4OFBA

Crystal structure of human brca1 brct in complex with nonphosphopeptide inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
209
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Peptide Library Approach to Uncover Phosphomimetic Inhibitors of the BRCA1 C-Terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Breast cancer type 1 susceptibility protein
total genus 67
structure length 209
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4ofbA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4ofbA01
3PA6A 2AZMA 3K15A 3U3ZA 3HUFA 3L40A 2DUNA 3EF1A 3PC8A 2INGX 4BU1A 2NTEA 1CDZA 2E2WA 3K0KA 3T7KA 2XNKA 3QVGB 1KZYC 4N40A 2COUA 1GZHB 4ID3A 2EBUA 3K05A 3PXEA 1WF6A 4BMDA 3QVGA 4IFIA 3PXBA 4Y2GA 3I0NA 1T29A 3L46A 3K0HA 3SHVA 3HUEA 1L0BA 3FA2A 2R1ZA 1N5OX 3EF0A 1Y98A 3COJA 3UEOA 2D8MA 3SHTA 3SQDA 1T2UA 4IGKA 1T15A 1Z56C 3KTFA 2EBWA 4XQ0A 3PC8C 1L7BA 4JLUA 4XPZA 3AL2A 3T7IA 5ECGC 2HTFA 1JNXX 3OLCX 3PC7A 2VXCA 2COKA 2LE0A 2L42A 2ETXA 3K16A 3T7JA 2JW5A 1IN1A 3PXDA 3PC6A 2EP8A 2COEA 3L41A 4OFBA 4BU0A 3UENA 2WT8A 3II6X 3JVEA 4U4AA 3PXCX 1T2VA 3T1NA 2K6GA 2K7FA 1OQAA 4Y18A 4BMCA 2ADOA 3SZMA 3PD7A 3PXAA 2XNHA 2VXBA 3I0MA 2M2IA 3AL3A 1IMOA
chains in the Genus database with same CATH superfamily
3FVQA 2IV2X 1F2VA 3G0GA 3Q7SA 3BDVA 4LBYA 3G7NA 4Q12A 5KNCA 5BSWA 2ENUA 2G8LA 2ZVQX 4Q9AA 1ISFA 4X63A 5FF9A 3B9PA 4ALLA 2O8FA 4BB0A 2PGAA 5I9MA 3C3YA 2FU5C 2VP9A 2GR9A 1DX6A 2WG2A 4GLLA 2GK6A 3ONVA 2WHRA 4KQHA 3LC1O 1K3FA 3PKZA 1ZK3A 4RIHA 4CV3A 3W6ZA 2O1EA 1XZBA 4UZEA 4COKA 3V2UA 4W4TA 1WHSB 3FX2A 1P91A 3GBVA 1RLIA 4DIUA 4LDAA 3DOHA 1Y5LA 2IBMA 4Q3BA 4DYDA 4QYWA 3URMA 2XGOA 3RVMA 1BX0A 3NUZA 1NLYA 1R7RA 3PXXA 4JBLA 4MPTA 3WYGA 1VB3A 3ZU5A 1Y6GA 3FJOA 1SXJC 3GFBA 1GZ4A 3LCRA 5EE9A 1KOLA 5CA1B 3V4SA 1NJ5A 4WESB 5SV2A 3AF3A 3QUBA 4QGFA 2NXEA 3BRCA 3E15A 2NQTA 2FZ5A 5ITZA 3IB3A 3JQ9C 3K6RA 3FRJA 1YHNA 3QVGA 3B36A 3HV2A 4REQB 2ISSD 3DVSX 1A5BB 1DEAA 1Q1NA 5HDQA 3C87A 5B1HA 3LRTA 1D7OA 4GX5A 4AXXA 5E7JA 3EASA 1ZAYA 5IPFA 2QD4A 1PL8A 4Y2XA 4ML3A 5HIJA 1YULA 5IDYA 3ZK7A 4BP9A 1JHZA 2DHDA 3COVA 4MQMA 4RPLA 3P5BA 4NARA 5DYIA 1GY8A 3I9V1 1UAGA 2WHXA 1EG2A 3V1YA 4RFSB 3D0QA 1SMKA 1UM9A 1MIOB 1X1TA 1A9OA 1SRQA 2NUTA 3IJEB 2E7ZA 3V4LA 1H85A 3GLIE 2X0DA 3T3PB 2JLXA 4F93B 3NEAA 4FYWA 3ZY5A 4KN8A 1PD1A 2ZXFA 3QYJA 2I6UA 4Y9UA 3TNLA 1OJLA 4GI7A 5ALYA 1QZXA 5H3HA 4R51A 4TMZA 3SQWA 1Z33A 1WXFA 1ZA1A 4YGXB 3RUCA 4CT4B 5C1DA 2ZB8A 4LOIA 1ZJWA 4NJMA 1X7ZB 3HY4A 1JEAA 4M88A 1A8IA 1EHYA 2ZTLA 3BEOA 1JMVA 1Z5GA 1WY7A 4Q21A 3VNVA 1Q15A 1QIGA 4B9EA 3PR3A 3REQA 2BBWA 2F48A 3ABIA 2J0EA 2UVPA 3GP8A 1KBZA 4FSXA 1BNCA 4ETNA 3NBXX 3UVEA 2IWHA 3NNDA 2JLRA 4ONEA 3OPYA 4YDHB 1O96B 3UK7A 2DX7A 2A67A 1HM5A 4MVJI 3BXPA 5JDIC 4Y6PA 1RWKA 3PXCX 3K9GA 1S02A 1MPXA 1CY4A 2NV6A 1VL8A 2CYBA 2UYQA 3IQEA 1O9GA 3PQEA 2IYSA 5GV8A 1ODCA 3NT4A 4HYEA 3JAWA 2B4KA 4RQUA 2ZSBA 2HL6A 3FCCA 5AK3A 3OHMA 3TQHA 2GFIA 4WZAE 9ATCA 2EKLA 3FLMA 3QVJA 4NL4H 4TKUB 1BKDR 1P1CA 4RTLA 2QG4A 3A32A 4IV0A 3TNFA 4PE5B 4YRSA 4HDCA 3HKDB 4PLWA 2JIZA 5AW1A 1JLRA 4YRAA 2RBGA 1SELA 5K4GA 1FUEA 1AS3A 1N4DA 2POCA 1RC1A 3KXIA 3Q1LA 4WVFA 1RQXA 1Q6YA 1P7PA 4Y2QA 1ZW1A 4L08A 1OZAA 3UAVA 1IJEA 2PBZA 3VO1A 4LXYA 5C3MA 1CF4A 2RAPA 2RI6A 4RMNA 3VAYA 1C9MA 1XYVA 4LRSB 2YN0A 1P0QA 1ESDA 1UJNA 2QW0X 3DEHA 1K08A 3DLPX 3KYDA 4WT7A 4A10A 4BJHB 4UTVA 1MOPA 1I6WA 3E22B 1XHEA 3BA1A 1L5KA 4CFSA 4YK7A 3RC3A 3RIXA 3IJPA 3BSFA 1CJMA 1EGAA 3IBYA 4Q0MA 2IZ7A 4WJKB 4D9JA 3PSAA 2ZJ8A 1EP2B 2LCFA 5L3RA 2Z2KA 1KPIA 1TM1E 3VISA 1NF9A 2XB6A 1O0BA 1SCQA 5EIOA 3OFSA 2B78A 3B6EA 3MLAA 5J4HA 1OYWA 2I33A 3PDIB 4IG9A 4R0NA 2A8YA 4XW2A 3CZ5A 1ZQ1A 2COUA 2Q21A 1ZN9A 3Q3GE 2O2DA 3G2QA 2ZSKA 3T1YB 5GJVC 3WE7A 3ZQUA 5M29A 2BCEA 3E4DA 3DT9A 4MJXA 2ID7A 1FJGB 1G21B 4MW1A 5ED0A 2HJWA 5BSTA 1ZNZA 1CY0A 3QYFA 1WX1A 3T1TA 2W6OA 4KYTA 4BMNA 3OJWA 4M7RA 1TJNA 2WIGA 2DBQA 3KLBA 1ZI6A 4NH0A 4PTZA 4ZHQA 1M74A 4OI0A 2WM3A 2ECQA 3C8HA 4RK6A 1I33A 4HAIA 2PH7A 4DR7B 1BC5A 3KPVA 3QEMA 4WRRA 4G8DA 1A95A 1Y3FE 3GY0A 4R7TA 1EGVB 1KQOA 1OWPA 4IDBA 1I7QB 2CXOA 1QZTA 5AVQA 2NU8B 1VRCA 4L50A 3DHYA 5IMBA 4KREA 4Q34A 2HREA 1X6VA 1RKUA 3WB0A 4INJA 3QJ5A 5IVDA 4A73A 1QZ3A 1ZGCA 1R3UA 1U1IA 5CJ2A 1WUKS 4QEDA 2R60A 3IP6A 1JILA 4US2R 3PPIA 4WMLA 1S0UA 2MU1A 4WV3A 2QD1A 4CODB 2HK7A 3LECA 2A14A 3B1ZA 3TOVA 3U3JA 1Y89A 1NQ5A 2I29A 5DYYA 4NHEA 4RZQA 5HE8A 5IABA 4N7BA 3QVLA 3AG6A 3VHRA 1IXZA 2PQ6A 4H6XA 1BDBA 1EAMA 4JROA 1E89A 2NPOA 1MX5A 4AB1A 3HKBA 4B4KA 1LI5A 1U2PA 2F8TA 4IDNA 2H2HA 4ZO9A 1UMDA 2C04A 2VF8A 1QS0A 3FZNA 3I9NA 4V03A 4Q9JA 4XIGS 2YDYA 4E5MA 1DRKA 2BSXA 5DWQA 4WAUA 1G2OA 1JHUA 4GZMA 4I50F 1XJ5A 2A9KA 4EFLA 1TW3A 1FNCA 1P5RA 3CUKA 3D4PA 3QUSA 4FMCF 3FZEA 3VPBA 1CP2A 2F67A 4HMPA 1X7WB 4YI3A 3DWFA 4E70A 5C1PA 2CFOA 2YBEA 2O1SA 4ZAWA 3KQQA 5LP6C 3VR3A 5JUWA 1Z22A 4HQKA 4A1OA 3HVHA 4PZ9A 3TGWA 1QLJA 1U3WA 3RWMB 4IS3A 4CLOA 1CUDA 1P17A 1E5XA 3HADA 1FFGA 2WP0A 3L01A 2VIIA 2BHRA 3IKLA 3E8MA 4OA8A 5FPYA 4BNJA 5HZHA 5E4JA 3TOXA 5K0SA 4M1OA 4TSKA 5G0VA 1KZHA 4FHGA 4MVJE 1X9IA 1JXQA 2VTEA 3IE2A 3ENWA 1GU0A 1KK2A 3A6KA 3F3YA 4XB1A 3MN1A 3SAJA 1D4ZA 3LYHA 3W2TA 1BGWA 4ENWA 1TLTA 3ND5A 4RF3A 1CUJA 1IYZA 4KOAA 4B6SA 2CGEA 1YKSA 1E9FA 2QSYA 5F1YA 1KJNA 2IUUA 1IXSB 2Z5VA 1HDRA 1LRLA 1Z4PX 5IASA 1QGZA 2ZTSA 3DDCA 1WSWA 3PFNA 4U1RA 3DAOA 4B9AA 2XTJA 5FLYA 3WC4A 1DE0A 2R8PA 3HDVA 1J8VA 1F06A 5JS1A 2JL1A 2O3QA 4NEQA 1NV8A 4LWOA 4B73A 2MR5A 3BH6A 4M49A 4UAVA 4LIPD 5L9AA 1AKNA 1DMRA 2P3LA 4YONB 4I3HA 3MAJA 1WF6A 1KIMA 1E4VA 1MJHA 3CUYA 3HDJA 3GEGA 1GCOA 1H2FA 5GY7A 3BXGA 1YNSA 2FWNA 3UANA 4ENSA 1AN0A 2GCIA 3ILVA 4JBYA 2RGUA 1J90A 5H70A 1E7WA 2XCSB 1P0CA 4RVDA 5JCZA 1ZD3A 1M67A 4F46A 3ILXA 1QONA 2ASEA 3EY9A 3OX1A 1Q0HA 5CEJA 4ZYVA 5L7TA 3QTBA 4OUDA 5DNWA 2P9TA 1MU0A 4IF6A 1WO8A 3R7DA 2ARKA 2BGMA 3HCAA 2VDQB 1DAFA 3RVPA 3ZWWA 2ON6A 1V1MA 3LE8A 2H1VA 4OXNA 3WJ7A 4D9FA 1TT5A 5ADWA 1KSJA 4ZYYA 2CFRA 1IJKA 2IUFA 1H2ZA 2HJVA 4Y0VA 2Q6IA 3K0CC 2W2MA 2C5GA 5TJ9A 4FC7A 4MRVA 1QG0A 2YNMC 4NZNA 4WPGA 3FB4A 4GMKA 4RMHA 4YT5A 3Q98A 1NDHA 2JFWA 2KQUA 4U2DA 1PO7A 3SBOA 1G6KA 3T95A 3TDMA 4EG7A 2VNJA 3LGAA 4RACA 3BWCA 3JRNA 2ZRBA 5CJJA 3S2ZA 3EQ8A 1E4OA 5E1OA 4MGKR 1VL0A 2FUCA 2X8WA 2ZTVA 1EINA 1IEXA 3ORSA 1FMCA 4PPYA 3TD9A 5CITA 5EJ7A 4L76A 5KNCD 1NJGA 2HO4A 1RVDA 3PGKA 1FSGA 5K1ZA 2PZBA 2XE6A 4J3FA 2Q99A 5HJ2A 1P81A 3V46A 4HV4A 4Y8VA 2QUHA 4P9NA 4EKDA 4D4IA 3A70A 2Q2OA 4UD6A 5EWMB 3DW1X 4BFWA 3ETJA 3I32A 1SCKA 2UYGA 4W1RA 4XX0B 2W6JD 3OQ1A 1E1YA 3TL6A 1C9EA 3LC0A 3THXA 2V96A 4YXWD 3PDJA 3H4TA 3N6XA 4RTOA 2PJDA 2WC1A 3OURA 5A6VA 5HUHA 1Z35A 3NTOA 5HVNA 4N48A 4DUZB 2R3SA 1K3UB 2HZ7A 1R0XA 1V26A 1NRIA 2D0PB 2R62A 4OXYA 1DIHA 2HHLA 3CEPB 1I4TD 3T0FA 2OILA 1PJZA 1N3BA 4RPKA 5ILOA 2A5GA 2IY9A 4P7KA 2P9CA 1TE2A 2JGFA 2VRBA 3CXRA 4QGHA 1RJ9A 4F06A 3J7AC 2FPMA 4CNQA 4QZVA 2BWJA 1L5YA 1LNSA 4DDVA 2ZI4A 4N5LA 5F3DA 1SEPA 2PH1A 5AK4A 3U13A 4JOBA 3BICA 4PGHA 4AZVA 3FIJA 4HP8A 5L53A 4UBOA 1QZUA 1GD1O 1ZK2A 2JCGA 2JI6A 4NE7A 4UU1A 3DWIA 1F8GA 3RS5A 3I5UA 4U9IS 3CB2A 5D5HA 4YHBA 3AUYA 3WL6A 4WLVA 4D8YA 4IJWA 4Q05A 4EUFA 3QW4B 4Z3OA 1NKVA 5H16A 4DV1B 3KS9A 3EVTA 3LQYA 3MJDA 1DXHA 2G5PA 4ENUA 1PR9A 1VJGA 3HKCB 3ZNOA 3M7IA 2HF8A 1ZUNB 2GPYA 4CUJA 4D82A 4URZR 3G9TA 3HNOA 3R2JA 5CVJA 5A0TA 2FCRA 3NU1A 2D2IA 1TJ5A 1VKHA 8LDHA 4G81A 3NHBA 3C3EA 4B6JA 1KARA 1FMLA 3NTQA 4JR2A 4Q03A 4BQPA 5A4FS 4ER3A 1FMTA 2OYRA 1C1YA 2VXYA 2J9GA 1YDHA 3JTMA 4CMEC 1I4DD 4GP7A 4XFJA 4H0FA 3EXG1 1RC0A 3FHJA 1FFHA 2VI5A 3RIHA 1YI1A 3USCS 1W4BA 3Q7EA 3PDWA 4UPEA 1HT0A 2AGVA 2LZ0A 1V7PC 4UE3S 5H3CA 1GKKA 1TTHA 1AURA 3D3QA 3DTVD 2VDNB 2W2KA 1FLAA 5EESA 1DAMA 4QWWA 2YN4A 2J1LA 2NU7B 4E1VA 4JIGA 1ATZA 1JQBA 1EEHA 1NYLA 1P4SA 4B4VA 1TEVA 1OYVA 4ZVSA 4ZVUA 5DI3A 4PICA 1XAHA 4DRZA 4XEHA 4LRWA 2H5JA 4KNVA 1UP6A 4JLDA 4QBIA 4ZKEA 5BR7A 2BZ0A 3LCJA 1IZ0A 1OIXA 2HMSA 2ZSFA 3DWGA 3LY5A 3NWJA 4M0FA 1ZONA 4NFSA 1C3LA 3L7BA 1IUKA 5E2AA 3DDOA 3WK7A 2IU4A 3HYSA 5ECGC 4N5MA 3FTNA 3O0TA 1B0ZA 4ZT5A 2UZ1A 1PT6A 1U9CA 3HDYA 4KR2A 4E5DA 1YC5A 2HRBA 3HGQA 4M21A 1RACA 5ARCA 3S27A 2GZRA 1MC8A 4CM4A 5JD6A 1RYHA 5JXGA 3KKZA 2Z5FA 1HTBA 2A57A 3IILA 2ZQZA 3OF3A 3IKVA 4RCZA 3VU9A 5JMTA 2Y8EA 2Q0QA 1LTHR 4GUAA 3H8SA 5BOSB 1QFJA 5CB0A 1L5WA 4C3ZA 2RE8A 4NZ9A 2ZUVA 3DOCA 5T3UA 4KPFC 2WIJA 3CE9A 4XUGB 1E6MA 5E6UA 5FTJA 5JMPA 2Z83A 2J31A 5AJXA 2Y1OA 3OWOA 4WXMA 3GDHA 1QYVA 2E4VA 1NVGA 3TFQA 1OWLA 3B12A 4LVNA 4ECEA 1SEVA 4BBJA 1ZY2A 3KCQA 1CHNA 2ZBPA 3MWJA 3P9QA 4MIEA 2ODEA 1C0IA 2QHXA 3KB1A 4G0OA 1FYWA 1EFVB 3F5MA 3CRZA 4ETIA 1QVRA 4YR9A 4J0QA 1HH4A 2PZAA 3CR3C 2EQAA 1RRVA 2GN8A 4NDAA 2W2OA 3IOBA 3TRHA 4JJZA 3UMCA 1DFIA 2EF0A 4HKTA 4GVPA 3S2GA 2C4NA 3QBJA 4D81A 2NIPA 5ULLA 1YVRA 4ZOCA 3EBLA 1BXGA 3GLSA 2B9EA 2H6EA 2AKYA 5H4HA 3KQOA 4Y1RA 3N3BC 4PO1A 4W7SA 2AI3A 4O4LB 3G2KA 2VZ8A 1V1RB 1OBVA 1B16A 3PQDA 4AZ3A 2CEAA 4A6EA 4C4PA 5IX8A 3MOIA 3QVUA 3CRW1 4FS8A 5A02A 1HE3A 1W8IA 1N2SA 3D31A 3QY9A 2HPVA 3DL0A 4CQLA 3IVGA 1JBKA 5EZ6B 1DVRA 2DPYA 4Y98A 3UJ8A 3WQHA 1KO4A 2PT6A 2IY7A 2QX6A 3PGVA 3N6VA 3R0XA 4RK7A 1D6JA 3RFTA 4DCUA 5L95A 4MDEA 1BH2A 1LZLA 2G88A 5C8DA 4IYJA 5LUBA 3TLCA 3CF4A 4US0R 2DUWA 1G8HA 2VRNA 1ZK0A 2YR0A 3N5CA 4WZAA 3WNBA 3D8TA 2X0NA 4PXAA 5HPYB 3LT5A 3VHQA 5M2QA 1QC5A 2JIQA 2Q6TA 3GGJA 3QLUA 1V8PA 3A37A 3E1KA 2GK4A 5LJIA 4HLUC 4MJ7A 4XWWA 3KDAA 2AMLA 3WL5A 1RPZA 1CRQA 2HPAA 4ER0A 3UNXA 3F8WA 2PAFA 3FTDA 4DCSA 2HFKA 3RTAA 4DF3A 3OTOB 2O0LA 5JFGA 3DFZA 3PGXA 1FRZA 1GGVA 1OBFO 2Z8XA 2DE0X 4G36A 4GPD1 1RJWA 1U2GA 1GNTA 3E0XA 3EAFA 3PUKA 1I1NA 1PR2A 5E1DA 1XTSA 2I7DA 2DFNA 4BJ3A 2AOTB 2G4LA 2IEAA 2QN3A 4KPGA 1JKFA 2GI4A 3THOA 4P80A 1OAKA 1Z34A 4BTEA 1G3QA 3PDUA 3BILA 4UAUA 4NI5A 3V8NA 4EGAA 1ADCA 3KTFA 4P93A 3O91A 3OZUA 5BN4A 2YVUA 4O6VA 3H9EO 4ZU1X 5CFNA 3HXQA 5CVCA 1XMIA 5CYPA 2ZWMA 4GXTA 4G85A 3ZBPA 3JWGA 1YL6A 3Q5GA 2MINA 4LYHA 4FQ7A 3P9KA 1OR8A 4RA9A 2A9VA 4AULA 3S29A 2I4TA 3KEQA 3DAHA 3RSOA 1ZSYA 4INPA 1KI1A 1RHQA 3QUQA 5IU6A 4Q01A 4F4IA 2EP7A 2W71A 2HFJA 4HN9A 1M0EA 1EUCB 5HFNA 3PQ3A 3FNQA 3PE4A 2EWMA 3KKNA 2EAUA 2F1JA 3BK2A 1WEKA 5YASA 1KYVA 3SC4A 1MR3F 1NIPA 3NPMA 5F1PA 1PFGA 1XA3A 1VDMA 3E7FA 3HCPA 2F6RA 4H27A 4I14A 4PNPA 2WMOB 1K8QA 1DO0A 5H9WA 2PNJA 1EE2A 4ZVPA 5A6SB 4DM4A 3RF7A 4ZI7B 3ED1A 3RV3A 3ZOKA 1ISJA 3BFKA 1P1HA 2C0CA 4N7JA 1AKMA 1DSSG 2YZMA 5HEKA 4BLRA 2IEDA 2IXAA 3UMJA 2QNRA 4Q66C 4EDHA 4EHKA 1W5SA 2PG3A 3WGTA 1PUXA 4MR9B 4C22A 3DMRA 2GKGA 2I4IA 4Q9NA 3IVRA 1C3VA 5AUPB 1FX0B 1MV5A 2QN8A 2IP2A 2A5DA 2QY6A 1JBEA 4ITRC 5TS3A 2VHJA 4Z9FA 1QK4A 5B2ZA 3DEJA 2RH4A 3H2GA 2AMFA 4KIGA 3B3AA 3E27A 5GPBA 2P6NA 5DVZA 4YECA 3BZBA 4TWJA 4Z99A 4E4YA 3I2JA 2H11A 4A23A 1T5LA 4IDDA 1VRWA 3NHAA 4M6WB 3GA5A 2P78A 5BV2P 1GKIA 4E03A 1HYBA 2OV3A 4LEIA 4KB5A 2DUMA 3IUBA 1NQVA 1ZVKA 2ZBFA 1CZNA 3FPHA 1FRQA 4JIMA 1KAQA 4CT0A 1P2DA 4DR2B 2XUJA 4MYTA 2ATXA 1KMNA 5MDHA 2ZYAA 4J03A 5CURA 1W88B 1CDDA 1AKEA 4ND7A 1UXGA 3IBCA 3BWEA 3KDPA 3L05A 1Z68A 3Q7QA 1A9XA 1NQOA 5I9TA 3IH5A 3NW9A 4MUIA 4LC1A 1AK1A 1FSPA 2O3RA 1UKBA 1YFKA 2D7CA 3I6IA 3O47A 3SYKA 4BZZA 3IE1A 4AWXA 2WZQA 3GRRA 2ILVA 1JJIA 2WFLA 3RJMA 1N7JA 3K0AB 2CZGA 4MAMA 4OLBA 5EKTA 3BYZA 1PJ4A 4ND1A 2RG7A 3OVMA 4BEVA 1NRXA 2OHGA 2WE7A 4HWSA 3Q7PA 1WB5A 1GN9A 4DMFA 1GKLA 4I6EA 3KQYA 5FWXB 2X1LA 5EHNA 3TX6A 1HQCA 2FP4A 2JGAA 1C7QA 1USVA 3NC4A 4NE9A 1Y1PA 3NVAA 1HRDA 5BMOA 4YHHB 3DHEA 2CZQA 1OROA 3GP5A 1ISHA 3KK0A 1VPDA 5AVXA 4W5TA 3CKKA 4MV9A 4XCVA 4JX9A 4RQAA 3TTSA 3U7EB 1FDTA 1UOPA 3L6RA 2Q5CA 1QJ4A 2W8BB 4JAVC 4AKHA 1U7XA 4FK8A 4BEJA 1W0KD 4N0DA 1GA1A 2ZVPX 3OE7A 1XDUA 5C7IO 4P3PA 2PL3A 4Q39A 4TQUS 5BW5A 5C5IA 2E4UA 5KJ1A 4AJIA 4FINA 3NLLA 2XB4A 3MTQA 2CDCA 2WWXA 3NBQA 2QEQA 3LBNA 3AH8A 2BH9A 3DE1X 5JTUA 4AP9A 3I62A 3ESDA 2W4IA 4LS3A 3AVYA 1MW9X 4D9NA 4HAYA 2BISA 4RWZA 3WLLA 3H1FA 3AETA 3GUVA 4YDSA 3ZYZA 4GECA 1NZFA 5EHXA 5JFOA 1PBTA 2M98A 1KEEB 3PNLA 3VR0A 3B52X 4CV2A 4D0NA 5AOVA 3PTLA 3HSKA 3L8ZA 5D6OA 4X8MA 4FLFA 3AB7A 4PPNA 1OQAA 1VYTA 1XTTA 5E4FA 4TYYA 1L4YA 2NZXA 2AT1A 3FNFA 3R0JA 4FOLA 4G4SP 4KQEA 3MGCA 2AI1A 4CIVA 5DN6A 1EFDN 2R8ZA 3AZOA 2XXJA 3W5HA 4E22A 5FIUA 5KVSA 4FBLA 4RGYA 3I0MA 4ZJUA 2QLFA 3SR4A 5FFFA 1ESNA 1A69A 2GEUA 5FHQA 3C8UA 1CS0A 4E12A 5KMGB 4B0PA 4FWTA 4MWCA 1GARA 1DBSA 4KXQA 2Z6UA 5E9QA 2C54A 1CIVA 2HAEA 2XUZA 4HN2A 3VNBA 2PR7A 5FA6A 3ZU3A 2FYTA 3K0FA 3SQOA 5KQSA 5HQ3B 1L8OA 3GROA 4PZEA 1NU8A 1F0NA 2OO3A 2VRCD 4FFMA 1N2JA 3VH1A 1NW9B 2Q3JA 4XX0A 5E9AA 5H9VA 3SHOA 3RS0A 2ZRNA 5FOWA 1YOVB 1USWA 5GINE 1RP1A 5FOTA 4IY1A 2GHQA 4M0EA 2W00A 3RTEA 4TMYA 2X5KO 3OCZA 2K2WA 1L4EA 3I5YA 2O19A 5CDFE 2AJ8A 3RSGA 2BZSA 3LPDA 2B99A 3JATB 1DX9A 3T41A 2O2ZA 3R5JA 3PUJA 4UDXX 2ROQA 3AKDA 3RLIA 1LRKA 1DAOA 2X5JO 1M7HA 3WIDA 1HDZA 2OWDA 1H5QA 2VUSA 3S6JA 3DDNA 4MRRA 1U3CA 1Z6XA 1WHTB 1WCIB 2IOFA 1EUCA 1MB0A 4P3XA 4W6ZA 3B8HA 1R6DA 1SXIA 1DEHA 2RK3A 3LUGA 1DT5A 1SU8A 1A5SB 4IIGA 4WFQA 3FOZA 4U7DA 1KVUA 1TCBA 1K0UA 3NBFA 4W5OA 1Y9AA 1TI7A 1N0WA 1CVIA 1E6CA 1Z8DA 4PZ0A 5DH9A 1NXVA 4OYRA 2ZYRA 2QDKA 2EKDA 2VK1A 3IPLA 4ZI7F 4EJ2A 1P7VA 4QYTA 1JEEA 4R0VA 2CB0A 1EIZA 2BM9A 1OYOA 4ZI3A 3EG9B 3N5KA 5F78A 1Y80A 3ZUPA 1RRCA 1RQRA 2GN4A 2ZJFA 2X8BA 4WA7A 2OKGA 1J42A 3FR7A 3FZGA 3MJEA 4GZ5A 2PD3A 2GN9A 1C3OA 4HXEB 4CN9A 4DYVA 5IMSA 1AUOA 3RC2A 4QC2A 2AOTA 4KEAA 4RTNA 3P9XA 1JIVA 2A9RA 3CINA 4GH5A 3IO3A 4P4TA 4LF9B 4YO7A 2PZMA 4ERXA 3WL4A 5HRCA 3JRWA 2X6RA 3AUSA 4BUCA 3U6KA 3AM5A 2O2GA 5AHRA 3PE3A 3VYVA 4D92A 3DLHA 3AR5A 3S0JA 1DZ3A 2ZYIA 1EZZA 3UYKA 4RTPA 3CGGA 3EVDA 4JUAA 1GKUB 2HU7A 5AKZA 2P2NA 2PH3A 3II6X 4GI5A 4J2HA 3KU1A 2FKNA 4LHYA 3UA3A 1RLUA 1WTAA 4BNYA 2ZSUA 3GEHA 4RE5A 2GAJA 1ZDMA 3CZCA 5DHSA 4EHAA 4K6GA 1NUAA 3MLEA 1C3JA 5HF5A 4EARA 2BEJA 3G6KA 2PRJA 3NG1A 4RV4A 3T1NA 1AV7A 3PJFA 3VHLB 1NN0A 3SE0A 3ZE1B 4BO6A 4C6HA 5I01A 4U7TB 4XWTA 2H0AA 1G41A 5JPCA 5EHZA 5CTAA 3CLUD 2CXXA 1WXXA 2JGMA 1X86B 1XZKA 2EDAA 4UEQA 3WHKA 4ANFA 2V54A 3E5HA 3CX3A 2O0MA 2XR1A 4S3MA 3W8FA 3C3CA 5KUTA 3B3FA 1KTIA 4CIXA 3HDGA 2HU5A 2XF8A 1PP4A 3A2NA 2R2AA 1HETA 1SKYB 3KL2A 3TW0A 4E2YA 1DPGA 5CG2A 3UGQA 3AY7A 2X1HA 4MR7B 3O7MA 2MHCA 4RYLA 4FD2A 4TTTS 1WDTA 1JRLA 4ZAVA 4IOLA 4AWAA 4Z9BA 1SN7A 4GD3Q 2X7XA 2H63A 4NICA 4RJIA 2ATCA 3VR4D 4B17A 4TOIA 1CV2A 1L6IA 4BU1A 4D80A 5BYAA 2W11A 1N32B 2XLCA 3LK6A 1HYQA 3N0XA 4IO0A 3CCFA 2E2WA 3FLBA 2FGJA 4M60A 1VDZA 1IIBA 1HDIA 5FWYB 3UXHA 3I6QA 4MW7A 1FFWA 1KZGB 2BFBB 4BQNA 4RC9A 5J2TF 3B5IA 4ESVA 1Z8FA 2R25B 1BXKA 2AFHA 3ID6C 3UJ3X 1N0UA 2Q3LA 2CVPA 4RO0A 2AOUA 3X1JA 4CQMA 2FW7A 4WA8A 4Z54A 4GPIB 4L73A 3ZWPA 4GBED 1EZ1A 3VJRA 1FX1A 3A0RB 2A4MA 1LPOA 5LMUB 3ZVKA 2CJFA 1M8PA 3NM5A 3UCXA 4P4UA 2J7PD 3FSGD 4PX9A 5CK4A 2PIAA 3EISA 3QMPA 3NOOA 4UFOA 4ZAYA 4NR0A 5M7EA 4BV3A 2UXBB 2XIQA 4P0QB 1RXIA 5AKYA 3MA0A 4POAA 1I2AA 5LR6A 1QIHA 4WK4B 4HEA6 3UB4A 3L1HA 3O8QB 3NVKI 1R0ZA 2AXEA 1S8OA 2QSZA 2DT5A 3AT1A 4KSBA 5I9LA 3T4XA 1QH8B 1C9DB 1D4OA 5AW9A 3X2EA 5HOEA 5JAZA 5BRAA 2H29A 3EIOA 1EFRA 3RTCA 3H6GA 1TVEA 2O7NA 3QFFA 3V2GA 1XQYA 1CJSA 1Q5PA 1U1GA 2H57A 2CEKA 4QXPA 2PX2A 3L2OB 4L5JA 4OLJA 3QVSA 4HGZA 1DDGA 5ALOA 1RADA 1T15A 1O4WA 2C5BA 2R96A 5K8JB 2D5CA 1YIAA 4CV0A 2O7VA 2D5IA 5I7VA 4S05A 2OGTA 3WYBA 1JQ5A 2FUEA 2IEYA 2W6MA 4HQNA 1NUUA 2WM9B 3R3ZA 2H1FA 4HL6A 4S35A 5JD4A 2HIAA 1G21A 3OZAA 5EE1A 4BVBA 2HMAA 3WYDA 4F71A 1M2HA 2FTKE 2G6TA 4H3SA 2PS3A 3KOYA 4MS1A 2PUFA 3H5AA 3AV0B 3ICWA 3RS4A 2PS9A 1FSZA 1QTQA 5JD3A 4RD2A 2VJBA 4MHOA 4W1PA 3I9KA 2LWIA 1ZWKA 3NATA 3QPBA 5G3YA 1GRQA 4JC5A 4GW3A 4YY3B 2QP3A 4G5SA 1NQUA 1Y81A 1ZN7A 5C5CA 4QX6A 4PNHA 2C2OA 4Z2AA 2ZBUA 4MMXB 4YCAA 4AG6A 4J9VA 3EWAA 2ZB2A 3ZH2A 1WMAA 2NVWA 1U7WA 3AM4A 3NCHA 4R8LA 4UQPA 2VSNA 2AC7A 3B6MA 4V2IA 4Z4CA 4X20A 2ZG6A 4DCMA 1GXSA 1P4JA 2AMVA 5KYYB 4CIAA 5F9FA 3QWIA 5BV1A 4MWEA 2AN4A 2OPHA 2IPMA 4AWBA 4BP1A 2XUQA 1QRDA 2B83A 2RHRA 5C18A 4HFJA 5CIYA 3TXYA 3QE2A 4NX2A 1ZGHA 2X86A 5TGTA 3D2CA 3X44A 4J91A 4C9BA 9LDTA 2W8BA 4LJKA 4FJ1A 5E7MA 4XLTA 4I6JA 5KTPA 1ZJ6A 2YOGA 1UODA 2XNJA 3NJ8A 1FFXB 2BFEB 1B1AA 1GU7A 5AICA 2QSJA 2O14A 3FPEA 1HRKA 3CSSA 2Y76A 5JANA 1B6RA 1QWOA 5UKDA 3DTYA 1ECBA 3E9NA 3TZQA 3WBJA 4ZRNA 2R6CA 4WE3A 3T7KA 3LOPA 2OB2A 1W96A 4JKOA 1T3HA 3C1OA 3GEDA 4OGWA 4RF5A 5E4TA 1N7GA 1YRWA 1GG5A 2RAUA 3PENA 3TKAA 2AX4A 3IAFA 3TGLA 3CUTA 3FTEA 2IU3A 3QX8A 2ERXA 4LN1A 1KZ6A 3FFXA 5FFNA 2F4VB 1SD5A 1XL0A 3GDGA 4C30A 1YQUA 2FSFA 3UYLA 4A2WA 4AKIA 2DULA 3QP9A 3ESXA 3NM6B 3SXUB 1PRYA 4TTVA 4X65B 1MJGM 5K3SA 3ZV3A 1SR8A 2B3TA 2G3YA 1AKQA 2ZXEA 3NANA 2EFYA 3F5DA 3KU4A 1XZFA 4WY5A 4WZBB 4YCBA 4M1TA 1N0IA 3L46A 1Q2XA 3M2PA 4C4OA 3ROPA 4OU4A 4R1TA 4D56A 3BJEA 5FLXA 2APJA 1JIQA 2D7JA 2VEDA 1NXSA 1K63A 1RWPA 3QKSB 3I5MA 3RVDA 2AC2A 2B8NA 3EZ2A 1Q6ZA 4YRLA 3K9WA 4OM7A 4R05A 4ES6A 3QKTA 4BUZA 4KXMA 4HQ6A 2WAYA 1E92A 2DHEA 3FWKA 3WDSA 2HTEA 4LYJA 4M9XA 2OGUA 5LWQA 1VMIA 4YTEA 4J4TA 4BZWA 1M6EX 1M7GA 4KFRA 3CMMA 1I7NA 3ILSA 3JQ8A 3LT4A 3PQCA 4GR9A 3IIJA 1IHOA 1UDCA 2AZ4A 1AKYA 2WTNA 3NUQA 4KDCA 4MV4A 4PZLA 3M83A 1TEHA 5FWDA 5G4KA 4ZEXA 5C0OE 3JQBA 2FPXA 3A4TA 5TMBA 5HKBA 2ZRPA 1TKCA 1FQKA 4BGIA 2HX1A 4Q4JA 1M0WA 3OZDA 1VM6A 1GFZA 1Z0KA 4BO5A 2VBIA 2YRXA 3CR8A 4KXUA 4PFKA 5A6SA 1MRSA 5EP1A 3ON5A 1YQWA 5AP9A 4YUVA 2QXUA 2WAOA 5J40A 2ZJBA 1UOEA 3EG5A 4MS4B 4Q7MB 5KVQA 5ESXA 2JLUA 4NCBA 1GNVA 3WA6A 1E2HA 5F7OA 2H1SA 2IW3A 3ZDZB 1AHHA 3O9ZA 1HT3A 2FEKA 2P4SA 4PYQA 4W8OA 3FYTA 4E6PA 2O8CB 4CV1A 1Z8HA 2RKWA 3K5WA 3S5JA 2OD7A 2R9VA 1S89A 3I0ZA 3NV9A 1KH3A 2FEMA 3GD5A 3W3AA 4PYRA 3DBIA 4JBIA 3OEWA 2ZE8A 4MRSA 4RWEA 4CIDA 4ZK2A 1JDUA 4K9OA 3FZQA 2GWRA 2JAHA 3E3AA 3PCTA 4ZPJA 5AW7A 1RYNA 5AQEA 3WQSB 1C1XB 5AFSA 1U2QA 5C80A 2E37A 4EGJA 1OHHA 2Y77A 3CH6A 1XEFA 4URWR 2O8FB 1NAIA 4D02A 2C97A 2ZRHA 3CO5A 1W47A 2A1UA 2UAGA 1FZTA 2FSSA 1G8AA 1YMUA 2QQGA 3C1TA 3D9QX 1LJUA 3VPFA 2O1XA 3K2QA 5AOAA 3SZ3A 4F9EA 1ULTA 2R1TB 1E79D 5ESDA 4R0MA 3BGDA 4M54A 1VJTA 3E2MA 3EZNA 2WPNA 3BWBA 3ZHQA 1PS8A 1RQLA 2IHNA 5SY4A 3DDUA 4D4JA 1YVDA 3ENVA 2WPDA 3JVIA 2PWZA 4AMYA 1E18A 3ZXXA 3D59A 3B1WA 4AD8A 5JAPA 2IV3A 1W85A 3RS2A 2BE7A 4MSUA 4EKYA 3CNQS 1J07A 3HNRA 4DNPA 1SCAA 2D5AA 1CYDA 3EDOA 1M1NB 3UAZA 4PC1A 2GYYA 3MJSA 4UNRA 1SQ0A 1W93A 2YW2A 3BJMA 3W1EA 2W98A 4D4HA 3IAS1 3OAAD 4N01A 1O94A 4IVPA 3VSEA 4IJKA 2ZUTA 2ZAOA 1JVBA 2AW3A 3VZCA 1EXMA 2H52A 3GH1A 6ABPA 2R6GA 2Z2XA 3AJDA 3AFIA 5KU7A 4DXHA 2BI4A 2CVHA 2XNCA 1ODLA 3ROGA 2ORED 1T3ZA 4G8JA 1F20A 1IB0A 1U9JA 3QPCA 4JXKA 3D4NA 5CIQA 3L0PA 3ZK9A 1WHTA 3QPAA 1CQPA 1ZOPA 4OO3A 1G3IA 3OIDA 1LPNA 3QBVA 1LU9A 1FBNA 2EBFX 3SDBA 4BGEA 2H48A 1UT8A 1FRVA 5ICMA 4HB4A 2Z4RA 1AQIA 3KO8A 5EXSA 2V5VA 3BJRA 5IJ9B 3N2YA 4QUGA 4E5SA 2H85A 1U1CA 1NNSA 3Q0TA 3C43A 1QHGA 1WCYA 2HKIA 3ODPA 2YUIA 4OHZA 2M1XA 4TWZA 5D7BA 1RYDA 3Q0IA 4J29A 1W4CA 2JHGA 2J5XA 4R98A 5GV7A 5LIRA 1EP3B 4RD0A 1B0PA 4FDVA 4WDRA 1NI3A 4M8IA 1CJUC 2FDCA 3LVRE 4RF2A 5IZ4A 3KAQA 3HJAA 5IDWA 1V5EA 4W9MC 5AKHA 3HVRA 3ZLJA 2QW1A 2QBYA 3IR5A 4NMLA 3U7HB 1XCLA 2P5TB 1S3SA 3DZGA 3DOEA 4O0MA 3IDAA 5JHHB 4C5CA 3L6EA 2L2QA 2OP1A 5LMZA 5DM2A 2ZS8A 2WDPA 1X1DA 2QV7A 3CY6A 5EE5B 4DRXA 3K53A 3IX7A 4LZLA 4RVCA 3NT2A 3RF6A 2P2DA 3REOA 1NJSA 3OTGA 1PKXA 3LLSA 3OQNA 2I99A 4KL8S 4ZQCB 2JIPA 3ND7A 4EY5A 3WYEA 2I34A 1N2OA 1DS6A 1U8YA 2EZTA 3JZAA 4MVJD 4ZOEA 4LQDA 3JY6A 3OIWA 3I2GA 4LQLA 3VC2A 1EX7A 3KUXA 4KQJA 3MMXA 2F1KA 2A7QA 4B80A 3EQ6A 3U9LA 1TO6A 1NFRA 2X13A 3OZTA 4YUYA 1ZITA 3WMWA 3H9UA 3QHAA 1F4VA 2Z3ZA 3B2NA 2UZ1B 4F3TA 1XC7A 4BDTA 1LLCA 3OFKA 1Y4SA 1TRKA 5M3BA 3Q8KA 5B57C 3MRVA 3AFOA 4M86A 4QJBA 1ML4A 3BH0A 5DM4A 1NM5C 1YQTA 5GMOA 5CR9A 2VHZA 1KMIY 2WJIA 4QYIA 1DC3A 2GM3A 4PPGA 2XUFA 4BO4A 3QU2A 4CLDA 3FRHA 1YTLA 3E7WA 4Z1MA 4CKCA 4EFNA 5JQGA 2ZZMA 1E9DA 2JAWA 3L4BA 3BB1A 3NH6A 4OREX 4D3XA 2JFQA 1Z74A 1LFAA 1X3SA 4UZFA 2XWSA 2V8OA 2J9FA 1QC5B 4WOPA 1M8KA 4AMZA 6LDHA 1AXEA 1H2HA 5HJ7A 3AVQA 3OQBA 3W8EA 1PSWA 1YZYA 1H4TA 1SY7A 3HCEA 5HFJA 3G49A 2ORYA 4G97A 5IK2A 4H4EA 4KAXA 2ZYUX 4OU5A 3TWOA 4IFIA 4H4DA 1G7RA 2IHKA 4R9VA 2LKCA 1V5GA 4GMGA 1W0CA 4HY3A 2XHEA 3GL9A 3HVJA 1IM8A 1J4AA 3PPXA 2OCPA 4IWNA 2HGZA 1LSJA 1WPXA 3GIDA 3RCBA 4M9SA 4Z2YA 2YWCA 1BZYA 2IITA 2W6NA 3MBIA 3HO6A 1W25A 4I3GA 2WR8A 4LBWA 3A6ZA 1QZZA 1RABA 1TQ8A 3LBIA 4GYJA 3IMCA 3B3QA 4FLMA 1C5KA 3IHLA 1NBHA 3PHBE 4I4NA 3FTCA 4N9WA 5FHRA 1WLSA 2H65A 5D3MB 1MNQA 3SC2B 3TOZA 1F0PA 4BXOA 2ZP1A 4V1CB 1YB6A 3C7DB 1NX6A 1NOIA 2OA0A 4LTMA 1MB2A 5LXTB 2P4EA 1P9NA 2ZI7A 3HMKA 1BIFA 1PHRA 2GK7A 3WHPA 2YHIB 4OX9B 1I2CA 3D0OA 5THKA 4BP3A 2QAJA 2COKA 5IVKA 2A88A 3GLHB 3T4EA 3QU5A 3LQQA 4A15A 4E5KA 2X5XA 1UBKS 4KWHA 1C3EA 2QYHA 4FEEA 4TQAA 1XF9A 4XFDA 4ER6A 1J33A 3T3MB 1B3BA 1CQJA 1FFAA 1E2IA 4XR9A 1DU4A 3ICOA 3KWFA 4UU0A 1RQ7A 1PNTA 1W73A 4RKEA 4D3YA 5BNWA 2ZJ5A 3O5AA 1DAIA 3DCYA 5JS6A 3GELA 4LJ8A 1IU9A 1VP9A 4PG4A 3EEOA 4WZBA 4I8DA 3UJHA 3GB9A 4XM1A 4ZYUA 1KY4A 2REQB 3SZGA 2PU5A 4TV9A 1K75A 2QR3A 5JAMA 1AQJA 2R87A 4RELA 1AQNA 4FYXA 1U2SA 5AHWA 1QB8A 4Y0NA 5KYNA 5ECDA 4QVGA 4RQTA 4TLMB 3ZDFA 1E0JA 1ZEMA 3GUZA 3DQZA 4OL0A 4OTZA 3OPYI 3QQ5A 1Z6AA 3WGOA 5CT6A 1ZMOA 1WR8A 2J08A 3IP1A 2XCOA 2D2FA 5HE9A 3QI2A 3OEHA 1JHAA 4GL2A 5DSZA 1YDGA 2IE8A 3C3AA 3RTBA 4TGLA 1G3MA 3JALB 2A0WA 4LYAA 1E8MA 3LKVA 1ZM3A 1DP4A 3NKFA 2VUTA 3LX8A 1I4WA 3T1QA 3QUTA 1KU0A 5IANA 5DGDA 1S4QA 4KQXA 1F60A 1PTKA 1KJZA 3CRQA 1E2DA 3V32A 2FWPA 1JG1A 4MUAA 5JCOA 2ZVJA 4RSGA 4N5IX 4NFYA 3RJZA 4ZT4A 1E0KA 2WYVA 3A9VA 2NSHA 3FDXA 2CLDX 5IH3A 3WGZA 2MWMA 1AO3A 1V8OA 2OGWA 2YRFA 3I09A 2IYTA 4LF7B 4UMEA 2NU6A 4G26A 1WKBA 5DIFA 3Q7RA 5KBYA 4DV0B 2QGNA 2GRAA 3QXSA 4UTZA 3TSOA 3GRCA 2Q4DA 3BB4A 3IMGA 3D2BA 4JSRA 2VSXA 1QK5A 1WP4A 2GN6A 4XYEA 4HUJA 4X20B 2Z09A 4O59O 2PJRA 2G40A 1G8PA 3EA0A 3NBAA 2GKSA 5ALGA 5SYNA 2C98A 4ZZ3A 3KSMA 3OH8A 1W0JD 4M0DA 1N5MA 3BX1A 3DMPA 4IBOA 1UT6A 5DMXA 1F2UA 4EFKA 1H6AA 2P91A 2R4QA 2ADMA 2WJGA 1C0EA 4BECA 3RK0A 1POWA 4IRUB 3WL3A 4DAEA 1OTXA 1EFTA 1CUWA 5I4BA 4MR8A 1C1HA 3TPFA 5KYVA 3VZRA 1YKGA 3N9IA 4R9RA 3PQ5A 3LPLA 4S12A 1EGHA 1H4SA 4JJFA 1L1FA 4I99A 4DTCA 2QT9A 3NEYA 2C1XA 3Q88A 4YFVA 1LBSA 3ZWOA 1E2NA 3OTWA 1QYCA 5H0IA 3M2TA 5IBQA 5AVSA 4NV3A 1IJFA 4OATA 4H7IA 5LB4A 1DCFA 4O8ZA 1JR4A 1ONPA 3T3OA 2HMWA 4AG5A 3FKQA 1TA0A 1ND6A 1T4MA 4ZXFA 1BHO1 1N6LA 2OK8A 2DR3A 1WE2A 1E3TA 2PS0A 3A3PA 3G2OA 2VPQA 3QLJA 2MYNA 2DH6A 3JQDA 2H9AA 4B3SB 4JGBA 2IHUA 2VWPA 3TDNA 1DLIA 4QNRA 3ZXIA 1WPGA 4ROTA 1PI3A 4O33A 3HB1A 1MDFA 5ALFA 2PA0A 2L69A 5HRAA 2QP4A 2XDQA 2B61A 3VH4A 1NBMA 4PIVA 3GHYA 4G1EB 4EHDA 3T1HB 3FYUA 3H1BA 4CFZA 1ONNA 3KBBA 5K7SA 5CVUA 3JZDA 1U6KA 4UPVA 4B84A 3PC7A 1JX6A 2I8CA 5LDDC 4KQ1A 4XVUA 4TKVB 4FZVA 4CR8A 4AZSA 2C2KA 5CT5A 3GEMA 4FNOA 4M9RA 1Z13A 4KXNA 3KQLA 3OT1B 3CH5A 3OOSA 4DCVA 2N47A 4D9CA 4JCOA 1FVXA 2ID4A 3GEEA 2O6HA 3VBEA 4BU0A 3UQZA 3L6CA 3D81A 2IYYA 2P27A 5EZSA 5TF0A 1ZN2A 4RV5A 4PHCA 1SUWA 2EL7A 2W6CX 4K8RB 4NTZA 4RPCA 2EFHB 1QYIA 4OL9A 1GP2A 3JQ8B 1JBQA 3ESZA 4MDHA 1BXRB 3SXJA 1DLJA 2W2TA 3A1DA 3TS1A 5I45A 3V1UA 4FW9A 2GXAA 13PKA 1GSAA 4KAAA 4MQUA 2BEKA 4WX2B 1LS6A 4S1NA 1E32A 4B40A 1P3Y1 3UWPA 4GQIA 1R4NB 5ALRA 1XROA 2HK9A 1VHDA 1X7YA 4M8KA 4TMXA 3UH1A 3W2FA 1RHRA 3GN1A 3PIDA 3BCSA 1VMAA 4M1EA 3JATA 4LSWA 4Q7EA 4QGBA 4WK0B 4MCAA 3WWYA 2JLBA 2QLNA 1FW6A 5E3JA 5A9SA 1U8EA 3PFBA 4TZTA 1KBOA 1OI7A 1E6KA 2HSGA 4FKBA 3E9RA 2O1WA 3FUUA 4X7MA 1U2ZA 3KKMA 5KJ6A 1A50B 1Z17A 1SUIA 3OQ6A 1QBKC 2PD6A 4I1RA 4RJJA 1K6JA 3I1JA 4HAWA 3T9FA 3PJGA 4E1BA 3SXUA 3C15C 2VZEA 1E2LA 5H82A 3WFZA 1P1BA 2H5LA 3ROEA 4DJDC 1FDVA 4YMLA 2A33A 5IAJA 1XMXA 2HSZA 3C8DA 1OCEA 2AZDA 3EODA 3GU3A 4FFPA 1RXCA 3DCJA 1Z6QA 4EMUA 2P2ZA 2SECE 4MGYR 4OGLA 4RKWA 5LJLA 4RULA 1ZCBA 1QQBA 2X9LA 4Q7KA 4UFPA 2JJQA 2V6BA 3B7WA 2R1VB 4C7JA 5BUQA 2JLCA 5K0GA 4X6YA 4DMRA 2R7KA 3GG9A 4PAGA 4HGQA 4ROSA 1ORTA 4NRDA 4H59A 5IJWA 1U8UA 4HAUA 5THQA 2NXNA 3B1YA 2Y4NA 2YV4A 2JZNA 2ZATA 4RKFA 2J87A 3OCCA 3JW8A 4ISBA 4RY0A 1TTQB 2HMYB 1A9ZA 3PKIA 3C1AA 4J7XA 3LFTA 1KPHA 2BEWA 3RHZA 3PSHA 4O4IF 1IWBB 1RZUA 3NJRA 1KAMA 1BWPA 3RRBA 2W2KB 2GEJA 5TLSA 2IKSA 1O3YA 4LV6A 4WY8A 1ENOA 4OK6A 4P58A 4PCUA 3IRVA 3VR4A 4C4RA 4TZ0A 1A82A 4JKYA 4AW9A 4AJOA 2PK3A 4F4UA 4AY2A 2BMEA 2HCBA 5J5CA 1W1IA 3AUTA 4C3OB 1EK5A 4NNOA 4DHEA 4IHAA 3RC9A 3X43A 3JSAA 2W43A 3V00A 2P5SA 2ZUSA 2Y0EA 2FR0A 1W1UA 1GFWA 1UZLA 2EJCA 3ML1A 2CVQA 4RDIA 2EATA 3GF4A 1JU3A 3FJ1A 4JP5A 5E2IA 4C03A 1OBHA 4L4RA 4PM4A 4H1TA 1JE1A 1KVQA 3FOEC 1VSQA 4YUZA 1RXUA 2FLWA 4LWQA 3S68A 1O5IA 5KOYA 3NVDA 3EEBA 1PK9A 2VK2A 1EFHA 4BCDA 4AY6A 2HC9A 3VPDA 1BJRE 3NI2A 3E2IA 1Y7TA 2G71A 4XGRA 4YCCA 3QLVC 1MG5A 1TGYA 1I10A 2J5BA 3O93A 4B85A 4Y30A 3KUCA 5E0KB 2FUKA 4RXTA 5EMKA 4YAUA 4CQNA 3LA8A 3OAAA 4YROA 1EU1A 3RSHA 1Y1KE 1YJXA 2VHEA 1XGKA 3EDRA 4MV1A 2PKCA 3T38A 3VKGA 2Z57A 4YRDA 1S01A 4NBNA 2QQEA 3U2QA 2WJ3A 1GCIA 1Y4DE 3WGMA 4M9ZA 5AMXA 1IONA 3ZR4B 2QVBA 3HPQA 3L1IA 4QA9A 3WIUA 1BVUA 4F96A 3PF8A 1TW2A 3OPMA 4EFDA 2I3DA 4GLFA 3AWIA 3PT5A 4RD4A 4AS1A 2AN5A 1KWGA 2ETVA 1FUIA 1OX5A 1RJDA 1Z2DA 2L0XA 4JQCA 2VDWA 5EQFA 1JG3A 4RAQA 3NP7A 2AHRA 5NULA 1K7EB 2X4LA 1M72A 4E3WA 4YP5A 3PHJA 3DLTA 2JFVA 3UJ6A 2RGXA 2WQ7A 1CR2A 5BSGA 1ZUIA 2QQ0A 3TB4A 4B3XA 3RBXA 2Q3MA 5C8ZA 4F5EA 3NTRA 1GNRA 4ZVRA 5CLFA 2C2MA 2EX1A 3HYNA 1XYGA 4NFHA 2X2EA 2HJRA 4PR3A 2DETA 2IELA 4GVXA 4GI1A 4BZQA 3F6BX 3HCNA 1ZVMA 4HVTA 4C29A 2P2SA 2R6R1 4ZEWA 1AHNA 2JLWA 2I0FA 2Q6KA 4CTMA 3O1JC 1ZRSA 4D42A 2EJUA 1UMKA 1ZUHA 3PF9A 1H66A 5T57A 5ICEA 1GCUA 4OXRA 4BLOA 1BCSB 2ZJ2A 4PZYA 2C03A 4KO2S 5F64A 1XQ6A 2B6NA 3NHRA 4QUEA 3D8SA 4KU4A 4RM2A 3K0KA 3MXTA 1TO1E 5LLTA 5FBQB 2R6HA 4IJQA 4INZA 3TZEA 2YMLA 4JDPA 1BDIA 4TN5A 3CRRA 4R69A 1G4UR 2VWHA 3JD4A 4IX9A 1PJRA 2QUJA 2VZ9A 4KGZA 3SC2A 5BYJA 5JT1A 4QFDA 1RXSA 4I1YA 3BB3A 3HJBA 1UFRA 5JSYA 1T1EA 2ZULA 1VLVA 3BFXA 3OZIA 4XARA 4YRGA 1FQWA 2HCFA 1CETA 2VSOA 1RYZA 2VF7A 3STTA 3E2PA 1MAVA 1OXBB 5B6JA 5IT5A 1ECFA 2QYSA 4QRIA 4HTFB 5KYTA 1CERA 4EQZA 2D4HA 1EAYA 1NVWQ 1K7CA 2FMIA 4LNAA 2YICA 5JCJA 1PR6A 3CONA 4A26A 3TINA 3K70C 2JFZA 1LD3A 1BEZA 3ZE7A 1YF3A 4HVAA 4KUEA 8ABPA 3W5CA 5JJLA 3LUKA 4G5RA 1H94A 4TTAA 4QGGA 4AO7A 5LXTF 2BGTA 3O4RA 3HUUA 4R2HA 1X1BA 1KAEA 1T36B 1XZHA 3AHIA 4J94A 4QAQA 1P1FA 2AUMA 4JP8A 2Q5QA 2QYOA 3ZTWA 2QL6A 3S4YA 2CV1A 2ZDGA 2VN8A 4P33A 1R8JA 4ZDWA 3L1VA 3RFCA 4GOND 2O05A 3OHSX 1TKBA 3C6KA 4EJFA 4G9GA 1GCAA 1YB7A 1QRRA 2J07A 1ODKA 3D4IA 3N2IA 4ZALA 1VG9B 1PTJC 3BGWA 4PZPA 4BNWA 3RNOA 3PICA 4BQFA 2GZHA 2FX5A 3DUWA 2CFCA 5FV7A 4MAAA 1YDMA 3H4VA 3KFXA 4GMFA 3WIVA 1ZR2A 1L7AA 1T35A 3M4NA 3MHTA 3TQCA 2QN6A 1H42A 1SU7A 1V9LA 4GM0A 3UJ9A 3GLIB 3T9EA 1CF2O 4JJ8A 3T7SA 3TSAA 2QXTA 4O25A 4C0AC 4UDYX 2WWHA 3EC7A 5KX5F 4K9MA 2FF5A 1JTEA 4XDHA 1FLDA 1WPQA 1KORA 4H4CA 2GBCA 1K5GA 3MGKA 1K27A 2NU9A 4F72A 1IBMB 1CW2B 3TD2A 3EH1A 3K4PA 3BORA 4GS5A 3V4RA 2X42A 3S7TA 5CAEB 3IUQA 4RU1A 4BO1A 4D5EA 5EOVA 4BFZA 5EMLA 2KWIA 1Y4UA 2VBCA 1LPAB 3VR1A 3VSCA 5IK2D 1GO2A 3L7IA 1KI9A 1W1WA 1VSUA 1WUTA 3DCIA 3DF7A 1XPUA 4DC1A 1GQQA 1I6LA 4MKXA 3QEOA 2DOKA 1MB9A 3VHXB 5ITVA 4DIEA 1VPTA 1XV5A 2NZVG 3RRNA 2C2YA 3HLYA 3JQFC 2G9NA 4C6TB 3LKBA 1J56A 2XVMA 2RC5A 4FE3A 2B3DA 2BBOA 1FNNA 3QITA 4QICA 2E48A 1HDYA 5JALA 1OT3A 3VDNB 4HMQA 2WJVA 4S0ZA 3VR5D 1J5PA 1VG8A 3CZMA 5I9IA 4JYPA 4M1MA 3CYFA 3MINA 4FUTA 2YIMA 2YZNA 3HLTA 3P0RA 3GDFA 1C8LA 2O8BA 2PXHA 2VTKA 1X1RA 3INGA 2VJMB 3JALA 1VPEA 4DQDA 1AH2A 2GCPA 3ZHXA 2O8CA 2ODWA 3U3ZA 5JU6A 2C8JA 3FOWA 2IIBA 1VKNA 3Q6NA 1HNNA 2DUUA 4FMBB 3PFHA 2MDTA 1QVWA 3IP8A 3LF1A 3PNMA 3MNFA 2XMCA 4KQWA 1RHKA 4LJAA 4ME6A 5BT8A 1XD9A 2J0VA 4HDMA 5ECWA 2P3SA 4NEHB 2OLEA 1JHYA 3LHKA 3UCFA 4DLTA 5A2QA 4EHLA 4FX2A 1PE0A 3ZV5A 4O1IA 1GN8A 3D5QA 5D3ZA 2AEJA 2W83A 3EMVA 3EXG2 5KTOA 3VFDA 2OAP1 3L7LA 2IEIA 2OV2A 4YMUA 5KSOA 5TR9A 3C3XA 3WOVA 1SHUX 3QNWA 1HE4A 1L4BA 4UM5A 5ELMA 5L51A 1AY0A 1JHRA 1Y6RA 3SYTA 1W44A 5GVRA 5CA1A 1MAUA 3C24A 1CQJB 2JK0A 4Y2YA 5HQ3A 3AVUA 1R0CA 2VJOA 1W36C 2HRZA 4BWVA 4XR4A 4BS9A 4EA9A 4LHEA 4ENPA 2FSHA 3L49A 3HCCA 5DYNA 2FMKA 4C2TA 5FR2A 2WPDD 4H17A 4LOKA 4MI9A 2I22A 4NS4A 3WIBA 3ZGOA 1AUQA 1ORDA 5AJVB 4Z9YA 1JIUA 4IXWA 5CGQB 3NDBB 1G20E 4HZUA 1WMDA 1AE1A 1KE1A 2AVDA 4QYSA 4BTVA 7ADHA 4H16A 3SHWA 3SYMA 3EQ7A 1SXJE 3O38A 4Y9TA 1Y5IA 4J0HA 5ALQA 1FS5A 3W5SA 3L06A 3TO5A 1HE8B 1HE5A 1NVEA 4YQYA 4X91A 3T7EA 4IDHA 1DEKA 3BC1A 4TL7A 4MWZA 1Y8CA 3H1EA 2I1VB 5JFTA 1FDOA 3IPXA 2RGAA 3LFHA 4B3DA 1NT4A 2VJLA 3ASZA 1U0LA 5LKRA 5B58C 2I2BA 3GJXC 2VNSA 3U40A 4HLNA 3SJBA 4DR6B 3FNEA 5FUVA 3UOAB 3AETB 3W7AA 3WAKA 3DZBA 1XCGB 5MHTA 5EE3A 3W90A 3S28A 7REQA 4CM5A 4UC0A 1SH7A 1U0RA 5ALWA 1U7PA 4IMJB 3IXLA 3MJ4A 3EPRA 3PYMA 1UPXA 2OLJA 3RABA 3AF2A 1JV2B 3PXDA 1LPBB 3HBFA 5KNLA 3TDKA 1T13A 5AVTA 3QK7A 3A3NA 5F2EA 5FORA 3OA2A 4CFYA 5B1YA 4OBEA 3UAOA 2CV2A 4MRMB 4LUCA 2ATVA 2ECFA 5GGXA 4RNDB 4HX2A 3STUA 2BJWA 3N8NA 3HB4X 1NOKA 3KWMA 3OUZA 2QN1A 1QQ7A 4OJYA 4YJHA 1REQB 2HA0A 1BMQA 4J43A 4F38A 2P2CA 2Q28A 2WSSD 5FI1B 1ZM2A 1E9SA 1Z7EA 4JSYA 5CFMA 1L7EA 1LX6A 2VDUE 2W6IA 5FYQA 5KOHA 3DMYA 2PR2A 3CRNA 3QEBZ 1QJCA 5JTTA 3IT0A 4CDMA 5E6SB 4MTLA 2H2DA 2XBLA 3D02A 3BL5A 3M5PA 1OKKA 3WP1B 4OK5A 1U0FA 5CDHA 3I2FA 2CHUA 2HD4A 3I6BA 5BURA 3K31A 3UK6A 4BNLA 1A2QA 1IDN1 1DGQA 3OIVA 5AO9A 4KGXA 4YP1A 4HAZA 4B87A 3EF1A 5DN9A 4J8PA 4ND5A 4BBPA 1KFKB 4TS3A 1JHQA 2GBLC 4DANA 3FYUC 2HJ9A 3VJLA 1TJYA 2VDVE 1GQOA 4I3FA 3OKFA 2VWGA 3CPSA 2Q2VA 3I3OA 1YQGA 3P9YA 2CFSA 5AWFC 3SI7A 5DLQC 4FNAA 3OOJA 3C3PA 1G9TA 2B0JA 3DLIA 4LGYA 1YVUA 4C0QC 2JGJA 1G6Q1 2D1SA 4NZOA 521PA 1HC7A 1MCZA 1R6TA 2WINI 3S99A 4RVHA 1UEXC 3SDSA 2YIDA 5HA5A 3EGEA 1VLMA 1F2TB 2J4CA 2WWRA 1CQZA 1XUOA 1KOGA 4KHPB 1A71A 1T26A 1KEUA 2XQVA 2RHWA 3IAM6 4W1QA 3UV6A 2D7DA 4OJQA 3KT6A 3A9WA 4PCAA 4DBLE 3FMVA 4FB5A 1URPA 1J5EB 2WW8A 3VBCA 1TU3A 2E1RA 1GZUA 2XMRA 3A6JA 3H5TA 1G8JA 5EFOA 3QKRA 2GAAA 4PVDA 4CGYA 5HJEA 1RKBA 1MGOA 2XADA 1QR2A 1QGDA 3AOGA 3CVJA 3JYNA 4RHFA 1R6BX 1TZCA 1MO4A 2NUPA 2VZ0A 4MROA 1GEGA 2XKBA 1HYEA 2NO5A 2V7BA 3JCZA 3KQWA 4EUEA 4FIZA 1S2IA 3EIUA 4MYUA 4MLCA 1L1RA 4MPJA 1V8FA 1YUMA 2VPXA 3PNKA 1QFMA 4GOKA 4X45A 3ZDBA 1H5NA 3QIVA 4GPEA 2JJ8A 2XRYA 2WP8J 4C1NA 1YFJA 1BQ3A 3KEGA 1P2SA 1DKMA 2F59A 2VJAA 4K9NA 2PMEA 4BOYA 5LQRA 1OGYA 1EMDA 3U7GA 2KSQA 4RJLA 1EX9A 1L7BA 4W5RA 1KI8A 3I6ZA 4E94A 4PSCA 1OC4A 3CSUA 3LPAA 1TM5E 3MINB 3CF2A 2BDUA 4RDXA 1DOZA 1NBME 5K4AA 5FWYA 1UBFA 2C9MA 3QLTA 3A4VA 1L5ZA 1NURA 3GXOA 1VGVA 2BFEA 5C8XA 2PBFA 2V3VA 3PHIA 1OWMA 4ARCA 4I55B 2AE1A 1R88A 3Q41A 1QHIA 3T7JA 3SS8A 1PQ4A 3YASA 3HEAA 4CEIA 3SJAA 3MTAA 4FDLA 2BD0A 3O9MA 2ZRJA 4DJEC 4RLFA 2FEXA 3KJEA 3OJEA 2Q1WA 4BVHA 1H0SA 1YS4A 3DNPA 3Q3JB 3AKCA 2IYVA 1QXSA 3QOXA 4N7RA 5GONA 2HOQA 5TEVA 3WBKA 2ZRFA 4HJRA 4L8VA 1UP4A 2KBEA 3O0DA 4DNFA 3RC8A 3QFCA 3O3NB 3K09A 4N3CA 3WLEA 3CVOA 4R2JA 4WKNA 5KREA 5JYCA 5A06A 1MTZA 2RBEA 2PX5A 2YYAA 3L92A 4X8HA 2P68A 2I8LA 3O4GA 5F21A 4L7VA 1JQJC 4C07A 5J1TB 2IH2A 1ZMXA 2FZKA 3AUFA 3MIIA 3HKCA 3L3BA 5B7NA 1ZFNA 3HXOA 4H7KA 5MFZA 3U61B 1R00A 1XCPA 2HK6A 2JFHA 3NIFB 1KJJA 3CVUA 2CF6A 4ZCLA 5KWEA 4YV1A 5FBKA 4ZREA 3IUSA 5GADl 4EMSA 1XXHA 3E7DA 3Q3VA 1QP8A 4UVIA 4YLGA 2ZYSA 5JNVA 5K8IA 3CLRC 3WTCA 1G9SA 4ZEMA 2AXPA 2O2JA 2ZJ0A 4PYLA 2Z43A 4EY6A 1XQXA 3A4MA 4IX1A 3BK1A 4LFAB 1E1LA 5SYMA 3A8TA 3GA7A 3IPRA 2GWHA 5C4MA 1MC4A 1NN1A 1DPFA 4HNGA 2HRQA 1Z73A 4MUFA 2Q4RA 4N12A 1N3IA 5KC9A 3R8CA 1D03A 4BKOA 3BMQA 2V98A 3LS2A 4DGSA 3DDSA 1I24A 2FUG1 4GEGA 1KGDA 1LJLA 2O5VA 6REQB 1CUFA 4UCXA 5AD1A 1QU2A 3OCWA 1S5PA 3F7NA 3QNUA 4L8LA 3OEHD 1U3GA 1IAQA 3OJCA 1W2GA 2OO5C 4BNKA 2JVJA 2FW8A 4JK3A 4HC4A 3SM3A 4EUSA 1RM5A 1R18A 2I2CA 2GBFA 1M1UA 4OHPA 1L5RA 4G25A 4YRNA 1QG2A 1X39A 2GN0A 1BGVA 1PL0A 4NCKA 1Z2AA 4EECA 5ENVA 1K98A 1U3UA 4J0JA 1IN7A 1EWTA 5HP4A 1HEUA 1WG8A 2QRHA 3M8KA 1M83A 4PIMA 1K88A 3PUZA 1RE1A 1YRHA 2Z30A 4Q7LA 1TF7A 2OZPA 3MTBA 2GF2A 2YIJA 4DTIA 3B6KA 2JI8A 3KOWA 1VI6A 2XVYA 1GGNA 5JS8A 4G84A 4EPXA 2NVOA 2EHJA 5T4HA 1SKQA 2ZQYA 1FQJA 4DV3B 4JJEA 1UFVA 3R76A 2XJ9A 3RWOA 1O8CA 2OCXA 4MV5A 4MA0A 4EENA 5A03A 4TYQA 2O7RA 3TSZA 5JSKA 3VMMA 3RVKA 2X3UA 2ZUUA 2WAMA 4DIBA 2IZ0A 1L7QA 2GPJA 3U3MA 2XVZA 1S2GA 3FFAA 4MYSA 3RG2A 3IEUA 3EXEB 2EKPA 5KTSA 2NO6A 3G8DA 3LY7A 1UIMA 3G8AA 4J1TA 4NCHA 2NUAB 1U1DA 4OHFA 2JGNA 3GZNA 1M1XB 1X7HA 1UMCB 1XZCA 3WV5A 4BVAA 4IIEA 5BW4A 4DV6B 5ILGA 4EZBA 3OIGA 4Q1VA 2ZCJA 1OAAA 2G08A 3R9IA 1R0SA 2G5TA 3OZ7A 3WRYC 3HZOA 5MGBA 1KQGA 2L42A 3TYXA 4OUDB 1PEDA 2ZDQA 1Z75A 3NWEA 1E61A 1WSAA 2A3NA 4MVJG 1YR1A 3HP7A 1BS1A 5DGCA 4DMKA 4PGMA 1NTOA 3UXMA 2HXSA 3RYIA 2JGEA 5TDHA 1PIWA 3C2QA 3AJRA 2WWTA 4MMYB 1Y1QA 2VDWB 3AF5A 4LE2A 2HYIC 3Q8MA 4DMHA 4YACA 5EPUA 2GBGA 1W5EA 2HMUA 4MYHA 1HQDA 4PCVA 1KS9A 3HA7A 3DTTA 4HATA 1KH2A 4G07A 4E6EA 4BP8A 4P54A 3C8MA 3AYZB 3BA6A 4JU9A 4KXFB 1V5IA 4KRGA 2ZE7A 4HUQA 4AURA 4BQQA 4CL8A 1KYTA 3CUUA 4XSHA 3ST7A 1PNQA 1J09A 1VJCA 3FPJA 4HWOA 2ZBRA 3P4UA 5JCXA 1QNLA 1DEOA 4LAFA 5JAHA 1I3OA 3H1PA 2C8LA 1RQGA 3EVNA 4Q18A 5D01A 4I1IA 2FETA 5DNAA 4XTCS 1TUIA 1BN6A 2P9HA 1TAGA 2X41A 2XQIA 2CL5A 4EVQA 4RJ2A 2VQEB 2XTAA 3W6NA 2OVFA 4PGAA 3FM9A 4J0FA 5EN4A 1HKUA 5E8JA 2FRDC 1PYDA 2VP6A 2N9UA 2QWXA 3FDFA 1LBEA 1DO8A 3EQ2A 1H8EA 1NX9A 1LS1A 2R1UA 2FHSA 2ZT8A 3WHLA 4CLEA 4DJAA 5A4AA 1T4DA 4RXMA 3G82C 2JVIA 4BV9A 1LA2A 4O29A 2AMJA 4EK9A 2CZCA 1CBUA 2R5WA 4DCPA 4EZIA 3N2GB 1OXMA 4EMTA 1PDWA 1HMPA 2ZE5A 4M7OA 4HX5A 4PYNA 1AUVA 3ND6A 5KO2A 2VYQA 2YWGA 4MWOA 3BF8A 2QR5A 1U28C 1I4EB 1NLFA 2NN3C 4DGQA 1OV4A 5TS2A 1JFSA 1E4YA 1HL3A 3V7FA 3LQRA 4L4UA 3U49A 2JKYA 1CLUA 5KC8A 4F4JA 1NW4A 2JGRA 2ADFA 2WYHA 4MP8A 3OZEA 1MQ8B 1RWMA 3DZHA 1JFVA 4PYMA 5HQTA 2O8NA 1D1PA 3MOSA 5CM9C 1SHLA 5KCZA 3AVWA 3BG5A 4LK2A 1X1AA 1Q14A 2NAFA 1ZA2A 2HHCA 3M6LA 1E0DA 3IIEA 4L27A 5FADA 2MJLA 1UDWA 2AUNA 1L5OA 3BAFA 4UHDA 3ZGZA 5TC4A 1L5LA 2PZKA 1Z7YA 4HUQB 3BJIC 4R01A 4R2MA 4AUNA 5ABPA 3JQFA 5CA0B 5EFZA 3WKAA 4DJJA 3OY2A 3AUKA 4WZBE 4DWJA 1XHLA 1Q7EA 4R71A 1N5LA 1WXIA 3I9LA 5G1OA 4O2BB 3S2YA 4BQEA 3PUXA 4DS3A 4F1JA 1KSGA 4KQGA 2BCGY 3RR2A 1DIOB 1ZSVA 3O2NA 3DOFA 4Q3OA 3ECCA 3IXQA 4EB6A 5CB6A 3TVTA 3SVTA 2R6DA 3NGLA 4DSOA 4EX6A 4QOIA 3KHUA 2F3UA 2PV0A 4AZWA 3F9IA 1EFPB 4NBWA 4IHJB 5ERYA 3WSWA 4DN6A 3VZQA 1FTGA 2P6PA 5G1NA 1UCFA 3V34A 4BFYA 1HE1C 4CZ2A 1L5QA 4D9EA 4JT4A 3HG7A 1NF2A 3Q7IA 1GNPA 1UL1X 4BO0A 4QDOA 3QZUA 1FXUA 3SF0A 1ACLA 3UFXA 3EXHB 1NE2A 1XU4A 2KJQA 3WK8A 4D97A 4YT4A 4UW9A 1UK7A 3LA6A 5BOVA 1CEQA 3V4OA 4Z7OB 2XTNA 3TXAA 4F6CA 5MGNA 1OXUA 2X6TA 4PC7A 3EZYA 3R3VA 1UPBA 3IVXA 3WLMA 2NM0A 5LQJA 4ALKA 1UXHA 5F76A 3D0RA 421PA 1KAOA 5HWSA 3L8FA 4G37A 4IYRA 1NI5A 4UU8A 4J3NA 3SIWA 1IZ9A 5KOJB 2NNLD 1GPJA 3K1TA 3OM1A 4QULA 3SSNA 4QTUB 2Q1SA 1XTUA 2ZBEA 3WV4A 2Y0DA 4R54A 3U3KA 4CNBA 3LUFA 4DQLA 5LZ7A 1OBOA 1G55A 1ST2A 2BH2A 2GRUA 3ZWYA 4U2BA 3EGXA 5IT4A 5BR8B 2OXIA 3HKEB 1IJBA 3Q40A 2DQ4A 2IYNA 1Q0TA 3L7NA 4DDHA 3L7DA 4DLWA 1QE3A 4WOCA 1PV1A 4BQIA 4ENQA 5CA1F 3EPLA 4XD7D 3TEJA 4D98A 2C9DA 2IY8A 4BVKA 4WD3A 4B83A 2WWIA 3OMWA 3AHHA 3Q72A 3SMQA 4EABA 3OTIA 4RK4A 5FNVB 1JAHA 1N2EA 1VL2A 3PDHA 2OBXA 4FGKA 3HFGA 1DBWA 1E2MA 1RMQA 1JU9A 2C29D 3GRUA 4KWCA 4GMDA 4RF4A 4F7DA 1T5OA 2EIXA 2F64A 3AY0A 1WKCA 3RSFA 1LPPA 1SHTX 1H2RS 2PUJA 1CFJA 1USGA 2DYKA 2X3FA 2AQHA 3K15A 3K72B 4UM7A 1FYVA 3OETA 3VV3A 1FNDA 3N2GA 4U7HA 5BUCA 3HBNA 3KQTA 4IDCA 2FZLA 4U9UA 2WWYA 2QA5A 2FW0A 3PVCA 4ZC8A 4DWVA 3COYA 1OIVA 1VJ5A 4OAOA 3U4HA 1KI6B 2GNAA 4KE9A 1PFQA 4PQRA 4CF4A 3SF8B 4ZGBA 1XRRA 1YBVA 1N2BA 2QRUA 3CNLA 3ADKA 2FRVA 4V1CI 3ZW8A 1FZQA 5EVCA 5LOVF 4QEKA 1GVNB 1UC4B 4UJ3A 2J9FB 4EHIA 1E3QA 2MINB 2R4TA 3GX1A 1LQUA 3K94A 4FCVA 2OY0A 2NO4A 4LJYA 3KPUA 4MV8A 4O2LA 4ABYA 1JLSA 3HDQA 3NXSA 2ZSEA 2ONZA 5E9WA 4INOA 3TIXB 5J43A 2AYZA 2GD2A 3IP5A 3ZCTA 1UXJA 2GNOA 2DRIA 1CUVA 1SIUA 4HEHA 1T6NA 4LVCA 4MR8B 1I9GA 3PC3A 1M0TA 1XTZA 4CR6A 2X8LA 1KVSA 4JJIA 1Z3CA 4B3JA 2XNSA 4JEIA 1YTUA 3SS7X 5A4KA 3G0BA 3ECSA 1Z2CA 2I1WA 3UG6A 3O84A 1OD6A 4EUNA 7REQB 3EZ7A 4RV9A 3AEXA 1IAVA 2BGKA 3EQZA 5CFZA 1NQTA 1TEXA 1TA4A 3ORYA 2ZUBA 3BMNB 1U9IC 3TJZA 3R5FA 3TTVA 2RGBA 4MKGA 5HK8A 4S2EA 1LJ8A 5AVJA 4IZHA 4Q4DA 2ZUWA 1I2MA 1LSOA 2GPNA 1JU4A 3FBWA 1M5TA 4E08A 2V6JA 3WJ1A 1B2LA 3ICCA 3MOGA 1HA3A 1TLFA 1WMFA 3OC6A 3EFEA 4GGPA 2O2HA 3SOZA 5B30A 4OJKA 5EQJB 4BVLA 4LDRA 5FAKA 3Q9SA 4MO2A 3CT4A 4MULA 1MC1A 1TA9A 1V4NA 3KVRA 4ZODA 4R3WA 4IQ4A 4DT1A 1P44A 7MHTA 1Y33E 2VLIA 1E7YA 3C14C 3QBTA 4OHXA 1IB6A 1GTL1 1BH6A 1P77A 1PF7E 1NONA 4MQFA 1YE3A 2KMLA 4BGDA 5LC1A 3CEAA 3O75A 3U62A 2ZIXA 3JVDA 3WXBA 2OUKA 2HTFA 3SKVA 1V9SA 2KHZA 2ZR9A 3UAYA 5JCJD 2GXSA 1T0JB 2V4UA 2VS1A 3ETEA 3P20A 4Y1EA 4D9BA 1ZZEA 1KEPA 4GR5A 4YLYA 1QV6A 2H4XA 3T7TA 4F2GA 4C0KA 2CKMA 2O8EB 3K9CA 1GL9B 1YZUA 4U2GA 3B6ZA 2D2EA 1XFAA 3QVMA 2H31A 3RVNA 3GYBA 4PPFA 4AZ3B 5A1JA 3S81A 1YR9A 2Z08A 3QKIA 3ER9A 1NE7A 1UBGA 1ZBDA 1PX2A 1PL7A 3CR7A 2YL2A 4FR5A 3SEQA 5HF8A 4P22A 3DL2A 1XLVA 1VXOA 3MWGA 1XZDA 4K28A 4ZVLA 4EWLA 2IYUA 2J7PA 3U9SA 1IC6A 3PIRA 3PHCA 1UDBA 3H6HA 2A59A 4EGFA 2AR0A 2J0UA 1I6MA 2I54A 5EJ8A 2VNIA 4KLRA 1XBTA 4YQZA 1OH5A 2PKQO 1UWKA 1Y6FA 3CB4A 2GUWA 4FIDA 5LCXA 5LLDA 1TT7A 4GPAA 4ILEA 4Z4GA 3JZFA 1WQ4A 3LH5A 2ZI6A 3DPIA 2H07A 1F2TA 2RCNA 3B51X 3PHGA 2PSFA 2R8BA 4CMKA 4DWWA 4EW2A 4I5EA 5J59A 3V4ZA 3HE3A 3L7YA 2IHVA 4IIHA 5HIIA 1J25A 1ZG3A 4TLBA 3BEDA 3CT6A 3Q5DA 2ZE6A 3EK2A 5DYWA 4NBKA 4V1CA 4OD0A 5E8RA 1FU7A 3X2SA 4ASUA 3DFMA 1YZVA 1BYUA 1IEWA 5DV9A 1EUYA 3ZJTA 4EITA 1A7AA 4WXRA 4IHJF 2CNWD 3D7NA 1WP9A 2A5FA 4GR4A 4PFSA 3TLGA 3V5NA 2V03A 3N6RA 2AG6A 3H9JA 4OYHA 4BVEA 1RQ2A 4IQFA 3VAAA 5FQOA 1YZ3A 2H0QA 2BOVA 5T6BA 3HQ4O 2WZBA 4JZKA 4N6GA 5B37A 5KI6A 2GZMA 3RT9A 1TYAE 2C7PA 1FMFA 5COAA 1Y0BA 1P3DA 4ZU3A 3RUEA 2YXDA 4NQRA 1RM4A 2DPHA 2EX4A 4NBRA 2EFGA 4GPZA 4F5DA 5HS6A 1FUYB 4FFSA 3G9XA 3S70A 1W5FA 2V8BA 4KVFA 2IBSA 1A2BA 4IUYA 3KYDB 4QQKA 4YALA 1KFBB 1PNOA 2ZGVA 2A2ZA 2HHHB 1AMUA 4TXMA 3X1WA 2D2VA 1MX9A 3TPZA 3A25A 1EVJA 4KXLA 4I5DA 4CR7A 4LG1A 3FGOA 2P9GA 1EM6A 3CSDA 2XMZA 1XRPA 2JBAA 1ZSNA 3QVWA 3HY3A 4IWYA 1UXOA 4W5WA 1UOOA 5JC1A 3KT8A 4DE5A 5EJGA 4Q3DA 3V6LA 4EH1A 4IAOA 3PNSA 4JQOA 1T6XA 1C0PA 3MPUA 4I55A 1DTEA 3MM4A 4NG4A 4NZPA 4OGKA 1RW4A 4FFDA 1TECE 3CBGA 2CLIB 2IUEA 2OGZA 2VP0A 4PF1A 5IH7A 5IBPA 3LY9A 5GONF 3M5WA 4ZXPA 1F12A 3BE8A 3K8QA 1AMNA 4OHMA 1R1DA 5GOZA 4E3ZA 2OV8A 1P2UA 2EBHX 2JJMA 2XMGA 3G0DA 4G0XA 4YMVA 5JRZA 3OU7A 1SKUA 1VBKA 4ZARA 3ZS9A 2IYFA 2RG1A 2VSYA 5LD2C 2LP4Y 2HN9A 2Q9CA 4CM6A 2DERA 1NG1A 2IEZA 2RHBA 5LN1A 4PSVA 2Y2UA 2ZJ4A 3EW7A 4ZGWA 3ZCUA 5BY2A 4WGGA 4Q48A 3SKXA 3ETHA 5BN5A 3UC5A 2QW8A 2BKLA 4LCEA 1ZL0A 1NIJA 4CMHA 2BP7B 4LTDA 1TEZA 1DCTA 1QAOA 3BSWA 4NBVA 5FL3A 3H2SA 2JLZA 2DFKB 5FJIA 5LOVB 4QDJA 5DPMA 4TV9B 3NRBA 3NTXA 3ZIDA 1HOXA 3BRWD 2OO5A 4ZYXA 2OG1A 1NDUA 4IICA 2R11A 4L51A 1KDPA 1ZH6A 3KYCA 2VPYA 4PYOA 4X94A 3C6ZA 3F6SA 1ZC3A 3FKSD 3QKRB 4KWTA 2WOOA 3R24A 4W9RA 1T5SA 4GRAA 2VT6A 3OZFA 4JLAA 3SY8A 1W36B 1JS1X 1V3QE 4I1SA 1OXVA 1H2YA 2O3SA 3JQ9A 2IWRA 5IXJA 4O5AA 4QPDA 5LA6A 1QDEA 2XMSA 1OBCA 3QELB 2BUBA 1BCSA 3MHPA 4TKUA 2F1OA 2VYNA 5ALIA 2BGUA 2YHIA 5IP5A 4P0PB 4IPTA 2O5CA 1G1AA 2HDNB 5TQ0A 3H3FA 3P52A 3NUGA 4FYIA 4U6QA 2A58A 4R16A 1KR2A 3WGYA 2ASVA 2QMYA 3E8SA 4AJNA 4AAYA 4E2ZA 3GP3A 4V39A 3VX4A 1R9GA 4X66B 1ANKA 3IAXA 1MJFA 5JD5A 4LZAA 1E8NA 1C7EA 5BOSA 1G4HA 2H4JA 3JYLA 4XYMA 3KHKA 1CUGA 4FONA 3UPDA 3U56A 3D3KA 3SHFA 3T54A 4OB6A 1ZMRA 3MYYA 1KDRA 2QJWA 1S6YA 2ZTUA 1ZKMA 3H3XA 2EP5A 2IA5A 1YBFA 2I6FA 2CVOA 4D0RA 1BW9A 5I9SA 4AKEA 3RRYA 4K1LA 1KP3A 3W7VA 2WV9A 3V4PB 1DAGA 1P5ZB 1G38A 5EKSA 1E3MA 4RA6B 1NKSA 1GYPA 2XT6A 2WMDA 1V39A 2Q07A 1S9HA 2WA2A 4IXNA 5HNKA 1JQLB 1GHTA 1XZQA 3KXDA 4HCJA 2JRCA 4YJHB 5ALDA 4GM4A 3UHPA 4EPVA 2J5RA 1OSNA 1J0CA 1RM3A 3LK7A 3H8WA 4CLRB 3DUFA 5JDIA 2ACEA 1G19A 3CLSC 1R8XA 4JVNA 1JLLB 4DEXA 4FZJA 5H83A 4G5FA 1U98A 5DXAA 4YRTA 1HYHA 5JROA 2H59A 1APBA 3K9FC 4L3OA 5CW1A 2JBAB 3E5NA 3RVJA 4FFVA 1KQNA 1G63A 4NOLA 2XUOA 1WMBA 1H8HA 1PZHA 4YT2A 3FDZB 2LW7A 1X19A 3AZQA 3HB9A 5IBRA 2B1GA 3BL6A 4DLNA 4YJ3F 1FPMA 1RIFA 3BMNA 3VO9A 3WA7A 3KR1A 4Y2HA 5CLQA 1GV0A 3ESAA 3SX4A 3V8EA 4PNEA 2WMNB 5CAEA 3L0IB 1T9ZA 1LBHA 1WXWA 4YYZA 3B1JA 3HN2A 2GXUA 2X22A 2M9MA 2PKQP 1L6RA 3ZNPA 1B0AA 2IXFA 3L0ZA 4XX1A 2OCLA 4L16A 1ZM7A 3QMWA 3HBLA 3EF3A 3INRA 2OBNA 4Q1AA 4ZAGA 4YRJA 3TCNA 1J1IA 4YWHA 2UU9B 1XRSB 1ZVQA 4G4JA 3LP8A 5AUOB 2A78A 2AG5A 4CEHA 3DBOB 1I7DA 1U4NA 1Q91A 3GRAA 4PRZA 1J2YA 1KHHA 4M7WA 1SO8A 1D0IA 1EWKA 4JN6B 4PHFA 3ZE8A 5A4MS 4DQKA 4OXXA 4WN9A 3T5PA 2FX3A 3LBFA 3A05A 3PC6A 4OK3A 3VNUA 2ODNA 4FGZA 3Q2KA 3WJAA 3ILYA 2HPHA 3BKXA 3R3UA 4JFAA 4UBJA 4F9TA 1RLJA 3IS3A 2Q49A 5TSDA 3WGLA 1JDZA 2L18A 2QJTA 5EPOA 1EBUA 2VL7A 1HZZA 2QTMA 2W2VA 1G1MA 4QLOA 2YBDA 1R6VA 1ZH2A 3D4LA 3KZ1E 1T9KA 5BV8A 5JEEA 2BLLA 5KQGA 1UBOS 1ZN8A 3H0EA 4KCGA 1NVKA 4OYYA 4B6FA 2A86A 3EGVA 3TM5A 2FXVA 3GLGE 4EELA 1E1RD 1ZI9A 1KY5A 4GDMA 4TMKA 2C3MA 3MW8A 2G25A 4LWPA 2E5FA 3H9CA 4RGQA 2VK8A 4ZCPA 4QO7A 4CGZA 2I4OA 4YGYA 3KE9A 1C1DB