 4QGGA 1X1SA 2DKNA 3RU3A 4I1YA 2ZUWA 3HV2A 5CX4A 3RRYA 3WDKA 3ZW9A 1EFDN 1R5OA 3AHDA 2H08A 4U2KA 5FH9A 1P1BA 3H1BA 1WO8A 4BRZA 1JBKA 4IYJA 4DIEA 4BQIA 1GPYA 2AZ4A 3H04A 2QA5A 3VUEA 3ZY2A 4Q4AA 3QNWA 4CXMA 3B85A 3ZHRA 4EFKA 5CFZA 2WFLA 4OI0A 2DULA 2HXSA 3MFYA 4JUBA 4P83A 1B8PA 2QJWA 2X22A 3CKMA 4GYJA 3PRYA 5KVAA 5ISMA 3U44A 1V9LA 3NJ8A 3NHKA 4BN5A 1ESDA 2AQ8A 2PNJA 4JLVA 1IU9A 2HU7A 1TM3E 2EJTA 3U1BA 3T41A 1GPJA 1XRNA 3N2GB 4U2CA 5LQNA 4DJJA 3INNA 3T1HB 1ZY2A 4PYJA 4JBXA 4B82A 1HFJA 3F6SA 3OJEA 1I3LA 3JQGB 1XZGA 3TO5A 3N8GA 3WFJA 1E3LA 1HRDA 1XDSA 5J2UB 1NVMB 2QPOA 1U02A 4MUNA 4WWHA 1YNOA 3IP9A 1XRQA 3FNFA 4ISBA 4QLBA 4PYQA 4WNYA 3C98A 2J4CA 2OFPA 2ECFA 3NTXA 4G2NA 1XF9A 2J9ZB 4PTZA 1FNSA 1Q7CA 4MUHA 3C3KA 4Z0HO 3LUHA 4I08A 3LVQE 2IIVA 4JP3A 4QNMA 1VFNA 1LV8A 4IIJB 5F51A 4BFUA 4OSOA 5EKTA 4MDYA 5BW8A 3UAYA 3Q5DA 1NDQA 5EJ6A 4XVCA 2A1TR 2Y66A 3ZJTA 2ODTX 1I2AA 5C9ZA 2P4UA 3BJEA 1GFSA 4O59O 3TOZA 1XMVA 4G0UA 2INGX 3HJBA 1WLYA 4TLAA 4EA9A 1ZGCA 1ZWLA 1ZJ4A 4LC9A 5JPCA 3FHOA 1UK9A 1K66A 3H4IA 1NJ6A 2HLDD 2PJDA 4CM5A 5BN4A 1J2EA 1T8UA 2WE7A 1CT9A 4GRIA 2QQFA 4C43A 4ZFNA 1MC5A 5AHKA 1S8AA 3EX7C 2JJYA 1QOZA 4LV8B 4Q39A 5LNK1 1M8PA 4Z8XA 3R76A 1TT5A 2RB4A 4OIMA 4XUEA 3E0XA 5J63A 3Q88A 4IINA 5HQ3B 2RAPA 2RBGA 2WJGA 3I8OA 5JZSA 3L8HA 4S1VA 1ILEA 3FGZA 3DT9A 1NM5A 3OQIB 3JTMA 5B1SA 4MH0R 2WJWA 3QUBA 3U17A 1M54A 1HKHA 1T29A 2BY4A 1TJNA 3PXBA 2CXTA 3NEAA 4TTTS 1D5CA 5IJ0A 4MPPA 3CTPA 4I36A 1L4NA 2O4UX 4BNTA 1LPOA 3FMGA 4Y9UA 1KBQA 4K03A 3KLPX 4MK4A 1O97D 1XHFA 4I8IA 4OFWA 4WV3A 3RYIB 1FNBA 1VDMA 1L5HA 3EGWA 2D5IA 2BONA 3SX2A 1BMTA 1FLVA 4YV1A 4HP8A 3TMYA 5CG2A 4CKWA 3GVPA 1P4GA 2DX7A 2I4MA 4O6VA 4DT1B 3RUHA 2Y67A 4PVDA 3C5EA 3H5WA 4YRJA 1XMQB 1WX1A 1PTKA 4QBGB 1OROA 2EFCB 3T0FA 4JSTA 2R7LA 5FTLA 3QX9A 2FW8A 1B6TA 1JF8A 3AF5A 2R7NA 1RQ7A 1XPOA 1NC3A 1XC7A 1RTTA 3X1MA 3UIEA 3QKSB 1OGJA 2PUHA 2VZ0A 4FT2A 3A9UA 3QWAA 3ER9A 1DJLA 1NXTA 1P2UA 4ZTBA 2VK8A 2G7ZA 4OXKA 4C5CA 1QCYA 2GTIA 2X1HA 3ETCA 4RGQA 2W48A 5DSXA 1IH8A 4ZO6A 2RGBA 2QM8A 2O57A 4CL0A 2ERCA 1IFXA 2PG3A 1G19A 1NATA 2HA5A 4PIVA 1NIJA 2O0MA 1X8JA 2IYYA 1EFVA 1HURA 1P9OA 3BN3A 3KS9A 2VYND 3V7WA 4BP3A 3PQEA 1EFAA 2CDCA 3D64A 4YROA 1HLGA 1S89A 1MPTA 3WWYA 1SQ5A 1YVEI 1OBOA 1UDAA 4EJ0A 3CURA 1QHHB 1RPNA 3EVAA 3IPXA 2BEKA 3N6RA 3NJ4A 3OIYA 4URFA 3G2MA 3VKFA 3WBJA 4CN9A 5BW5A 2Q1SA 2IUSA 1L8XA 3A4LA 3E3OA 1O6ZA 4QU0A 3T7DA 3COJA 1DMRA 2DBYA 2ZYUX 3GEIA 3TQHA 3WK5A 2AA3A 5CTJA 3ZLVA 1KDVA 4LGCA 4OHKA 1CJUC 1SUSA 4F7WA 3L46A 2GN6A 3JPYA 3SF8A 1KY2A 2WBLC 3T3MB 4WK4B 3RH0A 3HJCA 1ULAA 4IJ6A 2Q4BA 2XXAA 4DA9A 1WLSA 3CA8A 5LA6A 1IZ9A 2IYFA 3GLHB 3U1VA 3IIJA 3V42A 2QD3A 3KELA 5JNWA 1VJ5A 2QRNA 3L84A 1R00A 3VVCA 5L53A 5J23A 4FN4A 2TS1A 1XEWX 2O2JA 4IIGA 1X1QA 2VUSA 1CKEA 4RK4A 3WL5A 1F5NA 1JMKC 3TW0A 1A8PA 4L1KA 4Q15A 4FW8A 4LBWA 1E1QD 4M7PA 4UM8B 5IJ9B 4RLQA 1GAJA 3ZLUA 5JBQA 3WSVA 4MA0A 5FRDA 3ANYB 4BVLA 5GJVC 1HOXA 2FEMA 2ALJA 1DKUA 4IDBA 4KGZA 4ICIA 2IU3A 3ZE0B 5AVUA 1E3QA 1PK8A 5JSQA 2DXIA 1FFHA 4J2OA 1N5DA 5B5SA 2BFPA 4YMSA 4EAAA 2XY4A 3F71A 2JZOA 1RXVA 3AEKA 4TMKA 3X1DA 3SZMA 4CTMA 1CS0A 1LX7A 2Y2UA 4CCYB 3U7EB 4OHPA 2ZAGA 4CQMD 4BLTA 1ZJ5A 3L92A 1JH8A 4LXUA 4Q34A 2V55B 4HH3C 4MQMA 4BLRA 2QAJA 1NXWA 1JV2B 1ZNQO 5JR3A 1KFJB 2IV2X 3ZC3A 3KL4A 4LEIA 3V1LA 4F3TA 1JXAA 2ZIXB 2EFJA 3O31A 4NFLA 1QVWA 1G5PA 1PWHA 2Q2QA 3D7NA 3H5TA 1HYHA 2LIPA 3EG9A 4YQYA 3MLAA 1F60A 4KIJA 1OW3B 5LBUA 1Q3HA 4FEGA 1R0CA 2VPXA 4YC7A 5FCDA 3ER6A 3UAGA 2V6IA 1SVSA 1JKXA 4QXOA 2KE5A 4WD3A 2E4VA 1I7PA 2I8LA 1XOIA 2VHEA 1GNPA 4QOSA 3RVLA 4DM7A 3V80A 1V9CA 5KMGB 1S96A 1Z15A 2AEMA 3GLIA 3VX4A 3WLLA 1P4HA 4ZOCA 1DBIA 3RD5A 5IDQA 3IELA 1GUDA 1RCTE 3Q6MA 4PWYA 5AK6A 1F2UB 4J7UA 5TR9A 2GAAA 1F9EA 3VC1A 4C14A 2P69A 1ZK3A 5I7UA 1SH7A 1PT5A 3N6XA 1TF2A 3QELA 5LXTF 1Z5NA 4Q9IA 1FFDA 3MJSA 2ANBA 2H31A 5ALYA 3D8TA 3UMFA 4J16A 1Z4LA 2C8VA 3J80A 2BCJQ 1QF7A 3I37X 4QODA 2H0RA 1AE1A 2FGJA 4QGSA 3TSWA 1TW3A 1V3VA 3SXUB 4B7ZA 3KU1A 3JD1A 3CXRA 2KJQA 3D2LA 4YAOA 3WGQA 5JXJA 2ILVA 4A1OA 1RRMA 2REOA 3DMTC 1FY2A 2C88A 2B94A 4TWIA 2R0QC 1ABBA 3EWAA 4DV3B 1ZQ1A 2CL0X 2X9GA 1C9DB 4MQEA 4MYDA 1PAUA 1C9MA 1ULHA 3B82A 4LXIA 3SVLA 5EQDA 3I6BA 3JVDA 4IV0A 4WUVA 1DQSA 4UMEA 4E15A 3REQA 2Q5LA 1XMXA 2BHLA 3QKWA 4JEMA 4KVGA 3CVVA 1NUPA 2XUFA 2QL9A 4LBYA 2HIMA 4W6QA 5BPHA 4M3NA 1VZ2A 3QWFA 4R3UC 1XA3A 2IHBA 1DEHA 4C0KA 5AT1A 1DTWB 2LDBA 5TVGA 5AYVA 4PYLA 3QVKA 1D09A 1Y1LA 2D8AA 4IDEA 3U16A 5A6SB 1LDGA 1R5NA 5I8ZA 2WJYA 1NBOA 3FZGA 6NULA 1G9SA 1JRLA 4PHTA 4RMGA 5EN4A 1UKAA 4N39A 2WILA 2FK8A 4OH1A 1V95A 2VUTA 4BTEA 3S2FA 4YMHA 4MVCA 2WKQA 2AG0A 2CFRA 3W6NA 4IDFA 4YMUA 1J8QA 4X3CA 1MH1A 1IXZA 2PM8A 4XLTA 3T3HA 1F0YA 5JFOA 4X91A 5EJMA 4NJMA 4ALIA 2O1EA 3GLUA 2B3TA 2EKDA 4ZAWA 4EUKA 1DBPA 1N6KA 1BJRE 4JD5A 4WZBB 5CDYA 3RS8A 3X2SA 3UO8B 1BA3A 1LDBA 1JN0A 1NSFA 4NQRA 4QT0A 2HHJA 1B8NA 3UT5A 5D84A 5CA1B 2DHQA 3B20A 1L8QA 3PD1A 5HDBB 3SP1A 2VA8A 3IQZA 1U0LA 1GILA 5AI4A 3KYCA 2EERA 4K3VA 1VYTA 1SZPA 3PNOA 2GHQA 4TVBA 4HRYA 1IC6A 3V1TC 3M3PA 4ABTA 1YFJA 2QYHA 5EE3A 1COWD 1HE8B 2GZSA 3H18A 4HB3A 5IKOA 3L4JA 3GXOA 1U9YA 1FA9A 3RANA 3KKNA 5MF6A 2NXNA 2PX6A 4IRXA 4P86A 1MOPA 2DQ4A 5KNBA 4J03A 4PX9A 2FJ0A 5HF5A 5M2QA 3S29A 3FTQA 1H1LA 1EK2A 1T35A 2QU7A 4TKLA 3STHA 5FI1B 2PD6A 2X1LA 3EZYA 5I3ZA 2PR2A 5J5VA 2WNSA 2Q5IA 1MBZA 1P6XA 1UWLA 4X1IA 2OZLA 2IXTA 1XYGA 5A05A 1Y4ZA 4LI0A 4WZAA 3AGQA 2HSWA 1HG0A 3LT2A 4V0NA 4CLXA 3QI7A 3TCXB 3P26A 2YZGA 1JG1A 2J6BA 4LQ4A 4FSXA 1WSBA 4KU4A 2GBFA 3QOXA 3RS0A 3GPBA 3U4GA 3U48A 3SIRA 3T7JA 3ZQKA 2C95A 3ZWAA 1GPLA 5AK5A 3NUGA 4ERXA 4Q3CA 4R1MA 4WASA 3OZBA 1HE3A 4LE0A 2CL7X 4J2HA 1NBHA 5KNDA 1T5HX 5B58T 4P2BA 5L8VA 3IRUA 2DQSA 2ZR0A 4Y2YA 4WXEA 1II9A 1TL7C 1A97A 2NUAA 2DM6A 3RK4A 4JIGA 5KVVA 4ZK6A 1OX6A 3VDQA 1FPMA 3PFNA 4BO5A 4UE6A 1NLYA 3R0JA 3HWX1 3RYFB 4BWYA 4AJJA 3KYIB 2EWMA 3NNSA 1JDNA 4H7HA 4KWHA 2ZWPA 5LM3A 4FQ5A 4EM6A 5KPDA 4R1QA 5HP4A 3C5HA 3K5WA 4NCNA 2ZG6A 1RRCA 4N8SA 1YQGA 3SY8A 1O95D 2XH8A 1S2NA 3AVQA 4IIBA 1VL6A 1W29A 2C2MA 1J33A 2C42A 4Q01A 4HH0A 3I23A 4UBNA 5EPEA 4MJXA 4D7AA 3BRQA 4RY2A 1SEVA 2V7XA 4J0GA 5D3MB 3ZCRA 3UH1A 1FXWA 4DTIA 4FONA 2WMDA 3GRRA 1GT6A 1YI8A 1RJ9B 3TSAA 2PQ0A 1C2YA 3L0ZA 4OHYA 2WAAA 3HCRA 3OT1A 4RA6B 1M1YA 3DQZA 5CDGA 3GFGA 4MP6A 3KJNA 1RMTA 4ZHSA 2B8JA 3PDCA 5C51B 1I6LA 1XD2B 3LX4A 4PPNA 2HU5A 2EP5A 1J22A 4V2UA 2H11A 1ML3A 2XCTB 1S2MA 2RHOA 3CKLA 4LZNA 3EVEA 3FUXA 4LMAA 2W2OA 4QC2A 4QQNA 1C3JA 1XJWA 2OV2A 3QVLA 1ZJJA 2E4UA 4G4SP 3N9IA 4MLZA 3IURA 3PFBA 4B79A 4BNXA 5FUQA 5L3VA 4A36A 3NAZA 4LBVA 1J8MF 3IBFA 4Q48A 4MR8B 5TQVA 3RJ5A 2QP4A 3GLKA 3S0JA 3KDSE 5C18A 1NVWQ 1AS3A 1S2LA 4ZVQA 4KHZA 1ORRA 4FHFA 1VCMA 2G07A 1V7CA 2GA8A 3N58A 5KTYA 5KTTA 1WR8A 4LYHA 5IWAB 2V65A 4NCKA 5BN3B 3P9IA 4I5EA 4LYDA 3CF6R 4BZWA 5K3BA 3WKAA 3DTVA 1JU9A 2ZKLA 2GK7A 3MINB 1HT3A 4DIDA 4HWSA 1OV4A 2IUYA 3HJNA 3ROXA 3H99A 3HRIA 4ZK2A 5KNDH 3I9V6 2ORWA 4QQFA 1ZM7A 4OHBA 2R1ZA 2AF4C 4PCAA 3DCNA 3R6TA 3UK1A 3VO1A 5C1DA 1SQGA 5CFRA 4EAQA 3QMMA 5CB4B 1RZUA 1VCOA 4IDPA 3IJEB 2BBSA 1Z2OX 2XLBA 4NZMA 1TMKA 5E2IA 3X2FA 3PXCX 2CKMA 4YUWA 5CFQA 1N8TA 1DC6A 4II3A 1U1DA 2R7MA 3T5GA 1GYRA 4CEJA 1W46A 3BM5A 1KKUA 3R6WA 2NSLA 2A86A 2Y27A 3A70A 4GMKA 4JI5B 1NZDA 1GXSB 2XT9A 1DEKA 2I3GA 4B7UA 4C4XA 5I4KA 2FW7A 1XTVA 3JD0A 4PG6A 3GV0A 2QN3A 2X3FA 1HBJA 4REOA 2NN3C 1MAAA 1OU0A 5CDHA 4NZZA 1JQAA 2H2IA 4CR7A 1E77A 1XA4A 3REGA 2YOHA 1KO4A 2HBRA 3I5MA 1MO4A 3TXYA 2WIKA 1UBHS 4RY8A 2RHLA 3OQMA 5IAAA 2Y05A 4D5EA 1IHXA 1AQUA 4UUQA 1X15A 5FBWB 2C1XA 5FV4A 1BXZA 2J9FB 1E5DA 5JVDA 5HRUA 2YHSA 3LDAA 3ORRA 4RVOA 3ILSA 3ANSA 1U7WA 1A4UA 2C3OA 2G28A 2NZ8A 3A06A 3EVCA 1YXMA 4MQEB 3HXMA 3OQOA 3HY4A 2OVFA 2JW5A 4L7QA 5JBNA 3QE2A 4Y2VA 4MV9A 3B1KA 4RX1A 1JDVA 1CW2B 1TM7E 2IOFK 4R1LA 3G8BA 3SBEA 4XWKA 2XZOA 1NI5A 2DCMA 1Z5VA 4OJKA 4Z1MD 3I6ZA 1CUXA 3HZRA 2NTJA 5KO2A 1N0IA 4YBRA 4Z3KA 1KJWA 1PZMA 2NQTA 3DOJA 3HWWA 2JDIA 4G0PA 5DLPA 1J9GA 1I6KA 5JS2A 5K4GA 1A7AA 2WPDA 3L40A 4JKIA 5AKGA 1EVIA 2AFHB 2BFFB 3RAGA 4ETMA 5AIBA 2FEAA 3GCZA 1PVOA 2CLMB 1YQ9A 2XUAA 2VWQA 3DT8A 4F9GA 2P4SA 1CUAA 4LDJA 4AYWA 1SD2A 3MM4A 3ND6A 3NRCA 4IVNA 1LC0A 4MKGA 4B35A 4OH7A 4P54A 3B2QA 4HLUC 3NXSA 5AJHA 2ADOA 1JR4A 2WYUA 3R0IA 4FGLA 1DZ3A 1UOEA 2P3LA 4F4IA 1CNEA 4JXKA 1D4OA 1KZHA 1W85A 3QNUA 3TLXA 1VG8A 3DZIA 1E32A 4HD8A 4JCCA 5EIOA 1Z0IA 3ORYA 2BSQA 1YBAA 3N2NA 1QR2A 4B80A 2GRJA 5HK9A 4GL2A 2R6CA 5DT9A 4ZJZA 1U0JA 5ITZB 2VNHA 1B1CA 2AF3C 3K4QA 1RI1A 3P9NA 4IGAA 4YBZA 1S2IA 5B58C 4XTRA 5F2EA 5LQUA 2AYXA 4L6CA 2DPLA 4OVKA 5IXJA 1VJRA 5JAQA 3B3GA 4I81A 5IEBA 1SKAA 4U2DA 3R75A 2WWRA 9ABPA 4GAEA 3NCTA 521PA 1I4WA 4WNAB 3D3EA 4GH5A 2WJHA 2HRDA 4EJMA 3N5KA 4IHAA 1HPLA 3WGJA 1H4QA 5FWYA 2GN4A 1Z0JA 4TYPA 3WB1A 5JQGB 3OE7D 4UBIA 1PQWA 2HZBA 2FYTA 2QTBA 1LBIA 3HFSA 3MB8A 2I6QA 3MWEB 4LOLA 2QMUA 2I7XA 5HX7A 2FWIA 1XQWA 3A25A 5HCNA 3DUFB 1ZW1A 2PUTA 3P27A 2H2AA 5F7JA 4AKSA 3EIFA 1JIKA 3GBSA 4Y67A 1S1MA 1SRRA 3U3OA 3UXHA 4GG1A 1R9NA 3QA3E 1KVUA 4OBBA 4HMOA 2EJBA 1JJ7A 2R79A 1SC1A 3WLFA 1SOUA 4YRSA 5HZKA 5MHTA 2JGAA 3H7IA 2WJAA 4OLJA 4EUSA 4M6WA 121PA 3NOQA 1GEEA 2WJZB 1EJ6A 2XRMA 3E81A 2HDOA 3A10A 4FDUA 4JB2A 4OP3A 1DXOA 3CUTA 4PM4A 4RZHA 5HBGA 4NFSA 1PT7A 4J1SA 5CPFA 3DBOB 3Q4GA 1LXCA 1JAXA 4B84A 4OHUA 5L7WA 2XXAB 4FWIB 3CPEA 3VH4A 4UEWA 4H7EA 4W6ZA 4AKIA 1BE1A 1M6VA 4BGEA 4MUEA 3W4IA 2PMKA 2OCAA 1J2JA 2B99A 2J07A 5A03A 4GICA 3TJRA 4D3SA 5BVGA 4LJ4A 4RZ2A 1QE0A 1RZRA 2BM8A 5ARDA 5F78A 1BVRA 3LM8A 1NBIA 4GX0A 4KLRA 2AZTA 1AUOA 4UD6A 4XPIA 1FP7A 4LSMA 3WB2A 2QMYA 4GFDA 4M7WA 3VTFA 1EP1B 3VKWA 2ZUTA 2CXRA 3O8NA 3MTJA 1J2YA 2JJ2D 4IJ5A 1KEEA 4AF6A 5CM9C 4NHOA 4EARA 2JCSA 4KN6A 4LY0A 4GO1A 5FWNA 4G5HA 3M4ZA 2D5CA 2VRBA 4PLHA 2PLAA 4BATA 1ZXBA 4XUCA 3RC8A 3FYUC 1D7OA 3A2LA 3EWNA 2IHKA 2V9ZA 1U0FA 3ISTA 4U00A 2A9VA 1OAKA 1DL5A 4P35A 2GTHA 4QGHA 5M5BA 1AK9A 2H48A 1AZSC 3KPWA 1OLXB 3AETA 3BWBA 3QEMA 4WFQA 3U9TA 4W9NC 3E82A 2BKEA 4CF4A 4D0RA 5BVHA 1P1IA 2OC4A 4O2RA 1P7WA 1L4EA 3PXGA 1QONA 3F6EX 4NJOA 5D8DA 1XVLA 1D2NA 1QH8A 4GOJA 4L9RA 5AKIA 2XZDA 4WZAB 1EE9A 1MQ9A 1N3YA 4QJ5A 2IU0A 3WYGA 4Z53A 3E9QA 5IM4A 4CF5A 1XDDA 2CSXA 1AKUA 1Q44A 1W581 3UAZA 4Z9BA 2G17A 3AV3A 4NR0A 3MJTA 4OFXA 4ZIRB 1HNZB 1DWOA 3RSZA 2D1YA 1O0BA 2NU8B 5DX0A 2RONA 3PTLA 2ECOA 4N6NA 4RTQA 5G3YA 2Y1CA 1QG0A 2JJQA 1NPTO 2WJ4A 2HF8A 2JCBA 2VHZA 2X7XA 3VO9A 1Z33A 4MS4A 5BUSA 3NHJA 2QD1A 4D9HA 1BEEA 1CY8A 2R6HA 2R6ZA 3HFGA 4U5QA 1O6FA 4RE5A 4BAUA 2GAFA 1F8GA 4DZZA 3HUEA 4INZA 4CMIB 3OPVA 3T06B 1S8NA 2F3UA 1PFWA 2B8NA 5DYYA 1N0UA 2DQYA 1IBLB 4L3VA 4LV5B 3ZGZA 4ITVA 3SKYA 2AR0A 1QJCA 3ZCXA 1Z7GA 1PEYA 3IJ5A 4OQYA 5FBLB 1GG8A 1H23A 2NTNA 4FB5A 3NDJA 2GZ1A 2VDKB 4RABA 3FOFC 1ADJA 3Q7EA 3S40A 1R9JA 2C77A 5H4GA 8ATCA 1UKEA 3PJGA 4NARA 3HXPA 5J40A 1NFQA 1XJ0A 2CLHB 2ZUSA 2NT4A 4WCDA 1E6UA 2E4AA 2VJKA 1N57A 1RD4A 2HA0A 2VCYA 4J1QA 4JLOA 4I1PA 1MG5A 2R5FA 3MJRA 3OZWA 5ARCA 5P8WA 2V3CC 1V9SA 2EGUA 1ZSYA 3I09A 2SICE 2G0AA 2W71A 2HWYA 4LWQA 3DPSA 1JKJA 2ZDGA 5GQSA 3ZIAA 4QQRA 3L0CA 1OX4A 4IFEA 2ZVDA 4PSAA 1ZCFA 3TZLA 4CUZA 3UGJA 2QPTA 3O82A 2DRIA 5E1OA 1S3IA 2XQIA 4P31A 1NYRA 1QK5A 3WDMA 4WY2A 1BEZA 1U8UA 1GRVA 4LW8A 1GAWA 3S1LA 1L6RA 4K28A 4ND3A 3ROTA 3QKRB 2BOVA 5IK2A 2MWMA 3K0SA 3JQBA 1H2ZA 1QV7A 4HI0E 4Q3BA 4ND8B 3W4JA 1WEKA 3AI3A 4PGMA 1Q7RA 1ZNYA 5AW2A 2C5FA 3EW7A 1L4BA 4FFNA 2Q3DA 1AXGA 4RZIA 5FTKA 1UPTA 3FZNA 1QRSA 4U02A 3AJRA 2GJKA 3GGJA 3SQDA 3WWEA 2COUA 1MFPA 5IDWA 2XMPA 2JASA 3AZOA 4YUAA 3HM9A 4EG6A 2FVYA 4OK6A 5ALUA 2P9YA 3CWCA 1AX9A 1GR0A 3VOAA 3U5ZB 2IYQA 2KPOA 3DAOA 3EK2A 5EAIA 1QTQA 3FOAA 1UWCA 3IV9A 4RAQA 1WEHA 4XD2A 3RARA 3A1SA 3UXYA 4XRRA 4EFLA 3EDRA 3HK2A 1GGJA 1UDRA 1GA6A 2WIBA 3L6CA 2PBLA 3I61A 4EKDA 4KPEC 1NVEA 4QUDA 2R00A 4Q9DA 4OHOA 3REFA 2WJ6A 2OXTA 5IF3A 5KNBD 3OCVA 1WWKA 3PFKA 4RLSA 4E5YA 4F9TA 1EWVA 4YAJA 3IPAA 2ZRFA 2YJ6A 2HDWA 4UCQA 1ZJYA 3TQIA 4H6PA 5C5IA 2AMJA 3OJXA 4LTNA 1OFGA 3NJRA 4D97A 2JI6A 2VQ3A 3WBBA 1A5AB 3R23A 2IDKA 4PLVA 1HH4A 5E9AA 3ZKWB 2WMNB 5TMEA 5JAOA 3RO7A 2V1UA 1Q0UA 2VQDA 4LSWA 1LBEA 5KJ1A 5CH5A 1JKIA 5SV2A 3U26A 1XE3A 3I05A 3I72A 5KQRA 3WLKX 3UXEA 3QQPA 1PEAA 5EKDA 2EBWA 3MUNA 3QUSA 2CV2A 3PEWA 4WLFA 4KQXA 2J1LA 2GEVA 1N9GB 2CWDA 4U3JA 1H2YA 2XVMA 4OJMX 2BR4A 3SC2A 3NORA 4IFTA 1SB9A 4OOFA 1MDFA 2OHJA 2FWAA 2OP1A 1KL7A 1IQPA 2YIJA 4JLAA 5ALEA 4C01A 5BQ3A 1PFKA 4ZDWA 1G20E 3ZGLA 5C53B 1WP9A 1GM5A 4QGAA 1DQPA 1YASA 2NV2B 4UHJA 1I2DA 2GH1A 2IEBA 3F46A 3IUYA 3LC0A 4MI6A 4QGFA 4GGPA 5JYEA 1DDIA 4ALMA 2XT6A 4RANA 1X8LA 3EUAA 3FCEA 3WVNA 4TVSA 3C3DA 3TDMA 1N5RA 1T8SA 4ZZ1A 5TRTA 2N46A 3DL4A 1N7HA 4ZVUA 3L9WA 2VJMA 4KIWA 3VDMA 2EEPA 3OP4A 4DYHA 1V4NA 2BBOA 4Y6OA 4C6HA 2IEYA 3SYNA 9GPBA 1ZGAA 2ESRA 3T9FA