4OFBA

Crystal structure of human brca1 brct in complex with nonphosphopeptide inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
209
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Peptide Library Approach to Uncover Phosphomimetic Inhibitors of the BRCA1 C-Terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 67
structure length 209
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4ofbA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4ofbA01
3HUFA 3AL2A 3EF0A 3U3ZA 3AL3A 1GZHB 3L46A 3PXBA 3I0MA 4BMCA 4JLUA 2E2WA 3PXDA 3SQDA 1WF6A 3QVGA 3PXEA 2K7FA 3SZMA 3T7KA 4BMDA 2ETXA 3SHVA 2DUNA 3T7IA 4N40A 3K0HA 3K16A 2M2IA 1L0BA 2R1ZA 1OQAA 3PXAA 2VXCA 1L7BA 2WT8A 1JNXX 3UENA 3QVGB 4Y2GA 3PA6A 2COKA 3T7JA 3K05A 2VXBA 3K0KA 2L42A 4XPZA 3L41A 4ID3A 3OLCX 1CDZA 3L40A 3JVEA 4OFBA 1T2UA 4IGKA 3PC8A 1N5OX 1KZYC 3PC6A 3II6X 4BU1A 5ECGC 3COJA 2JW5A 3I0NA 3K15A 2NTEA 2D8MA 3FA2A 2COEA 2XNKA 3T1NA 2ADOA 1Y98A 4BU0A 3KTFA 4U4AA 2HTFA 1Z56C 1IMOA 1T15A 1T2VA 3PD7A 4IFIA 2K6GA 1IN1A 2EBWA 3PC7A 2LE0A 2EP8A 3SHTA 3EF1A 3HUEA 2XNHA 1T29A 4XQ0A 2AZMA 2EBUA 3UEOA 2COUA 2INGX 4Y18A 3PC8C 3PXCX
chains in the Genus database with same CATH superfamily
2FPXA 4J4TA 5IASA 4QPJC 5BNZA 4YYEA 4DWVA 5L3ZA 3WIVA 3QBDA 2QL9A 4Q1FA 2QTMA 5DYTA 1W4CA 3HB0A 1BYIA 1JIVA 1VPWA 4ILKA 4LKRA 1XVLA 1H66A 3MXOA 3O2NA 3ZIDA 4DV7B 2ZZNA 2X5JO 3H75A 5IC6A 4KQHA 3L05A 1M34A 5IUJC 4E5NA 1OFUA 2A5JA 3H5RA 3GH1A 3UNXA 3V7YA 4A0SA 1D8TA 2R8XA 4W5JA 3F3KA 2BV3A 2M98A 3HMKA 1RS0A 5TEWA 3T95A 4CMBA 1AMNA 2OHIA 1GPYA 1WF3A 5E6UB 5JHHB 2PQ0A 2AUNA 1SVNA 2HFJA 1H5NA 1CY1A 3GR6A 1C7FA 4YV1A 2CW5A 2CLEB 2NQ8A 2Y68A 3QXSA 3EDYA 3PQFA 4HS9A 4MICA 5HJ2A 2RK3A 2WKWA 2OL4A 4I4LA 4JLDA 1G7SA 1ZISA 3LT5A 4FYHA 5KQSA 1R0XA 2I7XA 2MJLA 1PS8A 1RKVA 2CVFA 1DG1G 1GNSA 2P9EA 3FUUA 2N75A 5ALDA 5TJHA 1JI3A 3RS5A 2BGNA 5C0OE 3RSGA 3RNLA 3EB9A 1DUVG 4E46A 4UFNA 4FOOA 1W5AA 3V5NA 5B4UA 2DXIA 1W0KA 1ZK3A 4NZ9A 3RJ5A 1XEAA 3C3PA 4PG6A 1VP9A 2LV8A 1JAYA 1SKYB 3KE8A 3P0EA 3F7OA 5CGZA 2QENA 4CMKA 2HOQA 2ZVDA 2E1PA 2ZUEA 1B76A 1DC6A 1TCAA 1XQVA 2CDRA 3ENZA 1G5QA 3IQHX 2WG1A 5CTJA 5IJAA 4YY3B 1H93A 4HFNA 4KE6A 4LOHA 4R0NA 1KVRA 3TYXA 1N9GA 1FBNA 2J30A 5I3CA 3TL6A 4DUZB 4E1VA 4K88A 4B3IA 1RQNA 3FUXA 1N5OX 1DXQA 1WQ3A 1VL5A 5JCXA 1H8ED 2DJ5A 3OEWA 3RBAA 4L4SA 3SK0A 3C4JA 1GGVA 2ZUCA 2Y0CA 3CNBA 2PZBA 1UC9A 4YPFA 4F0JA 3UYLA 2FW0A 4YAEA 3KCNA 4L3WA 2CVQA 1O94C 1XZIA 4Y30A 4BFCA 5L3SB 4GI3A 3R3XA 2FE4A 3DZFA 2DR0A 5FUWA 1EGMB 1YK0A 1XLTC 2CFOA 4FZJA 4RJIA 3RW9A 3EY9A 5ED0A 3V1UA 1CRPA 3MT7A 3R40A 1SR8A 3BCRA 4I3GA 1E7WA 1GGMA 1X13A 2FEPA 2IUSA 1NM5A 2PRSA 3DBRB 5EP3A 4WKPA 4D98A 2YH2A 1GHTA 2GZAA 2XEXA 1SXIA 4G6ZA 4J1TC 4JGBA 4MQMA 4C5CA 5KNCH 3NMUF 3BMNA 2WKSA 1LW7A 1M6VB 1Z82A 3I6IA 4DMCA 1RWWA 1JMYA 3OP1A 2H1VA 4W9RA 5DKFA 2AR9A 1L5VA 1YS6A 1IWOA 3R5SA 4RFVA 3RVMA 3PEYA 3IRUA 3RQSA 2C97A 5GZ3A 1K97A 4KQFA 4N0MA 1Y1QA 2OHFA 3CTMA 4HBGA 1TYEB 3B9QA 2QLBA 4GT1A 2NYUA 5EKUA 4E03A 4URVR 1BMDA 1ZKMA 3BTUA 3ORFA 3QEOA 5BW6B 4HRVA 4A27A 1J8MF 1ZX1A 2E4ZA 5A3RA 4OP1A 2Z4TA 3RD5A 5HRCA 1A4IA 2ZTUA 3I53A 2C4NA 1J06A 2WIKA 1DLJA 3H42B 3IP8A 4LTNA 4PS0A 4NOKA 2ZUFA 4IGFA 4E2FA 5KU7A 4LF8B 1M75A 3BQNB 4I4CA 5B64A 1IZZA 2J07A 1L5QA 5IMSA 1PW7A 4PYQA 1QH1A 2ZE6A 1PJBA 1QVRA 1XVVA 3OE7A 5K0GA 3L6UA 3NTVA 1ZINA 4JEIA 4PSDA 5F9HA 2P2LA 3FROA 3DFKA 4P2BA 3VKHA 1AKQA 4C2AA 5ANRB 3NT5A 1SEPA 1Y80A 5C31A 4LJ9A 4EI7A 1QNLA 5EXDA 3KZOA 2LTAA 4YP1A 3QPCA 4R0VA 5F3WB 1KNXA 3HB4X 4UPEA 3AWDA 3K5IA 2I1QA 1W75A 1BQ4A 1IWBB 2EL7A 2CDAA 4MI1A 4BIMA 3EJ6A 3ZS8A 2WHQA 5K4GA 3EW9A 4B7CA 1ZKDA 1VPDA 3H2YA 1IULA 1N2CA 1GXSA 2QTFA 5FAKA 3IOMA 3KUDA 4UM7A 4Y3UA 2PXCA 1H9CA 3MOGA 1KEZA 1QYIA 4D43A 4N18A 2FEXA 3HDJA 2IHTA 5L3VA 3FI0A 2FSVA 4IV0A 1Q6ZA 1W96A 5LQMA 2DKFA 2VYNA 4BNYA 2R1TA 1FDWA 5BYKA 1JTVA 2JEZA 1W0JA 1OB2A 1A5ZA 4NOJA 1REQB 3CSUA 1AS2A 4AWBA 1UXIA 2ZB7A 1KJYA 3QXHA 3ZJVA 2PUDA 1OWLA 3MCWA 1H3NA 1XZDA 3KZKA 1CUVA 1ML4A 1IE3A 3ETEA 3PFGA 4D4IA 1S4QA 3OPYB 4JI4B 3TRDA 3D1LA 2BD0A 2C8VA 4QQRA 1F6DA 4MCJA 1ZVKA 4WZAE 5I45A 4NLLA 4YV2A 1XVAA 3ZLJA 4H1HA 3UHAA 4G4SP 2J5BA 1UBEA 1K5GA 2VF4X 5DTIA 3V6LA 1LK7A 4X6YA 1CP3A 2ILTA 4G1BA 3SZ3A 2V55B 3H1TA 5LP6C 4AMYA 2WWXA 5DNUA 4XEUA 2SCUB 2C96A 2MYNA 4M21A 1KI3A 3AF4A 5I4BA 2C8KA 5JAIA 4ENVA 2H1CA 2VJQA 4OBXA 5HWSA 4MEBA 3TECE 2G70A 1B0PA 2EFYA 2D06A 3AFHA 3MT8A 2AYXA 2JFQA 4WY5A 1NP6A 3R7SA 1WIWA 1EGAA 2PJZA 4J1SA 2YZGA 3L0CA 1XPJA 4MPDA 2WF5A 3WYDA 4OJMX 2XMSA 4UM9D 4EFNA 2AS0A 3E48A 3GZNB 1ZITA 1XX6A 4FPXA 1IZ0A 2I65A 2KJQA 1TEVA 3LQRA 3QPWA 4FFBA 4LMPA 4G5SA 4PICA 2Q5CA 3NEAA 4G0MA 4G2NA 1KEWA 2JFBA 3P8ZA 4YRPA 1NJ8A 1FUEA 1FJ2A 1ZJZA 4Z3OA 4YECA 1Z0UA 3EAFA 1DADA 2MSLA 4GNKA 4PCVA 4RL4A 3CIFA 3M6AA 4PPNA 4D3DA 5IK2D 1II9A 4H35A 4XYGA 5AVQA 4F2GA 1E3SA 2D59A 2IIVA 3QIVA 4Y1RB 2QTNA 4FJ2A 5CIQA 1LVGA 3BK2A 1WLSA 4A8HA 4EOGA 5JAHA 3T9CA 5BMOA 1IVSA 4M1SA 3G23A 2JI4A 5JRJA 3EPLA 4YRDA 1BC5A 1R0LA 4IHAA 4DSNA 2GPJA 2HLHA 2ZWVA 4BVJA 3RQIA 4WFJA 5AM3A 3DHVA 3RKUA 1FW6A 3KS9A 1U8EA 2FMUA 1F9EA 5AW4A 3NHPA 4FCCA 4M1TA 4YEDA 3TDKA 3TSCA 2VF8A 4UZEA 2HADA 4YMIA 1WSBA 2O07A 4R54A 3M1AA 3QJYA 3HCCA 3BXPA 3ROFA 1D4AA 1WUKS 4L50A 3R6WA 4N8SA 2E3JA 5A1JA 4AG6A 5LMZA 1I3KA 1JZSA 2NX2A 4P54A 1H23A 1GY8A 2VF2A 3HYNA 4R1NA 1U5AA 1CR1A 1ZNZA 4MVJH 5F2OA 5ISMA 2FPGB 2OUIA 4Q16A 4LJ4A 1VRVA 1VIAA 4G4SO 4E1AA 5K3SA 1TF2A 4P4LA 1E61A 4MUNA 1MAUA 5IM5A 4KB5A 4CLRA 2UDPA 2IELA 1JNYA 3Q7RA 3LRTA 4PQGA 4FZRA 4RL6A 1WDWB 4D80A 1HNWB 3V55A 2CJWA 3GA5A 1TCUA 2C5LA 2GNPA 4PYNA 4KXVA 4X64B 1WXQA 4YRLA 1JEAA 1IUOA 1Q7TA 2PCJA 5EERA 3VPBA 3LPNA 2ZRQA 4RLQA 5LP6B 4Q39A 1C9NA 3PDIA 1T3SA 2D7CA 1CD5A 4L3VA 3KOYA 2CB0A 1H1LB 5C3UA 2CC2A 3STVA 3VHQA 3OVMA 4C6RA 1AA9A 1NBWB 2UYCA 1ZXLA 1KS2A 1XQWA 1O5TA 1UK9A 2JFNA 1ZHHA 2FY8A 2ZQZA 3BJRA 3N8DA 1UJ2A 2JH3A 3OLXA 1ZVQA 1CNMA 3L0PA 3MQ2A 4NFLA 4LKOA 3S2FA 2BFMA 4FFSA 2DFVA 1QR2A 2D8AA 4RJLA 3CNQS 4NH4A 3ET4A 4R2JA 2Q62A 3T99A 3ZQKA 2G04A 3VPCA 3WGYA 5IH3A 1QF9A 1U9CA 3D31A 1BKDR 3DO5A 2J9YB 3PQEA 2TSYB 3H2IA 4AZWA 1XMXA 3REGA 1KZYC 4M7RA 4LRQA 4DSUA 3MUNA 2C2WA 5CXSA 4BQNA 1JWAB 4FYJA 4O2BF 4AJLA 3KELA 4R40A 1FTSA 1MDFA 1HFEL 1XFDA 1YMVA 1XVTA 1Z29A 2E4VA 4JI5B 2AFRA 4HN4B 2QN8A 4CL3A 1OMOA 1U0RA 2W00A 4HX5A 4M0MA 5FULA 5FWYB 2ZM5A 4RTJA 4COKA 2C57A 2QG6A 3FPGA 3LY7A 1ZHFA 4GX2A 4KPYA 1PL0A 1TVCA 1EM8B 1UJ6A 5BNFA 3T1VA 3E4DA 3VPGA 5BSEA 3TDNA 2FF7A 1PJAA 4NEQA 3ZIAA 3H05A 3QX8A 1UKZA 2YDXA 3DOEA 1Y98A 3GFVA 2FWIA 3L1UA 3UMSA 4H3HB 1XTPA 4U02A 1GNRA 1QO0A 4M7WA 4PNZA 3LP6A 2I3DA 4RACA 1CWUA 1ZM7A 4QULA 5JSZB 1I6MA 1E3JA 4XD2A 1U7WA 4AQDA 3USCS 5K8LA 1UMKA 2Z5VA 1YB5A 4FHEA 3KXDA 1NI4B 3RS4A 5EIOA 1NC3A 5EE9A 3QFCA 2HMSA 5ILOA 3QSGA 4PIVA 2PEYA 1EUZA 2D5AA 1CLEA 1M67A 2PZFA 1OYWA 2YVLA 5K3FB 1W76A 5FRDA 4PNPA 3MK31 4X63A 3VR6H 2ZJBA 1E4OA 2WI8A 1DKRA 4BO8A 2XSZA 5J43A 4L75A 4B79A 3KQQA 4ZI2A 2R47A 4FQ7A 2PUTA 4X3PA 3F6RA 2ZKLA 1K8QA 2HDWA 2HRZA 2HSWA 3CJRA 4IHJF 4TXMA 4BN4A 3ANYB 1PK8A 2YFHA 4QQ8A 4PAQA 1L4GA 2V1UA 1ENYA 1L8XA 5TMEA 3LLCA 4KL8S 4YMVA 1KVQA 2Y76A 3TNJA 2XKKA 3ZJUA 2R6HA 4D0RA 3KTOA 3HM9A 1GTZA 1ND5A 1QRDA 1X8JA 2RAUA 4HV4A 3IR7A 3C45A 2G1PA 3EQZA 2CFSA 5IDVA 4YAUA 2O2CA 3L02A 3NIGB 3OCYA 3DL2A 3OUUA 5E4FA 2A7XA 1ZD4A 1A2BA 3QFRA 1Z6QA 1BNCA 2C5EA 3B13B 5LQJA 1I4WA 1ZD8A 5FTKA 4LK3A 1NXQA 1T4MA 4MAAA 3NC4A 4ZI7F 3N2GA 4KV9A 3GJ7A 1CR2A 3VZQA 3MTIA 1Y8QB 1XEWY 3UMVA 1ZK2A 4I1YA 3VNVA 1H9AA 2VDPB 3QF7A 3BE4A 4HEA6 1ODCA 4ZQCB 2HJGA 3S0JA 5B7GA 4OK3A 3EMDA 2VDWB 3TLBA 4BPRA 1PQWA 3OP4A 3OQJA 4BKMA 3LW8A 5A7HA 1RQPA 1K86A 1E2NA 2BJWA 2F3TA 2V3WA 4H3SA 2JLYA 1ZC4A 4IJMA 4DMGA 1KR5A 4MRMB 4KITB 1XN1A 1VG9B 3W5UA 3JZIA 2C1XA 2WB4A 5CDFA 1ZQ9A 3THYB 3PE6A 2JGIA 4FI3F 2I22A 4YJDA 4EUHA 1L4FA 1WU8A 4Z7NB 1PCXA 5I7SA 4NHEA 3RROA 3FBGA 4Z4FA 1EINA 2Y0EA 5TRTA 2AOWA 1IXRC 2C5GA 3AHCA 4ARZA 3ZKWA 4EWLA 4IOKA 1YDEA 2C83A 2GCEA 1GR1A 1WW8A 3UJCA 3S44A 1A9XA 2PUCA 1ONOA 5B3AA 3OM9A 1NVBA 3T4UA 3TW8B 2Z1DA 4EBFA 1QZ3A 1E59A 4WXHA 4E5DA 2GUGA 4OGFA 1R6AA 2RJ3A 1JLKA 1QC5A 2AMYA 1MQAA 3G5UA 4OXRA 3C6QA 3EXFA 3QBTA 3UWSA 2BF7A 3OKFA 3WLNA 4YUZA 4I08A 1SQSA 2PKYX 2YFKA 3LGSA 5BV7A 1HT1E 3IV9A 3KLMX 1TDJA 3IV7A 4EJ2A 4MLCA 2JVIA 5L51A 3SQXA 2B35A 2CXPA 4R3WA 4DYVA 1ORDA 1QG2A 3KT0A 4M53A 1E7RA 4RZHA 1EUCB 2O8EB 1DIBA 3OWOA 3P96A 5I7WA 5HF9A 2E21A 1B74A 1USIA 5CUQA 4C0XA 1GA6A 1NN1A 4N7MA 3T9FA 4EY5A 2VHZA 2CMHA 3HCOA 3B5EA 3NQ41 4RE6A 3HUEA 1R4MA 1WVIA 4X41A 1JFTA 1JMKC 1YC5A 1Z0KA 1E1CA 5DX1A 4JR0A 3E5HA 3OCXA 4XDHA 2P9ZA 3KKNA 4XIFA 4C0HA 3WGTA 5JOQA 1L3IA 4UPVA 1GD1O 1T2EA 1FCJA 2W6ID 4ZTZB 3VR6A 3LU1A 1EXNA 2PXHA 3AFMA 4LYHA 3V8RA 4DABA 5FV7A 2PLNA 1Q1QA 3AL2A 5CB6A 2BKVA 2ZRDA 3GT3A 4OY3A 5EMNA 1JLLA 4Q3AA 2F8TA 1SIBE 2QAGA 1S3IA 4KOEC 1S3GA 1XCGB 2Q3HA 1A69A 4FP9A 1UOEA 1XQ6A 4MB2A 5F73A 5LZ7A 4MWZA 4QOHA 3MB5A 5C81A 3VDRA 1B8NA 1YOVB 2OHHA 3W1VA 1N75A 4GPAA 4MVCA 4WFIA 4X91A 1FU8A 4TRMA 1NOKA 1NASA 1GWNA 1SQ6A 2Y2VA 2XUDA 1AZTA 1JAZA 2HNKA 4FFWA 1O9BA 3U3KA 3A7EA 2FEOA 3TLYA 1VCIA 2DWQA 1VA4A 4UMVA 1XD9A 3HN7A 4IGEA 1GAQA 2QZJA 4C4OA 5EE0A 4KAFA 4EHNA 3QV2A 2F8MA 2HEIA 3OZDA 2WR8A 1ADGA 4MVJG 4ZQGA 5KNBH 1ONNA 3GRVA 4M1KA 3U7IA 4KMMA 4W1PA 4O29A 4GKVA 4Z1MA 3U60B 1OX4B 3AGPA 1R64A 1OKKD 3SLGA 2BDUA 4N3NA 3E15A 3G9QA 4R6WA 1F6WA 3PNVA 3U4CA 3TR5A 3HBLA 5M3BA 1K2WA 2GCPA 4RJTA 2O48X 1T3LA 3EVBA 2I78A 4DM4A 1ZOPA 2EJWA 4UPDA 2GVNA 2P9YA 1DAHA 1MX9A 1Z38A 3EVEA 4IKPA 2Z57A 4PNHA 3LLSA 1XQ9A 4TTQA 2G7MC 1XKTA 2C5AA 3EWSA 1M1YA 3IBSA 2JCVA 4K9LA 3DW3X 5BVHA 5F23A 3LIIA 1UEIA 2ICAA 1UXJA 3W8FA 1QTQA 4TM8A 3HSSA 1HRKA 1RBZA 2GEUA 3OI7A 2Z2XA 5DT9A 1ZN7A 2B9VA 2CLHB 3EUEA 3AESA 5DIFA 2A58A 4ACAA 2O5EA 3IVAA 1SB8A 4EA7A 3D0OA 2CNKA 4CCYB 3IDSA 3V4RA 4P36A 5TPWB 5HJEA 2RBEA 3IQXA 1AOXA 2P4UA 4WI1A 3KYJB 1UKAA 3PR1A 1M54A 2BR4A 2QB5A 3O26A 5ETJA 3DV2A 2NXEA 3GT7A 4AP9A 2W6NA 4XOIA 3KVNA 3IQDB 3PVCA 3QG1A 2FR1A 3JQ6A 5AKZA 5G3ZA 5DTQA 1IM5A 1NUAA 2XBMA 3DEHA 2W70A 1SOAA 3AONB 3GRYA 2W90A 4HZUB 2OEPA 4IDAA 3AZPA 2XE7A 3TSYA 2VTBB 2H8KA 3QX9A 2CHUA 5I9NA 1DJNA 1FW8A 3PHGA 4D9CA 4ZV9A 3AHFA 2QSZA 3Q2IA 3G3EA 1OH8A 1N2SA 3QXXA 2PT7A 2WNHA 3OOJA 1NYRA 2WSLA 2H5JA 4MLPA 4NAHA 4Y67A 3RG2A 3W2TA 3EWNA 1MEOA 1RHRA 4MP6A 4JX8A 4TS1A 3H5VA 4IR7A 2GI4A 1MN6A 2ANBA 1X1TA 3E27A 1FVHA 3RG8A 1NPDA 4WNCA 2AHRA 3I09A 3TNLA 1WPGA 2OMEA 4JVNA 5EPOA 1L1QA 4QXAA 3IRVA 3L4BA 2YIVX 4TT8A 2OZLB 2X5NA 4PRZA 2FR8C 2JZOA 5AKHA 3L7KA 1D4FA 4G0YA 2Q6KA 2HA0A 3CUKA 4P80A 4A2PA 5ALHA 4PYMA 2ZDGA 9LDTA 5JNRA 3MOIA 1WPRA 4N5DA 121PA 3WYEA 4CT5A 2HEGA 2QLNA 4HJXA 1NNUA 1Z37A 3FWZA 3ICOA 5FNZA 5L4LA 5LNK1 4P98A 3SZLA 1MGOA 1VYUA 2OV1A 5TLSA 2BSQA 2AI3A 1NY5A 2P4HX 3W04A 4NOLA 2JK0A 3TIIA 4KXMA 3BWYA 2QD2A 1TKBA 2XUIA 3FE2A 1XMVA 3GRCA 3O94A 5DHRA 3NUZA 5KDDA 3A4LA 1IOZA 3DCNA 3OJEA 4Q93A 3C7KA 1KO8A 1PQYA 1LNSA 1XKQA 2WU0A 5A04A 3RAJA 1GQ2A 2DUJA 3D6VA 4TKMA 4YRJA 4QZVA 2WJVA 3HNOA 4J4BA 5BO5A 4DDWA 1D0IA 2P30A 5FXMA 1YR9A 4OYHA 1UKVY 5IXYA 2P3LA 1KZ6A 1MW9X 2FSPA 2ID9A 4U6SA 5DCYA 3FRJA 4H6WA 5K0CA 4DDTA 4O4HB 4Q24A 1P4AA 1POWA 2FPIA 2J5QA 2DFPA 2P0YA 4I81A 3UCEA 3ZEAA 2J6CA 5AW3A 5KYKA 1EMDA 1WP9A 3H1AA 2NXJA 1F6BA 1N6LA 3F9IA 1OCEA 2F43B 3A1DA 1QS0B 4JL5A 5JH7A 3PA6A 4M8SA 4ZIRA 3GLQA 3CVOA 1L7RA 3SS7X 1QQAA 3FDJA 3WDKA 1N1EA 2HQOA 3FTCA 3QENA 3FGZA 5KIAA 1OT3A 2GTIA 3W8EA 4MDHA 3U62A 1NMYA 2Z9BA 1E3MA 3NV9A 1ADFA 4KODA 1ARZA 1GCIA 4RQTA 5JXIA 1L7EA 2BHTA 4NMMA 2UU9B 3D3JA 3MLEA 4KQ2A 1TPZA 2H9IA 3R6TA 4BLWA 5AYVA 4DADA 3ZWBA 3ZE0B 3F4BA 2BFBA 1SNYA 2QMHA 3DZ8A 3PSHA 4X85A 4YP9A 2I6XA 4G84A 4BZPA 5HRAA 2UXDB 1NXPA 2ATVA 2IIPA 2WTBA 3ROXA 1P5ZB 1NVDA 1YZVA 2QSUA 3VI3B 1EWKA 2B2NA 2BFNA 3PUYA 5KUTA 1ATZA 1Y3FE 3UFXA 1IMJA 1O96A 3P19A 2B99A 4PTZA 2GD1O 2R44A 3GLUA 4YROA 3S2EA 1GUYA 3W6OA 4Q9HA 4KH1A 1O8BA 4Y2SA 3WMGA 2VA9A 1EWTA 2Q3MA 3CF4G 3GUCA 3T06B 2HLDD 3FPLA 5CXUA 3HGTA 5A5EA 1MRSA 2PD6A 2W4MA 4D99A 4I1PA 1V9LA 4ZT6A 2EZUA 1F2UA 3KPVA 3SDSA 5C53B 3D2CA 4B17A 1MTOA 5FOSA 1YI0A 2OSBA 1UMDA 1Q1BA 2HY7A 3AY0A 2VF7A 1MH9A 3K96A 3HKCA 4HGPA 3R7AA 2OESA 3IJEB 3HDYA 2OAQ1 4EGQA 4CKXA 1CRZA 1UBOS 3J81A 1ZU5A 1R88A 2YVKA 4TM7A 5AHWA 3R20A 1N6PA 1V2HE 1ZRHA 1DBSA 1NMZA 1Q22A 2HMUA 4EGCB 5JTUA 4MGIR 4HH1A 2XAAA 2PMCA 2RAPA 3RPEA 1ST3A 4RVSA 1Z36A 2P7IA 4EKEA 4CGZA 2AC2A 3T4PA 2GCIA 4TTVA 1X7XB 1EK0A 3FWNA 2DY0A 4ZVLA 3WL8A 2R62A 5CA0B 2ZSBA 1ABFA 2EW1A 1OAOC 2A1TR 2LDBA 2Q9AA 3LHSA 2ZVPX 3TD2A 1VL0A 4ND6A 4LYYA 5GTDA 3NPAA 4EA8A 2GYWA 4F2PA 5DBGA 3I8XA 4OXYA 1JDBC 1I10A 3WOVA 1YZGA 5TVGA 4DTIA 2C7PA 3LTEA 3REQA 4DGSA 1SUSA 3L8CA 1U28C 1ZD2P 4LX0A 3KHSA 4U3JA 1NA5A 4M1WA 2I9PA 4XJSA 4WUVA 1RQGA 2PV0A 3I9V1 2I0FA 1LDNA 5BNIA 5AVSA 3KEMA 3NTQA 4JSYA 2A0FA 3MCZA 3TMAA 4Q5IA 1ZRMA 2WYOA 1EHCA 1ISHA 2QSJA 3G6WA 1APBA 2EQBA 5BN5B 1UEJA 2I4IA 3JQ7B 4EMBA 2EEZA 4MCHA 4UUQA 3UTCA 4AKHA 1N8NA 3DT8A 2C2KA 1AKWA 2A84A 4ASUA 3MMNA 3S99A 1PQUA 3GMIA 4B5KA 3RIYA 1JIIA 3QPDA 4OSEA 4IHKA 3O4FA 1HQCA 3F0TA 4JOBA 3ME5A 2RE8A 1I7PA 3H0KA 4MRAA 3QE3A 4OGKA 3W4IA 3FHCB 3OCCA 2JCYA 1RQXA 3N8GA 1S8FA 1WUHS 4M46A 3NDRA 5I9SA 2VL7A 4L5YA 4NF2A 1XU4A 5CNJA 1DAEA 4RK5A 2QV0A 4E07A 4C3UA 4R9UC 2C3MA 2IYVA 3T7JA 4HWGA 1M8JA 3N2ZB 4ZC8A 3PQ3A 2W2OA 1LPNA 1SKMA 4B2LA 2IS6A 1P4RA 2YZNA 1KE2A 2QJWA 3KUUA 4NQRA 4TV8A 4EHFA 5IULC 2WABA 2X9NA 5A2GA 1CUXA 4UNIA 2LDXA 2XZDA 3PF9A 4Q4JA 1PEAA 5BN4A 2V6GA 4DA9A 4TMXA 5EZYF 1QHYA 1KZ4A 1R15A 2PUHA 1BXRA 1ULBA 2BMJA 3E8SA 3HLYA 4UJ5A 3F46A 2O2DA 1KI2A 4YQYA 3P9CA 1BVUA 4EY3A 4DLVA 2X41A 3QNMA 4F9EA 4YMSA 3A1SA 5FYDA 1MRNA 4H27A 1COWA 2ZIFA 2ZS8A 3E70C 2QT0A 2RHLA 3DVLA 3A4VA 3ZOKA 2NOAA 3AHHA 4DBLE 2O8FB 2J7PA 3IQWA 4GYYA 4V24A 4W63A 3T5TA 2IZ7A 1QCCA 3BILA 1ZNYA 5M34A 4C1BA 2V8OA 4JZKA 1BEZA 1E3LA 4BX9A 2HIMA 1KZ9A 2J08A 1EYZA 2FPMA 4I6EA 3LFHA 4URUR 3U9LA 3UMMA 1Y8RB 5B1SA 5EZ6B 1Z33A 3TIGA 2W22A 2AN9A 2DWUA 4M4SA 4MJXA 4Z7OB 4ZVKA 3I01M 1T5DX 2I1LA 4JP1A 1Y82A 3CNNA 3ASZA 1Z5GA 4BVLA 3UJHA 5G4LA 4A2WA 4R84A 2JRLA 3VNBA 1EVQA 1SXJC 3RVDA 1G55A 5M2QA 5IANA 4DRZA 4LRTB 4G5OA 4M0UA 4BZWA 4ID9A 1J2RA 5A03A 2YJNA 4GEKA 1EVKA 1SD1A 1VL1A 1WY7A 3ZS9A 5G4KA 2PH7A 4J8PA 4KHPB 2GQ0A 2FN4A 3AR3A 5AVKA 4R01A 4RHYA 3WYAA 4O5OA 3EG9A 1XDWA 3AI7A 4JEMA 4PS1A 3WWOA 2FCAA 1UPTA 4V0MA 5HQTA 1U3UA 2OM6A 4IIJA 3SIXA 5CFPA 2Z6QA 1UR5A 5ENZA 3SE7A 4DLRA 3N6RA 3H8WA 4DMFA 5EJ9A 4W5TA 4NXMB 2QYOA 1GZ5A 3LT2A 1T4DA 5HKKA 3L18A 3V9PA 3GY0A 3QUTA 1DWOA 4B5LA 5LDHA 1WXDA 2Q7DA 2XITA 4FB5A 2ADFA 2NSDA 3I01A 4UFOA 4WCVA 3RHZA 5I4CA 1K2VN 4ISCA 1Z9BA 1ADBA 5C46F 3LVQE 1PNOA 1ITZA 3RARA 1KQGA 2GB4A 2V9ZA 4DL9A 4GGPA 1GCGA 4Z99A 1AU9A 1FYXA 1AQUA 3DWEX 4CQMD 4E6EA 5D5PA 3WRWA 3AF6A 1MX1A 3KLBA 4MHSA 2HREA 2X23A 3GJSA 5FHRA 1C3OB 2ZBPA 1A9SA 1P8JA 1HM5A 2GNAA 2YNMC 1EWRA 3I9JA 5LJIA 1DEXA 4OV6B 4DV4B 3VJRA 2YMMA 1UPUA 2QE6A 3Q3VA 1KQFA 1B2LA 2X2PA 3LUJA 5I9MA 1DTSA 3C6BA 3VH2A 4P1ZA 5ICGA 4P7GA 4QXRA 3UMCA 4PLHA 3GYBA 2H0AA 4KXUA 2DU8A 3AP2A 2CFCA 3HYCA 3ZDCA 5JJIA 3U6BA 3OHPA 3EUFA 4O1HA 5IVDA 3EIEA 4YJ3A 4JB0A 2C1ZA 3IUYA 3QHAA 1MVLA 1VMAA 4I1VA 4Y2GA 5IAEA 5C8YF 2BEJA 4LF5B 5IBRA 4MUEA 1HDRA 1AK9A 4TQGA 1J2EA 1LSUA 2B37A 1NXTA 1XT6A 5TQVA 4LWQA 1PK9A 2PR2A 1F5NA 3CJTA 4N01A 2PKQP 1JR6A 3K9HA 4LWZA 5TS3A 1D5WA 3R1IA 4Q9LA 5E3JA 2AG5A 4L07A 4EJ6A 1BMTA 2HLPA 4YR9A 4JXZA 4AJEA 2J85A 2I54A 2HW8A 1GITA 3GRUA 1OXSC 3QKWA 4KE7A 1ZGZA 2J4FA 4KV7A 5JAOA 1INLA 1N4AA 4N47A 3WDLA 3AYZB 3TVYA 5MF6A 3EARA 4QODA 2I7DA 3L82B 3Q6IA 3SPXA 4AZSA 3BGVA 2AQ8A 1YJXA 4BBAA 2VJMB 3WXBA 3GFQA 2GBIA 2J0UB 2OFXA 2ZRMA 3L6CA 1SFRA 4JI8B 3ZCPA 1HL7A 3R41A 2ZI7A 3FA2A 2YS6A 2RGXA 4AJ4A 3ELUA 4D4KA 4E70A 1J70A 2ZAMA 4IDFA 1QP7A 3TR6A 2ZJ2A 1EBFA 3FFTA 3L5OA 2WZCA 7MHTA 2XR1A 2DTDA 2PU7A 4YRMA 1FNDA 4L4UA 4JZYA 3U4QB 4CEHB 1KO1A 3CG4A 2GZHA 4OK5A 4RZ3A 3UG7A 4DZRA 4DR4B 4KIUA 1WBJB 1CRWG 1N3BA 2VDRB 4MW2A 4XUDA 3OQOA 4Q3EA 5J2UF 3M6FA 3BZBA 3TLZA 5IM4A 4Z7JA 2NUBA 1FLAA 1RJ9A 2OBYA 1MLDA 3CG0A 2LWIA 4ZCIA 1J0AA 1OY1A 3GNSA 3PUHA 1GN9A 4M1ZA 2VJLA 3IT0A 4CM9A 4F96A 3C6MA 3E8MA 1M73E 2RBKA 3F6YA 2XKAA 5I9BA 4DIOA 1NJ5A 1JJFA 2VDNB 3E23A 3HY4A 5GWXA 3WAJA 5LOVA 3WXMA 3RYHB 5CYOA 5DSXA 3QNWA 1Y8AA 2IE0A 2WT9A 2H11A 3PQ7A 4EVIA 3RYCB 1YULA 4B6RA 3JRNA 1YQ9A 4UTXA 3R7WB 4CM7A 4DA8A 3HWX1 1YE8A 2DQZA 2JD0A 2N46A 2R68A 3TB4A 3ZY6A 1W1IA 2JPDA 2I4NA 1C4OA 2JAOA 4LHYA 2PJDA 1KQOA 4D5EA 3WWYA 2K2WA 4OP3A 4X62B 3NH9A 4PZZA 3FKQA 1KJ8A 3G49A 3SEZA 3L1HA 3TSOA 1IJBA 1YL7A 2PKQO 4L51A 1N32B 3L0SA 2IT1A 2J4DA 3I5UA 2ZRGA 1D9ZA 1UBUS 5CU7A 4JV5B 3VX3A 2BY4A 5ER6A 1L4YA 1YQDA 3KZXA 1KP2A 4W8GA 2P69A 3QX3A 3IBTA 4TZ6A 1I0IA 2W2LA 2CXQA 3AB8A 3AY6A 3OFVA 5T6BA 2IPXA 3LYAA 4NEHB 2XXBA 1D1PA 2AFHE 3X2SA 2NIPA 2B36A 4B3FX 5G0UA 4NFHA 5TQ2A 2PNJA 3S7ZA 3C3BA 2B0JA 3DMGA 5KTPA 4BBPA 1LS6A 5G02A 1Y9ZA 1M6EX 3KHKA 1XTBA 2JGLA 4HATA 3RGGA 1DT3A 1PKEA 2UV8A 4G07A 4F91B 3K16A 2G77B 1CNEA 4H16A 4QHSA 1YGYA 4NPCA 4YI5A 4N12A 3JD4A 1JU3A 1N5DA 3PXAA 5AICA 2M1XA 1ZS9A 1NE2A 3E5NA 2MOKA 4LNAA 1J9GA 4OK6A 3UENA 2BIFA 1ZO8A 2GKSA 2J45A 1Z8DA 2QTAA 1KO5A 1LSOA 2TMDA 2XB2A 3HXPA 4U7TB 4WK2B 4JC5A 4LNUA 1ZIXA 2DFNA 2NWQA 2JAQA 3P26A 3RHFA 3RIHA 4ARUA 1HT0A 3ESRA 1UK8A 2COKA 2FV8A 1U2SA 3OO0A 1IZ9A 3VZSA 1NURA 4RXUA 2X4GA 3PNOA 3T3PB 3TIVA 1ECFA 3QLEA 4D9KA 1Q0UA 3WLHA 1IBRA 4A0RA 1BEUB 1U9JA 3AJAA 3O2QB 1G3RA 3N0TA 3Q3IA 3FTFA 2GFHA 3OE4A 2B8WA 1RIIA 2HO5A 2PS1A 1ZGAA 4I9HA 4AIIA 3BD7A 4M0CA 1NT4A 1DOAA 1NUSA 4WCDA 1Z08A 3RC8A 4H7IA 1QR6A 1VJRA 4IDCA 2I6TA 3AP3A 2GA8A 3OM0A 4GYJA 5NULA 1V9CA 3RE1A 3WMEA 5A3QA 1ZH2A 4CEIB 4RD1A 2F3QA 1HNZB 2UYGA 3FUWA 4MW7A 5JI3E 4OQDA 4O5AA 1P2UA 4BP3A 3COWA 3F1LA 1U2RA 4XX1A 1QIGA 1PDWA 4KGZA 1XTJA 2PUWA 3WB1A 1K7EB 4FS8A 5ALPA 3UHOA 3ZQUA 1BZYA 1SZCA 1Y4SA 2P9FA 3O95A 2VP0A 1UFRA 5BY2A 2WILA 3A9TA 4LQ4A 1CF9A 3H1BA 4HRYA 4HB0A 2P4QA 4CF4A 5CG2A 5CBPB 2Z5LA 3M6VA 4Z9BA 3LFUA 2DH5A 3N2LA 1LPAB 1DL5A 1NNSA 2NYRA 3SBDA 4BN0A 2X76A 2VZEA 3AHJA 2F1IA 5FOUA 1OLSA 4DGQA 2MU1A 3ED5A 3JRXA 4OU4A 5FOXA 3F49S 1TZCA 3OIYA 4OHRA 4A4DA 1BCSB 3SMVA 4WK4B 3RWOA 1ADJA 4JCCA 5CVDA 4X20A 4QL3A 2FQYA 4BAZA 3ZWPA 3HEAA 5KMGB 1BN7A 4EJMA 1RJWA 1SGWA 3BH7A 1DLIA 1PW5A 4TV9F 3R7DA 1WD5A 1A95A 4UUMA 3GWGA 4YXFA 1CIVA 2XTZA 4RTPA 3NALA 3T3NA 1E6UA 3IDQA 1QLWA 5B36A 1KMHA 2JLAA 1E5XA 4KXFB 1Z83A 4F06A 5HCUA 1SOMA 4M9CA 4MROA 2WJ4A 3JPWA 1FP6A 4B87A 4QX6A 2QRUA 2QLTA 2IV3A 3P2YA 2MWMA 3UA3A 3HRIA 2VQSA 2AE1A 2HCJB 3PP8A 2YQZA 4JI2B 1KU6A 2VJDA 3TLAA 2SBTA 2O2EA 2Y6VA 1UMBA 3OKPA 3SR4A 1A5AB 1PNVA 2D4AA 3N39C 1RKQA 2ATIA 3BM5A 5KQMA 2CE7A 4XWYA 1IG3A 1Z74A 2GAJA 1YACA 2WJGA 3QE4A 1I5EA 2V4UA 4H7PA 5BQOA 4FYXA 5L9AA 4U7PB 4ENPA 2ZIWB 1XXHA 4P3NA 4XPIA 1E1NA 1A3CA 1GSIA 1NVWQ 5JS2A 5FKJA 3PKIA 2RARA 2VSOA 3WE7A 4DJJA 4K0KB 2PLFA 3E22A 1PIWA 3HPQA 4PX3A 2JJ2A 3DE2X 3I5AA 1JW9B 4R9NA 3FCOA 3UPTA 1R16A 1S5PA 2XUPA 3ZY3A 3ZHZA 4BFXA 1DSSG 3DCYA 4G0ZA 5AHXA 4A91A 4PSVA 1UBCA 1NPTO 3D5QA 5I5GA 4EYEA 3IV6A 2Q3DA 5TC4A 1ZOOA 1W5BA 1YRWA 2QZPA 4NU6A 3WKDA 4CF3A 4QJ3A 1P1IA 1TC2A 3MGBA 2X0RA 2FPPB 3LMKA 5BXYA 1T5TA 2NQTA 1Q84A 3HB7A 4JEUA 1W4RA 2F3UA 4Y1FA 4PZUA 3MBOA 1M8PA 1SCNE 4GR9A 5CMLA 1G41A 1IATA 2ZYHA 3OA2A 4NX2A 4TMVA 1WMSA 2VAPA 1RWNA 3KU1A 4HXGA 3V46A 4W1QA 4Z2AA 5AVRA 5COBA 1E2UA 5LA6F 4F4HA 5EJ5A 4FGZA 1KDRA 4ZT7A 2JB9A 2J87A 3BGWA 4GVPA 1KDPA 1EFPA 1DBQA 2Q6OA 3OIDA 1DELA 2K87A 4FGWA 4AQYB 3B82A 2NZUG 4W7IA 1MXFA 4BUCA 5JXGA 3DFZA 3MTBA 2BMDA 1Q0PA 4PPQA 2BM1A 1W52X 2OXFA 5BNWA 1XPUA 4RVCA 2HM7A 1K4MA 3UWMA 2YHUA 1Q7RA 4Y6PA 4RD0A 4M9UA 1WNFA 4ZDWA 4ZEXA 2YUIA 3KQWA 1NXWA 3QOWA 3DKPA 3A2KA 1JKFA 1U7ZA 2XE8A 2YWEA 3O9MA 3HLTA 4AJNA 4J03A 1TKCA 4PVCA 1TMGE 3R4VA 2W2PA 2PSJA 3JPYA 5EKXA 3TAHA 4ALJA 1QGDA 5ECYA 4EPTA 1TJYA 1VM6A 3AKYA 1JVNA 3VZRA 3FPJA 1OREA 4QOFA 3ZHVA 3TE6A 4L8YA 2GXQA 3CEAA 1OF1A 1E9EA 2IUYA 1DCKA 1QRAA 2B4AA 2XVXA 4TRJA 3RC7A 1RTKA 9MHTA 2IF2A 4FDVA 3BCHA 4P7KA 4KQ9A 1IOLA 5L45A 1T2DA 2RCYA 4GMDA 4PYRA 4RJ2A 1UC8A 3VV3A 2Q5JA 4HDKB 1IBCA 3L6RA 4WA8A 1TM4E 4X9XA 1T2AA 2GPBA 3L07A 4O3FA 2ZXEA 3ZWAA 5JRZA 1VRWA 3WISA 1JILA 2YY7A 4HBZA 3U44B 1HMPA 1YCDA 2COUA 2JBWA 4Q7EA 5A71A 3YASA 7MDHA 1CHNA 1FVXA 2OCXA 4ZVTA 4YMTA 4Z9AA 3PXCX 3IKLA 4UOQA 2EJTA 3F73A 2KM1A 1OTXA 3OEHA 4EDFA 1P75A 2BFFB 1X7YB 4U7JA 3Q72A 4ZYVA 1QF6A 2XHEA 1DQNA 5A02A 3EMKA 2NAPA 3I2GA 4R9RA 5D86A 3OEED 4JD5A 1XLVA 3OIFA 2IBTA 4IRMA 4BE4A 4EW3A 3MZ0A 3G0IA 3HJCA 2C4TA 2P9TA 2VG8A 4UTOA 5ITZA 3K0AA 3SM9A 4B9AA 1Y7PA 3EODA 3HCRA 1V2GA 4X71A 2OXEA 3QELB 1UT8A 1X14A 1XRPA 4IDOA 1GQFA 4UNSA 5THQA 3FCYA 5EIBD 4ARVA 2HXGA 3FOWA 1D07A 4P6VF 5ARCA 1R8YA 1KORA 3COSA 3RS8A 1KIFA 4BO7A 4PHHA 4G5XA 1NP7A 1PWYE 1N2OA 2ORIA 2QN3A 1X92A 3UM9A 1XZPA 4YRGA 3BVPA 4NAUA 4HLNA 3R3YA 2HV8A 5D3MA 1XC7A 3TAUA 2QYTA 3RS2A 1HC7A 1N4DA 5K0BA 3ABOB 3EDQA 3B5JA 3FNQA 3R5TA 2BHLA 3NAMA 2OKGA 3BX1A 4UVGA 4CG0A 1MAVA 2WFZA 4EF5A 2O8DA 1RW4A 4L85A 1JZQA 3SI7A 4JJ6A 3BWXA 5K3OA 3SYLA 1TVMA 1MC4A 2JGEA 1NV8A 4CT4B 5TQ0B 5BMVA 3Q15C 3QYFA 1PO7A 4HYYA 4FSXA 3D3QA 5E8JA 4EPYA 2W2MA 3QH4A 4JMLA 3SJZA 1ISGA 3ELWA 4NKRA 3WLOA 2Q4OA 4AZ3B 1L8OA 3JQAD 3C39A 3QE0A 4B8YA 1B0AA 1BWQA 2WSSD 3B3AA 1RPJA 2ZWIA 1A4UA 3I2HA 3P0RA 3ZI0A 1EXWA 4I14A 3UAWA 1OYVA 3DC2A 4IRXA 3IOYA 4ZCSA 4JI6B 1O08A 3IAAA 1QFSA 3FOAA 3V33A 3JD2A 3GJXC 4TSFA 2O8CA 5EJGA 1IQUA 3D7LA 4LJ7A 4DC0A 5JSYA 3ABQB 1QYDA 4C03A 1NMXA 5DPMA 3WGJA 1QM5A 1ZBQA 2GLTA 3CE6A 4HVAA 4MWBA 2Q8PA 1V8FA 2OPBA 1QRRA 5EIXA 2C2HA 3EDCA 1M2VA 3HJUA 5DLYA 2VRWA 2WOOA 3OZ7A 3WL7A 3LNTA 4OATA 3F7NA 1Y3CE 5AKIA 4DIMA 4CUJA 3E1GA 4DLUA 2WWWA 2AK3A 2XMBA 4GI2A 5B58T 1V4VA 4BZXA 1EXDA 4WLNA 2Z5FA 4BIIA 3ETLA 2I7CA 1Q5PA 4FW8A 2D7JA 3WVNA 2A94A 3BL6A 3EIXA 2EXXA 1L7VC 3ROKA 1LVHA 1G5FA 2VEOA 3R5FA 2QQ0A 1EK5A 2QN7A 3W2GA 8LDHA 2PAAA 4G36A 1IXYA 2EP5A 3DBHB 3T38A 2BFEA 1KKUA 2WAXA 3DAPA 1SKQA 3R8XA 3TM5A 1N2BA 3O1HB 1E2JA 1SBNE 2AZMA 4UUOA 1UJ4A 2V6JA 4EK9A 3UEOA 1G2OA 1R0WA 3MMPA 1OX6A 4NYIQ 1KYIA 4E5KA 1SULA 1VJ1A 3GN2A 4O4LA 1E6KA 2CVHA 1YRLA 4YWJA 1O95D 1MV8A 3I8OA 1HQKA 5ERYA 2QRJA 4CI9A 2CXHA 3TOSA 1YAHA 3W77A 2R79A 1Z4PX 1WQ1R 3RB8A 3H16A 4J0EA 3ADPA 5DFAA 4E31A 3TX2A 1Z2NX 2LCIA 1YS7A 3MS7A 4E08A 2DECA 3PTLA 2IOHA 4L02A 4M76B 2QQ5A 2H0QA 2Y05A 3I0ZA 3MILA 3EIFA 4RSHA 5AVOA 3R3WA 2Y1FA 3FM9A 1QCZA 2G4VA 2Q1WA 1FUKA 4NZZA 2V6MA 5BOSA 5KOHA 1Z6ZA 3QMMA 5MN4A 2XXAA 3ZE8A 1T9AA 3BGDA 5IHXA 1IU9A 3HJBA 5ES3A 4D3FA 2NPFA 3VDQA 3ZCVA 4BCDA 2BF4A 3Q2KA 5K0LA 2ERYA 4MR8B 3ZBTA 4KR7A 1GDHA 6LDHA 1I3NA 3Q8KA 1M6YA 2CUZA 5K7SA 3C5HA 4HAXA 2ZR0A 3K0FA 1A77A 2FP3A 5ULLA 3TZCA 2WRZA 3KAKA 4KPUB 3PHJA 3C5EA 2N42A 4MEAA 1OTHA 3EVCA 1M5TA 3PGLA 4LA4A 4MZXA 4CV1A 4HI0E 5EWMB 3C6KA 3EDRA 1QHHB 4Q1BA 3VAYA 2B4RO 1TD1A 1XZKA 1UBFA 2QJFA 4C7VA 4EJFA 1GRNA 1RC1A 1H0KA 1GA4A 1SIWA 2WMDA 3IYLW 1LBSA 2GN9A 3O3CA 3PHCA 4YASA 3UAYA 3WA7A 2I76A 1IC6A 5AUQA 3WMWA 4BP8A 3BD9A 4JKOA 2M6KA 4YO8A 3JVEA 4OPMA 1VHJA 4D9GA 2A14A 3PC6A 4IVRA 1LLDA 4HVTA 2B34A 2ZJAA 2Z43A 3DMNA 2NTJA 4FMBB 4GOLD 3ETDA 3FMGA 4FK8A 2WE8A 1ODTC 4MQUA 4XVCA 4GKJB 1UJCA 1C9EA 2V7BA 1HH4A 1HK7A 5F52A 5BUQA 2HI0A 1LNZA 1GFIA 2R97A 2YW2A 4LQDA 3B7PA 1O4WA 3KT6A 3KSZO 3TFQA 1FP4B 1RYNA 1CY6A 4L5IA 1K0UA 3CONA 3D8UA 1MFPA 4C0SA 3B52X 4F4IA 3AK4A 1B41A 1WXHA 2B8EA 3LO8A 2H1OA 3NS7A 3S2ZA 1SKYE 5B57C 1J1UA 4J16A 4C0JA 2HIGA 4QU5A 3PGXA 5BV2P 2F3PA 1TE2A 2HJWA 3KQKA 5CFZA 3AR8A 2B8JA 4NCXA 1VSBA 4DJ5X 5AW2A 2F67A 5H3CA 5KCMA 1WCV1 1WHTB 1WRBA 3JX9A 4I50F 3LWBA 2EX4A 1AKNA 4GUAA 3BXGA 4RWZA 3TSAA 2P8SA 1P5RA 2CBXA 2OBNA 2QLMA 4LBYA 2BSAA 1PJ2A 1VHQA 1R4NB 3IILA 1W6UA 3N2KB 1PEKE 4BVEA 2RB4A 2F2TA 2G83A 3DR3A 4BBJA 2Z95A 1XYYA 2P3QA 3H65A 2XDWA 4N9WA 1YB4A 3GRPA 4MGYR 1YHNA 2YRXA 2A5LA 3T9BA 1RPNA 1UBHS 1VHTA 1R3DA 4TUYB 2XA1A 2FDCA 2CJFA 4ADSG 2G40A 2FUKA 3MVEA 4JT8A 4O2AB 4YDRA 2NT4A 1L4EA 2ZUSA 3C3AA 3SJBA 4DA6A 1JPUA 1UMCA 1EUDA 3NHKA 4OA5A 1YQQA 2JJYA 4ZO4A 1IAVA 4ZYTA 1AO0A 4LRXA 2PKRA 2YFQA 2YV2A 1NBEA 3QITA 3DEYX 4HQRA 2Q1TA 4AULA 1ZPDA 2F9MA 3KSMA 4LRYA 4AK9A 4R81A 1PVVA 4NU0A 3ZGVA 3NKVA 3ONEA 2ZSDA 3OT1B 4RZIA 4PQEA 4US2R 1QLHA 1QRTA 1DB3A 1FFCA 4GDMA 1U6KA 3F3YA 4NCIA 3SR0A 5HPYB 4R51A 1BXGA 2D54A 2WV9A 4NIMA 3UJ3X 4HXEB 4N40A 4DYHA 4D4GA 5HX7A 2AFIB 1GRQA 3ZWVA 4G1UC 3N75A 1IYZA 3BBLA 2HHAA 1XCOA 3DPIA 3FCEA 2PCLA 3K4QA 4HUQA 5E2AA 2GAIA 3RWBA 4R1TA 4R68A 1ODJA 2ERXA 1JHAA 2RHTA 4JLWA 3VNSA 4WEQA 3F47A 4JLUA 2GETA 3I64A 1OGYA 2C04A 4DR7B 1Q1AA 1R74A 4IG9A 4RTQA 4YRRA 2XEDA 3HGQA 4IAOA 3KT3A 3GRZA 1AUVA 2FEKA 1R0SA 3TLJA 2XWQA 3DDUA 3UJBA 2HJVA 3H04A 4UARA 4Q7LA 1NE7A 3S28A 4ITUA 1GTG1 3SD7A 5IKPA 1M10A 1HA3A 1IUNA 4UZFA 3H18A 1DWQA 2A2ZA 1WU7A 3FYUC 2ZR9A 4QYTA 3IHWA 4RORA 3RYTC 5EEGA 3UMBA 4M7OA 5B37A 1XMOB 1JLSA 1CJUC 4DCMA 3LPAA 1XTUA 2N0SA 3EEFA 5G53C 1IWPB 2HRQA 1G4HA 5GJVC 1VG0B 2PMFA 2Z8ZA 2VNIA 3IL2A 2OGUA 1KAQA 3OX4A 3WK7A 3GDHA 2VKQA 4ND7A 1X3SA 1U0HC 2HJHA 2YKGA 4GFDA 4U2CA 4CQNA 2ECKA 4FDUA 4KFSA 4U7WA 4YDQA 1MUUA 2HN9A 5DEOA 4ZGBA 3P9IA 2ZZKA 1UBSB 2B78A 2QV7A 4YYZA 4BFZA 2BJVA 1Y4ZA 1AB5A 5JTTA 2Q8NA 5LYJF 2J46A 1ZCFA 1HKHA 1ZH8A 4F6RA 5IF9A 4M22A 3A4IA 5J40A 2GM9A 3MTQA 3BMCB 4FJ1A 1IVNA 1F51E 3AEKA 1CBUA 1Q6YA 4KUEA 2ZJOA 4M0LA 3VNRA 1BRMA 4YUXA 3CS3A 3E0QA 3C3KA 1KBQA 2QUAA 3ZHRA 2HUNA 3PG5A 5HQJA 1UP4A 5EVCA 2GM5A 4G0QA 1XDDA 1CQZA 1THMA 2JGAA 3HU2A 4PAOA 1USKA 1SOUA 3AVPA 1N77A 2CHEA 1QVVA 3DO6A 3TG2A 5HFAA 2HF2A 4QJBA 3B53X 3PFWO 1Z2CA 3FYHA 3QF4A 5JZ9A 3UMFA 5L3QA 3H17A 2XRZA 3M5WA 3PE3A 2E5FA 4QU9A 4KVZA 2QP4A 3NJRA 3O4HA 3B89A 2KMLA 4C7MA 4G0VA 1G20B 2AZXA 1GARA 3JV7A 3OZFA 2XUOA 2P9JA 5DEIA 4TYYA 1C7IA 3LI2A 2DHEA 2PAFA 3TTVA 1T8YA 3MYYA 4BNZA 1KRXA 3NEJA 4ZT4A 1CUYA 1HE4A 2AG8A 4NBLA 3WRYA 1PNTA 3TJZA 1XA0A 2HMYB 2HA5A 3QOYA 4XFDA 2PYIA 3EGXA 3OSUA 1RYYA 4N5MA 4DSZA 3FKJA 3R5KA 2WTXA 1IY2A 1KZ1A 2J3IA 4AT1A 3BULA 1CQPA 1NMSA 1TZ2A 4GE0A 4TWZA 3U4GA 1RQRA 5DN9A 3D7NA 4HEHA 1XD8A 1QH9A 1KBZA 2OUKA 4CR8A 5JAZA 1HPLA 3Q87B 3TZEA 5AJZA 1QF7A 1EVLA 4P58A 1E9CA 2J6BA 3N2IA 3KJFA 4XGRA 3JD3A 5ELMA 3Q85A 1I0LA 4MO9A 2VBCA 4D9HA 4RVNA 4LEIA 3SKXA 3STTA 2V7EA 3T7KA 2ZUVA 5K03A 2YZ2A 3DOJA 5ALVA 1K8RA 1WSDA 5DHUA 3H0EA 4YBZA 3WB9A 3UT5A 5BSGA 3FYUB 4U8GA 1ESCA 4JUBA 1HTTA 5KNCD 2MIIA 3R9KA 4Y9TA 2W43A 4XQ9A 2O2ZA 1GVHA 4NXNB 3OUZA 2E4UA 3NBYC 5HOEA 3FMOB 4C7BA 1VCNA 2QW0X 1MF7A 3LLMA 1I6WA 2CXTA 5DP1A 3D3WA 3M3DA 3N0XA 4KQGA 2DM6A 1JA1A 2BEUB 2H00A 3B1FA 3V7UA 3X1XA 1TUBB 5F1OA 1ESDA 2O3TA 2QM0A 1OR8A 2WLSA 3RSFA 3T61A 4BWYA 4JYCA 3FPHA 5IXSA 2QTLA 3ZNNA 1OFUX 4BNXA 2WJZB 5JAUA 3V4ZA 1W34A 3JQEA 4XGIA 3DE6X 5KYTA 4HEJA 2DH6A 2A0YA 3EVTA 1H3EA 4B75A 3CLUD 1XTIA 4G5FA 1F7VA 1ZOLA 1BCRA 4MJ3A 4POOA 1RXUA 1XLUA 1KU0A 2YMLA 5JSUA 3GBVA 3DE3X 4ABTA 1HI9A 2ZYTX 4LZPA 1VRCA 2AWNA 2NUAB 1RZRD 2FXIA 2DBZA 4ZK6A 5TVKA 3TE7A 1X7ZB 4EBBA 1P2FA 2PZJA 4G5YA 1HOXA 1JFVA 2XVYA 1N6KA 3ZDRA 3U3OA 3EZNA 2BM8A 4O4JA 5JYCA 2V7QD 3QKUA 3PNPA 3Q9NA 4MVWA 4Q0MA 1ODLA 4EZBA 2JIRA 3DBVO 2I67A 3SQOA 4C4SA 2D1SA 2JFOA 1B6RA 1LPPA 3H2BA 3VKWA 4BQQA 3PVZA 1PD1A 3H5LA 3L92A 1H2BA 1ORHA 2FGKA 3T6KA 2HC9A 3VV2A 3AOEC 5IDWA 4B73A 4HH4A 4QD3A 4RMHA 4XIYA 2VIIA 1R8JA 5CFNA 5TEVA 4YMGA 4YJFA 4S3MA 3UY4A 1FP2A 1OT5A 2YYAA 4KXQA 4U2FA 4V0NA 4ZQFA 1OXVA 4WADA 1V8ZA 3UN1A 1K92A 4BNUA 4C08A 521PA 4JUAA 3K32A 4M0PA 4CTJA 1XRSB 3THXA 1TT5A 3KJIA 4L9SA 2PT5A 4OYYA 1HF3A 1E96A 1OC2A 2TRSB 4Z8XA 2YC4C 2HJSA 1I4TD 4GOOD 3PX3A 4HWRA 5AD1A 4B4VA 2R96A 4ENQA 2XWSA 5JD5A 1T91A 1IN7A 4BQRA 4C06A 4C6TA 1GYRA 2IYTA 3LCCA 4RU1A 4HJRA 4CF7A 2VRNA 4YAGA 1LVUA 3GBSA 2VNHA 4I55B 1W85B 4JC4A 2EV9A 2R6AA 2NZJA 1GSAA 3KZMA 4UM8B 4YB8A 3ND7A 1QVWA 2F4NA 2JJQA 4MQFA 4P33A 3V3TA 2ZOSA 3VR5H 4U7FA 5LQAA 2F55A 1K4KA 1J99A 2X0NA 5EMKA 1IK6A 4IFEA 4MVJP 4EDHA 4AYTA 1H42A 3CR8A 3F6PA 4MRNA 1YI1A 4PRKA 1POXA 5A5VA 1H2XA 4Q9JA 1LQ2A 1P6XA 3P7MA 1YT5A 2QN2A 3RSQA 1KK2A 3RC2A 1SJ9A 2Z04A 3KJHA 2GM3A 4LXTA 2ZBFA 1M5UA 3PCTA 3UXMA 1OJLA 4JA0A 4NV0A 3QKRB 4PQRA 1QCYA 3CB4A 2W6CX 4FB4A 5KQGA 5ED4A 4KXWA 5DWQA 2X8JA 3ZIUA 2GZRA 4LW8A 5DW3A 3PDUA 5KKAA 5TF0A 1HDEA 1KP9A 2ZIXA 3HKEB 5AJXA 5IT0A 1XJQA 2RGNA 1U4NA 3BTSA 2FCRA 3UK0A 4LAFA 3U4HA 1M1ZA 4ZFNA 5IN4A 5JAPA 2F1RA 1I6LA 1JEQA 2FW7A 3CUTA 2X40A 1QHNA 3PTZA 2IIQA 3E3OA 2O06A 3P4YA 5REQB 3G2IA 4QEZA 3WYGA 2IYZA 3HUUA 2I8CA 1U31A 5GOTA 1I3MA 2I4LA 4C4XA 4HFJA 1L6RA 1XA4A 4CKEA 1VKNA 2ZU0C 3Q8XB 4QUAA 4WN3A 3RUEA 1YJQA 2C29D 2JCGA 2NSHA 2XZPA 4PX2A 3NBMA 3TMKA 5HCIA 3AR5A 4QG7A 4BXOA 1RMTA 3LOQA 1JIQA 5JATA 2A0UA 2FFBA 1Z7YA 1IZ7A 4RTLA 3LRXA 3KEOA 1WUTA 4KRXA 1TEHA 5AI8A 4C14A 1ECLA 2O5CA 1H2EA 7ADHA 3V34A 1XR3A 2C59A 4ACBA 3S1SA 3SSMA 3FSRA 1HDGO 4EO7A 2O3RA 4Z1OA 4B8WA 3H1EA 1GLGA 4JOCA 1MC1A 2FP4A 4PLWA 2DUWA 1ZYUA 4LCBA 3JQBC 2QRGA 1I1NA 3EXEA 4DCGA 1Y7IA 3GL9A 3KJGA 4Y2VA 2M1ZA 4DLWA 1JR3A 1CZHA 2PGLA 1JBQA 2VTDA 4Q4LA 3IBFA 4HNUA 5IF3A 3SOZA 3G2LA 3CBQA 3O1JC 2XI4A 3F3SA 3EAGA 4Z4EA 1JDVA 3THWB 3I4CA 2XD9A 2P62A 3ORHA 1ZRNA 5KYXB 1GNLA 2O2IA 4MVJD 2COEA 3LM8A 1H85A 3HJNA 2AN3A 5DV9A 3AVWA 1LS1A 3AFGA 4UVHA 3UOWA 4D45A 1UUFA 3LK7A 4BNFA 2ZREA 2FZGA 4KTVE 3L0OA 3W3AH 1V41E 4F9GA 2VR1A 3P2EA 4G89A 1G7RA 1SELA 4I4TB 4RGYA 3T3GA 3DHNA 2QXTA 3KQYA 5ESXA 5P8WA 3X1WA 2DSTA 1II0A 1A9YA 1Z4MA 5MFZA 5EJMA 3K1YA 5KEIA 3LNCA 4DT1A 4DWOA 4P4GA 1TU0A 4XCXA 2UZ4A 2CSXA 1NP3A 2RC5A 5ICEA 3JATA 1OHHA 4ZI3A 4YRBA 2O23A 2QTRA 4YJHB 3H87A 4YV0A 5BQ5A 1E9BA 4R7TA 2TMGA 4PHFA 2B1RA 3JY6A 4AWXA 4CUKA 4XWWA 1F60A 1EM6A 1TXGA 2QY6A 4G9GA 3LY9A 2BGWA 4O2BB 1Z8FA 4L9WA 1CUDA 3MNFA 3ZYCA 2G9ZA 2IEBA 1QJ4A 2PKXA 3JQ8B 4PPYA 3LSTA 3NBXX 4PG8A 3GLGA 2NUPA 5CR9A 4ZV7A 3UMJA 5DDIP 3UJ9A 3WYBA 4U9IS 2CLSA 3QVMA 4IWNA 1SAYA 3P4UA 4UASA 5A06A 1BMQA 1SCKA 3KALA 4NY1A 5J5CA 5C32A 2PK3A 1NMQA 1OI7A 1PL6A 3WP1B 1CQJA 2QTBA 1QBKC 1ULSA 4NJMB 1RTTA 2AZ4A 3PXBA 4BNWA 1A7JA 1JHMA 2IXAA 1ZSVA 1X70A 2ZTSA 4UCQA 4NE7A 5EKSA 1O94D 1IY8A 1YQUA 2XOKD 3EY4A 1LH0A 3OPMA 3MWEA 1IHYA 4NBTA 4A5SA 2O05A 2CLFB 1N3IA 4FYIA 4B3MB 5FWAA 5TPZA 4GPZA 2BTOA 4I1OA 4HXYA 4UEKA 2CHFA 1CUUA 3VRHA 1EFCA 4BHTA 4DANA 2PUAA 3PDCA 1M8FA 2FETA 2HUPA 3DDCA 4Q47A 4I8XA 3W7BA 4DR2B 5A1TA 2D74A 1M8KA 1U2GA 2QQFA 1TZKA 2YWHA 3UQYS 5K6AA 2PRJA 2JIMA 3TMYA 4HLUC 5A6VA 5L3RA 1L0BA 4N39A 1OQAA 4L78A 5EIHA 5E8RA 2HMAA 2VUHB 4M8IA 4CF5A 4UKDA 1I33A 1L7BA 4PU0A 3I9OA 3LDGA 2QSYA 5CLFA 1UM9A 3AXSA 2PJUA 2E87A 3N70A 2PVSA 1A8HA 1QZUA 1FP7A 1BDIA 3MRSA 2CXUA 4F84A 4YC7A 4LWPA 1P2VA 2CYBA 4U2KA 5K51A 1XMJA 3IAXA 3CLTC 3FRIA 3BJZA 1Q95A 3P9NA 1YO6A 3KJNA 4LF9B 2OTCA 4MUKA 1MD9A 1P0QA 4JJAA 3FDZA 4OO3A 5E38A 3H4VA 3HL0A 1CR6A 3A06A 2Q4EA 4M7PA 4NL4H 3G7SA 3NO4A 3GZJA 5TY0A 2PR7A 2BRUC 2WSBA 1GPNA 4ZRNA 3VFDA 4A16A 3SC2A 1BH6A 5FPHA 2WM9B 2NU8A 1E5LA 1TKRA 2EW8A 4MKRA 3S4YA 2XTAA 3LYHA 4PNEA 4C9BA 4D97A 3RUFA 5E6RB 2HKIA 3PJEA 4LRSB 2BFPA 2EQ5A 5TB5A 2P4SA 1FQKA 4N6OA 3UC5A 1YC2A 5JQGB 4J0IA 1SBTA 1V96A 1W48A 3IUEA 4DSAA 3OQIB 2CMDA 3NX4A 5DO9A 4FMPA 3W7VA 4ANFA 6REQB 5IKEA 1L4NA 1DX4A 2J3LA 2IX9A 3C97A 3E1KA 4IIJF 3UGQA 2CKDA 4GP9A 4PHGA 4FKMA 1RRFA 1ZK4A 3FRHA 5ENDA 4DMKA 3SIWA 1CYEA 3W78A 5GZ6A 1PFGA 2W11A 1C1DA 5U4XA 3EF1A 3AV0B 4BTLA 3RIXA 4I66A 1XZNA 1OB5A 2C8LA 1JXMA 3RVQA 1QHGA 5CDTA 3CVXA 1MQ9A 1WX1A 3V00A 5HBRA 3ILSA 2AF4C 3BERA 1SBYA 4M1YA 1W88B 4PZCA 2YFYA 3WO1A 3U4IA 3EBLA 4D4MA 3PQCA 3C87A 4EB0A 5JZOA 2Z3WA 1YZ3A 2JLSA 4OBEA 1P31A 2BBOA 3A0UA 2YXNA 4O8CA 1RWBA 5DBEX 4EY7A 3HR4A 4EMSA 1KSGA 3QLJA 2P2DA 2OLJA 3LKBA 4O3MA 1B73A 1Y8ZA 4P9NA 1J5PA 3EISA 3H5IA 3LUDA 4RD6A 3F6BX 4YTEA 4E5UA 4QBTA 1Z18A 4PY2A 1GG8A 3BA6A 3UPUA 3L04A 1E5QA 1PEYA 3PNLA 4JX9A 1XELA 4YJ3F 2B7BA 2PU5A 3I04M 4H7HA 2AOUA 2QRMA 4XWAA 2VJPA 1CHDA 4KQIA 1XZEA 4ALLA 1DEAA 1A88A 1MAAA 3A1EA 4KK3A 2FUG1 3I12A 2QBYB 4I99A 3W2EA 1A96A 1I51A 2RJNA 1NVUQ 3DVRX 4LZJA 5BSTA 1JBKA 4YPVA 2ASVA 3SJ7A 3EHEA 1WETA 3B38A 4PRLA 1JS1X 1C30B 4WLUA 4B4WA 4UREA 2I3ZA 2R85A 1SBHA 1NDHA 2WYVA 2WY2D 5IDYA 4K6MA 3EFOA 1E79A 2JKYA 4LY3A 4IVQA 3QPBA 2WAAA 5DULA 1LTQA 4Z4HA 5CD9A 3MEQA 3ZZ1A 5JPIA 4KPEC 3R8FA 4B46A 2EWMA 3I04A 3KYDB 5KNDA 3QPUA 3M81A 4EF4A 3HO1A 3L8GA 1QYRA 1RAEA 2XMPA 3BMOA 3Q7PA 1SA0B 3HPRA 2MINA 4WBNA 1P2BA 1N1GA 2LNDA 2ODNA 1G8AA 3L93A 4H9GA 4RS4A 1F0NA 2OE2A 2QRVA 3H97A 2AC7A 5ECGC 1QIIA 3JZDA 3DSRA 5IM4F 3KZ1E 3BRWD 4OM7A 1HRDA 1SUFA 4WRRA 1X87A 3J7TA 1SVOA 4OOFA 5TF4A 3VGJA 3VU1A 1UXHA 2J9ZB 4RA9B 3OTOB 5IAAA 1SHLA 4RA6B 1NVGA 1YF3A 3VJMA 3W1WA 4IUYA 1HNNA 4OHUA 2XNKA 2RGEA 1WUJS 3VH1A 4CWAA 3ZVKA 1MIOA 3KV3O 1NLYA 4MVJM 5CLQA 3EK2A 3I9KA 1I2DA 4KX5A 3AJDA 4MWEA 5LOVF 1IBLB 5AHRA 5I7AA 3JWHA 1FY2A 3N5CA 4IYJA 5KNBD 2GRAA 1HDXA 1Z7GA 4QRDA 4YLGA 1GGHA 1KPGA 3UJPA 2A9QA 1Q0SA 5DB4A 4ZJUA 1P1CA 4PXAA 2NO4A 2ZULA 1HR0B 2VVTA 2EBWA 1AUOA 1WY5A 4KO2S 1XRQA 2FGJA 1QE3A 1TJ4A 2XYQA 3L06A 1RKUA 1U3VA 5JFOA 4H6VA 3G1WA 3ND5A 4LJKA 2O0HA 3U4AA 3G8AA 1VI5A 1ACLA 3Q0TA 4QGFA 2PUFA 4WZAB 3CV3A 3GV0A 3CUSA 5IC5A 1Q14A 1L4UA 4LDQA 4QDJA 2V96A 4Y18A 5LQNA 3SS9X 1A7KA 1M9NA 1DZ3A 1Y9EA 3H7AA 5TIIA 2Y71A 3H6KA 4GPEA 3EHDA 2O8NA 1B8OA 4I6GA 4CG2A 4EYQA 1XB2A 4MYHA 1X8LA 1T5SA 3BDVA 1X39A 1VLQA 2G82A 4IO1A 3ZU3A 4CMIA 3N5KA 4KWIA 4IMPA 4B6JA 2PUEA 3I8SA 1Z0ZA 2LIVA 2Q5FA 1V43A 5JFTA 1NVMB 1C9JA 5FPYA 1PZMA 4MDFA 2G9RA 4M54A 1B93A 2VHCA 2WD7B 3R5HA 1JEOA 3JW8A 4W5HA 3LH5A 2BM0A 2NV0A 5CB4B 4JJEA 1P9NA 2H0RA 3UUEA 4RETA 5HF5A 4GI7A 3H5OA 1XZLA 3KFXA 4KGDA 1KFCB 4GKKB 3L9WA 4XARA 1ZH6A 1XRLA 5CVUA 3EYWA 2JH9A 3IKMB 3LPDA 4IXDA 3COZA 1Z35A 4QUJA 1QUEA 4BEVA 1KY3A 1U98A 2C9CA 2QUJA 3U0BA 2QR3A 1Z3IX 4KWCA 3ZXYA 4D9NA 2W0MA 5PNTA 3SDBA 2HZ7A 1WXXA 2YS7A 4E12A 1V3UA 2JBHA 1I7QB 3AJRA 5L6LB 1CB7A 5AIBA 1C9YA 2V3VA 3KXKA 4YS6A 2C3PA 5IEJA 4BC0A 5C4MA 5CLJA 1UH5A 2DFDA 1CY7A 2C4HA 4UTZA 1VLJA 4BFTA 2XUQA 1PQ4A 2CFIA 1TEXA 4IUBS 4MW4A 4A9AA 4JQSA 4TTIA 3KHTA 4N8DA 4LJ8A 4LDNA 2WUFA 3ZE6A 3KC2A 4AMGA 1PWXA 3OCZA 3W4JA 1FXWA 1EDZA 4L28A 3GN1A 1Y33E 2OV2A 4BTEA 3W5SA 1AD2A 1GCUA 1A9OA 3FVTA 4L8FA 5F1KA 3O47A 3FPSA 1UWVA 4HGQA 2PGOA 4KZKA 2IXGA 2IGBA 3V4VB 1BS2A 5IBPA 2BEWB 2ZBGA 3I37X 1RKXA 1FDUA 2QYSA 3UAVA 4W5OA 1ADCA 1VHWA 2FK8A 3L8YA 1YASA 2VATA 3NUGA 1BVRA 2CDBA 3IUNA 1W6RA 2VP2A 4NP6A 2AOTA 5E7QA 3VPFA 2XUZA 4BMPB 2WHPA 1K6JA 3H5AA 4Y6QA 3O83A 1J0BA 1GG5A 4ME6A 4NZYA 5D1HA 4OM8A 2QUZA 3NU1A 1YBFA 3LVBA 1EWVA 1AH2A 2VSXA 3HN2A 5C80A 2RHHA 1P4SA 3JYOA 2DR2A 1GTL1 2P67A 4MR9B 2GPNA 4AECA 1T2VA 2AN5A 2Q29A 4FM9A 4J1QA 3JSXA 3U61B 3HMQA 3ONFA 2RGBA 3DLBA 4B34A 2Q2VA 1F1BA 1ZUIA 3GEPA 4HWOA 4KCGA 3IOEA 4M0FA 4JFAA 3BCSA 5AOCA 4R8KA 4ZN6A 5K3AA 4W6QA 1U0OC 2I2BA 4MS1B 4ALIA 1T6BY 2PX3A 1YHYA 3CCCA 3NBQA 2WE7A 2LRHA 2YXDA 4X1IA 1GZ7A 4UXHA 4C7OA 2H1SA 2WTMA 2IP4A 3LQ2A 1GG9A 2IUTA 2VJNA 3HYRA 1KJIA 2PX8A 1TI7A 2WNSA 1RJDA 2XD4A 1XP5A 2CWDA 3HC7A 3K5WA 5TMPA 4OHPA 5CAEB 1WUYA 3FGPA 2CEKA 3AM3A 2FI1A 1X77A 1T1EA 3R9XA 1G6KA 2Z8YM 2Z9DA 3D8BA 3HY6A 4KE8A 3GOQA 1CQIB 1ZQ1A 1EEXB 4K81B 5T3UA 4OMUA 4DWJA 4DDVA 2JJ1A 3MYRA 3IQIX 3GNTA 3UJ8A 2ZT6A 1LC0A 1TYDE 1E2HA 2H08A 2QL7A 5B1HA 4X7BA 4XTCS 2NZWA 2XVAA 4OEHA 4RHCA 4M9XA 5FL3A 2CHGA 4BN5A 4CHTA 5KWIA 5L4NA 5FEUA 4LJRA 1TJ5A 3BFKA 4KACA 1PHPA 2VQ3A 3ZU2A 5C4IA 1W7AA 1T9DA 3R7LA 4ZTUB 4PO8A 5LBIA 4MH0R 1MZVA 2NO9A 1Z6PA 1QGOA 1E5DA 2XB6A 2ZSKA 2ZRAA 1TF5A 3C7DB 3N53A 2FRDC 1QVZA 1RP7A 1VKHA 5HTKA 3TLEA 3HI6A 1PTJC 3P9ZA 4R8LA 4LECA 1SQGA 4NU5A 1GP2A 2BCEA 3KYCA 5JRDS 1WCIA 1GUBA 3AY3A 3PIDA 3QTBA 4FYKA 4MARA 1R50A 3Q12A 1B6GA 1TA4A 2JBAB 3C70A 1PZFA 2V98A 5CB0A 3OIUA 3ZTTA 2WWIA 1E2EA 1Q0LA 2ZYWX 5D7NA 1QZXA 4ZTBA 5F35A 3ZBUA 5KSWB 4AJ1A 4LPKA 4TN1A 5BPFA 3CEJA 1CS0B 1T4BA 1CIJA 3CF4A 4FBMA 1DEKA 4PC6A 1T5LA 3EZXA 4RM3A 3BDAA 3O03A 4WCFC 4Z9YA 3W6PA 3K31A 3K9LA 2JIOA 2HL6A 3FFXA 3OOSA 4Q3CA 4FW9A 2BUBA 1B1AA 3RANA 4P08A 1ZBDA 3U3XA 4BLQA 4EKNB 3T5AA 1DFGA 4I5DA 3CT4A 2X19A 1C0KA 1GGKA 4NYJR 3JARA 1GNPA 3KEQA 5FWXB 2P1RA 3WI7A 1DRUA 4QBHA 1Z0JA 4EAAA 4I6JA 2WU4A 4A03A 1RCFA 2W58A 3MSCA 1XZHA 4H7DA 4LSGA 4DV2B 5CH3A 1TAUA 1E3WA 1XZ8A 3TCXB 1RYDA 4ENUA 1D2NA 3COVA 5CA1F 5I7UA 3KOXA 4FLEA 4WOBA 5FEMA 2JFWA 4RF4A 4J6FA 3HA2A 4PIPA 1PFVA 4JLJA 4P7JA 4F5DA 2YZKA 3QQ5A 1I1QB 2GJAA 1JG1A 1I36A 1T0UA 5SY6A 3QVJA 3D3NA 3IVRA 3Q5DA 2LD4A 4X8LA 3TLGA 4BO6A 5JYEA 4RQAA 4FCTA 5JO9A 4MQ5A 1GJRA 2JVKA 6Q21A 4V1CB 1YBVA 2QTGA 2WTNA 3SGLA 3TUZC 5IWCA 4KNYA 4KJZA 4ENSA 2R4TA 4GZ5A 2D1FA 3T52A 5DHQA 4ZAYA 1T4CB 1J42A 2OO3A 4K86A 5LB2A 1QKJA 1IRIA 2G3YA 3CR7A 3IB3A 3MUEA 1J0XO 2JD1A 3VR2A 5D3KA 3IAUA 4HDAA 5HE8A 4W82A 1Z6GA 1KE1A 5FNVB 4ZHQB 1U2DC 4TMYA 3CA8A 1P18A 3I42A 4RCZA 2DQ4A 3C41J 5KI6A 4CF6A 2XA2A 2B6NA 2W6JD 3W34A 3FPKA 3A9SA 1K68A 4WOKA 3WICA 4ITVA 1YBMA 2CLOB 2I8LA 4U6NA 5AWFC 5C1PA 3WWZA 4CL8A 4JVMA 5JBNA 4B3CA 2DULA 3HBFA 1HEYA 1ISPA 2PMKA 1JDZA 4YWHA 2JA2A 3BXOA 3NHRA 3F6CA 3L46A 5I51A 3RTEA 2OILA 2QD4A 2FZCA 2IU3A 2F1KA 4Y6SA 1G60A 1AZWA 5DYYA 3G7UA 1WXGA 3SBOA 3W6UA 1ZM9A 2PL9A 1C1HA 1P1JA 2V0NA 1IXKA 1B43A 1RBYA 3QVGA 4NK5A 4TLAA 4NU8X 4BY9E 3S68A 3DG9A 1HYBA 1AKYA 2BH2A 1AHNA 4OA8A 1U9IA 4WCFB 3EZGA 1JE1A 2W2KB 2QKYA 1TIPA 3I83A 3L7BA 4DPMA 4CEJB 4AKEA 4MWOA 2VNKA 3T35A 3WB2A 4C6HA 1GTMA 3EVFA 4FNGA 1DO8A 4A2CA 1ZM2A 2H59A 5GAJA 1QTIA 1K5PA 1Z06A 2A9JA 5C5IA 1DHTA 3HHPA 3GEBA 1TGYA 1ULHA 3AYXB 4IDEA 4BQEA 4D02A 1DG9A 4LYJA 2ZAYA 2RCNA 5FR1A 3DLHA 1YJ8A 4CLOA 2IUEA 4UBMA 3V1KA 1AY0A 2G28A 2V58A 3DC7A 3K09A 3KBBA 3LHIA 2OFFA 4AY4A 2YWGA 4YXWD 5I7FA 1BVYF 3ONDA 1GGEA 3UA4A 1FQWA 4ZYZA 1RRMA 1QHFA 4C43A 4IP0A 4KPFC 3ETCA 3PGKA 4R7GA 1NXSA 5I5EA 1EI9A 3SU8A 1MX3A 1YI8A 2WFLB 4ZV4A 5JJBA 1J22A 3PRHA 4DA0A 4LGMA 4UU8A 4HNRA 3RJMA 1FJGB 4LXYA 1U1EA 1V7QA 2VBFA 2O1EA 1DX9A 2YV4A 1H0SA 3DDZX 3MCUA 1CZNA 4IPTA 3DZDA 1WNTA 4N0EA 3EGCA 3AKZA 2CWWA 4PYKA 3D4IA 3LX4A 3PWZA 1JVBA 3K8ZA 4UNQA 3RFUA 4FHZA 3GQBB 4PTLA 3WTBA 3R3VA 3L43A 4C88A 5JNTA 1GKIA 3U19A 3R5XA 5KDLA 2ILVA 2WFMA 3R3HA 2RBGA 2W7TA 1EBUA 2FPRA 2D8MA 2VDVE 3C48A 3DVAA 2XB8A 4KAXA 5H68A 2MCFA 4BNLA 2F9FA 4IH9A 1O58A 4F3RA 1H2AS 3NI2A 1UDCA 4HQ0A 1JQJC 5ES4B 3AMVA 3T8YA 4CCWA 1EFDN 1T9GR 3D2AA 3IOCA 1Y6GA 1RKBA 3G8BA 4NJOA 5DLPA 5T3YA 2EIXA 5FWDA 3Q8MA 4UM5A 7REQA 2JJ8A 1MV5A 3KG2A 2FUEA 3JWPA 3K0CC 3L84A 4CTKA 1AIPA 2JLUA 1ZC3A 1JSLA 1MB3A 2Z2KA 3ANTA 3T41A 3C4VA 2QI9C 5IZCC 4LXXA 3EPJA 3GEMA 5C51B 2FPSA 4LHEA 4TTRA 1UKEA 3M4YA 3BFXA 1PLJA 1T0IA 1B6TA 3CH6A 3HDVA 4UNPA 4DVGA 4CKCB 3G88A 3LCMA 3ZV4A 2VTEA 1IXZA 1XD2A 1G4AE 2BYTA 1TQDA 1EJ2A 3OTHA 4XFKA 1TZMA 1EAMA 2W6QA 3BSSA 3ENNA 4JP8A 4DNPA 2NYAA 4Q4AB 4MYCA 3KPWA 4WJZA 4J0CA 4OXIA 2CJPA 3N6XA 3DBIA 4BLRA 4WLEA 3FFAA 2A78A 3M9WA 4FTWA 1N78A 3DMYA 2D62A 2REXB 2WMNB 1URPA 5ALMA 3CZAA 3LECA 2C5FA 2H5IA 5EMLA 2VPIA 1GO2A 1M7HA 2P6UA 1BRTA 3LQYA 3PNKA 3A70A 4OL9A 4YJ2F 2GKOA 2ZBRA 3U7QA 5IAGA 4MYTA 3E9NA 4WWHA 3OZCA 5DN6A 3VR4A 3Q7SA 1U8YA 2NU9A 4ZODA 1N5JA 5JVDF 5J4YA 1AKTA 4XYMA 5JCJA 1SUCA 2GHTA 2B92A 3FZEA 3NAGA 4Z4GA 3CPEA 1YQEA 4JYPA 5IVKA 4ZAZA 4KN5A 4A0QA 2OBXA 2ZQ5A 5GADl 3Q9LA 1FU7A 1QTNA 4KR3A 2IY8A 1QV9A 1IDN1 1RXWA 4D25A 2XNDD 3PJFA 3KR1A 3IUJA 4GOMD 2ID8A 2VPYA 3P2MA 3E03A 4TLDA 1ZMTA 3AHGA 3H11B 3GFGA 2VUTA 3LSYA 4RVDA 3BK1A 4IIBA 4PLFA 5JXJA 2A1IA 2GO7A 1E2KA 2ZSEA 3OZWA 2I1WA 4QUDA 3D4PA 4TROA 1J25A 1LRJA 2R1ZA 1N5MA 1QH8B 2A9OA 1TQHA 2HB6A 4QTUB 1KJJA 5BORA 4JI0B 1HGXA 5DCWA 2R6JA 2PXAA 3DMRA 1IN6A 3R24A 4INAA 1JR3E 2C7GA 3CZPA 3HTXA 2KWIA 3QNUA 1MJGM 2ZXFA 3RBZA 1V4BA 3UHJA 2OHJA 1L3CA 2BT4A 1W581 1FFXA 2EJUA 3WWDA 4EY8A 4FGKA 3VHXB 1U8ZA 3AW8A 3H8SA 1CVRA 3IMCA 3W5HA 3BFPA 3OHSX 3MFQA 1QK4A 1FF9A 5MHTA 3DAFA 4HEA1 3QG5A 4IMRA 5BN1A 1K0FA 3HRKA 4Q3BA 2JRCA 4QARA 2ZUTA 1VIDA 3C0KA 4Z4IA 1G21A 1YZQA 3EIHA 3AVVA 3MIIA 1CQXA 2V59A 3L7YA 5DWVA 2FRXA 2ONJA 1UF9A 2DP4E 1JLRA 2H07A 3OY2A 1K3UB 1W46A 1OBCA 3I39X 2Y8EA 3C24A 4NCHA 1I3OA 2BTQB 5ALFA 3M70A 1FYFA 3D2BA 3RUPA 2FLWA 5C8XA 3E7XA 3WFZA 4C1NA 1QPZA 2JJMA 2BCJQ 2X58A 4TKUB 1HDOA 1KMMA 3LZ6A 4UHCA 2CLLB 4DM3A 3VZBA 3GX1A 5G2OA 1MJGA 2QIPA 5IUNC 2Q1UA 2WPDA 5JADA 2MMGA 2BP7B 4BEWA 3RSCA 1JQ5A 1SVLA 4B3DA 4EVSA 1ZIPA 2A0KA 2W9XA 3PJGA 2Z6VA 4UATA 3UGTA 2VDKB 1M7GA 1SCIA 1KGSA 1U9YA 1TZJA 1W9MA 1HE5A 3WYNA 2IS1A 2FFQA 4GBED 4Q03A 4CMAA 4LOLA 2X5KO 3VHLB 4TZKA 2CXXA 2N9UA 4RM2A 1BWRA 1PN3A 3ANNA 1B14A 2X0DA 4B3BA 5AOBA 9ATCA 4B32A 2O7VA 1O9HA 5FUVA 2O2JA 4UJ3A 3DMPA 3ABZA 3UB4A 3PWSA 3V42A 1G59A 1SVWA 3B1JA 1WA5A 2J9XB 2ZLBA 2VUUA 3FW1A 2Q4BA 4B2PA 4ZDIA 3CUUA 1YSCA 2VS1A 1OFVA 5ELLA 4IHJA 3DMHA 2OB2A 1QGUB 4K5QA 4GBJA 1MEJA 3UCFA 3PUIA 4HOYA 4LDJA 4GP6A 4LXUA 5KKNB 1AB6A 1G2PA 1UP6A 1WKVA 4CKBA 4MQEA 3G5AA 4Q7KA 2CK3D 2I34A 5EZSA 4YP0A 4G9BA 1EVYA 3QWBA 1PGOA 2PNFA 2QRZA 5FUBA 2DCMA 2NN3C 3M5CA 1WMFA 3O1LA 4HG2A 5E7IA 5GONF 4QXQA 2IEIA 4DHWA 4UDXX 3ABRB 5CGQB 3VH4A 2Y0DA 4I9FA 2IEAA 2Q5HA 3ZY5A 3TLKA 3QKSB