4OFMA

Triclinic nagst1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
VHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase-1
publication title Structure of glutathione S-transferase 1 from the major human hookworm parasite Necator americanus (Na-GST-1) in complex with glutathione.
pubmed doi rcsb
source organism Necator americanus
molecule tags Transferase
total genus 69
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ofmA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ofmA01
4BL7A 1GTAA 2B7JA 2FY6A 1K3YA 2GS3A 2MBTA 2OADA 2BMXA 2GLRA 2R3XA 2H1BA 2GSSA 4EUYA 5INYA 2PVQA 3TCOA 3FKFA 5IO0A 2HFDA 4PUAA 1PKZA 2IIYA 4IQAA 2C3TA 4JBBA 1T00A 2H6XA 4IJ3A 2OBIA 5D9WA 3HY2A 2YANA 3LYKA 4ZBAA 2H6YA 3H8QA 4PXOA 4FIWA 5AIVA 3BBYA 1GWCA 2JSYA 4AF2A 1K0DA 2GSRA 3IBHA 1ST9A 2V6KA 1U87A 1ON4A 1GSUA 4J57E 4F03A 3E3EA 2ZNMA 2ZCTA 1HNCA 2I3YA 4XIHA 3DYRA 4EVMA 4HOJA 1KBNA 2K6VA 4MH3A 1FAAA 1U3AA 2JZRA 1NHOA 3LQ7A 1CQHA 1YDKA 3GSTA 5DQSA 1GH2A 3VPQA 4KX4A 4L0UA 2X64A 1U3IA 3AY8A 4E8HA 4I2TA 2YV9A 4IBPA 1PMTA 1Z7RA 4PQIA 5JWOB 2GQLA 4PQ1A 1SK0A 3DRNA 5IOXA 2CVBA 1AXDA 4QQ7A 1PX7A 1GSFA 3KM6A 3GTUB 2C3NA 2RIIA 5DAKA 3DKSA 2HT9A 4K7IA 4OCFA 5H5SA 1V2AA 4ZBDA 4EXJA 3LXZA 2LNTA 1YQ1A 3A2WA 5EY6A 2YPMA 3LYPA 5DVBA 4QL7A 5IMZA 3U5RE 2LJAA 5H5QA 2IMFA 2PWJA 4XCSA 2FA4A 2KLXA 2MYGA 1F2EA 4P3YB 3HVVA 4I5QA 3ME7A 1Y6EA 4FO5A 1PD21 1HNAA 5CREA 1SYRA 3EU4A 2LS5A 1RQMA 2J23A 1OYJA 3TOTA 1A2JA 3ZVJA 4GQCA 3IR4A 1O81A 3DD3A 1S3AA 1GSDA 1LBKA 2KUCA 2DIYA 3P90A 5KN0A 4KSOA 3O6TA 4F0CA 3GV1A 2JSZA 5FHIA 1F37A 1GULA 1XW5A 9GSSA 1XZOA 1BQ7A 3DVWA 5IPHA 2OJLA 2B6MA 2N5AA 3J7Yk 2VL2A 3RAZA 1A0FA 1EEMA 4PTSA 4HZ4A 2HSYA 3UL3A 2HRKB 4KDUA 2MMAA 3ZIJA 2I1UA 2HRFA 3FK8A 3H79A 4WR5A 2X8HA 2XBQA 3VLNA 3IA1A 1ML6A 2H0HA 3L9VA 1UC7A 1Q4JA 4KB3A 1OC3A 5B7CA 1MDJA 5HR1A 4POBA 2A2SA 3D6IA 1X5EA 2ON7A 3PGTA 1X5DA 2CQ9A 4WXTA 4OCEA 4YQVA 22GSA 3HJPA 4JR4A 4ZBBA 4PNFA 2H0IA 2LSTA 1B4QA 2G0FA 3H1NA 4MF5A 1U6TA 1XWCA 3MSZA 4K2DA 3A2XA 4HS1A 1YF1A 1ILOA 1Z7PA 4HQZA 19GSA 2O7KA 3D21A 4YQMA 4CDOA 5ELAA 2GGTA 3LGCA 3UEMA 2H19A 3LXTA 3U6VA 3G7JA 2L6CA 1VF4A 1EGRA 2NDOA 3FR9A 3JCML 4NV2A 3UVTA 1KEBA 3ZMLA 3QMXA 4NHZA 3TRPA 2E0QA 1WPIA 2DJ1A 4XS1A 1EP7A 18GSA 4QL9A 3G7YA 2IFQA 2CZ3A 3DEXA 2H01A 5D9XA 4XTSA 2OE0A 4GSNA 1GTIA 2OA7A 5LD0A 2REMA 4XHMA 1IYHA 1YF0A 3KP8A 4OFMA 2JZSA 3DMLA 3UOMA 5D9TA 4IJIA 5E4WA 4ZL9A 1ERWA 2OKAA 2MZCA 5J5NA 5JWRB 2GZZA 2JL4A 5JCGA 1SL1B 2WULA 1BEDA 3W8JA 2MBSA 4ECBA 1XIYA 4IN0A 3FZ4A 2VLUA 5EPFA 4XS6A 3LJRA 1PX6A 3A5WA 3BCIA 3IXRA 5G31A 5CO3A 1AQWA 3KH7A 1K0CA 1MD4A 1SU9A 1TJDA 4G0IA 3WT2A 4IQ1A 2OBKA 4O92A 1TRUA 4EC0A 2HZEB 3CYNA 5FWGA 2HXKA 4KGIA 1FVKA 3ZRDA 4HJMA 4POLA 3HYPA 2YJHA 5JCWA 2CT6A 3MAKA 4ZXGA 1M99A 1QFNA 1T1VA 4PNGA 2TIRA 1MD3A 3O3TA 4EDZA 3TB2A 2NTOA 4JU5A 1PL2A 2M72A 3K8NA 1AQVA 1XWAA 3I43A 1K3LA 3GSSA 4GWRA 1YY7A 4OO4A 2KHPA 1TU8A 1H75A 2K9FA 3C1SA 5DALB 4N0VA 1SK1A 2R2JA 3CXGA 3KGKA 1F3AA 4L8EA 1GP1A 5B6MA 2H0GA 2XC2A 4ZB6A 3M9JA 3ZL5A 1OKDA 3GFKA 1A24A 6GSSA 4MZBA 4YH2A 1XFLA 4MDCA 5IMAA 3CBUA 2C0DA 5F06A 4K6XA 3F4TA 2KP1A 5CP1A 5A4UA 4ZIJA 3EWLA 2HZFA 3KTBA 3ME8A 1WIKA 4N10A 4KW6A 2GQKA 1RK4A 2IN3A 5KEJA 5DCHA 4X43A 3MWHA 2B3SA 3TDGA 4KNDA 1ERUA 3GYKA 3GN3A 4TR0A 4EL1A 3VURA 4GTUA 2YWNA 1T3BA 2H1GA 2QC7A 2C0GA 3W6GA 4I97A 1M0UA 3C71A 3VWVA 1XOBA 4MZCA 4NAXA 3EURA 1O85A 1X0RA 2AHEA 2YV7A 1SJZA 2L4QA 4PQHA 5IM9A 2PPTA 4I8BA 2KOKA 2R6KA 2B1KA 1Z9HA 2VCZA 1PQNA 3TOUA 4ZB9A 4PURA 4XS4B 8GSSA 3FY7A 1OKTA 2Z9SA 5ECPB 1O8XA 2EIRA 2J9HA 3I6AA 1A8YA 1PRXA 4JR6A 5ECRB 1W4VA 1TDIA 4Q5RA 1TRVA 4KCEA 3BJ5A 2E2MA 2YWMA 3C73A 3IAM2 1W89A 3HDCA 1TU7A 1TI3A 2VOCA 2GZYA 4HU7A 2F8AA 1SK2A 4YQUA 2L4CA 6GSTA 4G10A 4J56E 1M2DA 2GDRA 3FR6A 4G9HA 3I9V2 5ECIB 4ULXA 5COHA 4IGJA 3GX0A 1UA5A 5G1LA 1FO5A 1OAZA 4WBJA 4WKWA 1Z3EA 5HFIA 3FW2A 2K8SA 13GSA 5L71A 1XOAA 2VIMA 1QUWA 3DGQA 1X5CA 4MP4A 4F0BA 2YWIA 1GUMA 1NSWA 1USBA 4BVXA 6GSVA 2PU9C 3ZMKA 1TK0B 4Q5NA 2FUG2 10GSA 3R3EA 4K1FA 1TI1A 20GSA 3O76A 2P31A 3TUEA 3TJJA 3CTGA 2PBJA 3L9SA 2V41A 3SWLA 4K8MA 4H86A 1GNEA 2PMTA 1RW1A 2I81A 3QD9A 1S3DA 3TJGA 5ENUA 1FB6A 1YEPA 2P5RA 5DJLA 1FOVA 1WOUA 3HXSA 5KN3A 1PKWA 4NXIA 4CW9A 2RM5A 1OE7A 4G0LA 4BWQA 3ISOA 2R5GA 4OMVA 3TKSC 3DIEA 5C00A 2C80A 2VCTA 2IJYA 1OE8A 4OWYA 2C4JA 2OACA 2LTKA 1Y25A 3GIXA 5DQYA 3PPUA 12GSA 1XWGA 3F4SA 1FHEA 2DC5A 5A4WA 1TXXA 4KE3A 2YZUA 2WRTA 5CRGA 2VAFA 4OD7A 2WJUA 1IYIA 2L5OA 3GTUA 3HD5A 3TRXA 2MMNA 4Q5QA 4LLRA 3TKQA 3TKRA 3IC4A 3CRTA 3L0HA 2BTOT 1TK8B 1TK5B 5ECLB 2YWOA 3QAWA 3LORA 4WBRD 3SBCA 4D73B 2I9HA 3BCKA 4N30A 1GL8A 3F9UA 4IKHA 3LWAA 2PN8A 2B7KA 1N2AA 3R2QA 1OVNA 2QKEA 3IC8A 1MTCA 1F6MC 2HNLA 5F0GA 3UBLA 4MJCA 2LQQA 3UBKA 2E7PA 1T4ZA 3BD2A 1OC8A 3FZ9A 3RDWA 1GSQA 4JEDA 1A0RP 4POMA 4LL1B 5KN2A 1B9YC 1M2BA 1OC9B 4TXOB 1BX9A 2LV3A 1SYXA 3QPMA 1I9DA 4OFTA 2VL3A 3D5JA 3IK7A 5HQPA 1J9BA 4MLYA 4MPFA 4TKYA 3KTLA 4KSMA 2ZUPA 3EC3A 1AAZA 4IP1A 2V6OA 1QK8A 4MJAA 1PA3A 3QFAC 2HRKA 1DE1A 4PX1A 4I6XA 1B9XC 1M7TA 4X1UA 3QAVA 2HRNA 1CQGA 2FWFA 4OO5A 3Q19A 4XRDA 3GRXA 1VGLA 3FYGA 3LSZA 1JZOA 3GA4A 3APOA 5J9CA 3G9BA 2XPDA 2X8CA 4TN8A 1QGVA 1GUKA 5HFKA 5BMUA 4TOPA 2CAIA 4MK3A 3P7XA 1THOA 1YKCA 1F9MA 2KP2A 1X9WB 3HJMA 2DLXA 2HSHA 3FEUA 1GSSA 2H74A 2G2QA 1GLQA 4ZILA 3I69A 3WGEA 3GL5A 5DJMA 3NZNA 3UMAA 2CVKA 1GTUA 5A4VA 3RBTA 1XPVA 3GKXA 4WF5A 2VD1A 4BA7A 1S3CA 4JRRA 4IW9A 3J7Yb 2HRAA 2HLSA 5FT3A 4GSSA 4BVYB 2LEGA 1KTEA 4KH7A 3C1RA 1SL2B 4IP6A 1A2MA 5CRHA 1VF2A 2CX3A 1E6BA 5ELGA 1J08A 4V2NA 1UN2A 1K0BA 5HFGA 3H93A 4ECIA 2AV4A 3EYTA 4JE1A 4X0XA 1AIUA 2FWHA 4V2MA 5GAPD 1ACVA 1ZL9A 5J41A 1ZZYA 1YEXA 2VO4A 4TR3A 1MDKA 2VCWA 2NBSA 1R4WA 4HZ2A 3ERFA 3FR3A 1M9BA 4FYBA 2LQOA 4JZQA 4AGSA 2TRXA 2QGVA 3WGDA 3UVHA 1V57A 4K7NA 2H70A 3HZ4A 4POKA 4EE0A 3UAPA 1YZXA 4KCAA 3TJBA 5CNWA 3CSJA 5ECMB 2VM1A 5D8IA 1O6JA 1FVJA 3WD6A 3IV4A 1E2YA 3GURA 1URMA 3KJYA 1WRYA 5ID2B 1PN9A 3KH9A 2AJQB 2PVOC 5JCUA 3F3QA 4E8EA 4F2IA 1ZGNA 5IMVA 4KA0A 4YAPA 3P8WA 3E9JB 3PINA 3GX8A 3VI7A 2H1AA 3A2VA 3GUSA 3EVIA 3F4RA 4NMUA 1BYEA 3BOAA 2PERA 3IHQA 4HQSA 1O73A 3WYWA 3GH6A 3M3MA 3D4TA 4FH8A 2LRCA 1WP0A 1R7HA 2UZ8A 4DSRA 4AJ7A 2HSMB 6GSXA 4CHSA 1V98A 2O8VB 2DMMA 2LJKA 2VD0A 4PGTA 3US3A 4TR1B 3ED3A 4F9ZA 3KP9A 1HNBA 4IELA 1GRXA 3VWUA 5F8BA 4RQRA 1LJRA 3VPTA 2XBIA 3OR5A 3ZIVA 2A2RA 3LEFA 3GL3A 2F3MA 3TKPA 3A3TA 4RI6A 2X8GA 1Q98A 1SKWB 3L4NA 1QXHA 4TR4A 4EF0A 2HQTA 3KEBA 4MMMA 2FLSA 1V58A 1XCCA 2NVLA 2BJXA 2EIOA 1DBYA 2F9SA 3KXOA 1DUGA 4MABA 3ZYWA 2C0EA 2IMDA 5D96A 1TRSA 1H4OA 1EZKA 3QDNA 1YKAA 3IRAA 4DSSA 5KN1A 3V1WA 3C7MA 2RM6A 4L0WA 3P2AA 2VL2C 2HE3A 4G19A 2JU5A 2JACA 3HCZA 1DE2A 2H8LA 2OE3A 5HR2A 5GZZB 5A5KA 3F0IA 4NPBA 4ZB8A 5D9VA 3EE2A 1T8EB 1TW9A 2IL3A 3GKMA 5J3RA 2FHEA 2LKUA 3G7IA 4BL7B 3WT1A 4NHWA 2I4AA 3KD0A 2L57A 3ZFBA 4HUAA 2GSQA 5DDLA 1V9WA 4TW5A 5GSSA 3KMOA 2VLTA 4XS4A 1EP8A 2GQMA 3M9KA 3H4KA 5GSTA 1TOFA 2O85A 4LMVA 1AQXA 2CVDA 2WDUA 6GSWA 3FRCA 4BPYA 1EV9A 4IHUA 2WCIA 1G6YA 3HVSA 1SENA 2JADA 1SJIA 3KMNA 5B8BA 3APSA 2O87A 1WMJA 4DSQA 5IMCA 4FYCA 1XW9A 3GHAA 1G7EA 5LCZA 1NW2A 2YOIA 4MJEA 1T4YA 2H75A 1VF1A 4BVXB 1XXUA 3ZTLA 4O7HA 3RPNA 3TGZA 4I2UA 4G2EA 5EVOA 5J9BA 2DSAA 2IPAA 4EDYA 1AC1A 4HDEA 2FGXA 2AB6A 2FA8A 2VCQA 5IO2A 1XVQA 4LMWA 4HEA2 5CYYA 3WGXA 4DEJA 1XVWA 1SKRB 2GTUA 2XHFA 1F3BA 1GTBA 5C04A 2FNOA 1U88A 1GLPA 2YN1A 1EV4A 11GSA 1LU4A 2QSIA 4Z7XA 5G1KA 2VM2A 2V2GA 4GLTA 2VCXA 4TVEA 2YNXA 1TKDB 3M8NA 3Q74A 5HR0A 2B5EA 2HSNB 4KDXA 5D73A 5LNKe 4TXVA 2FD3A 4ID0A 2WS2A 1K0AA 2AYTA 2VL9A 5IMDA 1GNWA 3LG6A 3QCPA 4USSA 2K8VA 5G30A 2FWEA 1HYUA 5DAKB 4WR4A 3UIWA 1MDIA 5HR3A 1JZRA 1MEKA 3L9UA 2HI7A 1SD9A 2WZ9A 4ACSA 1WWJA 3HA9A 4MF7A 2V1MA 1FB0A 2IMEA 4NWYA 3EINA 3APQA 3CMIA 4LL4B 4GXZA 5ABRA 1TTZA 1KNGA 4XRAA 4FQUA 4PUFC 3F63A 3M0FA 1NM3A 2H1DA 1HD2A 1A23A 1ZOFA 2ES7A 3RHCA 3EU3A 2LJRA 5JWQB 1R5AA 16GSA 1THXA 1JZWA 5CAXA 1JLWA 3F8UA 1B4PA 2LNSA 2WGRA 2AAWA 1GUHA 1QQ2A 5ECNB 2IMIA 1FG4A 2TRCP 2HYXA 2R4VA 4IS0A 1GSYA 3TKSE 5ECOB 2LUSA 2H66A 1HQOA 5J4UA 1EWXA 2ALBA 1EOGA 5EL8A 1BG5A 3M1GA 5IPGA 4KDYA 4MF6A 3QR6A 14GSA 3W8SA 1JHBA 5DCGA 1X9SB 4D73A 3ZREA 1NHYA 2GT5A 1YJ6A 1FW1A 2A4VA 4ZL8A 1R26A 3PH9A 3QFBC 1UVZA 3VWXA 2F8FA 3F6DA 2B5YA 2H73A 2L6DA 2C8UA 1R5PA 2EC4A 3NIVA 1PL1A 4GSTA 3GH9A 4AJ8A 3ERGA 5ECHB 2YCDA 2WB9A 7GSSA 3IE3A 1OC9A 3DWVA 3ERWA 2FCHA 4TXOA 1O7UA 2CAQA 3PR8A 3CSHA 5B6NA 4J2FA 4DVCA 3IDVA 3GKNA 1SJ6A 5IMFA 1K0OA 4BWSA 5ECSA 1VF3A 3EMPA 1WE0A 4FYUA 1EOHA 2K18A 1G0TA 1AW9A 4G0KA 1ABAA 2E2GA 3L78A 3FZ5A 2H76A 1SL0B 5AISA 1XBSA 4ISDA 2IFQB 3E0UA 4V1Ap 2DJ3A 1ERVA 1SKSB 3S9FA 4GF0A 2P5QA 3EMXA 5CRWA 2DMLA 3GNJA 3DXBA 3ZZXA 4F82A 3HZ8A 4IVFA 3UARA 4TRXA 5G5EA 1ZYQB 4L5LA 2P0GA 1XWBA 3HJOA 2H6ZA 3LFLA 4HJ2A 1Z6MA 4GQFA 2PGTA 4NV5A 1N8JA 2FWGA 5F05A 1TP9A 2LRNA 5AGYA 1ZCPA 4K0NA 5H5RA 4HI7A 2M46A 5DBQA 4RI7A 1WJKA 4O32A 4V2LA 4N0ZA 2B5XA 1TRWA 4ML1A 4KF9A 4BVYA 2D2ZA 3MDKA 3C8EA 4MCUA 2LRTA 4O5RA 4MA9A 2ON5A 2PUKC 1A2LA 4MH2A 1XWKA 4WETA 3TKSA 2IMKA 1A8LA 1BJXA 6GSUA 3ZITA 3KZQA 2XPEA 3CTFA 5CRDA 2N5FA 2C3QA 3HHVA 2RLIA 4MJBA 1T7PB 5F07A 2V32A 4RQXA 1Z5YE 2GZPA 2X99A 4ILFA 4WEYA 4ECJA 2DJ0A 1J0FA 2C1YA 1PGTA 2AUVA 1O8WA 3F6FA 2DBCA 2HZEA 3HVXA 1K0NA 4MPGA 5B8AA 3KIJA 4LA1A 2B1LA 3Q18A 5AN1A 3DVXA 3RPPA 1JFUA 2VLVA 4MZWA 4GCIA 1XW6A 3UJ1A 3IAS2 4AJ6A 1G7OA 4GRFA 4KAEA 2VCVA 4EO3A 1EGOA 1G6WA 3IPZA 4RUVA 5ID2A 2NPBA 3ZLPA 2DIZA 4KUNA 2MMOA 2DJKA 2N5BA 4OFNA 3RHBA 1X9MB 5DALA 1JLVA 1JZDA 5G5FA 5GAND 4V1Ag 3TJFA 4YAVA 3FHKA 1VRSD 1QMVA 3N9JA 1AUCA 2M80A 2L59A 4K0GA 3KCMA 2F51A 1ZYEA 3CRUA 3GKKA 4WF4A 2CV4A 5D93A 2CA8A 1SD8A 2DJJA 4N11A 3IK9A 2VUPA 2R37A 2CZ2A 4ZL7A 2MMZA 2YJ7A 2GSTA 3N5OA 1I5GA 2HSMA 3D22A 1DSBA 5E59A 5IIZA 3TRQA 5ECKB 4TR1A 5G2ZA 4L5OA 3VI5A 3HKRA 1ZMAA 2IWTA 4ECCA 1B8XA 4K9ZA 4HU9A 5IOWA 2EIQA 1M9AA 2YZHA 1V40A 3GMFA 4DSSB 3ZFLA 3VK9A 2YP6A 3Q6OA 3D4MA 2GVPA 2H71A 1C72A 1PSQA 1ERTA 3TJKA 2RUEA 3CSIA 1GSEA 1BAYA 3VFIA 2CX4A 1K0MA 2JZTA 3QOUA 1M2AA 3IOSA 3MNGA 17GSA 3F3RA 3QAGA 2DJ2A 3FZAA 2GT6A 2H72A 2H30A 2OE1A 2RUFA 2C0FA 3NOFA 4Q5FA 4K7OA 1B48A 5IQYA 2WFCA 2O89A 4ML6A 4EKZA 1Z6NA 3VWWA 3ZVJD 6GSYA 1EEJA 2L5LA 3D0ZA 5ECQB 1K3OA 5AIXA
chains in the Genus database with same CATH superfamily
4BL7A 1GTAA 2H1LA 2B7JA 2FY6A 1K3YA 2GS3A 2MBTA 2OADA 1Y1UA 2BMXA 2GLRA 2R3XA 2H1BA 2GSSA 4EUYA 5INYA 2PVQA 3TCOA 5J4YA 3FKFA 5IO0A 2HFDA 4PUAA 1PKZA 2IIYA 4IQAA 2C3TA 4JBBA 1T00A 2H6XA 4IJ3A 2OBIA 5D9WA 3HY2A 2YANA 3LYKA 4ZBAA 2H6YA 3H8QA 4PXOA 4FIWA 5AIVA 2WW1A 3BBYA 1GWCA 2JSYA 4AF2A 1K0DA 2GSRA 3IBHA 1ST9A 2V6KA 1U87A 1ON4A 1GSUA 4FXYP 4J57E 4F03A 3E3EA 2ZNMA 2ZCTA 1HNCA 2I3YA 4XIHA 3DYRA 4EVMA 4HOJA 1KBNA 2K6VA 4MH3A 1FAAA 1U3AA 2JZRA 1NHOA 3LQ7A 1CQHA 1YDKA 3GSTA 5DQSA 1GH2A 3VPQA 4KX4A 4L0UA 2X64A 1U3IA 3AY8A 4E8HA 4I2TA 2YV9A 4IBPA 1PMTA 1Z7RA 4PQIA 5JWOB 2GQLA 4YKGA 4PQ1A 1SK0A 3DRNA 5IOXA 2CVBA 1AXDA 4QQ7A 1PX7A 1GSFA 3KM6A 3GTUB 2C3NA 2RIIA 5DAKA 3DKSA 2HT9A 4K7IA 4OCFA 5H5SA 1V2AA 4ZBDA 4EXJA 3LXZA 2LNTA 1YQ1A 3A2WA 5EY6A 2YPMA 3LYPA 5DVBA 4QL7A 5IMZA 3U5RE 2LJAA 5H5QA 1XG8A 2IMFA 2PWJA 4XCSA 2FA4A 2KLXA 2MYGA 1F2EA 4P3YB 3HVVA 4I5QA 3ME7A 1Y6EA 4FO5A 1PD21 1HNAA 5CREA 1SYRA 3EU4A 2LS5A 1RQMA 2J23A 1OYJA 3TOTA 1A2JA 3ZVJA 4GQCA 3IR4A 1O81A 3DD3A 2X4AA 1S3AA 1GSDA 1LBKA 2KUCA 2DIYA 3P90A 5KN0A 4KSOA 3O6TA 4F0CA 3GV1A 2JSZA 5FHIA 4AI6A 1F37A 1GULA 1XW5A 9GSSA 1XZOA 1BQ7A 3DVWA 5IPHA 2OJLA 2B6MA 2N5AA 3J7Yk 2VL2A 3RAZA 1A0FA 1EEMA 4PTSA 4HZ4A 2HSYA 3UL3A 2HRKB 4KDUA 2MMAA 3ZIJA 2I1UA 2HRFA 3FK8A 3H79A 4WR5A 2X8HA 2XBQA 3VLNA 3IA1A 1ML6A 2H0HA 3L9VA 1UC7A 1Q4JA 4KB3A 1OC3A 5B7CA 1MDJA 5HR1A 4POBA 2A2SA 3D6IA 5BMUB 1X5EA 2ON7A 3PGTA 1X5DA 2CQ9A 4WXTA 4OCEA 4YQVA 22GSA 3HJPA 4JR4A 4ZBBA 4PNFA 2H0IA 2LSTA 1B4QA 2G0FA 3H1NA 4MF5A 1U6TA 1XWCA 3MSZA 4K2DA 3A2XA 4HS1A 1YF1A 1ILOA 1Z7PA 4HQZA 19GSA 2O7KA 3D21A 4YQMA 4CDOA 5ELAA 2GGTA 3LGCA 3UEMA 2H19A 3LXTA 3U6VA 3G7JA 2L6CA 1VF4A 1EGRA 2NDOA 3FR9A 3JCML 2O36A 4NV2A 3UVTA 1KEBA 3ZMLA 4ICYA 3QMXA 4NHZA 3HVNA 3TRPA 2E0QA 1WPIA 2DJ1A 4XS1A 1EP7A 2A2PA 18GSA 4QL9A 3G7YA 2IFQA 2CZ3A 3DEXA 2H01A 5D9XA 4XTSA 2OE0A 4GSNA 1GTIA 2OA7A 5LD0A 2REMA 4MNNA 4XHMA 1IYHA 1YF0A 3KP8A 4OFMA 2JZSA 2X49A 4Z2UA 3DMLA 3UOMA 5D9TA 4IJIA 5E4WA 4ZL9A 1ERWA 2OKAA 2MZCA 5J5NA 5JWRB 5A5HA 2GZZA 2JL4A 5JCGA 1SL1B 2WULA 1BEDA 2WVYA 3W8JA 2MBSA 4ECBA 1XIYA 4IN0A 3FZ4A 1PN0A 2VLUA 5EPFA 4XS6A 3LJRA 1PX6A 3A5WA 3BCIA 3IXRA 5G31A 5CO3A 1AQWA 3KH7A 1K0CA 1MD4A 1SU9A 4Z2RA 1TJDA 4G0IA 3WT2A 4IQ1A 2OBKA 4O92A 1TRUA 4EC0A 2HZEB 3RGBC 3CYNA 5FWGA 2HXKA 4KGIA 1FVKA 3ZRDA 4HJMA 4POLA 3HYPA 2YJHA 5JCWA 2CT6A 3MAKA 4ZXGA 1M99A 1QFNA 1T1VA 4PNGA 2TIRA 1MD3A 3O3TA 4EDZA 3TB2A 2NTOA 4JU5A 2WVZA 1PL2A 2M72A 3K8NA 1AQVA 1XWAA 3I43A 1K3LA 3GSSA 3HMJG 4GWRA 1YY7A 4OO4A 2KHPA 1TU8A 1H75A 2K9FA 3C1SA 5DALB 4N0VA 1FOHA 1SK1A 2R2JA 4YKFA 3CXGA 3KGKA 1F3AA 4L8EA 1GP1A 3EPTA 5B6MA 5KOWA 2H0GA 2XC2A 4ZB6A 2WW2A 3M9JA 3ZL5A 1OKDA 3GFKA 1A24A 6GSSA 4MZBA 4YH2A 1XFLA 4MDCA 5IMAA 3CBUA 2C0DA 5F06A 4K6XA 3F4TA 3RFRC 2KP1A 2WW3A 5CP1A 5A4UA 4ZIJA 3EWLA 2HZFA 3KTBA 3ME8A 1WIKA 4N10A 4KW6A 2A4HA 2GQKA 1RK4A 2IN3A 5KEJA 5DCHA 4X43A 3MWHA 2B3SA 3TDGA 4KNDA 1ERUA 3GYKA 3GN3A 4TR0A 4EL1A 3VURA 4GTUA 2YWNA 1T3BA 2H1GA 2QC7A 2C0GA 3W6GA 4I97A 1M0UA 3C71A 3VWVA 1XOBA 5J4VA 4MZCA 5J40A 4NAXA 3EURA 1O85A 1X0RA 2AHEA 2YV7A 1SJZA 2L4QA 4PQHA 5IM9A 1SVOA 2PPTA 4I8BA 2KOKA 2R6KA 2B1KA 1Z9HA 2VCZA 1PQNA 3TOUA 4ZB9A 4PURA 4XS4B 8GSSA 3FY7A 3IHGA 1OKTA 2Z9SA 5ECPB 1O8XA 2EIRA 4K5RA 2J9HA 3I6AA 1A8YA 1PRXA 4JR6A 4K5SA 5ECRB 1W4VA 1TDIA 4Q5RA 1TRVA 4KCEA 3BJ5A 2E2MA 2YWMA 3C73A 5A1NA 4N3ZA 3IAM2 1W89A 3HDCA 1TU7A 1TI3A 2VOCA 2GZYA 4HU7A 2F8AA 1SK2A 4YQUA 2L4CA 6GSTA 4G10A 4J56E 1M2DA 2GDRA 3FR6A 4G9HA 3I9V2 5ECIB 4ULXA 5COHA 4IGJA 3GX0A 1UA5A 5G1LA 1FO5A 1OAZA 4WBJA 4PHZC 4WKWA 1Z3EA 5HFIA 3FW2A 2K8SA 4G01A 4K2XA 3TU3B 13GSA 5L71A 1XOAA 2VIMA 1QUWA 5KOXA 3DGQA 1X5CA 4MP4A 4F0BA 2YWIA 1GUMA 1NSWA 1USBA 4BVXA 6GSVA 2PU9C 3ZMKA 1TK0B 3CQFA 4Q5NA 2FUG2 2WZSA 3R3EA 10GSA 4K1FA 1TI1A 1BG1A 20GSA 3O76A 2P31A 3TUEA 3TJJA 3CTGA 2PBJA 3L9SA 2V41A 3SWLA 4K8MA 4H86A 1GNEA 2PMTA 1RW1A 2I81A 3QD9A 1S3DA 3TJGA 5ENUA 1FB6A 1YEPA 1PFOA 2P5RA 5DJLA 1FOVA 1WOUA 3HXSA 5KN3A 1PKWA 2HSNA 4NXIA 4CW9A 1S3RA 2RM5A 1OE7A 4G0LA 4BWQA 3ISOA 2R5GA 4OMVA 3TKSC 3DIEA 5C00A 2C80A 2VCTA 2IJYA 1OE8A 4OWYA 2C4JA 2OACA 2LTKA 1Y25A 3GIXA 5DQYA 3PPUA 12GSA 1XWGA 3F4SA 1FHEA 2DC5A 2O3EA 5A4WA 1TXXA 4KE3A 2YZUA 2WRTA 5CRGA 2VAFA 4OD7A 2WJUA 1IYIA 2L5OA 3GTUA 4AKGA 5A34B 3HD5A 3TRXA 2MMNA 4Q5QA 4LLRA 3TKQA 3TKRA 3IC4A 3CRTA 3L0HA 2BTOT 1TK8B 1TK5B 5ECLB 4CY6A 2YWOA 3QAWA 3LORA 4A5PA 4WBRD 3SBCA 4D73B 2I9HA 3BCKA 4N30A 1GL8A 3F9UA 4IKHA 3LWAA 2PN8A 2B7KA 1N2AA 3R2QA 1OVNA 2QKEA 3IC8A 1MTCA 1F6MC 2HNLA 5F0GA 3UBLA 4MJCA 2LQQA 3UBKA 2E7PA 4EIPA 1T4ZA 3BD2A 1OC8A 3FZ9A 3RDWA 1GSQA 4JEDA 1A0RP 4POMA 4LL1B 5KN2A 1B9YC 1M2BA 1OC9B 1ZYNA 4TXOB 1BX9A 2LV3A 1SYXA 3QPMA 1I9DA 4OFTA 2VL3A 2DKIA 3D5JA 3IK7A 5HQPA 1J9BA 4MLYA 4MPFA 4TKYA 3KTLA 4KSMA 2ZUPA 3EC3A 1AAZA 4IP1A 2V6OA 1QK8A 4MJAA 1PA3A 3QFAC 2HRKA 1DE1A 4PX1A 4I6XA 1B9XC 1M7TA 4X1UA 3QAVA 2HRNA 1CQGA 2FWFA 4OO5A 3Q19A 4XRDA 3GRXA 1VGLA 4ZB7A 3FYGA 3LSZA 1JZOA 2UV8G 3GA4A 3APOA 5J9CA 3G9BA 2XPDA 2X8CA 4Z2TA 4TN8A 1QGVA 1GUKA 5HFKA 5BMUA 4TOPA 2CAIA 4MK3A 3P7XA 4E68A 1THOA 2WVXA 1YKCA 1F9MA 2KP2A 1X9WB 3HJMA 2DLXA 2HSHA 3FEUA 1GSSA 2H74A 2QA1A 2G2QA 1GLQA 4ZILA 3I69A 3WGEA 3GL5A 5DJMA 3NZNA 3UMAA 2CVKA 1GTUA 5A4VA 3RBTA 1XPVA 3GKXA 3LW9A 4WF5A 2VD1A 4BA7A 1S3CA 4JRRA 4IW9A 3J7Yb 2HRAA 2HLSA 5FT3A 4GSSA 4BVYB 2LEGA 1KTEA 4KH7A 3C1RA 1SL2B 4IP6A 1A2MA 5CRHA 1VF2A 2CX3A 1E6BA 5ELGA 1J08A 4V2NA 1UN2A 2O5VA 1K0BA 5HFGA 3H93A 4ECIA 2AV4A 3EYTA 4JE1A 4X0XA 1AIUA 2FWHA 4V2MA 5GAPD 1ACVA 1ZL9A 5J41A 1ZZYA 1YEXA 2VO4A 1S4BP 4TR3A 1MDKA 2VCWA 2NBSA 1R4WA 4HZ2A 3ERFA 3FR3A 1M9BA 4FYBA 2LQOA 4JZQA 4AGSA 2TRXA 2QGVA 3WGDA 3UVHA 1V57A 4K7NA 2H70A 3HZ4A 4POKA 4EE0A 3UAPA 1YZXA 4KCAA 3TJBA 5CNWA 3CSJA 5ECMB 2VM1A 5D8IA 1O6JA 1FVJA 3WD6A 3IV4A 1E2YA 3GURA 1URMA 3KJYA 1WRYA 5ID2B 1PN9A 3KH9A 2AJQB 2PVOC 5JCUA 3F3QA 4E8EA 4F2IA 1ZGNA 5IMVA 4KA0A 4YAPA 3P8WA 3E9JB 3GX8A 3PINA 3VI7A 2H1AA 3A2VA 3GUSA 3EVIA 3F4RA 4NMUA 1BYEA 3BOAA 2PERA 3IHQA 4HQSA 4W66A 1O73A 3WYWA 3GH6A 3M3MA 3D4TA 4FH8A 2LRCA 1WP0A 1R7HA 2UZ8A 4DSRA 4AJ7A 2HSMB 6GSXA 4CHSA 1V98A 2O8VB 2DMMA 2LJKA 2VD0A 4PGTA 3US3A 4TR1B 3ED3A 4F9ZA 3KP9A 1HNBA 4IELA 1GRXA 3VWUA 5F8BA 4RQRA 1LJRA 3VPTA 2XBIA 3OR5A 3ZIVA 2A2RA 3LEFA 3GL3A 2F3MA 3TKPA 3A3TA 4RI6A 2X8GA 1Q98A 1SKWB 3L4NA 1QXHA 4TR4A 4EF0A 3CWGA 2HQTA 3KEBA 4MMMA 2FLSA 1V58A 1XCCA 2NVLA 2BJXA 2EIOA 1DBYA 2F9SA 3KXOA 1DUGA 4MABA 3ZYWA 2C0EA 2IMDA 5D96A 1TRSA 1H4OA 1EZKA 3QDNA 1YKAA 3IRAA 4DSSA 5KN1A 3V1WA 3C7MA 2RM6A 4QMKA 4L0WA 3P2AA 2VL2C 2HE3A 4G19A 2JU5A 2JACA 3HCZA 1DE2A 4PI0C 2H8LA 2OE3A 5HR2A 5GZZB 5A5KA 3F0IA 4NPBA 5A1NB 4ZB8A 5D9VA 3EE2A 1T8EB 1TW9A 2IL3A 3GKMA 5J3RA 2FHEA 2LKUA 3G7IA 4BL7B 3WT1A 4NHWA 2I4AA 3KD0A 2L57A 3ZFBA 4HUAA 4AKHA 2GSQA 5DDLA 1V9WA 4TW5A 5GSSA 3KMOA 2VLTA 4XS4A 1EP8A 2GQMA 3M9KA 3H4KA 2EFCA 5GSTA 1TOFA 2O85A 4LMVA 1AQXA 2CVDA 2WDUA 6GSWA 3FRCA 4BPYA 1EV9A 4IHUA 2WCIA 1G6YA 3HVSA 1SENA 2JADA 1SJIA 2VKZG 3KMNA 5BRTA 5B8BA 3APSA 2O87A 1WMJA 4DSQA 5IMCA 4FYCA 1XW9A 3GHAA 1G7EA 5LCZA 1NW2A 2YOIA 4MJEA 1T4YA 2H75A 1VF1A 4BVXB 1XXUA 1M3JA 2EFDA 3ZTLA 4O7HA 3RPNA 3TGZA 4I2UA 4G2EA 5EVOA 5J9BA 2DSAA 2IPAA 4EDYA 1AC1A 4HDEA 2FGXA 2AB6A 2FA8A 2VCQA 5IO2A 1XVQA 4LMWA 4HEA2 5CYYA 3WGXA 4DEJA 1XVWA 1SKRB 2GTUA 2XHFA 2QA2A 1F3BA 1GTBA 5C04A 2FNOA 1U88A 1GLPA 2YN1A 1EV4A 11GSA 1LU4A 2QSIA 4Z7XA 5G1KA 2VM2A 2V2GA 4GLTA 2VCXA 4TVEA 2YNXA 1TKDB 3M8NA 3Q74A 5HR0A 2B5EA 2HSNB 4KDXA 5D73A 5LNKe 2DKHA 4TXVA 2FD3A 4ID0A 2WS2A 1K0AA 2AYTA 2VL9A 5IMDA 1GNWA 3LG6A 3QCPA 4USSA 2K8VA 5G30A 2FWEA 1HYUA 5DAKB 4WR4A 3UIWA 1MDIA 5HR3A 1JZRA 1MEKA 3L9UA 2HI7A 1SD9A 3FMWA 2WZ9A 4ACSA 1WWJA 3HA9A 4MF7A 2R0CA 2V1MA 1YEWC 1FB0A 2IMEA 4NWYA 3EINA 3APQA 3CMIA 4LL4B 4GXZA 5ABRA 1TTZA 1KNGA 4XRAA 4FQUA 4PUFC 3F63A 3M0FA 1NM3A 2H1DA 1HD2A 4AKXB 1A23A 4O5QA 1ZOFA 1I1IP 2ES7A 3RHCA 3EU3A 2LJRA 5JWQB 1R5AA 16GSA 1THXA 1JZWA 5CAXA 1JLWA 3F8UA 1B4PA 2LNSA 2WGRA 2AAWA 1GUHA 1QQ2A 5ECNB 2IMIA 1FG4A 2TRCP 2HYXA 2R4VA 4IS0A 1GSYA 5J47A 5A34A 3TKSE 5ECOB 4O5UA 2LUSA 2H66A 1HQOA 5J4UA 1EWXA 2ALBA 1EOGA 5EL8A 1BG5A 3M1GA 5IPGA 4KDYA 4MF6A 3QR6A 14GSA 3W8SA 1JHBA 5DCGA 1X9SB 4D73A 3ZREA 1NHYA 2GT5A 1YJ6A 1FW1A 1N25A 2A4VA 4ZL8A 1R26A 3PH9A 3QFBC 1UVZA 3VWXA 2F8FA 3F6DA 2B5YA 2H73A 2L6DA 2C8UA 1R5PA 1SVMA 3NIVA 2EC4A 1PL1A 4GSTA 1SVLA 3GH9A 4AJ8A 3ERGA 5ECHB 2YCDA 2WB9A 7GSSA 3IE3A 1OC9A 3DWVA 3ERWA 2FCHA 4TXOA 1ZYPA 1O7UA 2CAQA 3PR8A 3CSHA 5B6NA 4J2FA 4DVCA 3IDVA 3GKNA 1SJ6A 5IMFA 1K0OA 4BWSA 5ECSA 1VF3A 3EMPA 1WE0A 4FYUA 2WVXB 1EOHA 2K18A 4EIQA 1G0TA 1AW9A 4G0KA 1ABAA 2E2GA 3L78A 3FZ5A 2H76A 1SL0B 5AISA 1XBSA 4ISDA 2IFQB 3E0UA 3MYDA 4V1Ap 2DJ3A 1ERVA 1SKSB 3S9FA 4GF0A 2P5QA 2R0PA 3EMXA 5CRWA 2DMLA 3GNJA 3DXBA 3ZZXA 4F82A 3HZ8A 4IVFA 3UARA 5A5HB 4TRXA 5G5EA 1ZYQB 4AKIA 4L5LA 2P0GA 1XWBA 3HJOA 2H6ZA 3LFLA 3MIXA 4HJ2A 1Z6MA 4GQFA 2PGTA 4NV5A 1N8JA 2FWGA 5F05A 1TP9A 2LRNA 1TXUA 5AGYA 3CHXC 4K0NA 1ZCPA 4HI7A 2M46A 5H5RA 5DBQA 4RI7A 1WJKA 4O32A 4V2LA 4N0ZA 2B5XA 1TRWA 4ML1A 4KF9A 4BVYA 2D2ZA 3MDKA 3C8EA 4MCUA 2LRTA 4O5RA 4MA9A 2ON5A 2PUKC 1A2LA 4MH2A 1XWKA 4WETA 3TKSA 2IMKA 1A8LA 1BJXA 6GSUA 3ZITA 3KZQA 2OT3A 2XPEA 4GDFA 3CTFA 5CRDA 2N5FA 2C3QA 3HHVA 2RLIA 4MJBA 1T7PB 5F07A 2V32A 4RQXA 1Z5YE 2GZPA 2X99A 4ILFA 4WEYA 4ECJA 2DJ0A 1J0FA 2C1YA 1PGTA 2AUVA 1O8WA 3F6FA 2DBCA 2HZEA 3HVXA 1YVLA 1K0NA 4MPGA 5B8AA 3KIJA 4LA1A 2B1LA 3Q18A 5AN1A 3DVXA 3RPPA 1JFUA 2VLVA 4MZWA 4GCIA 1XW6A 3UJ1A 3IAS2 4AJ6A 1G7OA 4GRFA 4KAEA 2VCVA 4EO3A 1EGOA 1G6WA 3IPZA 4RUVA 5ID2A 2NPBA 4HSCX 2DIZA 4KUNA 3ZLPA 2MMOA 2DJKA 1M3IA 2N5BA 4OFNA 2R0GA 3RHBA 1X9MB 5DALA 1JLVA 1JZDA 5G5FA 5GAND 4V1Ag 3TJFA 4YAVA 3FHKA 1VRSD 1QMVA 3N9JA 1AUCA 2M80A 2L59A 4K0GA 3KCMA 2EFHA 2F51A 4X4JA 1ZYEA 3CRUA 3GKKA 4WF4A 2CV4A 5D93A 2CA8A 1SD8A 2DJJA 4N11A 3IK9A 2VUPA 2R37A 2CZ2A 4ZL7A 2MMZA 2YJ7A 2GSTA 3N5OA 3A5IA 1I5GA 2HSMA 3D22A 1DSBA 5E59A 5IIZA 3TRQA 5ECKB 4TR1A 5G2ZA 4L5OA 3VI5A 3HKRA 1ZMAA 2IWTA 2EFEA 4CY8A 4ECCA 1B8XA 4K9ZA 4HU9A 5IOWA 2EIQA 1M9AA 2YZHA 1V40A 3GMFA 4DSSB 3ZFLA 3VK9A 2YP6A 3Q6OA 3D4MA 2GVPA 2H71A 1C72A 1PSQA 1ERTA 3TJKA 2RUEA 3CSIA 1GSEA 1BAYA 3VFIA 4PI2C 2CX4A 1K0MA 2JZTA 3QOUA 1M2AA 3IOSA 1BF5A 3MNGA 17GSA 2WW0A 3F3RA 3QAGA 2DJ2A 3FZAA 2GT6A 2H72A 2H30A 2OE1A 2RUFA 2C0FA 3NOFA 4Q5FA 4K7OA 1B48A 5IQYA 2WFCA 2O89A 4ML6A 4EKZA 1Z6NA 3VWWA 3ZVJD 4BIKA 6GSYA 1EEJA 2L5LA 3D0ZA 5ECQB 1K3OA 5AIXA
chains in the Genus database with same CATH topology
4BL7A 1GTAA 2H1LA 2B7JA 2FY6A 1K3YA 2GS3A 2MBTA 2OADA 1Y1UA 2BMXA 2GLRA 2R3XA 2H1BA 2GSSA 4EUYA 5INYA 2PVQA 3TCOA 5J4YA 3FKFA 5IO0A 2HFDA 4PUAA 1PKZA 2IIYA 4IQAA 2C3TA 4JBBA 1T00A 2H6XA 4IJ3A 2OBIA 5D9WA 3HY2A 2YANA 3LYKA 4ZBAA 2H6YA 3H8QA 4PXOA 4FIWA 5AIVA 3BBYA 1GWCA 2JSYA 4AF2A 1K0DA 2GSRA 3IBHA 1ST9A 2V6KA 1U87A 1ON4A 1GSUA 4J57E 4F03A 3E3EA 2ZNMA 2ZCTA 1HNCA 2I3YA 4XIHA 3DYRA 4EVMA 4HOJA 1KBNA 2K6VA 4MH3A 1FAAA 1U3AA 2JZRA 1NHOA 3LQ7A 1CQHA 1YDKA 3GSTA 5DQSA 1GH2A 3VPQA 4KX4A 4L0UA 2X64A 1U3IA 3AY8A 4E8HA 4I2TA 2YV9A 4IBPA 1PMTA 1Z7RA 4PQIA 5JWOB 2GQLA 4YKGA 4PQ1A 1SK0A 3DRNA 5IOXA 2CVBA 1AXDA 4QQ7A 1PX7A 1GSFA 3KM6A 3GTUB 2C3NA 2RIIA 5DAKA 3DKSA 2HT9A 4K7IA 4OCFA 5H5SA 1V2AA 4ZBDA 4EXJA 3LXZA 2LNTA 1YQ1A 3A2WA 5EY6A 2YPMA 3LYPA 5DVBA 4QL7A 5IMZA 3U5RE 2LJAA 5H5QA 2IMFA 2PWJA 4XCSA 2FA4A 2KLXA 2MYGA 1F2EA 4P3YB 3HVVA 4I5QA 3ME7A 1Y6EA 4FO5A 1PD21 1HNAA 5CREA 1SYRA 3EU4A 2LS5A 1RQMA 2J23A 1OYJA 3TOTA 1A2JA 3ZVJA 4GQCA 3IR4A 1O81A 3DD3A 2X4AA 1S3AA 1GSDA 1LBKA 2KUCA 2DIYA 3P90A 5KN0A 4KSOA 3O6TA 4F0CA 3GV1A 2JSZA 5FHIA 4AI6A 1F37A 1GULA 1XW5A 9GSSA 1XZOA 1BQ7A 3DVWA 5IPHA 2OJLA 2B6MA 2N5AA 3J7Yk 2VL2A 3RAZA 1A0FA 1EEMA 4PTSA 4HZ4A 2HSYA 3UL3A 2HRKB 4KDUA 2MMAA 3ZIJA 2I1UA 2HRFA 3FK8A 3H79A 4WR5A 2X8HA 2XBQA 3VLNA 3IA1A 1ML6A 2H0HA 3L9VA 1UC7A 1Q4JA 4KB3A 1OC3A 5B7CA 1MDJA 5HR1A 4POBA 2A2SA 3D6IA 5BMUB 1X5EA 2ON7A 3PGTA 1X5DA 2CQ9A 4WXTA 4OCEA 4YQVA 22GSA 3HJPA 4JR4A 4ZBBA 4PNFA 2H0IA 2LSTA 1B4QA 2G0FA 3H1NA 4MF5A 1U6TA 1XWCA 3MSZA 4K2DA 3A2XA 4HS1A 1YF1A 1ILOA 1Z7PA 4HQZA 19GSA 2O7KA 3D21A 4YQMA 4CDOA 5ELAA 2GGTA 3LGCA 3UEMA 2H19A 3LXTA 3U6VA 3G7JA 2L6CA 1VF4A 1EGRA 2NDOA 3FR9A 3JCML 4NV2A 3UVTA 1KEBA 3ZMLA 4ICYA 3QMXA 4NHZA 3TRPA 2E0QA 1WPIA 2DJ1A 4XS1A 1EP7A 2A2PA 18GSA 4QL9A 3G7YA 2IFQA 2CZ3A 3DEXA 2H01A 5D9XA 4XTSA 2OE0A 4GSNA 1GTIA 2OA7A 5LD0A 2REMA 4MNNA 4XHMA 1IYHA 1YF0A 3KP8A 4OFMA 2JZSA 2X49A 4Z2UA 3DMLA 3UOMA 5D9TA 4IJIA 5E4WA 4ZL9A 1ERWA 2OKAA 2MZCA 5J5NA 5JWRB 5A5HA 2GZZA 2JL4A 5JCGA 1SL1B 2WULA 1BEDA 3W8JA 2MBSA 4ECBA 1XIYA 4IN0A 3FZ4A 1PN0A 2VLUA 5EPFA 4XS6A 3LJRA 1PX6A 3A5WA 3BCIA 3IXRA 5G31A 5CO3A 1AQWA 3KH7A 1K0CA 1MD4A 1SU9A 4Z2RA 1TJDA 4G0IA 3WT2A 4IQ1A 2OBKA 4O92A 1TRUA 4EC0A 2HZEB 3CYNA 5FWGA 2HXKA 4KGIA 1FVKA 3ZRDA 4HJMA 4POLA 3HYPA 2YJHA 5JCWA 2CT6A 3MAKA 4ZXGA 1M99A 1QFNA 1T1VA 4PNGA 2TIRA 1MD3A 3O3TA 4EDZA 3TB2A 2NTOA 4JU5A 1PL2A 2M72A 3K8NA 1AQVA 1XWAA 3I43A 1K3LA 3GSSA 3HMJG 4GWRA 1YY7A 4OO4A 2KHPA 1TU8A 1H75A 2K9FA 3C1SA 5DALB 4N0VA 1FOHA 1SK1A 2R2JA 4YKFA 3CXGA 3KGKA 1F3AA 4L8EA 1GP1A 3EPTA 5B6MA 5KOWA 2H0GA 2XC2A 4ZB6A 3M9JA 3ZL5A 1OKDA 3GFKA 1A24A 6GSSA 4MZBA 4YH2A 1XFLA 4MDCA 5IMAA 3CBUA 2C0DA 5F06A 4K6XA 3F4TA 2KP1A 5CP1A 5A4UA 4ZIJA 3EWLA 2HZFA 3KTBA 3ME8A 1WIKA 4N10A 4KW6A 2A4HA 2GQKA 1RK4A 2IN3A 5KEJA 5DCHA 4X43A 3MWHA 2B3SA 3TDGA 4KNDA 1ERUA 3GYKA 3GN3A 4TR0A 4EL1A 3VURA 4GTUA 2YWNA 1T3BA 2H1GA 2QC7A 2C0GA 3W6GA 4I97A 1M0UA 3C71A 3VWVA 1XOBA 5J4VA 4MZCA 5J40A 4NAXA 3EURA 1O85A 1X0RA 2AHEA 2YV7A 1SJZA 2L4QA 4PQHA 5IM9A 1SVOA 2PPTA 4I8BA 2KOKA 2R6KA 2B1KA 1Z9HA 2VCZA 1PQNA 3TOUA 4ZB9A 4PURA 4XS4B 8GSSA 3FY7A 3IHGA 1OKTA 2Z9SA 5ECPB 1O8XA 2EIRA 4K5RA 2J9HA 3I6AA 1A8YA 1PRXA 4JR6A 4K5SA 5ECRB 1W4VA 1TDIA 4Q5RA 1TRVA 4KCEA 3BJ5A 2E2MA 2YWMA 3C73A 5A1NA 4N3ZA 3IAM2 1W89A 3HDCA 1TU7A 1TI3A 2VOCA 2GZYA 4HU7A 2F8AA 1SK2A 4YQUA 2L4CA 6GSTA 4G10A 4J56E 1M2DA 2GDRA 3FR6A 4G9HA 3I9V2 5ECIB 4ULXA 5COHA 4IGJA 3GX0A 1UA5A 5G1LA 1FO5A 1OAZA 4WBJA 4WKWA 1Z3EA 5HFIA 3FW2A 2K8SA 4G01A 4K2XA 3TU3B 13GSA 5L71A 1XOAA 2VIMA 1QUWA 5KOXA 3DGQA 1X5CA 4MP4A 4F0BA 2YWIA 1GUMA 1NSWA 1USBA 4BVXA 6GSVA 2PU9C 3ZMKA 1TK0B 4Q5NA 2FUG2 10GSA 3R3EA 4K1FA 1TI1A 1BG1A 20GSA 3O76A 2P31A 3TUEA 3TJJA 3CTGA 2PBJA 3L9SA 2V41A 3SWLA 4K8MA 4H86A 1GNEA 2PMTA 1RW1A 2I81A 3QD9A 1S3DA 3TJGA 5ENUA 1FB6A 1YEPA 2P5RA 5DJLA 1FOVA 1WOUA 3HXSA 5KN3A 1PKWA 2HSNA 4NXIA 4CW9A 2RM5A 1OE7A 4G0LA 4BWQA 3ISOA 2R5GA 4OMVA 3TKSC 3DIEA 5C00A 2C80A 2VCTA 2IJYA 1OE8A 4OWYA 2C4JA 2OACA 2LTKA 1Y25A 3GIXA 5DQYA 3PPUA 12GSA 1XWGA 3F4SA 1FHEA 2DC5A 5A4WA 1TXXA 4KE3A 2YZUA 2WRTA 5CRGA 2VAFA 4OD7A 2WJUA 1IYIA 2L5OA 3GTUA 4AKGA 5A34B 3HD5A 3TRXA 2MMNA 4Q5QA 4LLRA 3TKQA 3TKRA 3IC4A 3CRTA 3L0HA 2BTOT 1TK8B 1TK5B 5ECLB 4CY6A 2YWOA 3QAWA 3LORA 4A5PA 4WBRD 3SBCA 4D73B 2I9HA 3BCKA 4N30A 1GL8A 3F9UA 4IKHA 3LWAA 2PN8A 2B7KA 1N2AA 3R2QA 1OVNA 2QKEA 3IC8A 1MTCA 1F6MC 2HNLA 5F0GA 3UBLA 4MJCA 2LQQA 3UBKA 2E7PA 4EIPA 1T4ZA 3BD2A 1OC8A 3FZ9A 3RDWA 1GSQA 4JEDA 1A0RP 4POMA 4LL1B 5KN2A 1B9YC 1M2BA 1OC9B 1ZYNA 4TXOB 1BX9A 2LV3A 1SYXA 3QPMA 1I9DA 4OFTA 2VL3A 2DKIA 3D5JA 3IK7A 5HQPA 1J9BA 4MLYA 4MPFA 4TKYA 3KTLA 4KSMA 2ZUPA 3EC3A 1AAZA 4IP1A 2V6OA 1QK8A 4MJAA 1PA3A 3QFAC 2HRKA 1DE1A 4PX1A 4I6XA 1B9XC 1M7TA 4X1UA 3QAVA 2HRNA 1CQGA 2FWFA 4OO5A 3Q19A 4XRDA 3GRXA 1VGLA 4ZB7A 3FYGA 3LSZA 1JZOA 2UV8G 3GA4A 3APOA 5J9CA 3G9BA 2XPDA 2X8CA 4Z2TA 4TN8A 1QGVA 1GUKA 5HFKA 5BMUA 4TOPA 2CAIA 4MK3A 3P7XA 4E68A 1THOA 1YKCA 1F9MA 2KP2A 1X9WB 3HJMA 2DLXA 2HSHA 3FEUA 1GSSA 2H74A 2QA1A 2G2QA 1GLQA 4ZILA 3I69A 3WGEA 3GL5A 5DJMA 3NZNA 3UMAA 2CVKA 1GTUA 5A4VA 3RBTA 1XPVA 3GKXA 3LW9A 4WF5A 2VD1A 4BA7A 1S3CA 4JRRA 4IW9A 3J7Yb 2HRAA 2HLSA 5FT3A 4GSSA 4BVYB 2LEGA 1KTEA 4KH7A 3C1RA 1SL2B 4IP6A 1A2MA 5CRHA 1VF2A 2CX3A 1E6BA 5ELGA 1J08A 4V2NA 1UN2A 2O5VA 1K0BA 5HFGA 3H93A 4ECIA 2AV4A 3EYTA 4JE1A 4X0XA 1AIUA 2FWHA 4V2MA 5GAPD 1ACVA 1ZL9A 5J41A 1ZZYA 1YEXA 2VO4A 4TR3A 1MDKA 2VCWA 2NBSA 1R4WA 4HZ2A 3ERFA 3FR3A 1M9BA 4FYBA 2LQOA 4JZQA 4AGSA 2TRXA 2QGVA 3WGDA 3UVHA 1V57A 4K7NA 2H70A 3HZ4A 4POKA 4EE0A 3UAPA 1YZXA 4KCAA 3TJBA 5CNWA 3CSJA 5ECMB 2VM1A 5D8IA 1O6JA 1FVJA 3WD6A 3IV4A 1E2YA 3GURA 1URMA 3KJYA 1WRYA 5ID2B 1PN9A 3KH9A 2AJQB 2PVOC 5JCUA 3F3QA 4E8EA 4F2IA 1ZGNA 5IMVA 4KA0A 4YAPA 3P8WA 3E9JB 3GX8A 3PINA 3VI7A 2H1AA 3A2VA 3GUSA 3EVIA 3F4RA 4NMUA 1BYEA 3BOAA 2PERA 3IHQA 4HQSA 4W66A 1O73A 3WYWA 3GH6A 3M3MA 3D4TA 4FH8A 2LRCA 1WP0A 1R7HA 2UZ8A 4DSRA 4AJ7A 2HSMB 6GSXA 4CHSA 1V98A 2O8VB 2DMMA 2LJKA 2VD0A 4PGTA 3US3A 4TR1B 3ED3A 4F9ZA 3KP9A 1HNBA 4IELA 1GRXA 3VWUA 5F8BA 4RQRA 1LJRA 3VPTA 2XBIA 3OR5A 3ZIVA 2A2RA 3LEFA 3GL3A 2F3MA 3TKPA 3A3TA 4RI6A 2X8GA 1Q98A 1SKWB 3L4NA 1QXHA 4TR4A 4EF0A 3CWGA 2HQTA 3KEBA 4MMMA 2FLSA 1V58A 1XCCA 2NVLA 2BJXA 2EIOA 1DBYA 2F9SA 3KXOA 1DUGA 4MABA 3ZYWA 2C0EA 2IMDA 5D96A 1TRSA 1H4OA 1EZKA 3QDNA 1YKAA 3IRAA 4DSSA 5KN1A 3V1WA 3C7MA 2RM6A 4QMKA 4L0WA 3P2AA 2VL2C 2HE3A 4G19A 2JU5A 2JACA 3HCZA 1DE2A 2H8LA 2OE3A 5HR2A 5GZZB 5A5KA 3F0IA 4NPBA 5A1NB 4ZB8A 5D9VA 3EE2A 1T8EB 1TW9A 2IL3A 3GKMA 5J3RA 2FHEA 2LKUA 3G7IA 4BL7B 3WT1A 4NHWA 2I4AA 3KD0A 2L57A 3ZFBA 4HUAA 4AKHA 2GSQA 5DDLA 1V9WA 4TW5A 5GSSA 3KMOA 2VLTA 4XS4A 1EP8A 2GQMA 3M9KA 3H4KA 2EFCA 5GSTA 1TOFA 2O85A 4LMVA 1AQXA 2CVDA 2WDUA 6GSWA 3FRCA 4BPYA 1EV9A 4IHUA 2WCIA 1G6YA 3HVSA 1SENA 2JADA 1SJIA 2VKZG 3KMNA 5BRTA 5B8BA 3APSA 2O87A 1WMJA 4DSQA 5IMCA 4FYCA 1XW9A 3GHAA 1G7EA 5LCZA 1NW2A 2YOIA 4MJEA 1T4YA 2H75A 1VF1A 4BVXB 1XXUA 2EFDA 3ZTLA 4O7HA 3RPNA 3TGZA 4I2UA 4G2EA 5EVOA 5J9BA 2DSAA 2IPAA 4EDYA 1AC1A 4HDEA 2FGXA 2AB6A 2FA8A 2VCQA 5IO2A 1XVQA 4LMWA 4HEA2 5CYYA 3WGXA 4DEJA 1XVWA 1SKRB 2GTUA 2XHFA 2QA2A 1F3BA 1GTBA 5C04A 2FNOA 1U88A 1GLPA 2YN1A 1EV4A 11GSA 1LU4A 2QSIA 4Z7XA 5G1KA 2VM2A 2V2GA 4GLTA 2VCXA 4TVEA 2YNXA 1TKDB 3M8NA 3Q74A 5HR0A 2B5EA 2HSNB 4KDXA 5D73A 5LNKe 2DKHA 4TXVA 2FD3A 4ID0A 2WS2A 1K0AA 2AYTA 2VL9A 5IMDA 1GNWA 3LG6A 3QCPA 4USSA 2K8VA 5G30A 2FWEA 1HYUA 5DAKB 4WR4A 3UIWA 1MDIA 5HR3A 1JZRA 1MEKA 3L9UA 2HI7A 1SD9A 3FMWA 2WZ9A 4ACSA 1WWJA 3HA9A 4MF7A 2R0CA 2V1MA 1FB0A 2IMEA 4NWYA 3EINA 3APQA 3CMIA 4LL4B 4GXZA 5ABRA 1TTZA 1KNGA 4XRAA 4FQUA 4PUFC 3F63A 3M0FA 1NM3A 2H1DA 1HD2A 4AKXB 1A23A 4O5QA 1ZOFA 2ES7A 3RHCA 3EU3A 2LJRA 5JWQB 1R5AA 16GSA 1THXA 1JZWA 5CAXA 1JLWA 3F8UA 1B4PA 2LNSA 2WGRA 2AAWA 1GUHA 1QQ2A 5ECNB 2IMIA 1FG4A 2TRCP 2HYXA 2R4VA 4IS0A 1GSYA 5J47A 5A34A 3TKSE 5ECOB 4O5UA 2LUSA 2H66A 1HQOA 5J4UA 1EWXA 2ALBA 1EOGA 5EL8A 1BG5A 3M1GA 5IPGA 4KDYA 4MF6A 3QR6A 14GSA 3W8SA 1JHBA 5DCGA 1X9SB 4D73A 3ZREA 1NHYA 2GT5A 1YJ6A 1FW1A 1N25A 2A4VA 4ZL8A 1R26A 3PH9A 3QFBC 1UVZA 3VWXA 2F8FA 3F6DA 2B5YA 2H73A 2L6DA 2C8UA 1R5PA 1SVMA 3NIVA 2EC4A 1PL1A 4GSTA 1SVLA 3GH9A 4AJ8A 3ERGA 5ECHB 2YCDA 2WB9A 7GSSA 3IE3A 1OC9A 3DWVA 3ERWA 2FCHA 4TXOA 1ZYPA 1O7UA 2CAQA 3PR8A 3CSHA 5B6NA 4J2FA 4DVCA 3IDVA 3GKNA 1SJ6A 5IMFA 1K0OA 4BWSA 5ECSA 1VF3A 3EMPA 1WE0A 4FYUA 1EOHA 2K18A 4EIQA 1G0TA 1AW9A 4G0KA 1ABAA 2E2GA 3L78A 3FZ5A 2H76A 1SL0B 5AISA 1XBSA 4ISDA 2IFQB 3E0UA 3MYDA 4V1Ap 2DJ3A 1ERVA 1SKSB 3S9FA 4GF0A 2P5QA 2R0PA 3EMXA 5CRWA 2DMLA 3GNJA 3DXBA 3ZZXA 4F82A 3HZ8A 4IVFA 3UARA 5A5HB 4TRXA 5G5EA 1ZYQB 4AKIA 4L5LA 2P0GA 1XWBA 3HJOA 2H6ZA 3LFLA 3MIXA 4HJ2A 1Z6MA 4GQFA 2PGTA 4NV5A 1N8JA 2FWGA 5F05A 1TP9A 2LRNA 1TXUA 5AGYA 1ZCPA 4K0NA 5H5RA 4HI7A 2M46A 5DBQA 4RI7A 1WJKA 4O32A 4V2LA 4N0ZA 2B5XA 1TRWA 4ML1A 4KF9A 4BVYA 2D2ZA 3MDKA 3C8EA 4MCUA 2LRTA 4O5RA 4MA9A 2ON5A 2PUKC 1A2LA 4MH2A 1XWKA 4WETA 3TKSA 2IMKA 1A8LA 1BJXA 6GSUA 3ZITA 3KZQA 2OT3A 2XPEA 4GDFA 3CTFA 5CRDA 2N5FA 2C3QA 3HHVA 2RLIA 4MJBA 1T7PB 5F07A 2V32A 4RQXA 1Z5YE 2GZPA 2X99A 4ILFA 4WEYA 4ECJA 2DJ0A 1J0FA 2C1YA 1PGTA 2AUVA 1O8WA 3F6FA 2DBCA 2HZEA 3HVXA 1YVLA 1K0NA 4MPGA 5B8AA 3KIJA 4LA1A 2B1LA 3Q18A 5AN1A 3DVXA 3RPPA 1JFUA 2VLVA 4MZWA 4GCIA 1XW6A 3UJ1A 3IAS2 4AJ6A 1G7OA 4GRFA 4KAEA 2VCVA 4EO3A 1EGOA 1G6WA 3IPZA 4RUVA 5ID2A 2NPBA 3ZLPA 2DIZA 4KUNA 2MMOA 2DJKA 2N5BA 4OFNA 2R0GA 3RHBA 1X9MB 5DALA 1JLVA 1JZDA 5G5FA 5GAND 4V1Ag 3TJFA 4YAVA 3FHKA 1VRSD 1QMVA 3N9JA 1AUCA 2M80A 2L59A 4K0GA 3KCMA 2EFHA 2F51A 4X4JA 1ZYEA 3CRUA 3GKKA 4WF4A 2CV4A 5D93A 2CA8A 1SD8A 2DJJA 4N11A 3IK9A 2VUPA 2R37A 2CZ2A 4ZL7A 2MMZA 2YJ7A 2GSTA 3N5OA 3A5IA 1I5GA 2HSMA 3D22A 1DSBA 5E59A 5IIZA 3TRQA 5ECKB 4TR1A 5G2ZA 4L5OA 3VI5A 3HKRA 1ZMAA 2IWTA 2EFEA 4CY8A 4ECCA 1B8XA 4K9ZA 4HU9A 5IOWA 2EIQA 1M9AA 2YZHA 1V40A 3GMFA 4DSSB 3ZFLA 3VK9A 2YP6A 3Q6OA 3D4MA 2GVPA 2H71A 1C72A 1PSQA 1ERTA 3TJKA 2RUEA 3CSIA 1GSEA 1BAYA 3VFIA 2CX4A 1K0MA 2JZTA 3QOUA 1M2AA 3IOSA 1BF5A 3MNGA 17GSA 3F3RA 3QAGA 2DJ2A 3FZAA 2GT6A 2H72A 2H30A 2OE1A 2RUFA 2C0FA 3NOFA 4Q5FA 4K7OA 1B48A 5IQYA 2WFCA 2O89A 4ML6A 4EKZA 1Z6NA 3VWWA 3ZVJD 6GSYA 1EEJA 2L5LA 3D0ZA 5ECQB 1K3OA 5AIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL7 A;  1GTA A;  2B7J A;  2FY6 A;  1K3Y A;  2GS3 A;  2MBT A;  2OAD A;  2BMX A;  2GLR A;  2R3X A;  2H1B A;  2GSS A;  4EUY A;  5INY A;  2PVQ A;  3TCO A;  3FKF A;  5IO0 A;  2HFD A;  4PUA A;  1PKZ A;  2IIY A;  4IQA A;  2C3T A;  4JBB A;  1T00 A;  2H6X A;  4IJ3 A;  2OBI A;  5D9W A;  3HY2 A;  2YAN A;  3LYK A;  4ZBA A;  2H6Y A;  3H8Q A;  4PXO A;  4FIW A;  5AIV A;  3BBY A;  1GWC A;  2JSY A;  4AF2 A;  1K0D A;  2GSR A;  3IBH A;  1ST9 A;  2V6K A;  1U87 A;  1ON4 A;  1GSU A;  4J57 E;  4F03 A;  3E3E A;  2ZNM A;  2ZCT A;  1HNC A;  2I3Y A;  4XIH A;  3DYR A;  4EVM A;  4HOJ A;  1KBN A;  2K6V A;  4MH3 A;  1FAA A;  1U3A A;  2JZR A;  1NHO A;  3LQ7 A;  1CQH A;  1YDK A;  3GST A;  5DQS A;  1GH2 A;  3VPQ A;  4KX4 A;  4L0U A;  2X64 A;  1U3I A;  3AY8 A;  4E8H A;  4I2T A;  2YV9 A;  4IBP A;  1PMT A;  1Z7R A;  4PQI A;  5JWO B;  2GQL A;  4PQ1 A;  1SK0 A;  3DRN A;  5IOX A;  2CVB A;  1AXD A;  4QQ7 A;  1PX7 A;  1GSF A;  3KM6 A;  3GTU B;  2C3N A;  2RII A;  5DAK A;  3DKS A;  2HT9 A;  4K7I A;  4OCF A;  5H5S A;  1V2A A;  4ZBD A;  4EXJ A;  3LXZ A;  2LNT A;  1YQ1 A;  3A2W A;  5EY6 A;  2YPM A;  3LYP A;  5DVB A;  4QL7 A;  5IMZ A;  3U5R E;  2LJA A;  5H5Q A;  2IMF A;  2PWJ A;  4XCS A;  2FA4 A;  2KLX A;  2MYG A;  1F2E A;  4P3Y B;  3HVV A;  4I5Q A;  3ME7 A;  1Y6E A;  4FO5 A;  1PD2 1;  1HNA A;  5CRE A;  1SYR A;  3EU4 A;  2LS5 A;  1RQM A;  2J23 A;  1OYJ A;  3TOT A;  1A2J A;  3ZVJ A;  4GQC A;  3IR4 A;  1O81 A;  3DD3 A;  1S3A A;  1GSD A;  1LBK A;  2KUC A;  2DIY A;  3P90 A;  5KN0 A;  4KSO A;  3O6T A;  4F0C A;  3GV1 A;  2JSZ A;  5FHI A;  1F37 A;  1GUL A;  1XW5 A;  9GSS A;  1XZO A;  1BQ7 A;  3DVW A;  5IPH A;  2OJL A;  2B6M A;  2N5A A;  3J7Y k;  2VL2 A;  3RAZ A;  1A0F A;  1EEM A;  4PTS A;  4HZ4 A;  2HSY A;  3UL3 A;  2HRK B;  4KDU A;  2MMA A;  3ZIJ A;  2I1U A;  2HRF A;  3FK8 A;  3H79 A;  4WR5 A;  2X8H A;  2XBQ A;  3VLN A;  3IA1 A;  1ML6 A;  2H0H A;  3L9V A;  1UC7 A;  1Q4J A;  4KB3 A;  1OC3 A;  5B7C A;  1MDJ A;  5HR1 A;  4POB A;  2A2S A;  3D6I A;  1X5E A;  2ON7 A;  3PGT A;  1X5D A;  2CQ9 A;  4WXT A;  4OCE A;  4YQV A;  22GS A;  3HJP A;  4JR4 A;  4ZBB A;  4PNF A;  2H0I A;  2LST A;  1B4Q A;  2G0F A;  3H1N A;  4MF5 A;  1U6T A;  1XWC A;  3MSZ A;  4K2D A;  3A2X A;  4HS1 A;  1YF1 A;  1ILO A;  1Z7P A;  4HQZ A;  19GS A;  2O7K A;  3D21 A;  4YQM A;  4CDO A;  5ELA A;  2GGT A;  3LGC A;  3UEM A;  2H19 A;  3LXT A;  3U6V A;  3G7J A;  2L6C A;  1VF4 A;  1EGR A;  2NDO A;  3FR9 A;  3JCM L;  4NV2 A;  3UVT A;  1KEB A;  3ZML A;  3QMX A;  4NHZ A;  3TRP A;  2E0Q A;  1WPI A;  2DJ1 A;  4XS1 A;  1EP7 A;  18GS A;  4QL9 A;  3G7Y A;  2IFQ A;  2CZ3 A;  3DEX A;  2H01 A;  5D9X A;  4XTS A;  2OE0 A;  4GSN A;  1GTI A;  2OA7 A;  5LD0 A;  2REM A;  4XHM A;  1IYH A;  1YF0 A;  3KP8 A;  4OFM A;  2JZS A;  3DML A;  3UOM A;  5D9T A;  4IJI A;  5E4W A;  4ZL9 A;  1ERW A;  2OKA A;  2MZC A;  5J5N A;  5JWR B;  2GZZ A;  2JL4 A;  5JCG A;  1SL1 B;  2WUL A;  1BED A;  3W8J A;  2MBS A;  4ECB A;  1XIY A;  4IN0 A;  3FZ4 A;  2VLU A;  5EPF A;  4XS6 A;  3LJR A;  1PX6 A;  3A5W A;  3BCI A;  3IXR A;  5G31 A;  5CO3 A;  1AQW A;  3KH7 A;  1K0C A;  1MD4 A;  1SU9 A;  1TJD A;  4G0I A;  3WT2 A;  4IQ1 A;  2OBK A;  4O92 A;  1TRU A;  4EC0 A;  2HZE B;  3CYN A;  5FWG A;  2HXK A;  4KGI A;  1FVK A;  3ZRD A;  4HJM A;  4POL A;  3HYP A;  2YJH A;  5JCW A;  2CT6 A;  3MAK A;  4ZXG A;  1M99 A;  1QFN A;  1T1V A;  4PNG A;  2TIR A;  1MD3 A;  3O3T A;  4EDZ A;  3TB2 A;  2NTO A;  4JU5 A;  1PL2 A;  2M72 A;  3K8N A;  1AQV A;  1XWA A;  3I43 A;  1K3L A;  3GSS A;  4GWR A;  1YY7 A;  4OO4 A;  2KHP A;  1TU8 A;  1H75 A;  2K9F A;  3C1S A;  5DAL B;  4N0V A;  1SK1 A;  2R2J A;  3CXG A;  3KGK A;  1F3A A;  4L8E A;  1GP1 A;  5B6M A;  2H0G A;  2XC2 A;  4ZB6 A;  3M9J A;  3ZL5 A;  1OKD A;  3GFK A;  1A24 A;  6GSS A;  4MZB A;  4YH2 A;  1XFL A;  4MDC A;  5IMA A;  3CBU A;  2C0D A;  5F06 A;  4K6X A;  3F4T A;  2KP1 A;  5CP1 A;  5A4U A;  4ZIJ A;  3EWL A;  2HZF A;  3KTB A;  3ME8 A;  1WIK A;  4N10 A;  4KW6 A;  2GQK A;  1RK4 A;  2IN3 A;  5KEJ A;  5DCH A;  4X43 A;  3MWH A;  2B3S A;  3TDG A;  4KND A;  1ERU A;  3GYK A;  3GN3 A;  4TR0 A;  4EL1 A;  3VUR A;  4GTU A;  2YWN A;  1T3B A;  2H1G A;  2QC7 A;  2C0G A;  3W6G A;  4I97 A;  1M0U A;  3C71 A;  3VWV A;  1XOB A;  4MZC A;  4NAX A;  3EUR A;  1O85 A;  1X0R A;  2AHE A;  2YV7 A;  1SJZ A;  2L4Q A;  4PQH A;  5IM9 A;  2PPT A;  4I8B A;  2KOK A;  2R6K A;  2B1K A;  1Z9H A;  2VCZ A;  1PQN A;  3TOU A;  4ZB9 A;  4PUR A;  4XS4 B;  8GSS A;  3FY7 A;  1OKT A;  2Z9S A;  5ECP B;  1O8X A;  2EIR A;  2J9H A;  3I6A A;  1A8Y A;  1PRX A;  4JR6 A;  5ECR B;  1W4V A;  1TDI A;  4Q5R A;  1TRV A;  4KCE A;  3BJ5 A;  2E2M A;  2YWM A;  3C73 A;  3IAM 2;  1W89 A;  3HDC A;  1TU7 A;  1TI3 A;  2VOC A;  2GZY A;  4HU7 A;  2F8A A;  1SK2 A;  4YQU A;  2L4C A;  6GST A;  4G10 A;  4J56 E;  1M2D A;  2GDR A;  3FR6 A;  4G9H A;  3I9V 2;  5ECI B;  4ULX A;  5COH A;  4IGJ A;  3GX0 A;  1UA5 A;  5G1L A;  1FO5 A;  1OAZ A;  4WBJ A;  4WKW A;  1Z3E A;  5HFI A;  3FW2 A;  2K8S A;  13GS A;  5L71 A;  1XOA A;  2VIM A;  1QUW A;  3DGQ A;  1X5C A;  4MP4 A;  4F0B A;  2YWI A;  1GUM A;  1NSW A;  1USB A;  4BVX A;  6GSV A;  2PU9 C;  3ZMK A;  1TK0 B;  4Q5N A;  2FUG 2;  10GS A;  3R3E A;  4K1F A;  1TI1 A;  20GS A;  3O76 A;  2P31 A;  3TUE A;  3TJJ A;  3CTG A;  2PBJ A;  3L9S A;  2V41 A;  3SWL A;  4K8M A;  4H86 A;  1GNE A;  2PMT A;  1RW1 A;  2I81 A;  3QD9 A;  1S3D A;  3TJG A;  5ENU A;  1FB6 A;  1YEP A;  2P5R A;  5DJL A;  1FOV A;  1WOU A;  3HXS A;  5KN3 A;  1PKW A;  4NXI A;  4CW9 A;  2RM5 A;  1OE7 A;  4G0L A;  4BWQ A;  3ISO A;  2R5G A;  4OMV A;  3TKS C;  3DIE A;  5C00 A;  2C80 A;  2VCT A;  2IJY A;  1OE8 A;  4OWY A;  2C4J A;  2OAC A;  2LTK A;  1Y25 A;  3GIX A;  5DQY A;  3PPU A;  12GS A;  1XWG A;  3F4S A;  1FHE A;  2DC5 A;  5A4W A;  1TXX A;  4KE3 A;  2YZU A;  2WRT A;  5CRG A;  2VAF A;  4OD7 A;  2WJU A;  1IYI A;  2L5O A;  3GTU A;  3HD5 A;  3TRX A;  2MMN A;  4Q5Q A;  4LLR A;  3TKQ A;  3TKR A;  3IC4 A;  3CRT A;  3L0H A;  2BTO T;  1TK8 B;  1TK5 B;  5ECL B;  2YWO A;  3QAW A;  3LOR A;  4WBR D;  3SBC A;  4D73 B;  2I9H A;  3BCK A;  4N30 A;  1GL8 A;  3F9U A;  4IKH A;  3LWA A;  2PN8 A;  2B7K A;  1N2A A;  3R2Q A;  1OVN A;  2QKE A;  3IC8 A;  1MTC A;  1F6M C;  2HNL A;  5F0G A;  3UBL A;  4MJC A;  2LQQ A;  3UBK A;  2E7P A;  1T4Z A;  3BD2 A;  1OC8 A;  3FZ9 A;  3RDW A;  1GSQ A;  4JED A;  1A0R P;  4POM A;  4LL1 B;  5KN2 A;  1B9Y C;  1M2B A;  1OC9 B;  4TXO B;  1BX9 A;  2LV3 A;  1SYX A;  3QPM A;  1I9D A;  4OFT A;  2VL3 A;  3D5J A;  3IK7 A;  5HQP A;  1J9B A;  4MLY A;  4MPF A;  4TKY A;  3KTL A;  4KSM A;  2ZUP A;  3EC3 A;  1AAZ A;  4IP1 A;  2V6O A;  1QK8 A;  4MJA A;  1PA3 A;  3QFA C;  2HRK A;  1DE1 A;  4PX1 A;  4I6X A;  1B9X C;  1M7T A;  4X1U A;  3QAV A;  2HRN A;  1CQG A;  2FWF A;  4OO5 A;  3Q19 A;  4XRD A;  3GRX A;  1VGL A;  3FYG A;  3LSZ A;  1JZO A;  3GA4 A;  3APO A;  5J9C A;  3G9B A;  2XPD A;  2X8C A;  4TN8 A;  1QGV A;  1GUK A;  5HFK A;  5BMU A;  4TOP A;  2CAI A;  4MK3 A;  3P7X A;  1THO A;  1YKC A;  1F9M A;  2KP2 A;  1X9W B;  3HJM A;  2DLX A;  2HSH A;  3FEU A;  1GSS A;  2H74 A;  2G2Q A;  1GLQ A;  4ZIL A;  3I69 A;  3WGE A;  3GL5 A;  5DJM A;  3NZN A;  3UMA A;  2CVK A;  1GTU A;  5A4V A;  3RBT A;  1XPV A;  3GKX A;  4WF5 A;  2VD1 A;  4BA7 A;  1S3C A;  4JRR A;  4IW9 A;  3J7Y b;  2HRA A;  2HLS A;  5FT3 A;  4GSS A;  4BVY B;  2LEG A;  1KTE A;  4KH7 A;  3C1R A;  1SL2 B;  4IP6 A;  1A2M A;  5CRH A;  1VF2 A;  2CX3 A;  1E6B A;  5ELG A;  1J08 A;  4V2N A;  1UN2 A;  1K0B A;  5HFG A;  3H93 A;  4ECI A;  2AV4 A;  3EYT A;  4JE1 A;  4X0X A;  1AIU A;  2FWH A;  4V2M A;  5GAP D;  1ACV A;  1ZL9 A;  5J41 A;  1ZZY A;  1YEX A;  2VO4 A;  4TR3 A;  1MDK A;  2VCW A;  2NBS A;  1R4W A;  4HZ2 A;  3ERF A;  3FR3 A;  1M9B A;  4FYB A;  2LQO A;  4JZQ A;  4AGS A;  2TRX A;  2QGV A;  3WGD A;  3UVH A;  1V57 A;  4K7N A;  2H70 A;  3HZ4 A;  4POK A;  4EE0 A;  3UAP A;  1YZX A;  4KCA A;  3TJB A;  5CNW A;  3CSJ A;  5ECM B;  2VM1 A;  5D8I A;  1O6J A;  1FVJ A;  3WD6 A;  3IV4 A;  1E2Y A;  3GUR A;  1URM A;  3KJY A;  1WRY A;  5ID2 B;  1PN9 A;  3KH9 A;  2AJQ B;  2PVO C;  5JCU A;  3F3Q A;  4E8E A;  4F2I A;  1ZGN A;  5IMV A;  4KA0 A;  4YAP A;  3P8W A;  3E9J B;  3PIN A;  3GX8 A;  3VI7 A;  2H1A A;  3A2V A;  3GUS A;  3EVI A;  3F4R A;  4NMU A;  1BYE A;  3BOA A;  2PER A;  3IHQ A;  4HQS A;  1O73 A;  3WYW A;  3GH6 A;  3M3M A;  3D4T A;  4FH8 A;  2LRC A;  1WP0 A;  1R7H A;  2UZ8 A;  4DSR A;  4AJ7 A;  2HSM B;  6GSX A;  4CHS A;  1V98 A;  2O8V B;  2DMM A;  2LJK A;  2VD0 A;  4PGT A;  3US3 A;  4TR1 B;  3ED3 A;  4F9Z A;  3KP9 A;  1HNB A;  4IEL A;  1GRX A;  3VWU A;  5F8B A;  4RQR A;  1LJR A;  3VPT A;  2XBI A;  3OR5 A;  3ZIV A;  2A2R A;  3LEF A;  3GL3 A;  2F3M A;  3TKP A;  3A3T A;  4RI6 A;  2X8G A;  1Q98 A;  1SKW B;  3L4N A;  1QXH A;  4TR4 A;  4EF0 A;  2HQT A;  3KEB A;  4MMM A;  2FLS A;  1V58 A;  1XCC A;  2NVL A;  2BJX A;  2EIO A;  1DBY A;  2F9S A;  3KXO A;  1DUG A;  4MAB A;  3ZYW A;  2C0E A;  2IMD A;  5D96 A;  1TRS A;  1H4O A;  1EZK A;  3QDN A;  1YKA A;  3IRA A;  4DSS A;  5KN1 A;  3V1W A;  3C7M A;  2RM6 A;  4L0W A;  3P2A A;  2VL2 C;  2HE3 A;  4G19 A;  2JU5 A;  2JAC A;  3HCZ A;  1DE2 A;  2H8L A;  2OE3 A;  5HR2 A;  5GZZ B;  5A5K A;  3F0I A;  4NPB A;  4ZB8 A;  5D9V A;  3EE2 A;  1T8E B;  1TW9 A;  2IL3 A;  3GKM A;  5J3R A;  2FHE A;  2LKU A;  3G7I A;  4BL7 B;  3WT1 A;  4NHW A;  2I4A A;  3KD0 A;  2L57 A;  3ZFB A;  4HUA A;  2GSQ A;  5DDL A;  1V9W A;  4TW5 A;  5GSS A;  3KMO A;  2VLT A;  4XS4 A;  1EP8 A;  2GQM A;  3M9K A;  3H4K A;  5GST A;  1TOF A;  2O85 A;  4LMV A;  1AQX A;  2CVD A;  2WDU A;  6GSW A;  3FRC A;  4BPY A;  1EV9 A;  4IHU A;  2WCI A;  1G6Y A;  3HVS A;  1SEN A;  2JAD A;  1SJI A;  3KMN A;  5B8B A;  3APS A;  2O87 A;  1WMJ A;  4DSQ A;  5IMC A;  4FYC A;  1XW9 A;  3GHA A;  1G7E A;  5LCZ A;  1NW2 A;  2YOI A;  4MJE A;  1T4Y A;  2H75 A;  1VF1 A;  4BVX B;  1XXU A;  3ZTL A;  4O7H A;  3RPN A;  3TGZ A;  4I2U A;  4G2E A;  5EVO A;  5J9B A;  2DSA A;  2IPA A;  4EDY A;  1AC1 A;  4HDE A;  2FGX A;  2AB6 A;  2FA8 A;  2VCQ A;  5IO2 A;  1XVQ A;  4LMW A;  4HEA 2;  5CYY A;  3WGX A;  4DEJ A;  1XVW A;  1SKR B;  2GTU A;  2XHF A;  1F3B A;  1GTB A;  5C04 A;  2FNO A;  1U88 A;  1GLP A;  2YN1 A;  1EV4 A;  11GS A;  1LU4 A;  2QSI A;  4Z7X A;  5G1K A;  2VM2 A;  2V2G A;  4GLT A;  2VCX A;  4TVE A;  2YNX A;  1TKD B;  3M8N A;  3Q74 A;  5HR0 A;  2B5E A;  2HSN B;  4KDX A;  5D73 A;  5LNK e;  4TXV A;  2FD3 A;  4ID0 A;  2WS2 A;  1K0A A;  2AYT A;  2VL9 A;  5IMD A;  1GNW A;  3LG6 A;  3QCP A;  4USS A;  2K8V A;  5G30 A;  2FWE A;  1HYU A;  5DAK B;  4WR4 A;  3UIW A;  1MDI A;  5HR3 A;  1JZR A;  1MEK A;  3L9U A;  2HI7 A;  1SD9 A;  2WZ9 A;  4ACS A;  1WWJ A;  3HA9 A;  4MF7 A;  2V1M A;  1FB0 A;  2IME A;  4NWY A;  3EIN A;  3APQ A;  3CMI A;  4LL4 B;  4GXZ A;  5ABR A;  1TTZ A;  1KNG A;  4XRA A;  4FQU A;  4PUF C;  3F63 A;  3M0F A;  1NM3 A;  2H1D A;  1HD2 A;  1A23 A;  1ZOF A;  2ES7 A;  3RHC A;  3EU3 A;  2LJR A;  5JWQ B;  1R5A A;  16GS A;  1THX A;  1JZW A;  5CAX A;  1JLW A;  3F8U A;  1B4P A;  2LNS A;  2WGR A;  2AAW A;  1GUH A;  1QQ2 A;  5ECN B;  2IMI A;  1FG4 A;  2TRC P;  2HYX A;  2R4V A;  4IS0 A;  1GSY A;  3TKS E;  5ECO B;  2LUS A;  2H66 A;  1HQO A;  5J4U A;  1EWX A;  2ALB A;  1EOG A;  5EL8 A;  1BG5 A;  3M1G A;  5IPG A;  4KDY A;  4MF6 A;  3QR6 A;  14GS A;  3W8S A;  1JHB A;  5DCG A;  1X9S B;  4D73 A;  3ZRE A;  1NHY A;  2GT5 A;  1YJ6 A;  1FW1 A;  2A4V A;  4ZL8 A;  1R26 A;  3PH9 A;  3QFB C;  1UVZ A;  3VWX A;  2F8F A;  3F6D A;  2B5Y A;  2H73 A;  2L6D A;  2C8U A;  1R5P A;  2EC4 A;  3NIV A;  1PL1 A;  4GST A;  3GH9 A;  4AJ8 A;  3ERG A;  5ECH B;  2YCD A;  2WB9 A;  7GSS A;  3IE3 A;  1OC9 A;  3DWV A;  3ERW A;  2FCH A;  4TXO A;  1O7U A;  2CAQ A;  3PR8 A;  3CSH A;  5B6N A;  4J2F A;  4DVC A;  3IDV A;  3GKN A;  1SJ6 A;  5IMF A;  1K0O A;  4BWS A;  5ECS A;  1VF3 A;  3EMP A;  1WE0 A;  4FYU A;  1EOH A;  2K18 A;  1G0T A;  1AW9 A;  4G0K A;  1ABA A;  2E2G A;  3L78 A;  3FZ5 A;  2H76 A;  1SL0 B;  5AIS A;  1XBS A;  4ISD A;  2IFQ B;  3E0U A;  4V1A p;  2DJ3 A;  1ERV A;  1SKS B;  3S9F A;  4GF0 A;  2P5Q A;  3EMX A;  5CRW A;  2DML A;  3GNJ A;  3DXB A;  3ZZX A;  4F82 A;  3HZ8 A;  4IVF A;  3UAR A;  4TRX A;  5G5E A;  1ZYQ B;  4L5L A;  2P0G A;  1XWB A;  3HJO A;  2H6Z A;  3LFL A;  4HJ2 A;  1Z6M A;  4GQF A;  2PGT A;  4NV5 A;  1N8J A;  2FWG A;  5F05 A;  1TP9 A;  2LRN A;  5AGY A;  1ZCP A;  4K0N A;  5H5R A;  4HI7 A;  2M46 A;  5DBQ A;  4RI7 A;  1WJK A;  4O32 A;  4V2L A;  4N0Z A;  2B5X A;  1TRW A;  4ML1 A;  4KF9 A;  4BVY A;  2D2Z A;  3MDK A;  3C8E A;  4MCU A;  2LRT A;  4O5R A;  4MA9 A;  2ON5 A;  2PUK C;  1A2L A;  4MH2 A;  1XWK A;  4WET A;  3TKS A;  2IMK A;  1A8L A;  1BJX A;  6GSU A;  3ZIT A;  3KZQ A;  2XPE A;  3CTF A;  5CRD A;  2N5F A;  2C3Q A;  3HHV A;  2RLI A;  4MJB A;  1T7P B;  5F07 A;  2V32 A;  4RQX A;  1Z5Y E;  2GZP A;  2X99 A;  4ILF A;  4WEY A;  4ECJ A;  2DJ0 A;  1J0F A;  2C1Y A;  1PGT A;  2AUV A;  1O8W A;  3F6F A;  2DBC A;  2HZE A;  3HVX A;  1K0N A;  4MPG A;  5B8A A;  3KIJ A;  4LA1 A;  2B1L A;  3Q18 A;  5AN1 A;  3DVX A;  3RPP A;  1JFU A;  2VLV A;  4MZW A;  4GCI A;  1XW6 A;  3UJ1 A;  3IAS 2;  4AJ6 A;  1G7O A;  4GRF A;  4KAE A;  2VCV A;  4EO3 A;  1EGO A;  1G6W A;  3IPZ A;  4RUV A;  5ID2 A;  2NPB A;  3ZLP A;  2DIZ A;  4KUN A;  2MMO A;  2DJK A;  2N5B A;  4OFN A;  3RHB A;  1X9M B;  5DAL A;  1JLV A;  1JZD A;  5G5F A;  5GAN D;  4V1A g;  3TJF A;  4YAV A;  3FHK A;  1VRS D;  1QMV A;  3N9J A;  1AUC A;  2M80 A;  2L59 A;  4K0G A;  3KCM A;  2F51 A;  1ZYE A;  3CRU A;  3GKK A;  4WF4 A;  2CV4 A;  5D93 A;  2CA8 A;  1SD8 A;  2DJJ A;  4N11 A;  3IK9 A;  2VUP A;  2R37 A;  2CZ2 A;  4ZL7 A;  2MMZ A;  2YJ7 A;  2GST A;  3N5O A;  1I5G A;  2HSM A;  3D22 A;  1DSB A;  5E59 A;  5IIZ A;  3TRQ A;  5ECK B;  4TR1 A;  5G2Z A;  4L5O A;  3VI5 A;  3HKR A;  1ZMA A;  2IWT A;  4ECC A;  1B8X A;  4K9Z A;  4HU9 A;  5IOW A;  2EIQ A;  1M9A A;  2YZH A;  1V40 A;  3GMF A;  4DSS B;  3ZFL A;  3VK9 A;  2YP6 A;  3Q6O A;  3D4M A;  2GVP A;  2H71 A;  1C72 A;  1PSQ A;  1ERT A;  3TJK A;  2RUE A;  3CSI A;  1GSE A;  1BAY A;  3VFI A;  2CX4 A;  1K0M A;  2JZT A;  3QOU A;  1M2A A;  3IOS A;  3MNG A;  17GS A;  3F3R A;  3QAG A;  2DJ2 A;  3FZA A;  2GT6 A;  2H72 A;  2H30 A;  2OE1 A;  2RUF A;  2C0F A;  3NOF A;  4Q5F A;  4K7O A;  1B48 A;  5IQY A;  2WFC A;  2O89 A;  4ML6 A;  4EKZ A;  1Z6N A;  3VWW A;  3ZVJ D;  6GSY A;  1EEJ A;  2L5L A;  3D0Z A;  5ECQ B;  1K3O A;  5AIX A; 
#chains in the Genus database with same CATH topology
 4BL7 A;  1GTA A;  2H1L A;  2B7J A;  2FY6 A;  1K3Y A;  2GS3 A;  2MBT A;  2OAD A;  1Y1U A;  2BMX A;  2GLR A;  2R3X A;  2H1B A;  2GSS A;  4EUY A;  5INY A;  2PVQ A;  3TCO A;  5J4Y A;  3FKF A;  5IO0 A;  2HFD A;  4PUA A;  1PKZ A;  2IIY A;  4IQA A;  2C3T A;  4JBB A;  1T00 A;  2H6X A;  4IJ3 A;  2OBI A;  5D9W A;  3HY2 A;  2YAN A;  3LYK A;  4ZBA A;  2H6Y A;  3H8Q A;  4PXO A;  4FIW A;  5AIV A;  2WW1 A;  3BBY A;  1GWC A;  2JSY A;  4AF2 A;  1K0D A;  2GSR A;  3IBH A;  1ST9 A;  2V6K A;  1U87 A;  1ON4 A;  1GSU A;  4FXY P;  4J57 E;  4F03 A;  3E3E A;  2ZNM A;  2ZCT A;  1HNC A;  2I3Y A;  4XIH A;  3DYR A;  4EVM A;  4HOJ A;  1KBN A;  2K6V A;  4MH3 A;  1FAA A;  1U3A A;  2JZR A;  1NHO A;  3LQ7 A;  1CQH A;  1YDK A;  3GST A;  5DQS A;  1GH2 A;  3VPQ A;  4KX4 A;  4L0U A;  2X64 A;  1U3I A;  3AY8 A;  4E8H A;  4I2T A;  2YV9 A;  4IBP A;  1PMT A;  1Z7R A;  4PQI A;  5JWO B;  2GQL A;  4YKG A;  4PQ1 A;  1SK0 A;  3DRN A;  5IOX A;  2CVB A;  1AXD A;  4QQ7 A;  1PX7 A;  1GSF A;  3KM6 A;  3GTU B;  2C3N A;  2RII A;  5DAK A;  3DKS A;  2HT9 A;  4K7I A;  4OCF A;  5H5S A;  1V2A A;  4ZBD A;  4EXJ A;  3LXZ A;  2LNT A;  1YQ1 A;  3A2W A;  5EY6 A;  2YPM A;  3LYP A;  5DVB A;  4QL7 A;  5IMZ A;  3U5R E;  2LJA A;  5H5Q A;  1XG8 A;  2IMF A;  2PWJ A;  4XCS A;  2FA4 A;  2KLX A;  2MYG A;  1F2E A;  4P3Y B;  3HVV A;  4I5Q A;  3ME7 A;  1Y6E A;  4FO5 A;  1PD2 1;  1HNA A;  5CRE A;  1SYR A;  3EU4 A;  2LS5 A;  1RQM A;  2J23 A;  1OYJ A;  3TOT A;  1A2J A;  3ZVJ A;  4GQC A;  3IR4 A;  1O81 A;  3DD3 A;  2X4A A;  1S3A A;  1GSD A;  1LBK A;  2KUC A;  2DIY A;  3P90 A;  5KN0 A;  4KSO A;  3O6T A;  4F0C A;  3GV1 A;  2JSZ A;  5FHI A;  4AI6 A;  1F37 A;  1GUL A;  1XW5 A;  9GSS A;  1XZO A;  1BQ7 A;  3DVW A;  5IPH A;  2OJL A;  2B6M A;  2N5A A;  3J7Y k;  2VL2 A;  3RAZ A;  1A0F A;  1EEM A;  4PTS A;  4HZ4 A;  2HSY A;  3UL3 A;  2HRK B;  4KDU A;  2MMA A;  3ZIJ A;  2I1U A;  2HRF A;  3FK8 A;  3H79 A;  4WR5 A;  2X8H A;  2XBQ A;  3VLN A;  3IA1 A;  1ML6 A;  2H0H A;  3L9V A;  1UC7 A;  1Q4J A;  4KB3 A;  1OC3 A;  5B7C A;  1MDJ A;  5HR1 A;  4POB A;  2A2S A;  3D6I A;  5BMU B;  1X5E A;  2ON7 A;  3PGT A;  1X5D A;  2CQ9 A;  4WXT A;  4OCE A;  4YQV A;  22GS A;  3HJP A;  4JR4 A;  4ZBB A;  4PNF A;  2H0I A;  2LST A;  1B4Q A;  2G0F A;  3H1N A;  4MF5 A;  1U6T A;  1XWC A;  3MSZ A;  4K2D A;  3A2X A;  4HS1 A;  1YF1 A;  1ILO A;  1Z7P A;  4HQZ A;  19GS A;  2O7K A;  3D21 A;  4YQM A;  4CDO A;  5ELA A;  2GGT A;  3LGC A;  3UEM A;  2H19 A;  3LXT A;  3U6V A;  3G7J A;  2L6C A;  1VF4 A;  1EGR A;  2NDO A;  3FR9 A;  3JCM L;  2O36 A;  4NV2 A;  3UVT A;  1KEB A;  3ZML A;  4ICY A;  3QMX A;  4NHZ A;  3HVN A;  3TRP A;  2E0Q A;  1WPI A;  2DJ1 A;  4XS1 A;  1EP7 A;  2A2P A;  18GS A;  4QL9 A;  3G7Y A;  2IFQ A;  2CZ3 A;  3DEX A;  2H01 A;  5D9X A;  4XTS A;  2OE0 A;  4GSN A;  1GTI A;  2OA7 A;  5LD0 A;  2REM A;  4MNN A;  4XHM A;  1IYH A;  1YF0 A;  3KP8 A;  4OFM A;  2JZS A;  2X49 A;  4Z2U A;  3DML A;  3UOM A;  5D9T A;  4IJI A;  5E4W A;  4ZL9 A;  1ERW A;  2OKA A;  2MZC A;  5J5N A;  5JWR B;  5A5H A;  2GZZ A;  2JL4 A;  5JCG A;  1SL1 B;  2WUL A;  1BED A;  2WVY A;  3W8J A;  2MBS A;  4ECB A;  1XIY A;  4IN0 A;  3FZ4 A;  1PN0 A;  2VLU A;  5EPF A;  4XS6 A;  3LJR A;  1PX6 A;  3A5W A;  3BCI A;  3IXR A;  5G31 A;  5CO3 A;  1AQW A;  3KH7 A;  1K0C A;  1MD4 A;  1SU9 A;  4Z2R A;  1TJD A;  4G0I A;  3WT2 A;  4IQ1 A;  2OBK A;  4O92 A;  1TRU A;  4EC0 A;  2HZE B;  3RGB C;  3CYN A;  5FWG A;  2HXK A;  4KGI A;  1FVK A;  3ZRD A;  4HJM A;  4POL A;  3HYP A;  2YJH A;  5JCW A;  2CT6 A;  3MAK A;  4ZXG A;  1M99 A;  1QFN A;  1T1V A;  4PNG A;  2TIR A;  1MD3 A;  3O3T A;  4EDZ A;  3TB2 A;  2NTO A;  4JU5 A;  2WVZ A;  1PL2 A;  2M72 A;  3K8N A;  1AQV A;  1XWA A;  3I43 A;  1K3L A;  3GSS A;  3HMJ G;  4GWR A;  1YY7 A;  4OO4 A;  2KHP A;  1TU8 A;  1H75 A;  2K9F A;  3C1S A;  5DAL B;  4N0V A;  1FOH A;  1SK1 A;  2R2J A;  4YKF A;  3CXG A;  3KGK A;  1F3A A;  4L8E A;  1GP1 A;  3EPT A;  5B6M A;  5KOW A;  2H0G A;  2XC2 A;  4ZB6 A;  2WW2 A;  3M9J A;  3ZL5 A;  1OKD A;  3GFK A;  1A24 A;  6GSS A;  4MZB A;  4YH2 A;  1XFL A;  4MDC A;  5IMA A;  3CBU A;  2C0D A;  5F06 A;  4K6X A;  3F4T A;  3RFR C;  2KP1 A;  2WW3 A;  5CP1 A;  5A4U A;  4ZIJ A;  3EWL A;  2HZF A;  3KTB A;  3ME8 A;  1WIK A;  4N10 A;  4KW6 A;  2A4H A;  2GQK A;  1RK4 A;  2IN3 A;  5KEJ A;  5DCH A;  4X43 A;  3MWH A;  2B3S A;  3TDG A;  4KND A;  1ERU A;  3GYK A;  3GN3 A;  4TR0 A;  4EL1 A;  3VUR A;  4GTU A;  2YWN A;  1T3B A;  2H1G A;  2QC7 A;  2C0G A;  3W6G A;  4I97 A;  1M0U A;  3C71 A;  3VWV A;  1XOB A;  5J4V A;  4MZC A;  5J40 A;  4NAX A;  3EUR A;  1O85 A;  1X0R A;  2AHE A;  2YV7 A;  1SJZ A;  2L4Q A;  4PQH A;  5IM9 A;  1SVO A;  2PPT A;  4I8B A;  2KOK A;  2R6K A;  2B1K A;  1Z9H A;  2VCZ A;  1PQN A;  3TOU A;  4ZB9 A;  4PUR A;  4XS4 B;  8GSS A;  3FY7 A;  3IHG A;  1OKT A;  2Z9S A;  5ECP B;  1O8X A;  2EIR A;  4K5R A;  2J9H A;  3I6A A;  1A8Y A;  1PRX A;  4JR6 A;  4K5S A;  5ECR B;  1W4V A;  1TDI A;  4Q5R A;  1TRV A;  4KCE A;  3BJ5 A;  2E2M A;  2YWM A;  3C73 A;  5A1N A;  4N3Z A;  3IAM 2;  1W89 A;  3HDC A;  1TU7 A;  1TI3 A;  2VOC A;  2GZY A;  4HU7 A;  2F8A A;  1SK2 A;  4YQU A;  2L4C A;  6GST A;  4G10 A;  4J56 E;  1M2D A;  2GDR A;  3FR6 A;  4G9H A;  3I9V 2;  5ECI B;  4ULX A;  5COH A;  4IGJ A;  3GX0 A;  1UA5 A;  5G1L A;  1FO5 A;  1OAZ A;  4WBJ A;  4PHZ C;  4WKW A;  1Z3E A;  5HFI A;  3FW2 A;  2K8S A;  4G01 A;  4K2X A;  3TU3 B;  13GS A;  5L71 A;  1XOA A;  2VIM A;  1QUW A;  5KOX A;  3DGQ A;  1X5C A;  4MP4 A;  4F0B A;  2YWI A;  1GUM A;  1NSW A;  1USB A;  4BVX A;  6GSV A;  2PU9 C;  3ZMK A;  1TK0 B;  3CQF A;  4Q5N A;  2FUG 2;  2WZS A;  3R3E A;  10GS A;  4K1F A;  1TI1 A;  1BG1 A;  20GS A;  3O76 A;  2P31 A;  3TUE A;  3TJJ A;  3CTG A;  2PBJ A;  3L9S A;  2V41 A;  3SWL A;  4K8M A;  4H86 A;  1GNE A;  2PMT A;  1RW1 A;  2I81 A;  3QD9 A;  1S3D A;  3TJG A;  5ENU A;  1FB6 A;  1YEP A;  1PFO A;  2P5R A;  5DJL A;  1FOV A;  1WOU A;  3HXS A;  5KN3 A;  1PKW A;  2HSN A;  4NXI A;  4CW9 A;  1S3R A;  2RM5 A;  1OE7 A;  4G0L A;  4BWQ A;  3ISO A;  2R5G A;  4OMV A;  3TKS C;  3DIE A;  5C00 A;  2C80 A;  2VCT A;  2IJY A;  1OE8 A;  4OWY A;  2C4J A;  2OAC A;  2LTK A;  1Y25 A;  3GIX A;  5DQY A;  3PPU A;  12GS A;  1XWG A;  3F4S A;  1FHE A;  2DC5 A;  2O3E A;  5A4W A;  1TXX A;  4KE3 A;  2YZU A;  2WRT A;  5CRG A;  2VAF A;  4OD7 A;  2WJU A;  1IYI A;  2L5O A;  3GTU A;  4AKG A;  5A34 B;  3HD5 A;  3TRX A;  2MMN A;  4Q5Q A;  4LLR A;  3TKQ A;  3TKR A;  3IC4 A;  3CRT A;  3L0H A;  2BTO T;  1TK8 B;  1TK5 B;  5ECL B;  4CY6 A;  2YWO A;  3QAW A;  3LOR A;  4A5P A;  4WBR D;  3SBC A;  4D73 B;  2I9H A;  3BCK A;  4N30 A;  1GL8 A;  3F9U A;  4IKH A;  3LWA A;  2PN8 A;  2B7K A;  1N2A A;  3R2Q A;  1OVN A;  2QKE A;  3IC8 A;  1MTC A;  1F6M C;  2HNL A;  5F0G A;  3UBL A;  4MJC A;  2LQQ A;  3UBK A;  2E7P A;  4EIP A;  1T4Z A;  3BD2 A;  1OC8 A;  3FZ9 A;  3RDW A;  1GSQ A;  4JED A;  1A0R P;  4POM A;  4LL1 B;  5KN2 A;  1B9Y C;  1M2B A;  1OC9 B;  1ZYN A;  4TXO B;  1BX9 A;  2LV3 A;  1SYX A;  3QPM A;  1I9D A;  4OFT A;  2VL3 A;  2DKI A;  3D5J A;  3IK7 A;  5HQP A;  1J9B A;  4MLY A;  4MPF A;  4TKY A;  3KTL A;  4KSM A;  2ZUP A;  3EC3 A;  1AAZ A;  4IP1 A;  2V6O A;  1QK8 A;  4MJA A;  1PA3 A;  3QFA C;  2HRK A;  1DE1 A;  4PX1 A;  4I6X A;  1B9X C;  1M7T A;  4X1U A;  3QAV A;  2HRN A;  1CQG A;  2FWF A;  4OO5 A;  3Q19 A;  4XRD A;  3GRX A;  1VGL A;  4ZB7 A;  3FYG A;  3LSZ A;  1JZO A;  2UV8 G;  3GA4 A;  3APO A;  5J9C A;  3G9B A;  2XPD A;  2X8C A;  4Z2T A;  4TN8 A;  1QGV A;  1GUK A;  5HFK A;  5BMU A;  4TOP A;  2CAI A;  4MK3 A;  3P7X A;  4E68 A;  1THO A;  2WVX A;  1YKC A;  1F9M A;  2KP2 A;  1X9W B;  3HJM A;  2DLX A;  2HSH A;  3FEU A;  1GSS A;  2H74 A;  2QA1 A;  2G2Q A;  1GLQ A;  4ZIL A;  3I69 A;  3WGE A;  3GL5 A;  5DJM A;  3NZN A;  3UMA A;  2CVK A;  1GTU A;  5A4V A;  3RBT A;  1XPV A;  3GKX A;  3LW9 A;  4WF5 A;  2VD1 A;  4BA7 A;  1S3C A;  4JRR A;  4IW9 A;  3J7Y b;  2HRA A;  2HLS A;  5FT3 A;  4GSS A;  4BVY B;  2LEG A;  1KTE A;  4KH7 A;  3C1R A;  1SL2 B;  4IP6 A;  1A2M A;  5CRH A;  1VF2 A;  2CX3 A;  1E6B A;  5ELG A;  1J08 A;  4V2N A;  1UN2 A;  2O5V A;  1K0B A;  5HFG A;  3H93 A;  4ECI A;  2AV4 A;  3EYT A;  4JE1 A;  4X0X A;  1AIU A;  2FWH A;  4V2M A;  5GAP D;  1ACV A;  1ZL9 A;  5J41 A;  1ZZY A;  1YEX A;  2VO4 A;  1S4B P;  4TR3 A;  1MDK A;  2VCW A;  2NBS A;  1R4W A;  4HZ2 A;  3ERF A;  3FR3 A;  1M9B A;  4FYB A;  2LQO A;  4JZQ A;  4AGS A;  2TRX A;  2QGV A;  3WGD A;  3UVH A;  1V57 A;  4K7N A;  2H70 A;  3HZ4 A;  4POK A;  4EE0 A;  3UAP A;  1YZX A;  4KCA A;  3TJB A;  5CNW A;  3CSJ A;  5ECM B;  2VM1 A;  5D8I A;  1O6J A;  1FVJ A;  3WD6 A;  3IV4 A;  1E2Y A;  3GUR A;  1URM A;  3KJY A;  1WRY A;  5ID2 B;  1PN9 A;  3KH9 A;  2AJQ B;  2PVO C;  5JCU A;  3F3Q A;  4E8E A;  4F2I A;  1ZGN A;  5IMV A;  4KA0 A;  4YAP A;  3P8W A;  3E9J B;  3GX8 A;  3PIN A;  3VI7 A;  2H1A A;  3A2V A;  3GUS A;  3EVI A;  3F4R A;  4NMU A;  1BYE A;  3BOA A;  2PER A;  3IHQ A;  4HQS A;  4W66 A;  1O73 A;  3WYW A;  3GH6 A;  3M3M A;  3D4T A;  4FH8 A;  2LRC A;  1WP0 A;  1R7H A;  2UZ8 A;  4DSR A;  4AJ7 A;  2HSM B;  6GSX A;  4CHS A;  1V98 A;  2O8V B;  2DMM A;  2LJK A;  2VD0 A;  4PGT A;  3US3 A;  4TR1 B;  3ED3 A;  4F9Z A;  3KP9 A;  1HNB A;  4IEL A;  1GRX A;  3VWU A;  5F8B A;  4RQR A;  1LJR A;  3VPT A;  2XBI A;  3OR5 A;  3ZIV A;  2A2R A;  3LEF A;  3GL3 A;  2F3M A;  3TKP A;  3A3T A;  4RI6 A;  2X8G A;  1Q98 A;  1SKW B;  3L4N A;  1QXH A;  4TR4 A;  4EF0 A;  3CWG A;  2HQT A;  3KEB A;  4MMM A;  2FLS A;  1V58 A;  1XCC A;  2NVL A;  2BJX A;  2EIO A;  1DBY A;  2F9S A;  3KXO A;  1DUG A;  4MAB A;  3ZYW A;  2C0E A;  2IMD A;  5D96 A;  1TRS A;  1H4O A;  1EZK A;  3QDN A;  1YKA A;  3IRA A;  4DSS A;  5KN1 A;  3V1W A;  3C7M A;  2RM6 A;  4QMK A;  4L0W A;  3P2A A;  2VL2 C;  2HE3 A;  4G19 A;  2JU5 A;  2JAC A;  3HCZ A;  1DE2 A;  4PI0 C;  2H8L A;  2OE3 A;  5HR2 A;  5GZZ B;  5A5K A;  3F0I A;  4NPB A;  5A1N B;  4ZB8 A;  5D9V A;  3EE2 A;  1T8E B;  1TW9 A;  2IL3 A;  3GKM A;  5J3R A;  2FHE A;  2LKU A;  3G7I A;  4BL7 B;  3WT1 A;  4NHW A;  2I4A A;  3KD0 A;  2L57 A;  3ZFB A;  4HUA A;  4AKH A;  2GSQ A;  5DDL A;  1V9W A;  4TW5 A;  5GSS A;  3KMO A;  2VLT A;  4XS4 A;  1EP8 A;  2GQM A;  3M9K A;  3H4K A;  2EFC A;  5GST A;  1TOF A;  2O85 A;  4LMV A;  1AQX A;  2CVD A;  2WDU A;  6GSW A;  3FRC A;  4BPY A;  1EV9 A;  4IHU A;  2WCI A;  1G6Y A;  3HVS A;  1SEN A;  2JAD A;  1SJI A;  2VKZ G;  3KMN A;  5BRT A;  5B8B A;  3APS A;  2O87 A;  1WMJ A;  4DSQ A;  5IMC A;  4FYC A;  1XW9 A;  3GHA A;  1G7E A;  5LCZ A;  1NW2 A;  2YOI A;  4MJE A;  1T4Y A;  2H75 A;  1VF1 A;  4BVX B;  1XXU A;  1M3J A;  2EFD A;  3ZTL A;  4O7H A;  3RPN A;  3TGZ A;  4I2U A;  4G2E A;  5EVO A;  5J9B A;  2DSA A;  2IPA A;  4EDY A;  1AC1 A;  4HDE A;  2FGX A;  2AB6 A;  2FA8 A;  2VCQ A;  5IO2 A;  1XVQ A;  4LMW A;  4HEA 2;  5CYY A;  3WGX A;  4DEJ A;  1XVW A;  1SKR B;  2GTU A;  2XHF A;  2QA2 A;  1F3B A;  1GTB A;  5C04 A;  2FNO A;  1U88 A;  1GLP A;  2YN1 A;  1EV4 A;  11GS A;  1LU4 A;  2QSI A;  4Z7X A;  5G1K A;  2VM2 A;  2V2G A;  4GLT A;  2VCX A;  4TVE A;  2YNX A;  1TKD B;  3M8N A;  3Q74 A;  5HR0 A;  2B5E A;  2HSN B;  4KDX A;  5D73 A;  5LNK e;  2DKH A;  4TXV A;  2FD3 A;  4ID0 A;  2WS2 A;  1K0A A;  2AYT A;  2VL9 A;  5IMD A;  1GNW A;  3LG6 A;  3QCP A;  4USS A;  2K8V A;  5G30 A;  2FWE A;  1HYU A;  5DAK B;  4WR4 A;  3UIW A;  1MDI A;  5HR3 A;  1JZR A;  1MEK A;  3L9U A;  2HI7 A;  1SD9 A;  3FMW A;  2WZ9 A;  4ACS A;  1WWJ A;  3HA9 A;  4MF7 A;  2R0C A;  2V1M A;  1YEW C;  1FB0 A;  2IME A;  4NWY A;  3EIN A;  3APQ A;  3CMI A;  4LL4 B;  4GXZ A;  5ABR A;  1TTZ A;  1KNG A;  4XRA A;  4FQU A;  4PUF C;  3F63 A;  3M0F A;  1NM3 A;  2H1D A;  1HD2 A;  4AKX B;  1A23 A;  4O5Q A;  1ZOF A;  1I1I P;  2ES7 A;  3RHC A;  3EU3 A;  2LJR A;  5JWQ B;  1R5A A;  16GS A;  1THX A;  1JZW A;  5CAX A;  1JLW A;  3F8U A;  1B4P A;  2LNS A;  2WGR A;  2AAW A;  1GUH A;  1QQ2 A;  5ECN B;  2IMI A;  1FG4 A;  2TRC P;  2HYX A;  2R4V A;  4IS0 A;  1GSY A;  5J47 A;  5A34 A;  3TKS E;  5ECO B;  4O5U A;  2LUS A;  2H66 A;  1HQO A;  5J4U A;  1EWX A;  2ALB A;  1EOG A;  5EL8 A;  1BG5 A;  3M1G A;  5IPG A;  4KDY A;  4MF6 A;  3QR6 A;  14GS A;  3W8S A;  1JHB A;  5DCG A;  1X9S B;  4D73 A;  3ZRE A;  1NHY A;  2GT5 A;  1YJ6 A;  1FW1 A;  1N25 A;  2A4V A;  4ZL8 A;  1R26 A;  3PH9 A;  3QFB C;  1UVZ A;  3VWX A;  2F8F A;  3F6D A;  2B5Y A;  2H73 A;  2L6D A;  2C8U A;  1R5P A;  1SVM A;  3NIV A;  2EC4 A;  1PL1 A;  4GST A;  1SVL A;  3GH9 A;  4AJ8 A;  3ERG A;  5ECH B;  2YCD A;  2WB9 A;  7GSS A;  3IE3 A;  1OC9 A;  3DWV A;  3ERW A;  2FCH A;  4TXO A;  1ZYP A;  1O7U A;  2CAQ A;  3PR8 A;  3CSH A;  5B6N A;  4J2F A;  4DVC A;  3IDV A;  3GKN A;  1SJ6 A;  5IMF A;  1K0O A;  4BWS A;  5ECS A;  1VF3 A;  3EMP A;  1WE0 A;  4FYU A;  2WVX B;  1EOH A;  2K18 A;  4EIQ A;  1G0T A;  1AW9 A;  4G0K A;  1ABA A;  2E2G A;  3L78 A;  3FZ5 A;  2H76 A;  1SL0 B;  5AIS A;  1XBS A;  4ISD A;  2IFQ B;  3E0U A;  3MYD A;  4V1A p;  2DJ3 A;  1ERV A;  1SKS B;  3S9F A;  4GF0 A;  2P5Q A;  2R0P A;  3EMX A;  5CRW A;  2DML A;  3GNJ A;  3DXB A;  3ZZX A;  4F82 A;  3HZ8 A;  4IVF A;  3UAR A;  5A5H B;  4TRX A;  5G5E A;  1ZYQ B;  4AKI A;  4L5L A;  2P0G A;  1XWB A;  3HJO A;  2H6Z A;  3LFL A;  3MIX A;  4HJ2 A;  1Z6M A;  4GQF A;  2PGT A;  4NV5 A;  1N8J A;  2FWG A;  5F05 A;  1TP9 A;  2LRN A;  1TXU A;  5AGY A;  3CHX C;  4K0N A;  1ZCP A;  4HI7 A;  2M46 A;  5H5R A;  5DBQ A;  4RI7 A;  1WJK A;  4O32 A;  4V2L A;  4N0Z A;  2B5X A;  1TRW A;  4ML1 A;  4KF9 A;  4BVY A;  2D2Z A;  3MDK A;  3C8E A;  4MCU A;  2LRT A;  4O5R A;  4MA9 A;  2ON5 A;  2PUK C;  1A2L A;  4MH2 A;  1XWK A;  4WET A;  3TKS A;  2IMK A;  1A8L A;  1BJX A;  6GSU A;  3ZIT A;  3KZQ A;  2OT3 A;  2XPE A;  4GDF A;  3CTF A;  5CRD A;  2N5F A;  2C3Q A;  3HHV A;  2RLI A;  4MJB A;  1T7P B;  5F07 A;  2V32 A;  4RQX A;  1Z5Y E;  2GZP A;  2X99 A;  4ILF A;  4WEY A;  4ECJ A;  2DJ0 A;  1J0F A;  2C1Y A;  1PGT A;  2AUV A;  1O8W A;  3F6F A;  2DBC A;  2HZE A;  3HVX A;  1YVL A;  1K0N A;  4MPG A;  5B8A A;  3KIJ A;  4LA1 A;  2B1L A;  3Q18 A;  5AN1 A;  3DVX A;  3RPP A;  1JFU A;  2VLV A;  4MZW A;  4GCI A;  1XW6 A;  3UJ1 A;  3IAS 2;  4AJ6 A;  1G7O A;  4GRF A;  4KAE A;  2VCV A;  4EO3 A;  1EGO A;  1G6W A;  3IPZ A;  4RUV A;  5ID2 A;  2NPB A;  4HSC X;  2DIZ A;  4KUN A;  3ZLP A;  2MMO A;  2DJK A;  1M3I A;  2N5B A;  4OFN A;  2R0G A;  3RHB A;  1X9M B;  5DAL A;  1JLV A;  1JZD A;  5G5F A;  5GAN D;  4V1A g;  3TJF A;  4YAV A;  3FHK A;  1VRS D;  1QMV A;  3N9J A;  1AUC A;  2M80 A;  2L59 A;  4K0G A;  3KCM A;  2EFH A;  2F51 A;  4X4J A;  1ZYE A;  3CRU A;  3GKK A;  4WF4 A;  2CV4 A;  5D93 A;  2CA8 A;  1SD8 A;  2DJJ A;  4N11 A;  3IK9 A;  2VUP A;  2R37 A;  2CZ2 A;  4ZL7 A;  2MMZ A;  2YJ7 A;  2GST A;  3N5O A;  3A5I A;  1I5G A;  2HSM A;  3D22 A;  1DSB A;  5E59 A;  5IIZ A;  3TRQ A;  5ECK B;  4TR1 A;  5G2Z A;  4L5O A;  3VI5 A;  3HKR A;  1ZMA A;  2IWT A;  2EFE A;  4CY8 A;  4ECC A;  1B8X A;  4K9Z A;  4HU9 A;  5IOW A;  2EIQ A;  1M9A A;  2YZH A;  1V40 A;  3GMF A;  4DSS B;  3ZFL A;  3VK9 A;  2YP6 A;  3Q6O A;  3D4M A;  2GVP A;  2H71 A;  1C72 A;  1PSQ A;  1ERT A;  3TJK A;  2RUE A;  3CSI A;  1GSE A;  1BAY A;  3VFI A;  4PI2 C;  2CX4 A;  1K0M A;  2JZT A;  3QOU A;  1M2A A;  3IOS A;  1BF5 A;  3MNG A;  17GS A;  2WW0 A;  3F3R A;  3QAG A;  2DJ2 A;  3FZA A;  2GT6 A;  2H72 A;  2H30 A;  2OE1 A;  2RUF A;  2C0F A;  3NOF A;  4Q5F A;  4K7O A;  1B48 A;  5IQY A;  2WFC A;  2O89 A;  4ML6 A;  4EKZ A;  1Z6N A;  3VWW A;  3ZVJ D;  4BIK A;  6GSY A;  1EEJ A;  2L5L A;  3D0Z A;  5ECQ B;  1K3O A;  5AIX A; 
#chains in the Genus database with same CATH homology
 4BL7 A;  1GTA A;  2H1L A;  2B7J A;  2FY6 A;  1K3Y A;  2GS3 A;  2MBT A;  2OAD A;  1Y1U A;  2BMX A;  2GLR A;  2R3X A;  2H1B A;  2GSS A;  4EUY A;  5INY A;  2PVQ A;  3TCO A;  5J4Y A;  3FKF A;  5IO0 A;  2HFD A;  4PUA A;  1PKZ A;  2IIY A;  4IQA A;  2C3T A;  4JBB A;  1T00 A;  2H6X A;  4IJ3 A;  2OBI A;  5D9W A;  3HY2 A;  2YAN A;  3LYK A;  4ZBA A;  2H6Y A;  3H8Q A;  4PXO A;  4FIW A;  5AIV A;  3BBY A;  1GWC A;  2JSY A;  4AF2 A;  1K0D A;  2GSR A;  3IBH A;  1ST9 A;  2V6K A;  1U87 A;  1ON4 A;  1GSU A;  4J57 E;  4F03 A;  3E3E A;  2ZNM A;  2ZCT A;  1HNC A;  2I3Y A;  4XIH A;  3DYR A;  4EVM A;  4HOJ A;  1KBN A;  2K6V A;  4MH3 A;  1FAA A;  1U3A A;  2JZR A;  1NHO A;  3LQ7 A;  1CQH A;  1YDK A;  3GST A;  5DQS A;  1GH2 A;  3VPQ A;  4KX4 A;  4L0U A;  2X64 A;  1U3I A;  3AY8 A;  4E8H A;  4I2T A;  2YV9 A;  4IBP A;  1PMT A;  1Z7R A;  4PQI A;  5JWO B;  2GQL A;  4YKG A;  4PQ1 A;  1SK0 A;  3DRN A;  5IOX A;  2CVB A;  1AXD A;  4QQ7 A;  1PX7 A;  1GSF A;  3KM6 A;  3GTU B;  2C3N A;  2RII A;  5DAK A;  3DKS A;  2HT9 A;  4K7I A;  4OCF A;  5H5S A;  1V2A A;  4ZBD A;  4EXJ A;  3LXZ A;  2LNT A;  1YQ1 A;  3A2W A;  5EY6 A;  2YPM A;  3LYP A;  5DVB A;  4QL7 A;  5IMZ A;  3U5R E;  2LJA A;  5H5Q A;  2IMF A;  2PWJ A;  4XCS A;  2FA4 A;  2KLX A;  2MYG A;  1F2E A;  4P3Y B;  3HVV A;  4I5Q A;  3ME7 A;  1Y6E A;  4FO5 A;  1PD2 1;  1HNA A;  5CRE A;  1SYR A;  3EU4 A;  2LS5 A;  1RQM A;  2J23 A;  1OYJ A;  3TOT A;  1A2J A;  3ZVJ A;  4GQC A;  3IR4 A;  1O81 A;  3DD3 A;  2X4A A;  1S3A A;  1GSD A;  1LBK A;  2KUC A;  2DIY A;  3P90 A;  5KN0 A;  4KSO A;  3O6T A;  4F0C A;  3GV1 A;  2JSZ A;  5FHI A;  4AI6 A;  1F37 A;  1GUL A;  1XW5 A;  9GSS A;  1XZO A;  1BQ7 A;  3DVW A;  5IPH A;  2OJL A;  2B6M A;  2N5A A;  3J7Y k;  2VL2 A;  3RAZ A;  1A0F A;  1EEM A;  4PTS A;  4HZ4 A;  2HSY A;  3UL3 A;  2HRK B;  4KDU A;  2MMA A;  3ZIJ A;  2I1U A;  2HRF A;  3FK8 A;  3H79 A;  4WR5 A;  2X8H A;  2XBQ A;  3VLN A;  3IA1 A;  1ML6 A;  2H0H A;  3L9V A;  1UC7 A;  1Q4J A;  4KB3 A;  1OC3 A;  5B7C A;  1MDJ A;  5HR1 A;  4POB A;  2A2S A;  3D6I A;  5BMU B;  1X5E A;  2ON7 A;  3PGT A;  1X5D A;  2CQ9 A;  4WXT A;  4OCE A;  4YQV A;  22GS A;  3HJP A;  4JR4 A;  4ZBB A;  4PNF A;  2H0I A;  2LST A;  1B4Q A;  2G0F A;  3H1N A;  4MF5 A;  1U6T A;  1XWC A;  3MSZ A;  4K2D A;  3A2X A;  4HS1 A;  1YF1 A;  1ILO A;  1Z7P A;  4HQZ A;  19GS A;  2O7K A;  3D21 A;  4YQM A;  4CDO A;  5ELA A;  2GGT A;  3LGC A;  3UEM A;  2H19 A;  3LXT A;  3U6V A;  3G7J A;  2L6C A;  1VF4 A;  1EGR A;  2NDO A;  3FR9 A;  3JCM L;  4NV2 A;  3UVT A;  1KEB A;  3ZML A;  4ICY A;  3QMX A;  4NHZ A;  3TRP A;  2E0Q A;  1WPI A;  2DJ1 A;  4XS1 A;  1EP7 A;  2A2P A;  18GS A;  4QL9 A;  3G7Y A;  2IFQ A;  2CZ3 A;  3DEX A;  2H01 A;  5D9X A;  4XTS A;  2OE0 A;  4GSN A;  1GTI A;  2OA7 A;  5LD0 A;  2REM A;  4MNN A;  4XHM A;  1IYH A;  1YF0 A;  3KP8 A;  4OFM A;  2JZS A;  2X49 A;  4Z2U A;  3DML A;  3UOM A;  5D9T A;  4IJI A;  5E4W A;  4ZL9 A;  1ERW A;  2OKA A;  2MZC A;  5J5N A;  5JWR B;  5A5H A;  2GZZ A;  2JL4 A;  5JCG A;  1SL1 B;  2WUL A;  1BED A;  3W8J A;  2MBS A;  4ECB A;  1XIY A;  4IN0 A;  3FZ4 A;  1PN0 A;  2VLU A;  5EPF A;  4XS6 A;  3LJR A;  1PX6 A;  3A5W A;  3BCI A;  3IXR A;  5G31 A;  5CO3 A;  1AQW A;  3KH7 A;  1K0C A;  1MD4 A;  1SU9 A;  4Z2R A;  1TJD A;  4G0I A;  3WT2 A;  4IQ1 A;  2OBK A;  4O92 A;  1TRU A;  4EC0 A;  2HZE B;  3CYN A;  5FWG A;  2HXK A;  4KGI A;  1FVK A;  3ZRD A;  4HJM A;  4POL A;  3HYP A;  2YJH A;  5JCW A;  2CT6 A;  3MAK A;  4ZXG A;  1M99 A;  1QFN A;  1T1V A;  4PNG A;  2TIR A;  1MD3 A;  3O3T A;  4EDZ A;  3TB2 A;  2NTO A;  4JU5 A;  1PL2 A;  2M72 A;  3K8N A;  1AQV A;  1XWA A;  3I43 A;  1K3L A;  3GSS A;  3HMJ G;  4GWR A;  1YY7 A;  4OO4 A;  2KHP A;  1TU8 A;  1H75 A;  2K9F A;  3C1S A;  5DAL B;  4N0V A;  1FOH A;  1SK1 A;  2R2J A;  4YKF A;  3CXG A;  3KGK A;  1F3A A;  4L8E A;  1GP1 A;  3EPT A;  5B6M A;  5KOW A;  2H0G A;  2XC2 A;  4ZB6 A;  3M9J A;  3ZL5 A;  1OKD A;  3GFK A;  1A24 A;  6GSS A;  4MZB A;  4YH2 A;  1XFL A;  4MDC A;  5IMA A;  3CBU A;  2C0D A;  5F06 A;  4K6X A;  3F4T A;  2KP1 A;  5CP1 A;  5A4U A;  4ZIJ A;  3EWL A;  2HZF A;  3KTB A;  3ME8 A;  1WIK A;  4N10 A;  4KW6 A;  2A4H A;  2GQK A;  1RK4 A;  2IN3 A;  5KEJ A;  5DCH A;  4X43 A;  3MWH A;  2B3S A;  3TDG A;  4KND A;  1ERU A;  3GYK A;  3GN3 A;  4TR0 A;  4EL1 A;  3VUR A;  4GTU A;  2YWN A;  1T3B A;  2H1G A;  2QC7 A;  2C0G A;  3W6G A;  4I97 A;  1M0U A;  3C71 A;  3VWV A;  1XOB A;  5J4V A;  4MZC A;  5J40 A;  4NAX A;  3EUR A;  1O85 A;  1X0R A;  2AHE A;  2YV7 A;  1SJZ A;  2L4Q A;  4PQH A;  5IM9 A;  1SVO A;  2PPT A;  4I8B A;  2KOK A;  2R6K A;  2B1K A;  1Z9H A;  2VCZ A;  1PQN A;  3TOU A;  4ZB9 A;  4PUR A;  4XS4 B;  8GSS A;  3FY7 A;  3IHG A;  1OKT A;  2Z9S A;  5ECP B;  1O8X A;  2EIR A;  4K5R A;  2J9H A;  3I6A A;  1A8Y A;  1PRX A;  4JR6 A;  4K5S A;  5ECR B;  1W4V A;  1TDI A;  4Q5R A;  1TRV A;  4KCE A;  3BJ5 A;  2E2M A;  2YWM A;  3C73 A;  5A1N A;  4N3Z A;  3IAM 2;  1W89 A;  3HDC A;  1TU7 A;  1TI3 A;  2VOC A;  2GZY A;  4HU7 A;  2F8A A;  1SK2 A;  4YQU A;  2L4C A;  6GST A;  4G10 A;  4J56 E;  1M2D A;  2GDR A;  3FR6 A;  4G9H A;  3I9V 2;  5ECI B;  4ULX A;  5COH A;  4IGJ A;  3GX0 A;  1UA5 A;  5G1L A;  1FO5 A;  1OAZ A;  4WBJ A;  4WKW A;  1Z3E A;  5HFI A;  3FW2 A;  2K8S A;  4G01 A;  4K2X A;  3TU3 B;  13GS A;  5L71 A;  1XOA A;  2VIM A;  1QUW A;  5KOX A;  3DGQ A;  1X5C A;  4MP4 A;  4F0B A;  2YWI A;  1GUM A;  1NSW A;  1USB A;  4BVX A;  6GSV A;  2PU9 C;  3ZMK A;  1TK0 B;  4Q5N A;  2FUG 2;  10GS A;  3R3E A;  4K1F A;  1TI1 A;  1BG1 A;  20GS A;  3O76 A;  2P31 A;  3TUE A;  3TJJ A;  3CTG A;  2PBJ A;  3L9S A;  2V41 A;  3SWL A;  4K8M A;  4H86 A;  1GNE A;  2PMT A;  1RW1 A;  2I81 A;  3QD9 A;  1S3D A;  3TJG A;  5ENU A;  1FB6 A;  1YEP A;  2P5R A;  5DJL A;  1FOV A;  1WOU A;  3HXS A;  5KN3 A;  1PKW A;  2HSN A;  4NXI A;  4CW9 A;  2RM5 A;  1OE7 A;  4G0L A;  4BWQ A;  3ISO A;  2R5G A;  4OMV A;  3TKS C;  3DIE A;  5C00 A;  2C80 A;  2VCT A;  2IJY A;  1OE8 A;  4OWY A;  2C4J A;  2OAC A;  2LTK A;  1Y25 A;  3GIX A;  5DQY A;  3PPU A;  12GS A;  1XWG A;  3F4S A;  1FHE A;  2DC5 A;  5A4W A;  1TXX A;  4KE3 A;  2YZU A;  2WRT A;  5CRG A;  2VAF A;  4OD7 A;  2WJU A;  1IYI A;  2L5O A;  3GTU A;  4AKG A;  5A34 B;  3HD5 A;  3TRX A;  2MMN A;  4Q5Q A;  4LLR A;  3TKQ A;  3TKR A;  3IC4 A;  3CRT A;  3L0H A;  2BTO T;  1TK8 B;  1TK5 B;  5ECL B;  4CY6 A;  2YWO A;  3QAW A;  3LOR A;  4A5P A;  4WBR D;  3SBC A;  4D73 B;  2I9H A;  3BCK A;  4N30 A;  1GL8 A;  3F9U A;  4IKH A;  3LWA A;  2PN8 A;  2B7K A;  1N2A A;  3R2Q A;  1OVN A;  2QKE A;  3IC8 A;  1MTC A;  1F6M C;  2HNL A;  5F0G A;  3UBL A;  4MJC A;  2LQQ A;  3UBK A;  2E7P A;  4EIP A;  1T4Z A;  3BD2 A;  1OC8 A;  3FZ9 A;  3RDW A;  1GSQ A;  4JED A;  1A0R P;  4POM A;  4LL1 B;  5KN2 A;  1B9Y C;  1M2B A;  1OC9 B;  1ZYN A;  4TXO B;  1BX9 A;  2LV3 A;  1SYX A;  3QPM A;  1I9D A;  4OFT A;  2VL3 A;  2DKI A;  3D5J A;  3IK7 A;  5HQP A;  1J9B A;  4MLY A;  4MPF A;  4TKY A;  3KTL A;  4KSM A;  2ZUP A;  3EC3 A;  1AAZ A;  4IP1 A;  2V6O A;  1QK8 A;  4MJA A;  1PA3 A;  3QFA C;  2HRK A;  1DE1 A;  4PX1 A;  4I6X A;  1B9X C;  1M7T A;  4X1U A;  3QAV A;  2HRN A;  1CQG A;  2FWF A;  4OO5 A;  3Q19 A;  4XRD A;  3GRX A;  1VGL A;  4ZB7 A;  3FYG A;  3LSZ A;  1JZO A;  2UV8 G;  3GA4 A;  3APO A;  5J9C A;  3G9B A;  2XPD A;  2X8C A;  4Z2T A;  4TN8 A;  1QGV A;  1GUK A;  5HFK A;  5BMU A;  4TOP A;  2CAI A;  4MK3 A;  3P7X A;  4E68 A;  1THO A;  1YKC A;  1F9M A;  2KP2 A;  1X9W B;  3HJM A;  2DLX A;  2HSH A;  3FEU A;  1GSS A;  2H74 A;  2QA1 A;  2G2Q A;  1GLQ A;  4ZIL A;  3I69 A;  3WGE A;  3GL5 A;  5DJM A;  3NZN A;  3UMA A;  2CVK A;  1GTU A;  5A4V A;  3RBT A;  1XPV A;  3GKX A;  3LW9 A;  4WF5 A;  2VD1 A;  4BA7 A;  1S3C A;  4JRR A;  4IW9 A;  3J7Y b;  2HRA A;  2HLS A;  5FT3 A;  4GSS A;  4BVY B;  2LEG A;  1KTE A;  4KH7 A;  3C1R A;  1SL2 B;  4IP6 A;  1A2M A;  5CRH A;  1VF2 A;  2CX3 A;  1E6B A;  5ELG A;  1J08 A;  4V2N A;  1UN2 A;  2O5V A;  1K0B A;  5HFG A;  3H93 A;  4ECI A;  2AV4 A;  3EYT A;  4JE1 A;  4X0X A;  1AIU A;  2FWH A;  4V2M A;  5GAP D;  1ACV A;  1ZL9 A;  5J41 A;  1ZZY A;  1YEX A;  2VO4 A;  4TR3 A;  1MDK A;  2VCW A;  2NBS A;  1R4W A;  4HZ2 A;  3ERF A;  3FR3 A;  1M9B A;  4FYB A;  2LQO A;  4JZQ A;  4AGS A;  2TRX A;  2QGV A;  3WGD A;  3UVH A;  1V57 A;  4K7N A;  2H70 A;  3HZ4 A;  4POK A;  4EE0 A;  3UAP A;  1YZX A;  4KCA A;  3TJB A;  5CNW A;  3CSJ A;  5ECM B;  2VM1 A;  5D8I A;  1O6J A;  1FVJ A;  3WD6 A;  3IV4 A;  1E2Y A;  3GUR A;  1URM A;  3KJY A;  1WRY A;  5ID2 B;  1PN9 A;  3KH9 A;  2AJQ B;  2PVO C;  5JCU A;  3F3Q A;  4E8E A;  4F2I A;  1ZGN A;  5IMV A;  4KA0 A;  4YAP A;  3P8W A;  3E9J B;  3GX8 A;  3PIN A;  3VI7 A;  2H1A A;  3A2V A;  3GUS A;  3EVI A;  3F4R A;  4NMU A;  1BYE A;  3BOA A;  2PER A;  3IHQ A;  4HQS A;  4W66 A;  1O73 A;  3WYW A;  3GH6 A;  3M3M A;  3D4T A;  4FH8 A;  2LRC A;  1WP0 A;  1R7H A;  2UZ8 A;  4DSR A;  4AJ7 A;  2HSM B;  6GSX A;  4CHS A;  1V98 A;  2O8V B;  2DMM A;  2LJK A;  2VD0 A;  4PGT A;  3US3 A;  4TR1 B;  3ED3 A;  4F9Z A;  3KP9 A;  1HNB A;  4IEL A;  1GRX A;  3VWU A;  5F8B A;  4RQR A;  1LJR A;  3VPT A;  2XBI A;  3OR5 A;  3ZIV A;  2A2R A;  3LEF A;  3GL3 A;  2F3M A;  3TKP A;  3A3T A;  4RI6 A;  2X8G A;  1Q98 A;  1SKW B;  3L4N A;  1QXH A;  4TR4 A;  4EF0 A;  3CWG A;  2HQT A;  3KEB A;  4MMM A;  2FLS A;  1V58 A;  1XCC A;  2NVL A;  2BJX A;  2EIO A;  1DBY A;  2F9S A;  3KXO A;  1DUG A;  4MAB A;  3ZYW A;  2C0E A;  2IMD A;  5D96 A;  1TRS A;  1H4O A;  1EZK A;  3QDN A;  1YKA A;  3IRA A;  4DSS A;  5KN1 A;  3V1W A;  3C7M A;  2RM6 A;  4QMK A;  4L0W A;  3P2A A;  2VL2 C;  2HE3 A;  4G19 A;  2JU5 A;  2JAC A;  3HCZ A;  1DE2 A;  2H8L A;  2OE3 A;  5HR2 A;  5GZZ B;  5A5K A;  3F0I A;  4NPB A;  5A1N B;  4ZB8 A;  5D9V A;  3EE2 A;  1T8E B;  1TW9 A;  2IL3 A;  3GKM A;  5J3R A;  2FHE A;  2LKU A;  3G7I A;  4BL7 B;  3WT1 A;  4NHW A;  2I4A A;  3KD0 A;  2L57 A;  3ZFB A;  4HUA A;  4AKH A;  2GSQ A;  5DDL A;  1V9W A;  4TW5 A;  5GSS A;  3KMO A;  2VLT A;  4XS4 A;  1EP8 A;  2GQM A;  3M9K A;  3H4K A;  2EFC A;  5GST A;  1TOF A;  2O85 A;  4LMV A;  1AQX A;  2CVD A;  2WDU A;  6GSW A;  3FRC A;  4BPY A;  1EV9 A;  4IHU A;  2WCI A;  1G6Y A;  3HVS A;  1SEN A;  2JAD A;  1SJI A;  2VKZ G;  3KMN A;  5BRT A;  5B8B A;  3APS A;  2O87 A;  1WMJ A;  4DSQ A;  5IMC A;  4FYC A;  1XW9 A;  3GHA A;  1G7E A;  5LCZ A;  1NW2 A;  2YOI A;  4MJE A;  1T4Y A;  2H75 A;  1VF1 A;  4BVX B;  1XXU A;  2EFD A;  3ZTL A;  4O7H A;  3RPN A;  3TGZ A;  4I2U A;  4G2E A;  5EVO A;  5J9B A;  2DSA A;  2IPA A;  4EDY A;  1AC1 A;  4HDE A;  2FGX A;  2AB6 A;  2FA8 A;  2VCQ A;  5IO2 A;  1XVQ A;  4LMW A;  4HEA 2;  5CYY A;  3WGX A;  4DEJ A;  1XVW A;  1SKR B;  2GTU A;  2XHF A;  2QA2 A;  1F3B A;  1GTB A;  5C04 A;  2FNO A;  1U88 A;  1GLP A;  2YN1 A;  1EV4 A;  11GS A;  1LU4 A;  2QSI A;  4Z7X A;  5G1K A;  2VM2 A;  2V2G A;  4GLT A;  2VCX A;  4TVE A;  2YNX A;  1TKD B;  3M8N A;  3Q74 A;  5HR0 A;  2B5E A;  2HSN B;  4KDX A;  5D73 A;  5LNK e;  2DKH A;  4TXV A;  2FD3 A;  4ID0 A;  2WS2 A;  1K0A A;  2AYT A;  2VL9 A;  5IMD A;  1GNW A;  3LG6 A;  3QCP A;  4USS A;  2K8V A;  5G30 A;  2FWE A;  1HYU A;  5DAK B;  4WR4 A;  3UIW A;  1MDI A;  5HR3 A;  1JZR A;  1MEK A;  3L9U A;  2HI7 A;  1SD9 A;  3FMW A;  2WZ9 A;  4ACS A;  1WWJ A;  3HA9 A;  4MF7 A;  2R0C A;  2V1M A;  1FB0 A;  2IME A;  4NWY A;  3EIN A;  3APQ A;  3CMI A;  4LL4 B;  4GXZ A;  5ABR A;  1TTZ A;  1KNG A;  4XRA A;  4FQU A;  4PUF C;  3F63 A;  3M0F A;  1NM3 A;  2H1D A;  1HD2 A;  4AKX B;  1A23 A;  4O5Q A;  1ZOF A;  2ES7 A;  3RHC A;  3EU3 A;  2LJR A;  5JWQ B;  1R5A A;  16GS A;  1THX A;  1JZW A;  5CAX A;  1JLW A;  3F8U A;  1B4P A;  2LNS A;  2WGR A;  2AAW A;  1GUH A;  1QQ2 A;  5ECN B;  2IMI A;  1FG4 A;  2TRC P;  2HYX A;  2R4V A;  4IS0 A;  1GSY A;  5J47 A;  5A34 A;  3TKS E;  5ECO B;  4O5U A;  2LUS A;  2H66 A;  1HQO A;  5J4U A;  1EWX A;  2ALB A;  1EOG A;  5EL8 A;  1BG5 A;  3M1G A;  5IPG A;  4KDY A;  4MF6 A;  3QR6 A;  14GS A;  3W8S A;  1JHB A;  5DCG A;  1X9S B;  4D73 A;  3ZRE A;  1NHY A;  2GT5 A;  1YJ6 A;  1FW1 A;  1N25 A;  2A4V A;  4ZL8 A;  1R26 A;  3PH9 A;  3QFB C;  1UVZ A;  3VWX A;  2F8F A;  3F6D A;  2B5Y A;  2H73 A;  2L6D A;  2C8U A;  1R5P A;  1SVM A;  3NIV A;  2EC4 A;  1PL1 A;  4GST A;  1SVL A;  3GH9 A;  4AJ8 A;  3ERG A;  5ECH B;  2YCD A;  2WB9 A;  7GSS A;  3IE3 A;  1OC9 A;  3DWV A;  3ERW A;  2FCH A;  4TXO A;  1ZYP A;  1O7U A;  2CAQ A;  3PR8 A;  3CSH A;  5B6N A;  4J2F A;  4DVC A;  3IDV A;  3GKN A;  1SJ6 A;  5IMF A;  1K0O A;  4BWS A;  5ECS A;  1VF3 A;  3EMP A;  1WE0 A;  4FYU A;  1EOH A;  2K18 A;  4EIQ A;  1G0T A;  1AW9 A;  4G0K A;  1ABA A;  2E2G A;  3L78 A;  3FZ5 A;  2H76 A;  1SL0 B;  5AIS A;  1XBS A;  4ISD A;  2IFQ B;  3E0U A;  3MYD A;  4V1A p;  2DJ3 A;  1ERV A;  1SKS B;  3S9F A;  4GF0 A;  2P5Q A;  2R0P A;  3EMX A;  5CRW A;  2DML A;  3GNJ A;  3DXB A;  3ZZX A;  4F82 A;  3HZ8 A;  4IVF A;  3UAR A;  5A5H B;  4TRX A;  5G5E A;  1ZYQ B;  4AKI A;  4L5L A;  2P0G A;  1XWB A;  3HJO A;  2H6Z A;  3LFL A;  3MIX A;  4HJ2 A;  1Z6M A;  4GQF A;  2PGT A;  4NV5 A;  1N8J A;  2FWG A;  5F05 A;  1TP9 A;  2LRN A;  1TXU A;  5AGY A;  1ZCP A;  4K0N A;  5H5R A;  4HI7 A;  2M46 A;  5DBQ A;  4RI7 A;  1WJK A;  4O32 A;  4V2L A;  4N0Z A;  2B5X A;  1TRW A;  4ML1 A;  4KF9 A;  4BVY A;  2D2Z A;  3MDK A;  3C8E A;  4MCU A;  2LRT A;  4O5R A;  4MA9 A;  2ON5 A;  2PUK C;  1A2L A;  4MH2 A;  1XWK A;  4WET A;  3TKS A;  2IMK A;  1A8L A;  1BJX A;  6GSU A;  3ZIT A;  3KZQ A;  2OT3 A;  2XPE A;  4GDF A;  3CTF A;  5CRD A;  2N5F A;  2C3Q A;  3HHV A;  2RLI A;  4MJB A;  1T7P B;  5F07 A;  2V32 A;  4RQX A;  1Z5Y E;  2GZP A;  2X99 A;  4ILF A;  4WEY A;  4ECJ A;  2DJ0 A;  1J0F A;  2C1Y A;  1PGT A;  2AUV A;  1O8W A;  3F6F A;  2DBC A;  2HZE A;  3HVX A;  1YVL A;  1K0N A;  4MPG A;  5B8A A;  3KIJ A;  4LA1 A;  2B1L A;  3Q18 A;  5AN1 A;  3DVX A;  3RPP A;  1JFU A;  2VLV A;  4MZW A;  4GCI A;  1XW6 A;  3UJ1 A;  3IAS 2;  4AJ6 A;  1G7O A;  4GRF A;  4KAE A;  2VCV A;  4EO3 A;  1EGO A;  1G6W A;  3IPZ A;  4RUV A;  5ID2 A;  2NPB A;  3ZLP A;  2DIZ A;  4KUN A;  2MMO A;  2DJK A;  2N5B A;  4OFN A;  2R0G A;  3RHB A;  1X9M B;  5DAL A;  1JLV A;  1JZD A;  5G5F A;  5GAN D;  4V1A g;  3TJF A;  4YAV A;  3FHK A;  1VRS D;  1QMV A;  3N9J A;  1AUC A;  2M80 A;  2L59 A;  4K0G A;  3KCM A;  2EFH A;  2F51 A;  4X4J A;  1ZYE A;  3CRU A;  3GKK A;  4WF4 A;  2CV4 A;  5D93 A;  2CA8 A;  1SD8 A;  2DJJ A;  4N11 A;  3IK9 A;  2VUP A;  2R37 A;  2CZ2 A;  4ZL7 A;  2MMZ A;  2YJ7 A;  2GST A;  3N5O A;  3A5I A;  1I5G A;  2HSM A;  3D22 A;  1DSB A;  5E59 A;  5IIZ A;  3TRQ A;  5ECK B;  4TR1 A;  5G2Z A;  4L5O A;  3VI5 A;  3HKR A;  1ZMA A;  2IWT A;  2EFE A;  4CY8 A;  4ECC A;  1B8X A;  4K9Z A;  4HU9 A;  5IOW A;  2EIQ A;  1M9A A;  2YZH A;  1V40 A;  3GMF A;  4DSS B;  3ZFL A;  3VK9 A;  2YP6 A;  3Q6O A;  3D4M A;  2GVP A;  2H71 A;  1C72 A;  1PSQ A;  1ERT A;  3TJK A;  2RUE A;  3CSI A;  1GSE A;  1BAY A;  3VFI A;  2CX4 A;  1K0M A;  2JZT A;  3QOU A;  1M2A A;  3IOS A;  1BF5 A;  3MNG A;  17GS A;  3F3R A;  3QAG A;  2DJ2 A;  3FZA A;  2GT6 A;  2H72 A;  2H30 A;  2OE1 A;  2RUF A;  2C0F A;  3NOF A;  4Q5F A;  4K7O A;  1B48 A;  5IQY A;  2WFC A;  2O89 A;  4ML6 A;  4EKZ A;  1Z6N A;  3VWW A;  3ZVJ D;  6GSY A;  1EEJ A;  2L5L A;  3D0Z A;  5ECQ B;  1K3O A;  5AIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...