4OFTA

C- orthorombic nagst1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
206
structure length
206
Chain Sequence
MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase-1
publication title Structure of glutathione S-transferase 1 from the major human hookworm parasite Necator americanus (Na-GST-1) in complex with glutathione.
pubmed doi rcsb
source organism Necator americanus
molecule tags Transferase
total genus 71
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4oftA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4oftA01
4MJBA 2CX3A 3ZVJA 2HZEA 2IFQA 1E6BA 4WR4A 2DMLA 3JCML 4QL7A 1Z3EA 3HVSA 2HRKB 2VLUA 1XCCA 1F3BA 1GTUA 1YEXA 4ZL8A 1OC3A 3FK8A 2C3NA 1SD8A 2L59A 4I2UA 4MF7A 4ECIA 2MBSA 3L9UA 3VWVA 5KEJA 4EC0A 3NIVA 2PPTA 1TU8A 3Q18A 5D9XA 1WP0A 4KSOA 2KP2A 4J57E 3F6DA 3F4RA 3UAPA 3FR9A 1Z7PA 2JZRA 4WXTA 3QMXA 2HLSA 2E0QA 3A2XA 5D9VA 2H30A 2YWNA 4K8MA 3U6VA 2GS3A 3A3TA 2ES7A 1EEJA 4OFNA 3RHBA 2V6KA 2R37A 4KA0A 3KZQA 3NOFA 3N9JA 3BCIA 2DJKA 4FYBA 3IAS2 2YZHA 3UJ1A 1VF1A 4EF0A 1TI3A 1X9SB 2AHEA 1AIUA 1BQ7A 2ZCTA 1MDIA 4WEYA 4JBBA 3O76A 3M9KA 5INYA 3KM6A 5GAPD 4LMWA 3US3A 3ZREA 4POLA 3F4SA 3RPPA 1USBA 3IC8A 2VD1A 4HU9A 5ID2A 4GF0A 3RAZA 4QL9A 2OE1A 3UBKA 4K1FA 5H5SA 1X5EA 1R4WA 5ECOB 2PWJA 2YCDA 1TK5B 3MSZA 2VLVA 2YV9A 3KGKA 3EMPA 1EGRA 1SK1A 4EVMA 4Q5RA 1N2AA 5ECMB 3GNJA 3L0HA 1FOVA 1WRYA 2H70A 2GT5A 1AW9A 3LQ7A 4PNGA 1ON4A 1ML6A 5IMFA 4K6XA 4K7NA 3HJOA 3M3MA 1I5GA 3UARA 1AAZA 2GQMA 3F9UA 4K7IA 2GTUA 3AY8A 2B1LA 3A5WA 1GSUA 4V2NA 3HHVA 1A0RP 5ECNB 3CXGA 1V9WA 1UC7A 5IMCA 2DMMA 4I2TA 1F37A 2JL4A 4HUAA 4L0WA 1XVQA 4P3YB 3IPZA 3KEBA 3C1RA 4K7OA 2VL9A 5DAKB 1QMVA 4N0VA 1H75A 3EC3A 2DJ0A 5KN1A 2Z9SA 2BMXA 4USSA 1CQHA 4KW6A 2OE0A 2MYGA 1GSDA 6GSTA 1Z6MA 1B9XC 4GSNA 1WJKA 5G1KA 2H1GA 2HI7A 1LJRA 4TOPA 3QFAC 4IS0A 4EKZA 4IW9A 3QOUA 3UOMA 1O85A 1K3LA 4WBRD 3E0UA 4WF4A 1WMJA 1G6WA 1KTEA 2A2SA 3FZ4A 2OA7A 3GHAA 5EL8A 3BBYA 4GSSA 3VPTA 4PNFA 1NHYA 2LRNA 5H5RA 1MD4A 3KD0A 4MF6A 4LLRA 1TP9A 5GSSA 5F06A 5J41A 4POKA 4JEDA 2GVPA 4PURA 4YQUA 5ECSA 1V40A 3FYGA 1KBNA 1TRSA 5F8BA 4MK3A 3FRCA 4ZB9A 1VRSD 4BA7A 4MJAA 5DALB 1O6JA 1TOFA 1TI1A 1V57A 3D22A 3EU4A 3VI5A 1ZMAA 2B5XA 1T8EB 4G0KA 5HR0A 2B7KA 1RK4A 3IR4A 2KUCA 1QK8A 5D96A 3GURA 4OMVA 4GCIA 2IIYA 5ECQB 4PUFC 3VWXA 1WE0A 4E8HA 2WZ9A 1F2EA 2KOKA 3H93A 1HNAA 4GRFA 4BVXA 4MLYA 4HJ2A 1JHBA 2EIRA 2WJUA 4XS4B 2C8UA 3KTLA 4MP4A 4IKHA 2YZUA 4POBA 3TJKA 1G7EA 2JU5A 3C73A 2UZ8A 3KMNA 3APQA 1EEMA 2H0HA 4GXZA 2IMDA 2F51A 3D4MA 3RHCA 3DIEA 1YY7A 3I9V2 3CSHA 3R2QA 2LRTA 3W8SA 4YQMA 5F07A 5ECIB 1S3DA 4TR0A 1XW6A 2TRXA 1U87A 3VURA 5CRDA 1PD21 5B6NA 1O81A 3IC4A 3WGXA 4O5RA 4ZXGA 1UVZA 2HXKA 5G31A 3GTUB 3TKPA 3LWAA 2H0GA 3DVXA 4XRDA 2IMIA 2HZFA 4KDYA 1Z6NA 4RQRA 3CYNA 4OD7A 1F9MA 5J4UA 5AIVA 2VUPA 2N5FA 3TKSE 1EWXA 1OAZA 3KIJA 2V1MA 1ZGNA 4EE0A 2GQLA 1ERVA 4MJCA 2L5LA 4TR1B 2DIYA 4XCSA 2LSTA 1ZL9A 2OBKA 3HD5A 2KLXA 4OWYA 3HCZA 1X5DA 2H6XA 5IPGA 2OADA 4XRAA 1GH2A 2VO4A 4ZB8A 3IA1A 1K0NA 2EIQA 3F0IA 3IHQA 5AISA 1AXDA 1Y25A 4ECCA 4F0CA 1XWBA 1B8XA 4FYUA 2GQKA 1O8XA 4XTSA 1UN2A 5IMVA 2VCVA 2QKEA 1AQXA 1B9YC 1GTIA 2JACA 5EVOA 3WYWA 3QAGA 5IIZA 3M1GA 1GSQA 4O92A 3D21A 1M2BA 2V2GA 2C1YA 2E2MA 2HSHA 2A2RA 3FHKA 1PGTA 2K6VA 5DQSA 1G0TA 2PVQA 3M8NA 5EY6A 2V41A 1JZOA 2H01A 4LL4B 3QPMA 4WF5A 1GTBA 2MMAA 2XPDA 4PTSA 3DKSA 3WT2A 5CYYA 1QGVA 2CA8A 2CVDA 2VCZA 1FG4A 1RQMA 2G2QA 3LFLA 1OYJA 3VLNA 6GSUA 3G7JA 2GGTA 1YZXA 4N11A 2GZYA 4LL1B 2VL3A 2IMEA 2H66A 2DJ3A 2FD3A 4MZCA 3ZVJD 1SKWB 2I4AA 4MA9A 1K0CA 3ISOA 4XS6A 1DE2A 4ISDA 3IBHA 2PBJA 2FWGA 2RIIA 2PERA 2DJJA 1A8LA 4ECJA 1SL0B 3UVTA 1T00A 4HDEA 3IE3A 3D0ZA 4AJ7A 2PVOC 3L78A 1ERTA 1HYUA 3C71A 3F63A 1PKZA 2ZUPA 4DSSA 4KH7A 2HZEB 1G7OA 2IFQB 17GSA 3IV4A 5J3RA 4KCEA 1HNBA 2H75A 2B5YA 2CVKA 4FIWA 1EV4A 3WGEA 5HFKA 1GNWA 2J9HA 2FUG2 1GTAA 5ABRA 4BL7A 4KCAA 3QDNA 1U3AA 3C7MA 5GAND 3MDKA 5FWGA 1TW9A 5DCGA 3L4NA 1TTZA 2HSYA 5G1LA 4K0GA 1PRXA 4ZL9A 5D93A 3M9JA 2VM2A 4F9ZA 4WKWA 1K0AA 4HI7A 5J5NA 3VI7A 1AQVA 3L9VA 3ZL5A 4BPYA 2H76A 1AC1A 3LG6A 2I1UA 4JE1A 5D8IA 5IPHA 2LV3A 4DVCA 4X1UA 3P2AA 2B1KA 2NDOA 2YWIA 5AGYA 3APSA 5DCHA 3Q6OA 1A23A 5HR3A 3C8EA 2M72A 5J9CA 1YEPA 5G5EA 2G0FA 1SU9A 3FZAA 4ZBBA 1PMTA 2LJKA 2E2GA 2GLRA 1PX6A 4TKYA 2F8FA 5ID2B 3E3EA 5KN0A 1EOHA 1R26A 4BVYA 3VPQA 3TJGA 5ECPB 2HRAA 4J56E 2QC7A 2JSZA 2H6YA 4RUVA 19GSA 1XBSA 1XPVA 4RQXA 2DIZA 1XWKA 5IMDA 3TKSA 4Q5NA 3FR6A 4PQ1A 1QXHA 1TXXA 5HFGA 3ZIJA 1SL2B 2GDRA 3TJBA 5CAXA 3K8NA 2CAQA 4DSQA 2VD0A 2ZNMA 1SJ6A 4PQHA 1K3OA 1A2LA 1FB6A 1BJXA 2WDUA 3ZZXA 1T7PB 4BWQA 4MPGA 3IXRA 8GSSA 3TJFA 3FZ9A 1GRXA 3LYPA 1URMA 2PUKC 3BCKA 1HD2A 3G7IA 3ZIVA 4EXJA 6GSWA 4BWSA 4TN8A 1WWJA 3ZFLA 3CTGA 2FWFA 4K9ZA 4Q5FA 2M80A 4IP1A 2X64A 1M7TA 3DGQA 2LTKA 4NV2A 4MMMA 5EPFA 2O8VB 2CVBA 3I43A 3UBLA 22GSA 2FCHA 2LEGA 5G2ZA 1XW5A 1JZRA 1OE8A 3P7XA 4N0ZA 3E9JB 2LQQA 3GN3A 2H6ZA 5A4UA 3GKNA 4HZ4A 1FO5A 1K0OA 1EP7A 3DRNA 3LXZA 2RUFA 4KUNA 3EWLA 4ECBA 2O89A 3EINA 4JR6A 2CX4A 2RUEA 5ECLB 2C3QA 2HT9A 2YJHA 4D73A 2D2ZA 2LQOA 2FA8A 6GSSA 4QQ7A 1GP1A 1TDIA 3ZLPA 3GMFA 2IPAA 1WOUA 4MABA 4TXVA 1EGOA 3GSSA 1WPIA 2GZZA 2NTOA 1JZDA 2FWHA 3C1SA 5HR1A 2KP1A 2B6MA 1GSYA 5C00A 4K2DA 4EDZA 4IJIA 1H4OA 3VK9A 3D5JA 3HKRA 1OC9A 3EU3A 2H72A 5D9WA 4HZ2A 4FYCA 4TR4A 1SL1B 5D73A 3MNGA 1XFLA 4IHUA 2R2JA 2VAFA 4TXOA 4RI6A 4HEA2 3TKSC 2B7JA 1NW2A 3IK7A 4ZL7A 1M2DA 4X43A 4TVEA 3FKFA 5B7CA 4NHZA 4MJEA 5CO3A 1NSWA 1LU4A 3UL3A 1PSQA 3EE2A 2VIMA 4J2FA 3VWWA 4G2EA 2ON7A 4NV5A 2TRCP 3RBTA 4JR4A 2CAIA 5HFIA 2VL2A 9GSSA 1GL8A 2C4JA 1N8JA 4BVXB 3I69A 2PGTA 4XIHA 1IYHA 1BYEA 1PQNA 1XWGA 3OR5A 1XWCA 2KHPA 4I5QA 3M0FA 18GSA 1FAAA 2BTOT 3KP9A 2I9HA 4GTUA 2H71A 2GSTA 1R7HA 4JZQA 3MWHA 4I8BA 2RM6A 2TIRA 1VGLA 3GYKA 1C72A 2YN1A 2HNLA 1T1VA 3IRAA 2DBCA 2GSQA 3R3EA 4IJ3A 2HSMA 6GSVA 1M9BA 1PL1A 2B5EA 4CW9A 3WT1A 5GSTA 2WB9A 4KDUA 2GZPA 2LS5A 5C04A 4IN0A 3ZFBA 5DDLA 5IM9A 3O3TA 3CBUA 3IOSA 1GUHA 2HRFA 2OBIA 4FQUA 3CTFA 3HJPA 1K3YA 2V6OA 2OACA 2IN3A 3O6TA 1ZCPA 3CSJA 4MPFA 3BJ5A 1YQ1A 2HQTA 2MMNA 5A5KA 5JWOB 1GNEA 1GSSA 2L6DA 3PPUA 4TRXA 3CRTA 4KE3A 4N30A 2M46A 2R4VA 5JCUA 4G0LA 4OFTA 2O7KA 2NPBA 3ZRDA 2AUVA 4WBJA 1X9WB 4PUAA 2VCTA 4OO4A 5BMUA 1YDKA 1PL2A 3LXTA 4KAEA 1MD3A 4N10A 4YAVA 3DWVA 1Z7RA 1HNCA 1EOGA 2FWEA 3SBCA 3PR8A 2GT6A 2H74A 1O73A 2XPEA 4KGIA 1QFNA 2VCQA 2CV4A 4AJ8A 5IOXA 4NXIA 4MH2A 4OO5A 1YJ6A 4ML6A 2F8AA 4G19A 2H1DA 3DYRA 3H8QA 6GSYA 4NHWA 3TKRA 4ZBAA 4CDOA 1BAYA 1ZZYA 4NAXA 1O8WA 1VF2A 3KCMA 2JADA 2ALBA 4E8EA 1GWCA 4O7HA 3WGDA 3GKKA 1YF1A 4FH8A 4MDCA 2IMKA 5FT3A 2XC2A 2EC4A 1TK0B 2VL2C 1ERWA 5E4WA 1UA5A 2C0GA 5H5QA 4MF5A 4L0UA 3QCPA 4F0BA 1U3IA 1GSFA 1FHEA 1DBYA 1F3AA 4K0NA 3KTBA 3SWLA 4KF9A 3F4TA 3DMLA 3KH7A 3N5OA 11GSA 3PGTA 4NPBA 2R6KA 1KNGA 4AGSA 5IMZA 3UEMA 1PKWA 4KDXA 14GSA 3RDWA 1TKDB 4ID0A 2I3YA 2QGVA 1K0DA 4DSRA 4DEJA 2B3SA 2FHEA 1J0FA 5IO2A 4HQZA 1TJDA 2IWTA 2WRTA 3QD9A 3TRPA 4WETA 3EURA 4NWYA 1GSEA 5DJLA 4YQVA 1TU7A 4KX4A 10GSA 2MMZA 1XVWA 3TOUA 3NZNA 4IBPA 3LSZA 2HRKA 1U6TA 2O85A 3EVIA 4DSSB 1I9DA 2XHFA 3ED3A 13GSA 3ME7A 3GH9A 2X8GA 3GL3A 5F05A 4Q5QA 5IQYA 3UVHA 1SENA 4IQ1A 2MZCA 2R3XA 1MTCA 4MH3A 4HU7A 1S3CA 4MZWA 3KMOA 4IQAA 5CRHA 4BL7B 1GULA 3G7YA 4OCFA 1XOAA 1XOBA 4RI7A 1EV9A 2YJ7A 2YP6A 5E59A 1X0RA 3IDVA 3HVXA 4MCUA 2YV7A 1THXA 3GSTA 2L4QA 3P90A 4HQSA 5DJMA 4FO5A 1XZOA 3D6IA 2CQ9A 1Q98A 2NBSA 1M0UA 2H73A 2C0DA 4V2MA 2LJAA 2R5GA 2IJYA 3GA4A 2CZ3A 1F6MC 4GSTA 1QQ2A 3Q19A 2K9FA 3LYKA 1XWAA 5CRGA 4PQIA 1Z9HA 2L5OA 1Q4JA 4KB3A 4TW5A 4L5OA 2WFCA 1KEBA 5ELGA 4HS1A 1ZYEA 4O32A 4BVYB 1QUWA 1SYXA 2K8SA 4PGTA 2EIOA 3FZ5A 2DJ1A 2FNOA 1AUCA 4F82A 2GSRA 5FHIA 3CSIA 1W89A 3A2VA 4ULXA 3ZYWA 3FW2A 4LMVA 1ERUA 2RLIA 20GSA 1PN9A 5ECHB 3TOTA 2XBQA 2VCXA 2HRNA 1MDJA 3ZMLA 4KNDA 5CP1A 2ON5A 2H0IA 2HYXA 2H8LA 3GIXA 4NMUA 1ZOFA 2YPMA 2F3MA 2X99A 3H1NA 1AQWA 3F8UA 3HYPA 3TJJA 1LBKA 2I81A 4YH2A 1A8YA 5J9BA 2PU9C 2PMTA 3HJMA 5ELAA 1M9AA 3ERFA 4IELA 3TB2A 1DE1A 1W4VA 1JZWA 4POMA 2LRCA 1FVKA 1R5AA 1GUKA 1SKRB 3EYTA 7GSSA 2N5BA 1Y6EA 3D4TA 4HJMA 3GV1A 3BOAA 1DSBA 2WS2A 2C80A 3S9FA 1A0FA 5AIXA 5JCWA 1M2AA 5DAKA 5B6MA 4V1Ap 2E7PA 3GRXA 3QR6A 5HR2A 5G5FA 1X5CA 1GLPA 3HDCA 2RM5A 3HVVA 3KH9A 3ME8A 1B4QA 3TKQA 3ZITA 4EUYA 2X8HA 4IP6A 3P8WA 1VF3A 3GX0A 3TRQA 5A4VA 1YKAA 4LA1A 1K0MA 1CQGA 4ACSA 2YWOA 1Z5YE 3KJYA 2C0EA 3Q74A 4PXOA 2WCIA 1S3AA 3GKMA 3DVWA 3J7Yk 2L6CA 4G10A 3CMIA 2C3TA 4X0XA 5ECRB 2V32A 5A4WA 4D73B 1OE7A 3GKXA 2OE3A 4XHMA 1OC8A 3VFIA 1E2YA 1NHOA 3A2WA 2PN8A 2NVLA 3TDGA 2LJRA 4ZBDA 1OKDA 3EMXA 1R5PA 2JSYA 2X8CA 4HOJA 5D9TA 1JFUA 1X9MB 3HZ8A 4ILFA 2VM1A 3F3RA 1OKTA 3APOA 3ZMKA 1SK2A 1THOA 4IVFA 5DALA 4EDYA 4V2LA 1OC9B 3MAKA 4I97A 3GFKA 5JWRB 2AJQB 3LJRA 2LKUA 4YAPA 5COHA 2JZTA 4MZBA 3HXSA 1A24A 1ILOA 4TXOB 5LCZA 4G0IA 5CNWA 2VOCA 3UMAA 3GUSA 4AF2A 2FLSA 1IYIA 4L8EA 5B8BA 1GUMA 3L9SA 4GQCA 12GSA 2WULA 3ERGA 4G9HA 1A2MA 2JZSA 1YKCA 5HQPA 4H86A 3FEUA 4I6XA 1XXUA 3KP8A 3PH9A 1VF4A 2P5RA 4Z7XA 1K0BA 4XS4A 3WD6A 2MBTA 3TUEA 3GH6A 1WIKA 3PINA 1EZKA 5B8AA 1T4ZA 5L71A 2P31A 4JU5A 6GSXA 4GQFA 1YF0A 2N5AA 4CHSA 1TRWA 2IL3A 1BX9A 1TRUA 3TRXA 1FVJA 4WR5A 1U88A 2A4VA 3GTUA 2O87A 2HE3A 2HSMB 2AV4A 2WGRA 1OVNA 4EO3A 2XBIA 1JLVA 2K8VA 3H4KA 2J23A 1BG5A 1B48A 4GWRA 1V58A 5JWQB 2LNTA 2LNSA 1V2AA 5CRWA 2REMA 2CZ2A 4F03A 2AB6A 2YOIA 5JCGA 1PX7A 1BEDA 2L57A 4TR1A 3GX8A 2H1BA 3ERWA 1G6YA 3TGZA 3V1WA 2MMOA 2HFDA 3FR3A 5IOWA 2C0FA 1SK0A 5IMAA 16GSA 2IMFA 4OFMA 3BD2A 2YNXA 5ECKB 1B4PA 1MDKA 5LNKe 4L5LA 1SYRA 4OCEA 2F9SA 3UIWA 4ML1A 4IGJA 2AAWA 1ABAA 2H19A 1RW1A 5AN1A 2QSIA 1XW9A 2GSSA 1T4YA 3TCOA 1ST9A 2DJ2A 2VLTA 5KN3A 3F3QA 4JRRA 5ENUA 5G30A 3IK9A 1PA3A 2DSAA 1JLWA 1GLQA 4KSMA 5GZZB 1FB0A 3J7Yb 1J9BA 2YWMA 1SKSB 2K18A 3KXOA 3FY7A 1J08A 4EL1A 2CT6A 3HY2A 1ACVA 5F0GA 3I6AA 3W8JA 5KN2A 3DEXA 3DXBA 2YANA 2P0GA 3F6FA 5LD0A 4ZILA 4F2IA 1T3BA 3LGCA 2L4CA 2FY6A 1FW1A 2DLXA 1SD9A 1V98A 2FGXA 4V1Ag 1A2JA 3VWUA 2OKAA 4GLTA 4AJ6A 1M99A 4ZIJA 3HZ4A 1SJZA 3LEFA 5DBQA 3CRUA 2HSNB 2VCWA 4ZB6A 1TRVA 3LORA 2H1AA 3QFBC 5CREA 1DUGA 1HQOA 3H79A 5DQYA 2LUSA 4PX1A 5IO0A 1EP8A 2DC5A 2AYTA 4TR3A 4XS1A 3G9BA 2BJXA 3RPNA 1O7UA 2FA4A 1NM3A 3QAVA 3ZTLA 1TK8B 3HA9A 1MEKA 1ZYQB 2OJLA 5DVBA 3W6GA 1SJIA 3DD3A 1XIYA 2P5QA 3U5RE 3QAWA 3GL5A 3IAM2
chains in the Genus database with same CATH superfamily
4MJBA 2CX3A 3ZVJA 2HZEA 2IFQA 1E6BA 4WR4A 2DMLA 3JCML 4QL7A 1Z3EA 3HVSA 2HRKB 1SVMA 2VLUA 1XCCA 1F3BA 1GTUA 1YEXA 4ZL8A 1OC3A 3FK8A 2C3NA 1SD8A 2L59A 4I2UA 4MF7A 4ECIA 2MBSA 4CY6A 3L9UA 3VWVA 5KEJA 4EC0A 3NIVA 2PPTA 1TU8A 3Q18A 5D9XA 1WP0A 4KSOA 2KP2A 4J57E 3F6DA 2H1LA 3F4RA 3UAPA 3FR9A 1Z7PA 2JZRA 4WXTA 3QMXA 2HLSA 2E0QA 3A2XA 5D9VA 2H30A 2YWNA 4K8MA 3U6VA 2GS3A 3A3TA 2ES7A 1EEJA 4OFNA 3RHBA 2V6KA 2R37A 4KA0A 3KZQA 3NOFA 3N9JA 3BCIA 2WVXA 2DJKA 4FYBA 3IAS2 2YZHA 3UJ1A 3FMWA 1VF1A 4EF0A 1TI3A 1X9SB 2AHEA 1AIUA 1BQ7A 2ZCTA 1MDIA 4WEYA 4JBBA 3O76A 3M9KA 5INYA 3KM6A 5GAPD 4LMWA 3US3A 3ZREA 4POLA 3F4SA 3RPPA 4G01A 2EFHA 1USBA 3IC8A 2VD1A 4HU9A 5ID2A 4GF0A 4W66A 3RAZA 4BIKA 4QL9A 2OE1A 3UBKA 4K1FA 5H5SA 1X5EA 1R4WA 5ECOB 2PWJA 2YCDA 1TK5B 3MIXA 3MSZA 2VLVA 2YV9A 3KGKA 3EMPA 5J47A 1EGRA 1SK1A 4EVMA 4Q5RA 1N2AA 5ECMB 3GNJA 3L0HA 1FOVA 1WRYA 2H70A 2GT5A 1AW9A 3LQ7A 4PNGA 4PI0C 1ON4A 1ML6A 5IMFA 4K6XA 4K7NA 3HJOA 3M3MA 1I5GA 3UARA 1AAZA 5A5HA 2GQMA 3F9UA 4K7IA 2GTUA 3AY8A 2B1LA 3A5WA 1GSUA 4V2NA 3HHVA 1A0RP 5ECNB 1S4BP 3CXGA 1V9WA 1UC7A 5IMCA 2DMMA 4I2TA 4X4JA 1F37A 2JL4A 4HUAA 4L0WA 1XVQA 4P3YB 3IPZA 3KEBA 3C1RA 4K7OA 2VL9A 5DAKB 1QMVA 4N0VA 1H75A 3EC3A 3MYDA 2DJ0A 5KN1A 2Z9SA 2BMXA 4USSA 1CQHA 4KW6A 2OE0A 2MYGA 1GSDA 6GSTA 1Z6MA 1B9XC 4GSNA 1WJKA 5G1KA 5A34B 2H1GA 2WZSA 2HI7A 1LJRA 4TOPA 3QFAC 4IS0A 4EKZA 4IW9A 3QOUA 3UOMA 1O85A 1K3LA 3TU3B 4WBRD 3E0UA 4WF4A 1WMJA 1G6WA 1I1IP 1KTEA 2A2SA 3FZ4A 2OA7A 3GHAA 5EL8A 3BBYA 4GSSA 3VPTA 4PNFA 1NHYA 2LRNA 5H5RA 3LW9A 1MD4A 4Z2RA 3KD0A 4MF6A 4LLRA 1TP9A 5GSSA 5F06A 5J41A 4POKA 4JEDA 2GVPA 4PURA 2QA2A 4YQUA 5ECSA 1V40A 3FYGA 1KBNA 1TRSA 5F8BA 4MK3A 3FRCA 4ZB9A 1VRSD 4BA7A 4MJAA 5DALB 1O6JA 1TOFA 1TI1A 1V57A 3D22A 3EU4A 3VI5A 1ZMAA 2B5XA 1T8EB 4G0KA 5HR0A 2B7KA 1RK4A 3IR4A 2KUCA 1QK8A 5D96A 3GURA 4OMVA 4GCIA 2IIYA 5ECQB 4PUFC 3VWXA 1WE0A 4E8HA 2WZ9A 5A1NB 1F2EA 2KOKA 3H93A 1HNAA 4GRFA 4BVXA 4MLYA 4HJ2A 1JHBA 2EIRA 2WJUA 4XS4B 2C8UA 3KTLA 4MP4A 4IKHA 2YZUA 4POBA 3TJKA 1G7EA 2JU5A 3C73A 2UZ8A 4ICYA 3KMNA 3APQA 1EEMA 2H0HA 4GXZA 2IMDA 2F51A 3D4MA 3RHCA 1XG8A 1ZYNA 3DIEA 1YY7A 3I9V2 3CSHA 3R2QA 2LRTA 3W8SA 4YQMA 5F07A 5ECIB 1S3DA 4TR0A 1XW6A 2TRXA 1U87A 3VURA 5CRDA 1PD21 5B6NA 1O81A 3IC4A 3WGXA 4O5RA 4ZXGA 1UVZA 2HXKA 5G31A 3GTUB 3TKPA 3LWAA 2H0GA 3DVXA 4XRDA 2IMIA 2HZFA 4KDYA 4YKFA 1Z6NA 2X49A 4RQRA 3CYNA 4OD7A 2R0PA 1F9MA 5J4UA 5AIVA 2VUPA 2N5FA 3TKSE 1EWXA 1OAZA 3KIJA 2V1MA 1ZGNA 4EE0A 2GQLA 1ERVA 4MJCA 2L5LA 4TR1B 2DIYA 4XCSA 2LSTA 4PHZC 1ZL9A 2OBKA 3HD5A 2KLXA 4OWYA 3HCZA 1X5DA 2H6XA 5IPGA 2OADA 4XRAA 1GH2A 2VO4A 4ZB8A 3IA1A 1K0NA 2EIQA 3F0IA 3IHQA 5AISA 1AXDA 1Y25A 4ECCA 4F0CA 1XWBA 1B8XA 4FYUA 2GQKA 1O8XA 4XTSA 1UN2A 5IMVA 2VCVA 2QKEA 1AQXA 1B9YC 1GTIA 2JACA 1SVOA 5EVOA 3WYWA 3QAGA 5IIZA 3M1GA 1GSQA 4O92A 3D21A 1M2BA 2V2GA 2C1YA 1M3JA 2E2MA 2HSHA 2A2RA 3FHKA 1PGTA 2K6VA 5DQSA 1G0TA 2PVQA 3M8NA 5EY6A 2V41A 2X4AA 1JZOA 2H01A 4LL4B 2O5VA 3QPMA 4WF5A 1GTBA 2MMAA 2XPDA 4PTSA 3DKSA 3WT2A 5CYYA 1QGVA 4ZB7A 2CA8A 2CVDA 2VCZA 1FG4A 1RQMA 2G2QA 3LFLA 1OYJA 3VLNA 6GSUA 3G7JA 2GGTA 1YZXA 4N11A 2GZYA 4LL1B 2VL3A 2IMEA 2H66A 2DJ3A 2FD3A 4MZCA 3ZVJD 1SKWB 2I4AA 4MA9A 1K0CA 3ISOA 4XS6A 1DE2A 4ISDA 3IBHA 2PBJA 2FWGA 2RIIA 2PERA 2DJJA 1A8LA 4ECJA 1SL0B 3UVTA 1T00A 4HDEA 3IE3A 3D0ZA 2R0GA 4AJ7A 2PVOC 3L78A 1ERTA 1HYUA 3C71A 3F63A 1PKZA 2ZUPA 4DSSA 5BRTA 4KH7A 3RFRC 2HZEB 1G7OA 2IFQB 17GSA 3IV4A 5J3RA 4KCEA 1HNBA 2H75A 2B5YA 2CVKA 4FIWA 1EV4A 3WGEA 5HFKA 1GNWA 2J9HA 2FUG2 1GTAA 4CY8A 5ABRA 4BL7A 4KCAA 3QDNA 1U3AA 3C7MA 5GAND 3MDKA 5FWGA 1TW9A 5DCGA 3L4NA 1TTZA 2O36A 2HSYA 5G1LA 4K0GA 1PRXA 4ZL9A 5D93A 3M9JA 2VM2A 4F9ZA 4WKWA 1K0AA 4HI7A 5J5NA 3VI7A 1AQVA 5KOXA 3L9VA 3ZL5A 4BPYA 2H76A 1AC1A 3LG6A 2I1UA 4JE1A 5D8IA 5IPHA 2LV3A 4DVCA 4X1UA 3P2AA 2WVXB 2B1KA 2O3EA 2NDOA 2YWIA 5AGYA 3APSA 5DCHA 2WVYA 3Q6OA 1A23A 5HR3A 3C8EA 2M72A 5J9CA 1YEPA 5G5EA 2G0FA 1SU9A 3FZAA 4ZBBA 1PMTA 2LJKA 2E2GA 2GLRA 1PX6A 4TKYA 2F8FA 5ID2B 3E3EA 5KN0A 1EOHA 1R26A 4BVYA 3VPQA 3TJGA 5ECPB 2HRAA 4J56E 2QC7A 2JSZA 2H6YA 4RUVA 19GSA 1XBSA 1XPVA 4RQXA 2DIZA 1XWKA 5IMDA 3TKSA 4Q5NA 3FR6A 4PQ1A 1QXHA 1TXXA 5HFGA 3ZIJA 1SL2B 2GDRA 3TJBA 5CAXA 3K8NA 2CAQA 4DSQA 1Y1UA 2VD0A 2ZNMA 1SJ6A 4PQHA 1K3OA 1A2LA 1FB6A 1BJXA 2WDUA 3ZZXA 1T7PB 4BWQA 4MPGA 3IXRA 8GSSA 3TJFA 3FZ9A 1BF5A 1GRXA 5A5HB 4K5SA 3LYPA 1URMA 2PUKC 3BCKA 1HD2A 3G7IA 3ZIVA 4EXJA 6GSWA 4BWSA 4TN8A 1WWJA 3ZFLA 3CTGA 2FWFA 4K9ZA 4Q5FA 2M80A 4IP1A 2X64A 1M7TA 3DGQA 2LTKA 4NV2A 4MMMA 3RGBC 5EPFA 2O8VB 2CVBA 3I43A 3UBLA 22GSA 2FCHA 2LEGA 5G2ZA 1XW5A 1JZRA 1OE8A 3P7XA 4HSCX 4N0ZA 3E9JB 2LQQA 3CHXC 3GN3A 2H6ZA 5A4UA 3GKNA 4HZ4A 1FO5A 1K0OA 1EP7A 3DRNA 3LXZA 4E68A 2RUFA 4KUNA 3EWLA 4ECBA 2O89A 3EINA 4JR6A 2CX4A 2RUEA 5ECLB 2C3QA 2HT9A 2YJHA 4D73A 4EIQA 2D2ZA 2LQOA 2FA8A 6GSSA 4QQ7A 1GP1A 1TDIA 3ZLPA 3GMFA 2IPAA 1WOUA 4MABA 4TXVA 1EGOA 1PN0A 3GSSA 1WPIA 2GZZA 2NTOA 1JZDA 2FWHA 3C1SA 5HR1A 2KP1A 2B6MA 1GSYA 5C00A 4K2DA 4EDZA 4IJIA 1H4OA 3VK9A 3D5JA 4Z2UA 3HKRA 1OC9A 3EU3A 2H72A 5D9WA 4HZ2A 4FYCA 4TR4A 1SL1B 5D73A 3MNGA 1XFLA 4IHUA 2R2JA 2VAFA 4TXOA 4RI6A 2R0CA 4HEA2 3TKSC 2B7JA 1NW2A 3IK7A 4ZL7A 1M2DA 4X43A 4TVEA 3FKFA 5B7CA 4NHZA 4MJEA 5CO3A 1NSWA 1LU4A 3UL3A 1PSQA 3EE2A 2VIMA 4J2FA 3VWWA 4G2EA 2ON7A 4NV5A 2TRCP 3RBTA 4JR4A 1FOHA 4PI2C 2CAIA 5HFIA 2VL2A 9GSSA 1GL8A 2C4JA 1N8JA 4BVXB 3I69A 2PGTA 4XIHA 1IYHA 1BYEA 1PQNA 1XWGA 4GDFA 3OR5A 1XWCA 2KHPA 4I5QA 3M0FA 18GSA 1FAAA 2BTOT 1S3RA 3KP9A 2I9HA 4GTUA 2H71A 2GSTA 1R7HA 4JZQA 3MWHA 4I8BA 2RM6A 2TIRA 1VGLA 3GYKA 1C72A 2YN1A 2HNLA 1T1VA 3IRAA 2DBCA 2GSQA 3R3EA 2VKZG 4IJ3A 2HSMA 6GSVA 1M9BA 1PL1A 2B5EA 4CW9A 3WT1A 5GSTA 2WB9A 4KDUA 2GZPA 2LS5A 5C04A 4IN0A 3ZFBA 5DDLA 5IM9A 2EFEA 3O3TA 3CBUA 3IOSA 1GUHA 2HRFA 2OBIA 4FQUA 3CTFA 3HJPA 1K3YA 2V6OA 2OACA 2IN3A 3O6TA 1ZCPA 3CSJA 4MPFA 3BJ5A 1YQ1A 2HQTA 2EFDA 2MMNA 3HVNA 5A5KA 5JWOB 1GNEA 1GSSA 2L6DA 3PPUA 4TRXA 3CRTA 4KE3A 1YVLA 4AKXB 4N30A 2M46A 2R4VA 5JCUA 4G0LA 4OFTA 2O7KA 2NPBA 3ZRDA 2AUVA 4WBJA 1X9WB 4PUAA 2VCTA 4OO4A 5BMUA 1YDKA 1PL2A 3LXTA 4KAEA 1MD3A 4N10A 4K5RA 4YAVA 3DWVA 1Z7RA 3HMJG 1HNCA 1EOGA 2FWEA 3SBCA 3PR8A 2GT6A 2H74A 1O73A 2XPEA 4KGIA 1QFNA 4QMKA 3EPTA 2VCQA 2CV4A 4AJ8A 5IOXA 4NXIA 4MH2A 4OO5A 1YJ6A 4ML6A 4FXYP 2F8AA 4G19A 2H1DA 3DYRA 3H8QA 6GSYA 4NHWA 3TKRA 4ZBAA 4CDOA 1BAYA 1ZZYA 4NAXA 1O8WA 1VF2A 2A4HA 3KCMA 2JADA 2ALBA 4E8EA 1GWCA 4O7HA 3WGDA 3GKKA 1YF1A 4FH8A 4MDCA 2IMKA 5FT3A 2XC2A 2EC4A 1TK0B 2VL2C 1ERWA 5E4WA 1UA5A 2C0GA 5H5QA 4MF5A 4L0UA 3QCPA 4F0BA 1U3IA 1GSFA 1FHEA 1DBYA 1F3AA 4K0NA 2HSNA 3SWLA 3KTBA 4KF9A 3F4TA 3DMLA 4AI6A 3KH7A 3N5OA 11GSA 3PGTA 4NPBA 2R6KA 1KNGA 4AGSA 5IMZA 3UEMA 1PKWA 4KDXA 14GSA 3RDWA 1TKDB 4ID0A 2I3YA 2QGVA 1K0DA 4MNNA 4DEJA 4DSRA 2B3SA 2FHEA 1J0FA 5IO2A 4HQZA 1TJDA 2IWTA 2WRTA 3QD9A 3TRPA 4WETA 3EURA 4NWYA 1GSEA 5DJLA 4YQVA 1TU7A 4KX4A 10GSA 4Z2TA 2MMZA 1XVWA 3TOUA 3NZNA 4IBPA 3LSZA 2HRKA 1U6TA 2O85A 3EVIA 4DSSB 1I9DA 2XHFA 3ED3A 13GSA 3ME7A 3GH9A 2X8GA 3GL3A 5F05A 1N25A 4Q5QA 5IQYA 3UVHA 1SENA 4IQ1A 2MZCA 2R3XA 1MTCA 4MH3A 4HU7A 1S3CA 4MZWA 3KMOA 4IQAA 5CRHA 4BL7B 1GULA 3G7YA 4OCFA 1XOAA 1XOBA 4RI7A 1EV9A 2YJ7A 2YP6A 5E59A 1X0RA 3IDVA 3HVXA 4MCUA 2YV7A 1THXA 3GSTA 2L4QA 3P90A 4HQSA 5DJMA 4FO5A 1XZOA 3D6IA 2CQ9A 1Q98A 2NBSA 1M0UA 1TXUA 2H73A 2C0DA 4V2MA 2LJAA 2R5GA 2IJYA 3GA4A 2CZ3A 1F6MC 4GSTA 1QQ2A 3Q19A 2K9FA 3LYKA 1XWAA 5CRGA 4PQIA 2WW3A 1Z9HA 2L5OA 1Q4JA 4KB3A 4TW5A 4L5OA 2WFCA 1KEBA 5ELGA 4HS1A 1ZYEA 5J40A 4O32A 4BVYB 1QUWA 1SYXA 2K8SA 4PGTA 2EIOA 1M3IA 3FZ5A 2DJ1A 2FNOA 1AUCA 4F82A 2GSRA 5FHIA 3CSIA 1W89A 3A2VA 4ULXA 3ZYWA 3FW2A 4LMVA 1ERUA 2RLIA 20GSA 1PN9A 5ECHB 3TOTA 2XBQA 2VCXA 2HRNA 1MDJA 3ZMLA 4KNDA 5CP1A 2ON5A 2H0IA 2HYXA 2H8LA 3GIXA 4NMUA 1ZOFA 2YPMA 2F3MA 2X99A 3H1NA 1AQWA 3F8UA 3HYPA 3TJJA 1LBKA 4AKIA 2I81A 4YH2A 1A8YA 5J9BA 2PU9C 2PMTA 3HJMA 5ELAA 1M9AA 3ERFA 4IELA 3TB2A 1DE1A 1W4VA 1JZWA 4POMA 2LRCA 4O5QA 1FVKA 1R5AA 1GUKA 1SKRB 3EYTA 7GSSA 2N5BA 1Y6EA 3D4TA 4HJMA 3GV1A 3BOAA 1DSBA 2WS2A 2C80A 3S9FA 1A0FA 5AIXA 5JCWA 1M2AA 5DAKA 5B6MA 4V1Ap 2E7PA 3GRXA 3QR6A 5HR2A 5G5FA 1X5CA 1GLPA 5J4YA 3HDCA 2RM5A 3HVVA 3KH9A 3ME8A 1B4QA 3TKQA 4YKGA 3ZITA 4EUYA 2X8HA 4IP6A 3P8WA 1VF3A 3GX0A 3TRQA 5A34A 5A4VA 1YKAA 4LA1A 1K0MA 1CQGA 4ACSA 2YWOA 1Z5YE 3KJYA 2UV8G 2C0EA 3Q74A 4PXOA 2WCIA 1S3AA 3GKMA 3DVWA 3J7Yk 2L6CA 4G10A 3CMIA 2C3TA 4X0XA 3CQFA 5ECRB 2V32A 5A4WA 4D73B 1OE7A 3GKXA 2OE3A 4XHMA 1OC8A 3VFIA 1E2YA 1NHOA 1PFOA 3A2WA 2PN8A 2NVLA 3TDGA 2LJRA 4ZBDA 1OKDA 3EMXA 1R5PA 2JSYA 2X8CA 4HOJA 5D9TA 1JFUA 1X9MB 3HZ8A 4ILFA 2VM1A 3F3RA 1OKTA 3APOA 1YEWC 2WW1A 3ZMKA 1SK2A 1THOA 4EIPA 4IVFA 5DALA 4EDYA 4V2LA 1OC9B 3MAKA 4I97A 3GFKA 5JWRB 2AJQB 2WW2A 3LJRA 2LKUA 4YAPA 5COHA 2JZTA 4MZBA 3HXSA 1A24A 1ILOA 4TXOB 5LCZA 4G0IA 5CNWA 2VOCA 3UMAA 3GUSA 4AF2A 2FLSA 1IYIA 4L8EA 5B8BA 1GUMA 3L9SA 2QA1A 4GQCA 12GSA 2WULA 3ERGA 4G9HA 1A2MA 2JZSA 1YKCA 5HQPA 5A1NA 4H86A 3FEUA 4I6XA 1XXUA 3KP8A 3PH9A 1VF4A 2P5RA 4Z7XA 1K0BA 4XS4A 3WD6A 2MBTA 3TUEA 3GH6A 1WIKA 3PINA 1EZKA 5B8AA 1T4ZA 5L71A 2P31A 4JU5A 5KOWA 6GSXA 4GQFA 1YF0A 2N5AA 4CHSA 1TRWA 2IL3A 1BX9A 1TRUA 3TRXA 2A2PA 1FVJA 4WR5A 1U88A 2A4VA 3GTUA 2O87A 2HE3A 2HSMB 2AV4A 2WGRA 1OVNA 4EO3A 2XBIA 1JLVA 2K8VA 3H4KA 2WVZA 2J23A 1BG5A 1B48A 4AKHA 4AKGA 4GWRA 1V58A 5JWQB 2LNTA 2LNSA 1V2AA 5CRWA 2REMA 2CZ2A 4F03A 2AB6A 2YOIA 5JCGA 1ZYPA 1PX7A 1BEDA 2L57A 4TR1A 3GX8A 2H1BA 3ERWA 1G6YA 3TGZA 3V1WA 2MMOA 2HFDA 3FR3A 5IOWA 2C0FA 1SK0A 5IMAA 16GSA 2IMFA 4OFMA 3BD2A 2YNXA 5ECKB 1B4PA 1MDKA 5LNKe 4L5LA 1SYRA 4OCEA 2OT3A 2F9SA 5BMUB 3UIWA 4ML1A 4IGJA 2AAWA 1ABAA 2H19A 1RW1A 5AN1A 2QSIA 1XW9A 2GSSA 1T4YA 3TCOA 1ST9A 2DJ2A 2VLTA 5KN3A 3F3QA 4JRRA 5ENUA 5G30A 3IK9A 1PA3A 2DSAA 1JLWA 5J4VA 1GLQA 4KSMA 5GZZB 1FB0A 3J7Yb 1J9BA 2YWMA 1SKSB 2K18A 3KXOA 3FY7A 1J08A 4EL1A 2CT6A 3HY2A 1ACVA 5F0GA 3I6AA 3W8JA 5KN2A 3DEXA 3DXBA 2YANA 2P0GA 3F6FA 5LD0A 4ZILA 3A5IA 4F2IA 1T3BA 3LGCA 2L4CA 2FY6A 1FW1A 2DLXA 1SD9A 1V98A 2FGXA 4V1Ag 1A2JA 3VWUA 2DKIA 2OKAA 4GLTA 2EFCA 1BG1A 3CWGA 4N3ZA 3IHGA 2WW0A 4AJ6A 1M99A 4ZIJA 3HZ4A 1SJZA 3LEFA 5DBQA 3CRUA 2HSNB 2VCWA 4ZB6A 1TRVA 3LORA 2H1AA 3QFBC 2DKHA 5CREA 1DUGA 1HQOA 3H79A 5DQYA 2LUSA 4PX1A 5IO0A 1EP8A 4O5UA 2DC5A 2AYTA 4TR3A 4XS1A 1SVLA 3G9BA 2BJXA 3RPNA 1O7UA 2FA4A 1NM3A 4A5PA 3QAVA 3ZTLA 1TK8B 3HA9A 1MEKA 1ZYQB 2OJLA 4K2XA 5DVBA 3W6GA 1SJIA 3DD3A 1XIYA 2P5QA 3U5RE 3QAWA 3GL5A 3IAM2
chains in the Genus database with same CATH topology
4MJBA 2CX3A 3ZVJA 2HZEA 2IFQA 1E6BA 4WR4A 2DMLA 3JCML 4QL7A 1Z3EA 3HVSA 2HRKB 1SVMA 2VLUA 1XCCA 1F3BA 1GTUA 1YEXA 4ZL8A 1OC3A 3FK8A 2C3NA 1SD8A 2L59A 4I2UA 4MF7A 4ECIA 2MBSA 4CY6A 3L9UA 3VWVA 5KEJA 4EC0A 3NIVA 2PPTA 1TU8A 3Q18A 5D9XA 1WP0A 4KSOA 2KP2A 4J57E 3F6DA 2H1LA 3F4RA 3UAPA 3FR9A 1Z7PA 2JZRA 4WXTA 3QMXA 2HLSA 2E0QA 3A2XA 5D9VA 2H30A 2YWNA 4K8MA 3U6VA 2GS3A 3A3TA 2ES7A 1EEJA 4OFNA 3RHBA 2V6KA 2R37A 4KA0A 3KZQA 3NOFA 3N9JA 3BCIA 2DJKA 4FYBA 3IAS2 2YZHA 3UJ1A 3FMWA 1VF1A 4EF0A 1TI3A 1X9SB 2AHEA 1AIUA 1BQ7A 2ZCTA 1MDIA 4WEYA 4JBBA 3O76A 3M9KA 5INYA 3KM6A 5GAPD 4LMWA 3US3A 3ZREA 4POLA 3F4SA 3RPPA 4G01A 2EFHA 1USBA 3IC8A 2VD1A 4HU9A 5ID2A 4GF0A 4W66A 3RAZA 4QL9A 2OE1A 3UBKA 4K1FA 5H5SA 1X5EA 1R4WA 5ECOB 2PWJA 2YCDA 1TK5B 3MIXA 3MSZA 2VLVA 2YV9A 3KGKA 3EMPA 5J47A 1EGRA 1SK1A 4EVMA 4Q5RA 1N2AA 5ECMB 3GNJA 3L0HA 1FOVA 1WRYA 2H70A 2GT5A 1AW9A 3LQ7A 4PNGA 1ON4A 1ML6A 5IMFA 4K6XA 4K7NA 3HJOA 3M3MA 1I5GA 3UARA 1AAZA 5A5HA 2GQMA 3F9UA 4K7IA 2GTUA 3AY8A 2B1LA 3A5WA 1GSUA 4V2NA 3HHVA 1A0RP 5ECNB 3CXGA 1V9WA 1UC7A 5IMCA 2DMMA 4I2TA 4X4JA 1F37A 2JL4A 4HUAA 4L0WA 1XVQA 4P3YB 3IPZA 3KEBA 3C1RA 4K7OA 2VL9A 5DAKB 1QMVA 4N0VA 1H75A 3EC3A 3MYDA 2DJ0A 5KN1A 2Z9SA 2BMXA 4USSA 1CQHA 4KW6A 2OE0A 2MYGA 1GSDA 6GSTA 1Z6MA 1B9XC 4GSNA 1WJKA 5G1KA 5A34B 2H1GA 2HI7A 1LJRA 4TOPA 3QFAC 4IS0A 4EKZA 4IW9A 3QOUA 3UOMA 1O85A 1K3LA 3TU3B 4WBRD 3E0UA 4WF4A 1WMJA 1G6WA 1KTEA 2A2SA 3FZ4A 2OA7A 3GHAA 5EL8A 3BBYA 4GSSA 3VPTA 4PNFA 1NHYA 2LRNA 5H5RA 3LW9A 1MD4A 4Z2RA 3KD0A 4MF6A 4LLRA 1TP9A 5GSSA 5F06A 5J41A 4POKA 4JEDA 2GVPA 4PURA 2QA2A 4YQUA 5ECSA 1V40A 3FYGA 1KBNA 1TRSA 5F8BA 4MK3A 3FRCA 4ZB9A 1VRSD 4BA7A 4MJAA 5DALB 1O6JA 1TOFA 1TI1A 1V57A 3D22A 3EU4A 3VI5A 1ZMAA 2B5XA 1T8EB 4G0KA 5HR0A 2B7KA 1RK4A 3IR4A 2KUCA 1QK8A 5D96A 3GURA 4OMVA 4GCIA 2IIYA 5ECQB 4PUFC 3VWXA 1WE0A 4E8HA 2WZ9A 5A1NB 1F2EA 2KOKA 3H93A 1HNAA 4GRFA 4BVXA 4MLYA 4HJ2A 1JHBA 2EIRA 2WJUA 4XS4B 2C8UA 3KTLA 4MP4A 4IKHA 2YZUA 4POBA 3TJKA 1G7EA 2JU5A 3C73A 2UZ8A 4ICYA 3KMNA 3APQA 1EEMA 2H0HA 4GXZA 2IMDA 2F51A 3D4MA 3RHCA 1ZYNA 3DIEA 1YY7A 3I9V2 3CSHA 3R2QA 2LRTA 3W8SA 4YQMA 5F07A 5ECIB 1S3DA 4TR0A 1XW6A 2TRXA 1U87A 3VURA 5CRDA 1PD21 5B6NA 1O81A 3IC4A 3WGXA 4O5RA 4ZXGA 1UVZA 2HXKA 5G31A 3GTUB 3TKPA 3LWAA 2H0GA 3DVXA 4XRDA 2IMIA 2HZFA 4KDYA 4YKFA 1Z6NA 2X49A 4RQRA 3CYNA 4OD7A 2R0PA 1F9MA 5J4UA 5AIVA 2VUPA 2N5FA 3TKSE 1EWXA 1OAZA 3KIJA 2V1MA 1ZGNA 4EE0A 2GQLA 1ERVA 4MJCA 2L5LA 4TR1B 2DIYA 4XCSA 2LSTA 1ZL9A 2OBKA 3HD5A 2KLXA 4OWYA 3HCZA 1X5DA 2H6XA 5IPGA 2OADA 4XRAA 1GH2A 2VO4A 4ZB8A 3IA1A 1K0NA 2EIQA 3F0IA 3IHQA 5AISA 1AXDA 1Y25A 4ECCA 4F0CA 1XWBA 1B8XA 4FYUA 2GQKA 1O8XA 4XTSA 1UN2A 5IMVA 2VCVA 2QKEA 1AQXA 1B9YC 1GTIA 2JACA 1SVOA 5EVOA 3WYWA 3QAGA 5IIZA 3M1GA 1GSQA 4O92A 3D21A 1M2BA 2V2GA 2C1YA 2E2MA 2HSHA 2A2RA 3FHKA 1PGTA 2K6VA 5DQSA 1G0TA 2PVQA 3M8NA 5EY6A 2V41A 2X4AA 1JZOA 2H01A 4LL4B 2O5VA 3QPMA 4WF5A 1GTBA 2MMAA 2XPDA 4PTSA 3DKSA 3WT2A 5CYYA 1QGVA 4ZB7A 2CA8A 2CVDA 2VCZA 1FG4A 1RQMA 2G2QA 3LFLA 1OYJA 3VLNA 6GSUA 3G7JA 2GGTA 1YZXA 4N11A 2GZYA 4LL1B 2VL3A 2IMEA 2H66A 2DJ3A 2FD3A 4MZCA 3ZVJD 1SKWB 2I4AA 4MA9A 1K0CA 3ISOA 4XS6A 1DE2A 4ISDA 3IBHA 2PBJA 2FWGA 2RIIA 2PERA 2DJJA 1A8LA 4ECJA 1SL0B 3UVTA 1T00A 4HDEA 3IE3A 3D0ZA 2R0GA 4AJ7A 2PVOC 3L78A 1ERTA 1HYUA 3C71A 3F63A 1PKZA 2ZUPA 4DSSA 5BRTA 4KH7A 2HZEB 1G7OA 2IFQB 17GSA 3IV4A 5J3RA 4KCEA 1HNBA 2H75A 2B5YA 2CVKA 4FIWA 1EV4A 3WGEA 5HFKA 1GNWA 2J9HA 2FUG2 1GTAA 4CY8A 5ABRA 4BL7A 4KCAA 3QDNA 1U3AA 3C7MA 5GAND 3MDKA 5FWGA 1TW9A 5DCGA 3L4NA 1TTZA 2HSYA 5G1LA 4K0GA 1PRXA 4ZL9A 5D93A 3M9JA 2VM2A 4F9ZA 4WKWA 1K0AA 4HI7A 5J5NA 3VI7A 1AQVA 5KOXA 3L9VA 3ZL5A 4BPYA 2H76A 1AC1A 3LG6A 2I1UA 4JE1A 5D8IA 5IPHA 2LV3A 4DVCA 4X1UA 3P2AA 2B1KA 2NDOA 2YWIA 5AGYA 3APSA 5DCHA 3Q6OA 1A23A 5HR3A 3C8EA 2M72A 5J9CA 1YEPA 5G5EA 2G0FA 1SU9A 3FZAA 4ZBBA 1PMTA 2LJKA 2E2GA 2GLRA 1PX6A 4TKYA 2F8FA 5ID2B 3E3EA 5KN0A 1EOHA 1R26A 4BVYA 3VPQA 3TJGA 5ECPB 2HRAA 4J56E 2QC7A 2JSZA 2H6YA 4RUVA 19GSA 1XBSA 1XPVA 4RQXA 2DIZA 1XWKA 5IMDA 3TKSA 4Q5NA 3FR6A 4PQ1A 1QXHA 1TXXA 5HFGA 3ZIJA 1SL2B 2GDRA 3TJBA 5CAXA 3K8NA 2CAQA 4DSQA 1Y1UA 2VD0A 2ZNMA 1SJ6A 4PQHA 1K3OA 1A2LA 1FB6A 1BJXA 2WDUA 3ZZXA 1T7PB 4BWQA 4MPGA 3IXRA 8GSSA 3TJFA 3FZ9A 1BF5A 1GRXA 5A5HB 4K5SA 3LYPA 1URMA 2PUKC 3BCKA 1HD2A 3G7IA 3ZIVA 4EXJA 6GSWA 4BWSA 4TN8A 1WWJA 3ZFLA 3CTGA 2FWFA 4K9ZA 4Q5FA 2M80A 4IP1A 2X64A 1M7TA 3DGQA 2LTKA 4NV2A 4MMMA 5EPFA 2O8VB 2CVBA 3I43A 3UBLA 22GSA 2FCHA 2LEGA 5G2ZA 1XW5A 1JZRA 1OE8A 3P7XA 4N0ZA 3E9JB 2LQQA 3GN3A 2H6ZA 5A4UA 3GKNA 4HZ4A 1FO5A 1K0OA 1EP7A 3DRNA 3LXZA 4E68A 2RUFA 4KUNA 3EWLA 4ECBA 2O89A 3EINA 4JR6A 2CX4A 2RUEA 5ECLB 2C3QA 2HT9A 2YJHA 4D73A 4EIQA 2D2ZA 2LQOA 2FA8A 6GSSA 4QQ7A 1GP1A 1TDIA 3ZLPA 3GMFA 2IPAA 1WOUA 4MABA 4TXVA 1EGOA 1PN0A 3GSSA 1WPIA 2GZZA 2NTOA 1JZDA 2FWHA 3C1SA 5HR1A 2KP1A 2B6MA 1GSYA 5C00A 4K2DA 4EDZA 4IJIA 1H4OA 3VK9A 3D5JA 4Z2UA 3HKRA 1OC9A 3EU3A 2H72A 5D9WA 4HZ2A 4FYCA 4TR4A 1SL1B 5D73A 3MNGA 1XFLA 4IHUA 2R2JA 2VAFA 4TXOA 4RI6A 2R0CA 4HEA2 3TKSC 2B7JA 1NW2A 3IK7A 4ZL7A 1M2DA 4X43A 4TVEA 3FKFA 5B7CA 4NHZA 4MJEA 5CO3A 1NSWA 1LU4A 3UL3A 1PSQA 3EE2A 2VIMA 4J2FA 3VWWA 4G2EA 2ON7A 4NV5A 2TRCP 3RBTA 4JR4A 1FOHA 2CAIA 5HFIA 2VL2A 9GSSA 1GL8A 2C4JA 1N8JA 4BVXB 3I69A 2PGTA 4XIHA 1IYHA 1BYEA 1PQNA 1XWGA 4GDFA 3OR5A 1XWCA 2KHPA 4I5QA 3M0FA 18GSA 1FAAA 2BTOT 3KP9A 2I9HA 4GTUA 2H71A 2GSTA 1R7HA 4JZQA 3MWHA 4I8BA 2RM6A 2TIRA 1VGLA 3GYKA 1C72A 2YN1A 2HNLA 1T1VA 3IRAA 2DBCA 2GSQA 3R3EA 2VKZG 4IJ3A 2HSMA 6GSVA 1M9BA 1PL1A 2B5EA 4CW9A 3WT1A 5GSTA 2WB9A 4KDUA 2GZPA 2LS5A 5C04A 4IN0A 3ZFBA 5DDLA 5IM9A 2EFEA 3O3TA 3CBUA 3IOSA 1GUHA 2HRFA 2OBIA 4FQUA 3CTFA 3HJPA 1K3YA 2V6OA 2OACA 2IN3A 3O6TA 1ZCPA 3CSJA 4MPFA 3BJ5A 1YQ1A 2HQTA 2EFDA 2MMNA 5A5KA 5JWOB 1GNEA 1GSSA 2L6DA 3PPUA 4TRXA 3CRTA 4KE3A 1YVLA 4AKXB 4N30A 2M46A 2R4VA 5JCUA 4G0LA 4OFTA 2O7KA 2NPBA 3ZRDA 2AUVA 4WBJA 1X9WB 4PUAA 2VCTA 4OO4A 5BMUA 1YDKA 1PL2A 3LXTA 4KAEA 1MD3A 4N10A 4K5RA 4YAVA 3DWVA 1Z7RA 3HMJG 1HNCA 1EOGA 2FWEA 3SBCA 3PR8A 2GT6A 2H74A 1O73A 2XPEA 4KGIA 1QFNA 4QMKA 3EPTA 2VCQA 2CV4A 4AJ8A 5IOXA 4NXIA 4MH2A 4OO5A 1YJ6A 4ML6A 2F8AA 4G19A 2H1DA 3DYRA 3H8QA 6GSYA 4NHWA 3TKRA 4ZBAA 4CDOA 1BAYA 1ZZYA 4NAXA 1O8WA 1VF2A 2A4HA 3KCMA 2JADA 2ALBA 4E8EA 1GWCA 4O7HA 3WGDA 3GKKA 1YF1A 4FH8A 4MDCA 2IMKA 5FT3A 2XC2A 2EC4A 1TK0B 2VL2C 1ERWA 5E4WA 1UA5A 2C0GA 5H5QA 4MF5A 4L0UA 3QCPA 4F0BA 1U3IA 1GSFA 1FHEA 1DBYA 1F3AA 4K0NA 2HSNA 3SWLA 3KTBA 4KF9A 3F4TA 3DMLA 4AI6A 3KH7A 3N5OA 11GSA 3PGTA 4NPBA 2R6KA 1KNGA 4AGSA 5IMZA 3UEMA 1PKWA 4KDXA 14GSA 3RDWA 1TKDB 4ID0A 2I3YA 2QGVA 1K0DA 4MNNA 4DEJA 4DSRA 2B3SA 2FHEA 1J0FA 5IO2A 4HQZA 1TJDA 2IWTA 2WRTA 3QD9A 3TRPA 4WETA 3EURA 4NWYA 1GSEA 5DJLA 4YQVA 1TU7A 4KX4A 10GSA 4Z2TA 2MMZA 1XVWA 3TOUA 3NZNA 4IBPA 3LSZA 2HRKA 1U6TA 2O85A 3EVIA 4DSSB 1I9DA 2XHFA 3ED3A 13GSA 3ME7A 3GH9A 2X8GA 3GL3A 5F05A 1N25A 4Q5QA 5IQYA 3UVHA 1SENA 4IQ1A 2MZCA 2R3XA 1MTCA 4MH3A 4HU7A 1S3CA 4MZWA 3KMOA 4IQAA 5CRHA 4BL7B 1GULA 3G7YA 4OCFA 1XOAA 1XOBA 4RI7A 1EV9A 2YJ7A 2YP6A 5E59A 1X0RA 3IDVA 3HVXA 4MCUA 2YV7A 1THXA 3GSTA 2L4QA 3P90A 4HQSA 5DJMA 4FO5A 1XZOA 3D6IA 2CQ9A 1Q98A 2NBSA 1M0UA 1TXUA 2H73A 2C0DA 4V2MA 2LJAA 2R5GA 2IJYA 3GA4A 2CZ3A 1F6MC 4GSTA 1QQ2A 3Q19A 2K9FA 3LYKA 1XWAA 5CRGA 4PQIA 1Z9HA 2L5OA 1Q4JA 4KB3A 4TW5A 4L5OA 2WFCA 1KEBA 5ELGA 4HS1A 1ZYEA 5J40A 4O32A 4BVYB 1QUWA 1SYXA 2K8SA 4PGTA 2EIOA 3FZ5A 2DJ1A 2FNOA 1AUCA 4F82A 2GSRA 5FHIA 3CSIA 1W89A 3A2VA 4ULXA 3ZYWA 3FW2A 4LMVA 1ERUA 2RLIA 20GSA 1PN9A 5ECHB 3TOTA 2XBQA 2VCXA 2HRNA 1MDJA 3ZMLA 4KNDA 5CP1A 2ON5A 2H0IA 2HYXA 2H8LA 3GIXA 4NMUA 1ZOFA 2YPMA 2F3MA 2X99A 3H1NA 1AQWA 3F8UA 3HYPA 3TJJA 1LBKA 4AKIA 2I81A 4YH2A 1A8YA 5J9BA 2PU9C 2PMTA 3HJMA 5ELAA 1M9AA 3ERFA 4IELA 3TB2A 1DE1A 1W4VA 1JZWA 4POMA 2LRCA 4O5QA 1FVKA 1R5AA 1GUKA 1SKRB 3EYTA 7GSSA 2N5BA 1Y6EA 3D4TA 4HJMA 3GV1A 3BOAA 1DSBA 2WS2A 2C80A 3S9FA 1A0FA 5AIXA 5JCWA 1M2AA 5DAKA 5B6MA 4V1Ap 2E7PA 3GRXA 3QR6A 5HR2A 5G5FA 1X5CA 1GLPA 5J4YA 3HDCA 2RM5A 3HVVA 3KH9A 3ME8A 1B4QA 3TKQA 4YKGA 3ZITA 4EUYA 2X8HA 4IP6A 3P8WA 1VF3A 3GX0A 3TRQA 5A34A 5A4VA 1YKAA 4LA1A 1K0MA 1CQGA 4ACSA 2YWOA 1Z5YE 3KJYA 2UV8G 2C0EA 3Q74A 4PXOA 2WCIA 1S3AA 3GKMA 3DVWA 3J7Yk 2L6CA 4G10A 3CMIA 2C3TA 4X0XA 5ECRB 2V32A 5A4WA 4D73B 1OE7A 3GKXA 2OE3A 4XHMA 1OC8A 3VFIA 1E2YA 1NHOA 3A2WA 2PN8A 2NVLA 3TDGA 2LJRA 4ZBDA 1OKDA 3EMXA 1R5PA 2JSYA 2X8CA 4HOJA 5D9TA 1JFUA 1X9MB 3HZ8A 4ILFA 2VM1A 3F3RA 1OKTA 3APOA 4EIPA 3ZMKA 1SK2A 1THOA 4IVFA 5DALA 4EDYA 4V2LA 1OC9B 3MAKA 4I97A 3GFKA 5JWRB 2AJQB 3LJRA 2LKUA 4YAPA 5COHA 2JZTA 4MZBA 3HXSA 1A24A 1ILOA 4TXOB 5LCZA 4G0IA 5CNWA 2VOCA 3UMAA 3GUSA 4AF2A 2FLSA 1IYIA 4L8EA 5B8BA 1GUMA 3L9SA 2QA1A 4GQCA 12GSA 2WULA 3ERGA 4G9HA 1A2MA 2JZSA 1YKCA 5HQPA 5A1NA 4H86A 3FEUA 4I6XA 1XXUA 3KP8A 3PH9A 1VF4A 2P5RA 4Z7XA 1K0BA 4XS4A 3WD6A 2MBTA 3TUEA 3GH6A 1WIKA 3PINA 1EZKA 5B8AA 1T4ZA 5L71A 2P31A 4JU5A 5KOWA 6GSXA 4GQFA 1YF0A 2N5AA 4CHSA 1TRWA 2IL3A 1BX9A 1TRUA 3TRXA 2A2PA 1FVJA 4WR5A 1U88A 2A4VA 3GTUA 2O87A 2HE3A 2HSMB 2AV4A 2WGRA 1OVNA 4EO3A 2XBIA 1JLVA 2K8VA 3H4KA 2J23A 1BG5A 1B48A 4AKHA 4AKGA 4GWRA 1V58A 5JWQB 2LNTA 2LNSA 1V2AA 5CRWA 2REMA 2CZ2A 4F03A 2AB6A 2YOIA 5JCGA 1ZYPA 1PX7A 1BEDA 2L57A 4TR1A 3GX8A 2H1BA 3ERWA 1G6YA 3TGZA 3V1WA 2MMOA 2HFDA 3FR3A 5IOWA 2C0FA 1SK0A 5IMAA 16GSA 2IMFA 4OFMA 3BD2A 2YNXA 5ECKB 1B4PA 1MDKA 5LNKe 4L5LA 1SYRA 4OCEA 2OT3A 2F9SA 5BMUB 3UIWA 4ML1A 4IGJA 2AAWA 1ABAA 2H19A 1RW1A 5AN1A 2QSIA 1XW9A 2GSSA 1T4YA 3TCOA 1ST9A 2DJ2A 2VLTA 5KN3A 3F3QA 4JRRA 5ENUA 5G30A 3IK9A 1PA3A 2DSAA 1JLWA 5J4VA 1GLQA 4KSMA 5GZZB 1FB0A 3J7Yb 1J9BA 2YWMA 1SKSB 2K18A 3KXOA 3FY7A 1J08A 4EL1A 2CT6A 3HY2A 1ACVA 5F0GA 3I6AA 3W8JA 5KN2A 3DEXA 3DXBA 2YANA 2P0GA 3F6FA 5LD0A 4ZILA 3A5IA 4F2IA 1T3BA 3LGCA 2L4CA 2FY6A 1FW1A 2DLXA 1SD9A 1V98A 2FGXA 4V1Ag 1A2JA 3VWUA 2DKIA 2OKAA 4GLTA 2EFCA 1BG1A 3CWGA 4N3ZA 3IHGA 4AJ6A 1M99A 4ZIJA 3HZ4A 1SJZA 3LEFA 5DBQA 3CRUA 2HSNB 2VCWA 4ZB6A 1TRVA 3LORA 2H1AA 3QFBC 2DKHA 5CREA 1DUGA 1HQOA 3H79A 5DQYA 2LUSA 4PX1A 5IO0A 1EP8A 4O5UA 2DC5A 2AYTA 4TR3A 4XS1A 1SVLA 3G9BA 2BJXA 3RPNA 1O7UA 2FA4A 1NM3A 4A5PA 3QAVA 3ZTLA 1TK8B 3HA9A 1MEKA 1ZYQB 2OJLA 4K2XA 5DVBA 3W6GA 1SJIA 3DD3A 1XIYA 2P5QA 3U5RE 3QAWA 3GL5A 3IAM2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJB A;  2CX3 A;  3ZVJ A;  2HZE A;  2IFQ A;  1E6B A;  4WR4 A;  2DML A;  3JCM L;  4QL7 A;  1Z3E A;  3HVS A;  2HRK B;  2VLU A;  1XCC A;  1F3B A;  1GTU A;  1YEX A;  4ZL8 A;  1OC3 A;  3FK8 A;  2C3N A;  1SD8 A;  2L59 A;  4I2U A;  4MF7 A;  4ECI A;  2MBS A;  3L9U A;  3VWV A;  5KEJ A;  4EC0 A;  3NIV A;  2PPT A;  1TU8 A;  3Q18 A;  5D9X A;  1WP0 A;  4KSO A;  2KP2 A;  4J57 E;  3F6D A;  3F4R A;  3UAP A;  3FR9 A;  1Z7P A;  2JZR A;  4WXT A;  3QMX A;  2HLS A;  2E0Q A;  3A2X A;  5D9V A;  2H30 A;  2YWN A;  4K8M A;  3U6V A;  2GS3 A;  3A3T A;  2ES7 A;  1EEJ A;  4OFN A;  3RHB A;  2V6K A;  2R37 A;  4KA0 A;  3KZQ A;  3NOF A;  3N9J A;  3BCI A;  2DJK A;  4FYB A;  3IAS 2;  2YZH A;  3UJ1 A;  1VF1 A;  4EF0 A;  1TI3 A;  1X9S B;  2AHE A;  1AIU A;  1BQ7 A;  2ZCT A;  1MDI A;  4WEY A;  4JBB A;  3O76 A;  3M9K A;  5INY A;  3KM6 A;  5GAP D;  4LMW A;  3US3 A;  3ZRE A;  4POL A;  3F4S A;  3RPP A;  1USB A;  3IC8 A;  2VD1 A;  4HU9 A;  5ID2 A;  4GF0 A;  3RAZ A;  4QL9 A;  2OE1 A;  3UBK A;  4K1F A;  5H5S A;  1X5E A;  1R4W A;  5ECO B;  2PWJ A;  2YCD A;  1TK5 B;  3MSZ A;  2VLV A;  2YV9 A;  3KGK A;  3EMP A;  1EGR A;  1SK1 A;  4EVM A;  4Q5R A;  1N2A A;  5ECM B;  3GNJ A;  3L0H A;  1FOV A;  1WRY A;  2H70 A;  2GT5 A;  1AW9 A;  3LQ7 A;  4PNG A;  1ON4 A;  1ML6 A;  5IMF A;  4K6X A;  4K7N A;  3HJO A;  3M3M A;  1I5G A;  3UAR A;  1AAZ A;  2GQM A;  3F9U A;  4K7I A;  2GTU A;  3AY8 A;  2B1L A;  3A5W A;  1GSU A;  4V2N A;  3HHV A;  1A0R P;  5ECN B;  3CXG A;  1V9W A;  1UC7 A;  5IMC A;  2DMM A;  4I2T A;  1F37 A;  2JL4 A;  4HUA A;  4L0W A;  1XVQ A;  4P3Y B;  3IPZ A;  3KEB A;  3C1R A;  4K7O A;  2VL9 A;  5DAK B;  1QMV A;  4N0V A;  1H75 A;  3EC3 A;  2DJ0 A;  5KN1 A;  2Z9S A;  2BMX A;  4USS A;  1CQH A;  4KW6 A;  2OE0 A;  2MYG A;  1GSD A;  6GST A;  1Z6M A;  1B9X C;  4GSN A;  1WJK A;  5G1K A;  2H1G A;  2HI7 A;  1LJR A;  4TOP A;  3QFA C;  4IS0 A;  4EKZ A;  4IW9 A;  3QOU A;  3UOM A;  1O85 A;  1K3L A;  4WBR D;  3E0U A;  4WF4 A;  1WMJ A;  1G6W A;  1KTE A;  2A2S A;  3FZ4 A;  2OA7 A;  3GHA A;  5EL8 A;  3BBY A;  4GSS A;  3VPT A;  4PNF A;  1NHY A;  2LRN A;  5H5R A;  1MD4 A;  3KD0 A;  4MF6 A;  4LLR A;  1TP9 A;  5GSS A;  5F06 A;  5J41 A;  4POK A;  4JED A;  2GVP A;  4PUR A;  4YQU A;  5ECS A;  1V40 A;  3FYG A;  1KBN A;  1TRS A;  5F8B A;  4MK3 A;  3FRC A;  4ZB9 A;  1VRS D;  4BA7 A;  4MJA A;  5DAL B;  1O6J A;  1TOF A;  1TI1 A;  1V57 A;  3D22 A;  3EU4 A;  3VI5 A;  1ZMA A;  2B5X A;  1T8E B;  4G0K A;  5HR0 A;  2B7K A;  1RK4 A;  3IR4 A;  2KUC A;  1QK8 A;  5D96 A;  3GUR A;  4OMV A;  4GCI A;  2IIY A;  5ECQ B;  4PUF C;  3VWX A;  1WE0 A;  4E8H A;  2WZ9 A;  1F2E A;  2KOK A;  3H93 A;  1HNA A;  4GRF A;  4BVX A;  4MLY A;  4HJ2 A;  1JHB A;  2EIR A;  2WJU A;  4XS4 B;  2C8U A;  3KTL A;  4MP4 A;  4IKH A;  2YZU A;  4POB A;  3TJK A;  1G7E A;  2JU5 A;  3C73 A;  2UZ8 A;  3KMN A;  3APQ A;  1EEM A;  2H0H A;  4GXZ A;  2IMD A;  2F51 A;  3D4M A;  3RHC A;  3DIE A;  1YY7 A;  3I9V 2;  3CSH A;  3R2Q A;  2LRT A;  3W8S A;  4YQM A;  5F07 A;  5ECI B;  1S3D A;  4TR0 A;  1XW6 A;  2TRX A;  1U87 A;  3VUR A;  5CRD A;  1PD2 1;  5B6N A;  1O81 A;  3IC4 A;  3WGX A;  4O5R A;  4ZXG A;  1UVZ A;  2HXK A;  5G31 A;  3GTU B;  3TKP A;  3LWA A;  2H0G A;  3DVX A;  4XRD A;  2IMI A;  2HZF A;  4KDY A;  1Z6N A;  4RQR A;  3CYN A;  4OD7 A;  1F9M A;  5J4U A;  5AIV A;  2VUP A;  2N5F A;  3TKS E;  1EWX A;  1OAZ A;  3KIJ A;  2V1M A;  1ZGN A;  4EE0 A;  2GQL A;  1ERV A;  4MJC A;  2L5L A;  4TR1 B;  2DIY A;  4XCS A;  2LST A;  1ZL9 A;  2OBK A;  3HD5 A;  2KLX A;  4OWY A;  3HCZ A;  1X5D A;  2H6X A;  5IPG A;  2OAD A;  4XRA A;  1GH2 A;  2VO4 A;  4ZB8 A;  3IA1 A;  1K0N A;  2EIQ A;  3F0I A;  3IHQ A;  5AIS A;  1AXD A;  1Y25 A;  4ECC A;  4F0C A;  1XWB A;  1B8X A;  4FYU A;  2GQK A;  1O8X A;  4XTS A;  1UN2 A;  5IMV A;  2VCV A;  2QKE A;  1AQX A;  1B9Y C;  1GTI A;  2JAC A;  5EVO A;  3WYW A;  3QAG A;  5IIZ A;  3M1G A;  1GSQ A;  4O92 A;  3D21 A;  1M2B A;  2V2G A;  2C1Y A;  2E2M A;  2HSH A;  2A2R A;  3FHK A;  1PGT A;  2K6V A;  5DQS A;  1G0T A;  2PVQ A;  3M8N A;  5EY6 A;  2V41 A;  1JZO A;  2H01 A;  4LL4 B;  3QPM A;  4WF5 A;  1GTB A;  2MMA A;  2XPD A;  4PTS A;  3DKS A;  3WT2 A;  5CYY A;  1QGV A;  2CA8 A;  2CVD A;  2VCZ A;  1FG4 A;  1RQM A;  2G2Q A;  3LFL A;  1OYJ A;  3VLN A;  6GSU A;  3G7J A;  2GGT A;  1YZX A;  4N11 A;  2GZY A;  4LL1 B;  2VL3 A;  2IME A;  2H66 A;  2DJ3 A;  2FD3 A;  4MZC A;  3ZVJ D;  1SKW B;  2I4A A;  4MA9 A;  1K0C A;  3ISO A;  4XS6 A;  1DE2 A;  4ISD A;  3IBH A;  2PBJ A;  2FWG A;  2RII A;  2PER A;  2DJJ A;  1A8L A;  4ECJ A;  1SL0 B;  3UVT A;  1T00 A;  4HDE A;  3IE3 A;  3D0Z A;  4AJ7 A;  2PVO C;  3L78 A;  1ERT A;  1HYU A;  3C71 A;  3F63 A;  1PKZ A;  2ZUP A;  4DSS A;  4KH7 A;  2HZE B;  1G7O A;  2IFQ B;  17GS A;  3IV4 A;  5J3R A;  4KCE A;  1HNB A;  2H75 A;  2B5Y A;  2CVK A;  4FIW A;  1EV4 A;  3WGE A;  5HFK A;  1GNW A;  2J9H A;  2FUG 2;  1GTA A;  5ABR A;  4BL7 A;  4KCA A;  3QDN A;  1U3A A;  3C7M A;  5GAN D;  3MDK A;  5FWG A;  1TW9 A;  5DCG A;  3L4N A;  1TTZ A;  2HSY A;  5G1L A;  4K0G A;  1PRX A;  4ZL9 A;  5D93 A;  3M9J A;  2VM2 A;  4F9Z A;  4WKW A;  1K0A A;  4HI7 A;  5J5N A;  3VI7 A;  1AQV A;  3L9V A;  3ZL5 A;  4BPY A;  2H76 A;  1AC1 A;  3LG6 A;  2I1U A;  4JE1 A;  5D8I A;  5IPH A;  2LV3 A;  4DVC A;  4X1U A;  3P2A A;  2B1K A;  2NDO A;  2YWI A;  5AGY A;  3APS A;  5DCH A;  3Q6O A;  1A23 A;  5HR3 A;  3C8E A;  2M72 A;  5J9C A;  1YEP A;  5G5E A;  2G0F A;  1SU9 A;  3FZA A;  4ZBB A;  1PMT A;  2LJK A;  2E2G A;  2GLR A;  1PX6 A;  4TKY A;  2F8F A;  5ID2 B;  3E3E A;  5KN0 A;  1EOH A;  1R26 A;  4BVY A;  3VPQ A;  3TJG A;  5ECP B;  2HRA A;  4J56 E;  2QC7 A;  2JSZ A;  2H6Y A;  4RUV A;  19GS A;  1XBS A;  1XPV A;  4RQX A;  2DIZ A;  1XWK A;  5IMD A;  3TKS A;  4Q5N A;  3FR6 A;  4PQ1 A;  1QXH A;  1TXX A;  5HFG A;  3ZIJ A;  1SL2 B;  2GDR A;  3TJB A;  5CAX A;  3K8N A;  2CAQ A;  4DSQ A;  2VD0 A;  2ZNM A;  1SJ6 A;  4PQH A;  1K3O A;  1A2L A;  1FB6 A;  1BJX A;  2WDU A;  3ZZX A;  1T7P B;  4BWQ A;  4MPG A;  3IXR A;  8GSS A;  3TJF A;  3FZ9 A;  1GRX A;  3LYP A;  1URM A;  2PUK C;  3BCK A;  1HD2 A;  3G7I A;  3ZIV A;  4EXJ A;  6GSW A;  4BWS A;  4TN8 A;  1WWJ A;  3ZFL A;  3CTG A;  2FWF A;  4K9Z A;  4Q5F A;  2M80 A;  4IP1 A;  2X64 A;  1M7T A;  3DGQ A;  2LTK A;  4NV2 A;  4MMM A;  5EPF A;  2O8V B;  2CVB A;  3I43 A;  3UBL A;  22GS A;  2FCH A;  2LEG A;  5G2Z A;  1XW5 A;  1JZR A;  1OE8 A;  3P7X A;  4N0Z A;  3E9J B;  2LQQ A;  3GN3 A;  2H6Z A;  5A4U A;  3GKN A;  4HZ4 A;  1FO5 A;  1K0O A;  1EP7 A;  3DRN A;  3LXZ A;  2RUF A;  4KUN A;  3EWL A;  4ECB A;  2O89 A;  3EIN A;  4JR6 A;  2CX4 A;  2RUE A;  5ECL B;  2C3Q A;  2HT9 A;  2YJH A;  4D73 A;  2D2Z A;  2LQO A;  2FA8 A;  6GSS A;  4QQ7 A;  1GP1 A;  1TDI A;  3ZLP A;  3GMF A;  2IPA A;  1WOU A;  4MAB A;  4TXV A;  1EGO A;  3GSS A;  1WPI A;  2GZZ A;  2NTO A;  1JZD A;  2FWH A;  3C1S A;  5HR1 A;  2KP1 A;  2B6M A;  1GSY A;  5C00 A;  4K2D A;  4EDZ A;  4IJI A;  1H4O A;  3VK9 A;  3D5J A;  3HKR A;  1OC9 A;  3EU3 A;  2H72 A;  5D9W A;  4HZ2 A;  4FYC A;  4TR4 A;  1SL1 B;  5D73 A;  3MNG A;  1XFL A;  4IHU A;  2R2J A;  2VAF A;  4TXO A;  4RI6 A;  4HEA 2;  3TKS C;  2B7J A;  1NW2 A;  3IK7 A;  4ZL7 A;  1M2D A;  4X43 A;  4TVE A;  3FKF A;  5B7C A;  4NHZ A;  4MJE A;  5CO3 A;  1NSW A;  1LU4 A;  3UL3 A;  1PSQ A;  3EE2 A;  2VIM A;  4J2F A;  3VWW A;  4G2E A;  2ON7 A;  4NV5 A;  2TRC P;  3RBT A;  4JR4 A;  2CAI A;  5HFI A;  2VL2 A;  9GSS A;  1GL8 A;  2C4J A;  1N8J A;  4BVX B;  3I69 A;  2PGT A;  4XIH A;  1IYH A;  1BYE A;  1PQN A;  1XWG A;  3OR5 A;  1XWC A;  2KHP A;  4I5Q A;  3M0F A;  18GS A;  1FAA A;  2BTO T;  3KP9 A;  2I9H A;  4GTU A;  2H71 A;  2GST A;  1R7H A;  4JZQ A;  3MWH A;  4I8B A;  2RM6 A;  2TIR A;  1VGL A;  3GYK A;  1C72 A;  2YN1 A;  2HNL A;  1T1V A;  3IRA A;  2DBC A;  2GSQ A;  3R3E A;  4IJ3 A;  2HSM A;  6GSV A;  1M9B A;  1PL1 A;  2B5E A;  4CW9 A;  3WT1 A;  5GST A;  2WB9 A;  4KDU A;  2GZP A;  2LS5 A;  5C04 A;  4IN0 A;  3ZFB A;  5DDL A;  5IM9 A;  3O3T A;  3CBU A;  3IOS A;  1GUH A;  2HRF A;  2OBI A;  4FQU A;  3CTF A;  3HJP A;  1K3Y A;  2V6O A;  2OAC A;  2IN3 A;  3O6T A;  1ZCP A;  3CSJ A;  4MPF A;  3BJ5 A;  1YQ1 A;  2HQT A;  2MMN A;  5A5K A;  5JWO B;  1GNE A;  1GSS A;  2L6D A;  3PPU A;  4TRX A;  3CRT A;  4KE3 A;  4N30 A;  2M46 A;  2R4V A;  5JCU A;  4G0L A;  4OFT A;  2O7K A;  2NPB A;  3ZRD A;  2AUV A;  4WBJ A;  1X9W B;  4PUA A;  2VCT A;  4OO4 A;  5BMU A;  1YDK A;  1PL2 A;  3LXT A;  4KAE A;  1MD3 A;  4N10 A;  4YAV A;  3DWV A;  1Z7R A;  1HNC A;  1EOG A;  2FWE A;  3SBC A;  3PR8 A;  2GT6 A;  2H74 A;  1O73 A;  2XPE A;  4KGI A;  1QFN A;  2VCQ A;  2CV4 A;  4AJ8 A;  5IOX A;  4NXI A;  4MH2 A;  4OO5 A;  1YJ6 A;  4ML6 A;  2F8A A;  4G19 A;  2H1D A;  3DYR A;  3H8Q A;  6GSY A;  4NHW A;  3TKR A;  4ZBA A;  4CDO A;  1BAY A;  1ZZY A;  4NAX A;  1O8W A;  1VF2 A;  3KCM A;  2JAD A;  2ALB A;  4E8E A;  1GWC A;  4O7H A;  3WGD A;  3GKK A;  1YF1 A;  4FH8 A;  4MDC A;  2IMK A;  5FT3 A;  2XC2 A;  2EC4 A;  1TK0 B;  2VL2 C;  1ERW A;  5E4W A;  1UA5 A;  2C0G A;  5H5Q A;  4MF5 A;  4L0U A;  3QCP A;  4F0B A;  1U3I A;  1GSF A;  1FHE A;  1DBY A;  1F3A A;  4K0N A;  3KTB A;  3SWL A;  4KF9 A;  3F4T A;  3DML A;  3KH7 A;  3N5O A;  11GS A;  3PGT A;  4NPB A;  2R6K A;  1KNG A;  4AGS A;  5IMZ A;  3UEM A;  1PKW A;  4KDX A;  14GS A;  3RDW A;  1TKD B;  4ID0 A;  2I3Y A;  2QGV A;  1K0D A;  4DSR A;  4DEJ A;  2B3S A;  2FHE A;  1J0F A;  5IO2 A;  4HQZ A;  1TJD A;  2IWT A;  2WRT A;  3QD9 A;  3TRP A;  4WET A;  3EUR A;  4NWY A;  1GSE A;  5DJL A;  4YQV A;  1TU7 A;  4KX4 A;  10GS A;  2MMZ A;  1XVW A;  3TOU A;  3NZN A;  4IBP A;  3LSZ A;  2HRK A;  1U6T A;  2O85 A;  3EVI A;  4DSS B;  1I9D A;  2XHF A;  3ED3 A;  13GS A;  3ME7 A;  3GH9 A;  2X8G A;  3GL3 A;  5F05 A;  4Q5Q A;  5IQY A;  3UVH A;  1SEN A;  4IQ1 A;  2MZC A;  2R3X A;  1MTC A;  4MH3 A;  4HU7 A;  1S3C A;  4MZW A;  3KMO A;  4IQA A;  5CRH A;  4BL7 B;  1GUL A;  3G7Y A;  4OCF A;  1XOA A;  1XOB A;  4RI7 A;  1EV9 A;  2YJ7 A;  2YP6 A;  5E59 A;  1X0R A;  3IDV A;  3HVX A;  4MCU A;  2YV7 A;  1THX A;  3GST A;  2L4Q A;  3P90 A;  4HQS A;  5DJM A;  4FO5 A;  1XZO A;  3D6I A;  2CQ9 A;  1Q98 A;  2NBS A;  1M0U A;  2H73 A;  2C0D A;  4V2M A;  2LJA A;  2R5G A;  2IJY A;  3GA4 A;  2CZ3 A;  1F6M C;  4GST A;  1QQ2 A;  3Q19 A;  2K9F A;  3LYK A;  1XWA A;  5CRG A;  4PQI A;  1Z9H A;  2L5O A;  1Q4J A;  4KB3 A;  4TW5 A;  4L5O A;  2WFC A;  1KEB A;  5ELG A;  4HS1 A;  1ZYE A;  4O32 A;  4BVY B;  1QUW A;  1SYX A;  2K8S A;  4PGT A;  2EIO A;  3FZ5 A;  2DJ1 A;  2FNO A;  1AUC A;  4F82 A;  2GSR A;  5FHI A;  3CSI A;  1W89 A;  3A2V A;  4ULX A;  3ZYW A;  3FW2 A;  4LMV A;  1ERU A;  2RLI A;  20GS A;  1PN9 A;  5ECH B;  3TOT A;  2XBQ A;  2VCX A;  2HRN A;  1MDJ A;  3ZML A;  4KND A;  5CP1 A;  2ON5 A;  2H0I A;  2HYX A;  2H8L A;  3GIX A;  4NMU A;  1ZOF A;  2YPM A;  2F3M A;  2X99 A;  3H1N A;  1AQW A;  3F8U A;  3HYP A;  3TJJ A;  1LBK A;  2I81 A;  4YH2 A;  1A8Y A;  5J9B A;  2PU9 C;  2PMT A;  3HJM A;  5ELA A;  1M9A A;  3ERF A;  4IEL A;  3TB2 A;  1DE1 A;  1W4V A;  1JZW A;  4POM A;  2LRC A;  1FVK A;  1R5A A;  1GUK A;  1SKR B;  3EYT A;  7GSS A;  2N5B A;  1Y6E A;  3D4T A;  4HJM A;  3GV1 A;  3BOA A;  1DSB A;  2WS2 A;  2C80 A;  3S9F A;  1A0F A;  5AIX A;  5JCW A;  1M2A A;  5DAK A;  5B6M A;  4V1A p;  2E7P A;  3GRX A;  3QR6 A;  5HR2 A;  5G5F A;  1X5C A;  1GLP A;  3HDC A;  2RM5 A;  3HVV A;  3KH9 A;  3ME8 A;  1B4Q A;  3TKQ A;  3ZIT A;  4EUY A;  2X8H A;  4IP6 A;  3P8W A;  1VF3 A;  3GX0 A;  3TRQ A;  5A4V A;  1YKA A;  4LA1 A;  1K0M A;  1CQG A;  4ACS A;  2YWO A;  1Z5Y E;  3KJY A;  2C0E A;  3Q74 A;  4PXO A;  2WCI A;  1S3A A;  3GKM A;  3DVW A;  3J7Y k;  2L6C A;  4G10 A;  3CMI A;  2C3T A;  4X0X A;  5ECR B;  2V32 A;  5A4W A;  4D73 B;  1OE7 A;  3GKX A;  2OE3 A;  4XHM A;  1OC8 A;  3VFI A;  1E2Y A;  1NHO A;  3A2W A;  2PN8 A;  2NVL A;  3TDG A;  2LJR A;  4ZBD A;  1OKD A;  3EMX A;  1R5P A;  2JSY A;  2X8C A;  4HOJ A;  5D9T A;  1JFU A;  1X9M B;  3HZ8 A;  4ILF A;  2VM1 A;  3F3R A;  1OKT A;  3APO A;  3ZMK A;  1SK2 A;  1THO A;  4IVF A;  5DAL A;  4EDY A;  4V2L A;  1OC9 B;  3MAK A;  4I97 A;  3GFK A;  5JWR B;  2AJQ B;  3LJR A;  2LKU A;  4YAP A;  5COH A;  2JZT A;  4MZB A;  3HXS A;  1A24 A;  1ILO A;  4TXO B;  5LCZ A;  4G0I A;  5CNW A;  2VOC A;  3UMA A;  3GUS A;  4AF2 A;  2FLS A;  1IYI A;  4L8E A;  5B8B A;  1GUM A;  3L9S A;  4GQC A;  12GS A;  2WUL A;  3ERG A;  4G9H A;  1A2M A;  2JZS A;  1YKC A;  5HQP A;  4H86 A;  3FEU A;  4I6X A;  1XXU A;  3KP8 A;  3PH9 A;  1VF4 A;  2P5R A;  4Z7X A;  1K0B A;  4XS4 A;  3WD6 A;  2MBT A;  3TUE A;  3GH6 A;  1WIK A;  3PIN A;  1EZK A;  5B8A A;  1T4Z A;  5L71 A;  2P31 A;  4JU5 A;  6GSX A;  4GQF A;  1YF0 A;  2N5A A;  4CHS A;  1TRW A;  2IL3 A;  1BX9 A;  1TRU A;  3TRX A;  1FVJ A;  4WR5 A;  1U88 A;  2A4V A;  3GTU A;  2O87 A;  2HE3 A;  2HSM B;  2AV4 A;  2WGR A;  1OVN A;  4EO3 A;  2XBI A;  1JLV A;  2K8V A;  3H4K A;  2J23 A;  1BG5 A;  1B48 A;  4GWR A;  1V58 A;  5JWQ B;  2LNT A;  2LNS A;  1V2A A;  5CRW A;  2REM A;  2CZ2 A;  4F03 A;  2AB6 A;  2YOI A;  5JCG A;  1PX7 A;  1BED A;  2L57 A;  4TR1 A;  3GX8 A;  2H1B A;  3ERW A;  1G6Y A;  3TGZ A;  3V1W A;  2MMO A;  2HFD A;  3FR3 A;  5IOW A;  2C0F A;  1SK0 A;  5IMA A;  16GS A;  2IMF A;  4OFM A;  3BD2 A;  2YNX A;  5ECK B;  1B4P A;  1MDK A;  5LNK e;  4L5L A;  1SYR A;  4OCE A;  2F9S A;  3UIW A;  4ML1 A;  4IGJ A;  2AAW A;  1ABA A;  2H19 A;  1RW1 A;  5AN1 A;  2QSI A;  1XW9 A;  2GSS A;  1T4Y A;  3TCO A;  1ST9 A;  2DJ2 A;  2VLT A;  5KN3 A;  3F3Q A;  4JRR A;  5ENU A;  5G30 A;  3IK9 A;  1PA3 A;  2DSA A;  1JLW A;  1GLQ A;  4KSM A;  5GZZ B;  1FB0 A;  3J7Y b;  1J9B A;  2YWM A;  1SKS B;  2K18 A;  3KXO A;  3FY7 A;  1J08 A;  4EL1 A;  2CT6 A;  3HY2 A;  1ACV A;  5F0G A;  3I6A A;  3W8J A;  5KN2 A;  3DEX A;  3DXB A;  2YAN A;  2P0G A;  3F6F A;  5LD0 A;  4ZIL A;  4F2I A;  1T3B A;  3LGC A;  2L4C A;  2FY6 A;  1FW1 A;  2DLX A;  1SD9 A;  1V98 A;  2FGX A;  4V1A g;  1A2J A;  3VWU A;  2OKA A;  4GLT A;  4AJ6 A;  1M99 A;  4ZIJ A;  3HZ4 A;  1SJZ A;  3LEF A;  5DBQ A;  3CRU A;  2HSN B;  2VCW A;  4ZB6 A;  1TRV A;  3LOR A;  2H1A A;  3QFB C;  5CRE A;  1DUG A;  1HQO A;  3H79 A;  5DQY A;  2LUS A;  4PX1 A;  5IO0 A;  1EP8 A;  2DC5 A;  2AYT A;  4TR3 A;  4XS1 A;  3G9B A;  2BJX A;  3RPN A;  1O7U A;  2FA4 A;  1NM3 A;  3QAV A;  3ZTL A;  1TK8 B;  3HA9 A;  1MEK A;  1ZYQ B;  2OJL A;  5DVB A;  3W6G A;  1SJI A;  3DD3 A;  1XIY A;  2P5Q A;  3U5R E;  3QAW A;  3GL5 A;  3IAM 2; 
#chains in the Genus database with same CATH topology
 4MJB A;  2CX3 A;  3ZVJ A;  2HZE A;  2IFQ A;  1E6B A;  4WR4 A;  2DML A;  3JCM L;  4QL7 A;  1Z3E A;  3HVS A;  2HRK B;  1SVM A;  2VLU A;  1XCC A;  1F3B A;  1GTU A;  1YEX A;  4ZL8 A;  1OC3 A;  3FK8 A;  2C3N A;  1SD8 A;  2L59 A;  4I2U A;  4MF7 A;  4ECI A;  2MBS A;  4CY6 A;  3L9U A;  3VWV A;  5KEJ A;  4EC0 A;  3NIV A;  2PPT A;  1TU8 A;  3Q18 A;  5D9X A;  1WP0 A;  4KSO A;  2KP2 A;  4J57 E;  3F6D A;  2H1L A;  3F4R A;  3UAP A;  3FR9 A;  1Z7P A;  2JZR A;  4WXT A;  3QMX A;  2HLS A;  2E0Q A;  3A2X A;  5D9V A;  2H30 A;  2YWN A;  4K8M A;  3U6V A;  2GS3 A;  3A3T A;  2ES7 A;  1EEJ A;  4OFN A;  3RHB A;  2V6K A;  2R37 A;  4KA0 A;  3KZQ A;  3NOF A;  3N9J A;  3BCI A;  2WVX A;  2DJK A;  4FYB A;  3IAS 2;  2YZH A;  3UJ1 A;  3FMW A;  1VF1 A;  4EF0 A;  1TI3 A;  1X9S B;  2AHE A;  1AIU A;  1BQ7 A;  2ZCT A;  1MDI A;  4WEY A;  4JBB A;  3O76 A;  3M9K A;  5INY A;  3KM6 A;  5GAP D;  4LMW A;  3US3 A;  3ZRE A;  4POL A;  3F4S A;  3RPP A;  4G01 A;  2EFH A;  1USB A;  3IC8 A;  2VD1 A;  4HU9 A;  5ID2 A;  4GF0 A;  4W66 A;  3RAZ A;  4BIK A;  4QL9 A;  2OE1 A;  3UBK A;  4K1F A;  5H5S A;  1X5E A;  1R4W A;  5ECO B;  2PWJ A;  2YCD A;  1TK5 B;  3MIX A;  3MSZ A;  2VLV A;  2YV9 A;  3KGK A;  3EMP A;  5J47 A;  1EGR A;  1SK1 A;  4EVM A;  4Q5R A;  1N2A A;  5ECM B;  3GNJ A;  3L0H A;  1FOV A;  1WRY A;  2H70 A;  2GT5 A;  1AW9 A;  3LQ7 A;  4PNG A;  4PI0 C;  1ON4 A;  1ML6 A;  5IMF A;  4K6X A;  4K7N A;  3HJO A;  3M3M A;  1I5G A;  3UAR A;  1AAZ A;  5A5H A;  2GQM A;  3F9U A;  4K7I A;  2GTU A;  3AY8 A;  2B1L A;  3A5W A;  1GSU A;  4V2N A;  3HHV A;  1A0R P;  5ECN B;  1S4B P;  3CXG A;  1V9W A;  1UC7 A;  5IMC A;  2DMM A;  4I2T A;  4X4J A;  1F37 A;  2JL4 A;  4HUA A;  4L0W A;  1XVQ A;  4P3Y B;  3IPZ A;  3KEB A;  3C1R A;  4K7O A;  2VL9 A;  5DAK B;  1QMV A;  4N0V A;  1H75 A;  3EC3 A;  3MYD A;  2DJ0 A;  5KN1 A;  2Z9S A;  2BMX A;  4USS A;  1CQH A;  4KW6 A;  2OE0 A;  2MYG A;  1GSD A;  6GST A;  1Z6M A;  1B9X C;  4GSN A;  1WJK A;  5G1K A;  5A34 B;  2H1G A;  2WZS A;  2HI7 A;  1LJR A;  4TOP A;  3QFA C;  4IS0 A;  4EKZ A;  4IW9 A;  3QOU A;  3UOM A;  1O85 A;  1K3L A;  3TU3 B;  4WBR D;  3E0U A;  4WF4 A;  1WMJ A;  1G6W A;  1I1I P;  1KTE A;  2A2S A;  3FZ4 A;  2OA7 A;  3GHA A;  5EL8 A;  3BBY A;  4GSS A;  3VPT A;  4PNF A;  1NHY A;  2LRN A;  5H5R A;  3LW9 A;  1MD4 A;  4Z2R A;  3KD0 A;  4MF6 A;  4LLR A;  1TP9 A;  5GSS A;  5F06 A;  5J41 A;  4POK A;  4JED A;  2GVP A;  4PUR A;  2QA2 A;  4YQU A;  5ECS A;  1V40 A;  3FYG A;  1KBN A;  1TRS A;  5F8B A;  4MK3 A;  3FRC A;  4ZB9 A;  1VRS D;  4BA7 A;  4MJA A;  5DAL B;  1O6J A;  1TOF A;  1TI1 A;  1V57 A;  3D22 A;  3EU4 A;  3VI5 A;  1ZMA A;  2B5X A;  1T8E B;  4G0K A;  5HR0 A;  2B7K A;  1RK4 A;  3IR4 A;  2KUC A;  1QK8 A;  5D96 A;  3GUR A;  4OMV A;  4GCI A;  2IIY A;  5ECQ B;  4PUF C;  3VWX A;  1WE0 A;  4E8H A;  2WZ9 A;  5A1N B;  1F2E A;  2KOK A;  3H93 A;  1HNA A;  4GRF A;  4BVX A;  4MLY A;  4HJ2 A;  1JHB A;  2EIR A;  2WJU A;  4XS4 B;  2C8U A;  3KTL A;  4MP4 A;  4IKH A;  2YZU A;  4POB A;  3TJK A;  1G7E A;  2JU5 A;  3C73 A;  2UZ8 A;  4ICY A;  3KMN A;  3APQ A;  1EEM A;  2H0H A;  4GXZ A;  2IMD A;  2F51 A;  3D4M A;  3RHC A;  1XG8 A;  1ZYN A;  3DIE A;  1YY7 A;  3I9V 2;  3CSH A;  3R2Q A;  2LRT A;  3W8S A;  4YQM A;  5F07 A;  5ECI B;  1S3D A;  4TR0 A;  1XW6 A;  2TRX A;  1U87 A;  3VUR A;  5CRD A;  1PD2 1;  5B6N A;  1O81 A;  3IC4 A;  3WGX A;  4O5R A;  4ZXG A;  1UVZ A;  2HXK A;  5G31 A;  3GTU B;  3TKP A;  3LWA A;  2H0G A;  3DVX A;  4XRD A;  2IMI A;  2HZF A;  4KDY A;  4YKF A;  1Z6N A;  2X49 A;  4RQR A;  3CYN A;  4OD7 A;  2R0P A;  1F9M A;  5J4U A;  5AIV A;  2VUP A;  2N5F A;  3TKS E;  1EWX A;  1OAZ A;  3KIJ A;  2V1M A;  1ZGN A;  4EE0 A;  2GQL A;  1ERV A;  4MJC A;  2L5L A;  4TR1 B;  2DIY A;  4XCS A;  2LST A;  4PHZ C;  1ZL9 A;  2OBK A;  3HD5 A;  2KLX A;  4OWY A;  3HCZ A;  1X5D A;  2H6X A;  5IPG A;  2OAD A;  4XRA A;  1GH2 A;  2VO4 A;  4ZB8 A;  3IA1 A;  1K0N A;  2EIQ A;  3F0I A;  3IHQ A;  5AIS A;  1AXD A;  1Y25 A;  4ECC A;  4F0C A;  1XWB A;  1B8X A;  4FYU A;  2GQK A;  1O8X A;  4XTS A;  1UN2 A;  5IMV A;  2VCV A;  2QKE A;  1AQX A;  1B9Y C;  1GTI A;  2JAC A;  1SVO A;  5EVO A;  3WYW A;  3QAG A;  5IIZ A;  3M1G A;  1GSQ A;  4O92 A;  3D21 A;  1M2B A;  2V2G A;  2C1Y A;  1M3J A;  2E2M A;  2HSH A;  2A2R A;  3FHK A;  1PGT A;  2K6V A;  5DQS A;  1G0T A;  2PVQ A;  3M8N A;  5EY6 A;  2V41 A;  2X4A A;  1JZO A;  2H01 A;  4LL4 B;  2O5V A;  3QPM A;  4WF5 A;  1GTB A;  2MMA A;  2XPD A;  4PTS A;  3DKS A;  3WT2 A;  5CYY A;  1QGV A;  4ZB7 A;  2CA8 A;  2CVD A;  2VCZ A;  1FG4 A;  1RQM A;  2G2Q A;  3LFL A;  1OYJ A;  3VLN A;  6GSU A;  3G7J A;  2GGT A;  1YZX A;  4N11 A;  2GZY A;  4LL1 B;  2VL3 A;  2IME A;  2H66 A;  2DJ3 A;  2FD3 A;  4MZC A;  3ZVJ D;  1SKW B;  2I4A A;  4MA9 A;  1K0C A;  3ISO A;  4XS6 A;  1DE2 A;  4ISD A;  3IBH A;  2PBJ A;  2FWG A;  2RII A;  2PER A;  2DJJ A;  1A8L A;  4ECJ A;  1SL0 B;  3UVT A;  1T00 A;  4HDE A;  3IE3 A;  3D0Z A;  2R0G A;  4AJ7 A;  2PVO C;  3L78 A;  1ERT A;  1HYU A;  3C71 A;  3F63 A;  1PKZ A;  2ZUP A;  4DSS A;  5BRT A;  4KH7 A;  3RFR C;  2HZE B;  1G7O A;  2IFQ B;  17GS A;  3IV4 A;  5J3R A;  4KCE A;  1HNB A;  2H75 A;  2B5Y A;  2CVK A;  4FIW A;  1EV4 A;  3WGE A;  5HFK A;  1GNW A;  2J9H A;  2FUG 2;  1GTA A;  4CY8 A;  5ABR A;  4BL7 A;  4KCA A;  3QDN A;  1U3A A;  3C7M A;  5GAN D;  3MDK A;  5FWG A;  1TW9 A;  5DCG A;  3L4N A;  1TTZ A;  2O36 A;  2HSY A;  5G1L A;  4K0G A;  1PRX A;  4ZL9 A;  5D93 A;  3M9J A;  2VM2 A;  4F9Z A;  4WKW A;  1K0A A;  4HI7 A;  5J5N A;  3VI7 A;  1AQV A;  5KOX A;  3L9V A;  3ZL5 A;  4BPY A;  2H76 A;  1AC1 A;  3LG6 A;  2I1U A;  4JE1 A;  5D8I A;  5IPH A;  2LV3 A;  4DVC A;  4X1U A;  3P2A A;  2WVX B;  2B1K A;  2O3E A;  2NDO A;  2YWI A;  5AGY A;  3APS A;  5DCH A;  2WVY A;  3Q6O A;  1A23 A;  5HR3 A;  3C8E A;  2M72 A;  5J9C A;  1YEP A;  5G5E A;  2G0F A;  1SU9 A;  3FZA A;  4ZBB A;  1PMT A;  2LJK A;  2E2G A;  2GLR A;  1PX6 A;  4TKY A;  2F8F A;  5ID2 B;  3E3E A;  5KN0 A;  1EOH A;  1R26 A;  4BVY A;  3VPQ A;  3TJG A;  5ECP B;  2HRA A;  4J56 E;  2QC7 A;  2JSZ A;  2H6Y A;  4RUV A;  19GS A;  1XBS A;  1XPV A;  4RQX A;  2DIZ A;  1XWK A;  5IMD A;  3TKS A;  4Q5N A;  3FR6 A;  4PQ1 A;  1QXH A;  1TXX A;  5HFG A;  3ZIJ A;  1SL2 B;  2GDR A;  3TJB A;  5CAX A;  3K8N A;  2CAQ A;  4DSQ A;  1Y1U A;  2VD0 A;  2ZNM A;  1SJ6 A;  4PQH A;  1K3O A;  1A2L A;  1FB6 A;  1BJX A;  2WDU A;  3ZZX A;  1T7P B;  4BWQ A;  4MPG A;  3IXR A;  8GSS A;  3TJF A;  3FZ9 A;  1BF5 A;  1GRX A;  5A5H B;  4K5S A;  3LYP A;  1URM A;  2PUK C;  3BCK A;  1HD2 A;  3G7I A;  3ZIV A;  4EXJ A;  6GSW A;  4BWS A;  4TN8 A;  1WWJ A;  3ZFL A;  3CTG A;  2FWF A;  4K9Z A;  4Q5F A;  2M80 A;  4IP1 A;  2X64 A;  1M7T A;  3DGQ A;  2LTK A;  4NV2 A;  4MMM A;  3RGB C;  5EPF A;  2O8V B;  2CVB A;  3I43 A;  3UBL A;  22GS A;  2FCH A;  2LEG A;  5G2Z A;  1XW5 A;  1JZR A;  1OE8 A;  3P7X A;  4HSC X;  4N0Z A;  3E9J B;  2LQQ A;  3CHX C;  3GN3 A;  2H6Z A;  5A4U A;  3GKN A;  4HZ4 A;  1FO5 A;  1K0O A;  1EP7 A;  3DRN A;  3LXZ A;  4E68 A;  2RUF A;  4KUN A;  3EWL A;  4ECB A;  2O89 A;  3EIN A;  4JR6 A;  2CX4 A;  2RUE A;  5ECL B;  2C3Q A;  2HT9 A;  2YJH A;  4D73 A;  4EIQ A;  2D2Z A;  2LQO A;  2FA8 A;  6GSS A;  4QQ7 A;  1GP1 A;  1TDI A;  3ZLP A;  3GMF A;  2IPA A;  1WOU A;  4MAB A;  4TXV A;  1EGO A;  1PN0 A;  3GSS A;  1WPI A;  2GZZ A;  2NTO A;  1JZD A;  2FWH A;  3C1S A;  5HR1 A;  2KP1 A;  2B6M A;  1GSY A;  5C00 A;  4K2D A;  4EDZ A;  4IJI A;  1H4O A;  3VK9 A;  3D5J A;  4Z2U A;  3HKR A;  1OC9 A;  3EU3 A;  2H72 A;  5D9W A;  4HZ2 A;  4FYC A;  4TR4 A;  1SL1 B;  5D73 A;  3MNG A;  1XFL A;  4IHU A;  2R2J A;  2VAF A;  4TXO A;  4RI6 A;  2R0C A;  4HEA 2;  3TKS C;  2B7J A;  1NW2 A;  3IK7 A;  4ZL7 A;  1M2D A;  4X43 A;  4TVE A;  3FKF A;  5B7C A;  4NHZ A;  4MJE A;  5CO3 A;  1NSW A;  1LU4 A;  3UL3 A;  1PSQ A;  3EE2 A;  2VIM A;  4J2F A;  3VWW A;  4G2E A;  2ON7 A;  4NV5 A;  2TRC P;  3RBT A;  4JR4 A;  1FOH A;  4PI2 C;  2CAI A;  5HFI A;  2VL2 A;  9GSS A;  1GL8 A;  2C4J A;  1N8J A;  4BVX B;  3I69 A;  2PGT A;  4XIH A;  1IYH A;  1BYE A;  1PQN A;  1XWG A;  4GDF A;  3OR5 A;  1XWC A;  2KHP A;  4I5Q A;  3M0F A;  18GS A;  1FAA A;  2BTO T;  1S3R A;  3KP9 A;  2I9H A;  4GTU A;  2H71 A;  2GST A;  1R7H A;  4JZQ A;  3MWH A;  4I8B A;  2RM6 A;  2TIR A;  1VGL A;  3GYK A;  1C72 A;  2YN1 A;  2HNL A;  1T1V A;  3IRA A;  2DBC A;  2GSQ A;  3R3E A;  2VKZ G;  4IJ3 A;  2HSM A;  6GSV A;  1M9B A;  1PL1 A;  2B5E A;  4CW9 A;  3WT1 A;  5GST A;  2WB9 A;  4KDU A;  2GZP A;  2LS5 A;  5C04 A;  4IN0 A;  3ZFB A;  5DDL A;  5IM9 A;  2EFE A;  3O3T A;  3CBU A;  3IOS A;  1GUH A;  2HRF A;  2OBI A;  4FQU A;  3CTF A;  3HJP A;  1K3Y A;  2V6O A;  2OAC A;  2IN3 A;  3O6T A;  1ZCP A;  3CSJ A;  4MPF A;  3BJ5 A;  1YQ1 A;  2HQT A;  2EFD A;  2MMN A;  3HVN A;  5A5K A;  5JWO B;  1GNE A;  1GSS A;  2L6D A;  3PPU A;  4TRX A;  3CRT A;  4KE3 A;  1YVL A;  4AKX B;  4N30 A;  2M46 A;  2R4V A;  5JCU A;  4G0L A;  4OFT A;  2O7K A;  2NPB A;  3ZRD A;  2AUV A;  4WBJ A;  1X9W B;  4PUA A;  2VCT A;  4OO4 A;  5BMU A;  1YDK A;  1PL2 A;  3LXT A;  4KAE A;  1MD3 A;  4N10 A;  4K5R A;  4YAV A;  3DWV A;  1Z7R A;  3HMJ G;  1HNC A;  1EOG A;  2FWE A;  3SBC A;  3PR8 A;  2GT6 A;  2H74 A;  1O73 A;  2XPE A;  4KGI A;  1QFN A;  4QMK A;  3EPT A;  2VCQ A;  2CV4 A;  4AJ8 A;  5IOX A;  4NXI A;  4MH2 A;  4OO5 A;  1YJ6 A;  4ML6 A;  4FXY P;  2F8A A;  4G19 A;  2H1D A;  3DYR A;  3H8Q A;  6GSY A;  4NHW A;  3TKR A;  4ZBA A;  4CDO A;  1BAY A;  1ZZY A;  4NAX A;  1O8W A;  1VF2 A;  2A4H A;  3KCM A;  2JAD A;  2ALB A;  4E8E A;  1GWC A;  4O7H A;  3WGD A;  3GKK A;  1YF1 A;  4FH8 A;  4MDC A;  2IMK A;  5FT3 A;  2XC2 A;  2EC4 A;  1TK0 B;  2VL2 C;  1ERW A;  5E4W A;  1UA5 A;  2C0G A;  5H5Q A;  4MF5 A;  4L0U A;  3QCP A;  4F0B A;  1U3I A;  1GSF A;  1FHE A;  1DBY A;  1F3A A;  4K0N A;  2HSN A;  3SWL A;  3KTB A;  4KF9 A;  3F4T A;  3DML A;  4AI6 A;  3KH7 A;  3N5O A;  11GS A;  3PGT A;  4NPB A;  2R6K A;  1KNG A;  4AGS A;  5IMZ A;  3UEM A;  1PKW A;  4KDX A;  14GS A;  3RDW A;  1TKD B;  4ID0 A;  2I3Y A;  2QGV A;  1K0D A;  4MNN A;  4DEJ A;  4DSR A;  2B3S A;  2FHE A;  1J0F A;  5IO2 A;  4HQZ A;  1TJD A;  2IWT A;  2WRT A;  3QD9 A;  3TRP A;  4WET A;  3EUR A;  4NWY A;  1GSE A;  5DJL A;  4YQV A;  1TU7 A;  4KX4 A;  10GS A;  4Z2T A;  2MMZ A;  1XVW A;  3TOU A;  3NZN A;  4IBP A;  3LSZ A;  2HRK A;  1U6T A;  2O85 A;  3EVI A;  4DSS B;  1I9D A;  2XHF A;  3ED3 A;  13GS A;  3ME7 A;  3GH9 A;  2X8G A;  3GL3 A;  5F05 A;  1N25 A;  4Q5Q A;  5IQY A;  3UVH A;  1SEN A;  4IQ1 A;  2MZC A;  2R3X A;  1MTC A;  4MH3 A;  4HU7 A;  1S3C A;  4MZW A;  3KMO A;  4IQA A;  5CRH A;  4BL7 B;  1GUL A;  3G7Y A;  4OCF A;  1XOA A;  1XOB A;  4RI7 A;  1EV9 A;  2YJ7 A;  2YP6 A;  5E59 A;  1X0R A;  3IDV A;  3HVX A;  4MCU A;  2YV7 A;  1THX A;  3GST A;  2L4Q A;  3P90 A;  4HQS A;  5DJM A;  4FO5 A;  1XZO A;  3D6I A;  2CQ9 A;  1Q98 A;  2NBS A;  1M0U A;  1TXU A;  2H73 A;  2C0D A;  4V2M A;  2LJA A;  2R5G A;  2IJY A;  3GA4 A;  2CZ3 A;  1F6M C;  4GST A;  1QQ2 A;  3Q19 A;  2K9F A;  3LYK A;  1XWA A;  5CRG A;  4PQI A;  2WW3 A;  1Z9H A;  2L5O A;  1Q4J A;  4KB3 A;  4TW5 A;  4L5O A;  2WFC A;  1KEB A;  5ELG A;  4HS1 A;  1ZYE A;  5J40 A;  4O32 A;  4BVY B;  1QUW A;  1SYX A;  2K8S A;  4PGT A;  2EIO A;  1M3I A;  3FZ5 A;  2DJ1 A;  2FNO A;  1AUC A;  4F82 A;  2GSR A;  5FHI A;  3CSI A;  1W89 A;  3A2V A;  4ULX A;  3ZYW A;  3FW2 A;  4LMV A;  1ERU A;  2RLI A;  20GS A;  1PN9 A;  5ECH B;  3TOT A;  2XBQ A;  2VCX A;  2HRN A;  1MDJ A;  3ZML A;  4KND A;  5CP1 A;  2ON5 A;  2H0I A;  2HYX A;  2H8L A;  3GIX A;  4NMU A;  1ZOF A;  2YPM A;  2F3M A;  2X99 A;  3H1N A;  1AQW A;  3F8U A;  3HYP A;  3TJJ A;  1LBK A;  4AKI A;  2I81 A;  4YH2 A;  1A8Y A;  5J9B A;  2PU9 C;  2PMT A;  3HJM A;  5ELA A;  1M9A A;  3ERF A;  4IEL A;  3TB2 A;  1DE1 A;  1W4V A;  1JZW A;  4POM A;  2LRC A;  4O5Q A;  1FVK A;  1R5A A;  1GUK A;  1SKR B;  3EYT A;  7GSS A;  2N5B A;  1Y6E A;  3D4T A;  4HJM A;  3GV1 A;  3BOA A;  1DSB A;  2WS2 A;  2C80 A;  3S9F A;  1A0F A;  5AIX A;  5JCW A;  1M2A A;  5DAK A;  5B6M A;  4V1A p;  2E7P A;  3GRX A;  3QR6 A;  5HR2 A;  5G5F A;  1X5C A;  1GLP A;  5J4Y A;  3HDC A;  2RM5 A;  3HVV A;  3KH9 A;  3ME8 A;  1B4Q A;  3TKQ A;  4YKG A;  3ZIT A;  4EUY A;  2X8H A;  4IP6 A;  3P8W A;  1VF3 A;  3GX0 A;  3TRQ A;  5A34 A;  5A4V A;  1YKA A;  4LA1 A;  1K0M A;  1CQG A;  4ACS A;  2YWO A;  1Z5Y E;  3KJY A;  2UV8 G;  2C0E A;  3Q74 A;  4PXO A;  2WCI A;  1S3A A;  3GKM A;  3DVW A;  3J7Y k;  2L6C A;  4G10 A;  3CMI A;  2C3T A;  4X0X A;  3CQF A;  5ECR B;  2V32 A;  5A4W A;  4D73 B;  1OE7 A;  3GKX A;  2OE3 A;  4XHM A;  1OC8 A;  3VFI A;  1E2Y A;  1NHO A;  1PFO A;  3A2W A;  2PN8 A;  2NVL A;  3TDG A;  2LJR A;  4ZBD A;  1OKD A;  3EMX A;  1R5P A;  2JSY A;  2X8C A;  4HOJ A;  5D9T A;  1JFU A;  1X9M B;  3HZ8 A;  4ILF A;  2VM1 A;  3F3R A;  1OKT A;  3APO A;  1YEW C;  2WW1 A;  3ZMK A;  1SK2 A;  1THO A;  4EIP A;  4IVF A;  5DAL A;  4EDY A;  4V2L A;  1OC9 B;  3MAK A;  4I97 A;  3GFK A;  5JWR B;  2AJQ B;  2WW2 A;  3LJR A;  2LKU A;  4YAP A;  5COH A;  2JZT A;  4MZB A;  3HXS A;  1A24 A;  1ILO A;  4TXO B;  5LCZ A;  4G0I A;  5CNW A;  2VOC A;  3UMA A;  3GUS A;  4AF2 A;  2FLS A;  1IYI A;  4L8E A;  5B8B A;  1GUM A;  3L9S A;  2QA1 A;  4GQC A;  12GS A;  2WUL A;  3ERG A;  4G9H A;  1A2M A;  2JZS A;  1YKC A;  5HQP A;  5A1N A;  4H86 A;  3FEU A;  4I6X A;  1XXU A;  3KP8 A;  3PH9 A;  1VF4 A;  2P5R A;  4Z7X A;  1K0B A;  4XS4 A;  3WD6 A;  2MBT A;  3TUE A;  3GH6 A;  1WIK A;  3PIN A;  1EZK A;  5B8A A;  1T4Z A;  5L71 A;  2P31 A;  4JU5 A;  5KOW A;  6GSX A;  4GQF A;  1YF0 A;  2N5A A;  4CHS A;  1TRW A;  2IL3 A;  1BX9 A;  1TRU A;  3TRX A;  2A2P A;  1FVJ A;  4WR5 A;  1U88 A;  2A4V A;  3GTU A;  2O87 A;  2HE3 A;  2HSM B;  2AV4 A;  2WGR A;  1OVN A;  4EO3 A;  2XBI A;  1JLV A;  2K8V A;  3H4K A;  2WVZ A;  2J23 A;  1BG5 A;  1B48 A;  4AKH A;  4AKG A;  4GWR A;  1V58 A;  5JWQ B;  2LNT A;  2LNS A;  1V2A A;  5CRW A;  2REM A;  2CZ2 A;  4F03 A;  2AB6 A;  2YOI A;  5JCG A;  1ZYP A;  1PX7 A;  1BED A;  2L57 A;  4TR1 A;  3GX8 A;  2H1B A;  3ERW A;  1G6Y A;  3TGZ A;  3V1W A;  2MMO A;  2HFD A;  3FR3 A;  5IOW A;  2C0F A;  1SK0 A;  5IMA A;  16GS A;  2IMF A;  4OFM A;  3BD2 A;  2YNX A;  5ECK B;  1B4P A;  1MDK A;  5LNK e;  4L5L A;  1SYR A;  4OCE A;  2OT3 A;  2F9S A;  5BMU B;  3UIW A;  4ML1 A;  4IGJ A;  2AAW A;  1ABA A;  2H19 A;  1RW1 A;  5AN1 A;  2QSI A;  1XW9 A;  2GSS A;  1T4Y A;  3TCO A;  1ST9 A;  2DJ2 A;  2VLT A;  5KN3 A;  3F3Q A;  4JRR A;  5ENU A;  5G30 A;  3IK9 A;  1PA3 A;  2DSA A;  1JLW A;  5J4V A;  1GLQ A;  4KSM A;  5GZZ B;  1FB0 A;  3J7Y b;  1J9B A;  2YWM A;  1SKS B;  2K18 A;  3KXO A;  3FY7 A;  1J08 A;  4EL1 A;  2CT6 A;  3HY2 A;  1ACV A;  5F0G A;  3I6A A;  3W8J A;  5KN2 A;  3DEX A;  3DXB A;  2YAN A;  2P0G A;  3F6F A;  5LD0 A;  4ZIL A;  3A5I A;  4F2I A;  1T3B A;  3LGC A;  2L4C A;  2FY6 A;  1FW1 A;  2DLX A;  1SD9 A;  1V98 A;  2FGX A;  4V1A g;  1A2J A;  3VWU A;  2DKI A;  2OKA A;  4GLT A;  2EFC A;  1BG1 A;  3CWG A;  4N3Z A;  3IHG A;  2WW0 A;  4AJ6 A;  1M99 A;  4ZIJ A;  3HZ4 A;  1SJZ A;  3LEF A;  5DBQ A;  3CRU A;  2HSN B;  2VCW A;  4ZB6 A;  1TRV A;  3LOR A;  2H1A A;  3QFB C;  2DKH A;  5CRE A;  1DUG A;  1HQO A;  3H79 A;  5DQY A;  2LUS A;  4PX1 A;  5IO0 A;  1EP8 A;  4O5U A;  2DC5 A;  2AYT A;  4TR3 A;  4XS1 A;  1SVL A;  3G9B A;  2BJX A;  3RPN A;  1O7U A;  2FA4 A;  1NM3 A;  4A5P A;  3QAV A;  3ZTL A;  1TK8 B;  3HA9 A;  1MEK A;  1ZYQ B;  2OJL A;  4K2X A;  5DVB A;  3W6G A;  1SJI A;  3DD3 A;  1XIY A;  2P5Q A;  3U5R E;  3QAW A;  3GL5 A;  3IAM 2; 
#chains in the Genus database with same CATH homology
 4MJB A;  2CX3 A;  3ZVJ A;  2HZE A;  2IFQ A;  1E6B A;  4WR4 A;  2DML A;  3JCM L;  4QL7 A;  1Z3E A;  3HVS A;  2HRK B;  1SVM A;  2VLU A;  1XCC A;  1F3B A;  1GTU A;  1YEX A;  4ZL8 A;  1OC3 A;  3FK8 A;  2C3N A;  1SD8 A;  2L59 A;  4I2U A;  4MF7 A;  4ECI A;  2MBS A;  4CY6 A;  3L9U A;  3VWV A;  5KEJ A;  4EC0 A;  3NIV A;  2PPT A;  1TU8 A;  3Q18 A;  5D9X A;  1WP0 A;  4KSO A;  2KP2 A;  4J57 E;  3F6D A;  2H1L A;  3F4R A;  3UAP A;  3FR9 A;  1Z7P A;  2JZR A;  4WXT A;  3QMX A;  2HLS A;  2E0Q A;  3A2X A;  5D9V A;  2H30 A;  2YWN A;  4K8M A;  3U6V A;  2GS3 A;  3A3T A;  2ES7 A;  1EEJ A;  4OFN A;  3RHB A;  2V6K A;  2R37 A;  4KA0 A;  3KZQ A;  3NOF A;  3N9J A;  3BCI A;  2DJK A;  4FYB A;  3IAS 2;  2YZH A;  3UJ1 A;  3FMW A;  1VF1 A;  4EF0 A;  1TI3 A;  1X9S B;  2AHE A;  1AIU A;  1BQ7 A;  2ZCT A;  1MDI A;  4WEY A;  4JBB A;  3O76 A;  3M9K A;  5INY A;  3KM6 A;  5GAP D;  4LMW A;  3US3 A;  3ZRE A;  4POL A;  3F4S A;  3RPP A;  4G01 A;  2EFH A;  1USB A;  3IC8 A;  2VD1 A;  4HU9 A;  5ID2 A;  4GF0 A;  4W66 A;  3RAZ A;  4QL9 A;  2OE1 A;  3UBK A;  4K1F A;  5H5S A;  1X5E A;  1R4W A;  5ECO B;  2PWJ A;  2YCD A;  1TK5 B;  3MIX A;  3MSZ A;  2VLV A;  2YV9 A;  3KGK A;  3EMP A;  5J47 A;  1EGR A;  1SK1 A;  4EVM A;  4Q5R A;  1N2A A;  5ECM B;  3GNJ A;  3L0H A;  1FOV A;  1WRY A;  2H70 A;  2GT5 A;  1AW9 A;  3LQ7 A;  4PNG A;  1ON4 A;  1ML6 A;  5IMF A;  4K6X A;  4K7N A;  3HJO A;  3M3M A;  1I5G A;  3UAR A;  1AAZ A;  5A5H A;  2GQM A;  3F9U A;  4K7I A;  2GTU A;  3AY8 A;  2B1L A;  3A5W A;  1GSU A;  4V2N A;  3HHV A;  1A0R P;  5ECN B;  3CXG A;  1V9W A;  1UC7 A;  5IMC A;  2DMM A;  4I2T A;  4X4J A;  1F37 A;  2JL4 A;  4HUA A;  4L0W A;  1XVQ A;  4P3Y B;  3IPZ A;  3KEB A;  3C1R A;  4K7O A;  2VL9 A;  5DAK B;  1QMV A;  4N0V A;  1H75 A;  3EC3 A;  3MYD A;  2DJ0 A;  5KN1 A;  2Z9S A;  2BMX A;  4USS A;  1CQH A;  4KW6 A;  2OE0 A;  2MYG A;  1GSD A;  6GST A;  1Z6M A;  1B9X C;  4GSN A;  1WJK A;  5G1K A;  5A34 B;  2H1G A;  2HI7 A;  1LJR A;  4TOP A;  3QFA C;  4IS0 A;  4EKZ A;  4IW9 A;  3QOU A;  3UOM A;  1O85 A;  1K3L A;  3TU3 B;  4WBR D;  3E0U A;  4WF4 A;  1WMJ A;  1G6W A;  1KTE A;  2A2S A;  3FZ4 A;  2OA7 A;  3GHA A;  5EL8 A;  3BBY A;  4GSS A;  3VPT A;  4PNF A;  1NHY A;  2LRN A;  5H5R A;  3LW9 A;  1MD4 A;  4Z2R A;  3KD0 A;  4MF6 A;  4LLR A;  1TP9 A;  5GSS A;  5F06 A;  5J41 A;  4POK A;  4JED A;  2GVP A;  4PUR A;  2QA2 A;  4YQU A;  5ECS A;  1V40 A;  3FYG A;  1KBN A;  1TRS A;  5F8B A;  4MK3 A;  3FRC A;  4ZB9 A;  1VRS D;  4BA7 A;  4MJA A;  5DAL B;  1O6J A;  1TOF A;  1TI1 A;  1V57 A;  3D22 A;  3EU4 A;  3VI5 A;  1ZMA A;  2B5X A;  1T8E B;  4G0K A;  5HR0 A;  2B7K A;  1RK4 A;  3IR4 A;  2KUC A;  1QK8 A;  5D96 A;  3GUR A;  4OMV A;  4GCI A;  2IIY A;  5ECQ B;  4PUF C;  3VWX A;  1WE0 A;  4E8H A;  2WZ9 A;  5A1N B;  1F2E A;  2KOK A;  3H93 A;  1HNA A;  4GRF A;  4BVX A;  4MLY A;  4HJ2 A;  1JHB A;  2EIR A;  2WJU A;  4XS4 B;  2C8U A;  3KTL A;  4MP4 A;  4IKH A;  2YZU A;  4POB A;  3TJK A;  1G7E A;  2JU5 A;  3C73 A;  2UZ8 A;  4ICY A;  3KMN A;  3APQ A;  1EEM A;  2H0H A;  4GXZ A;  2IMD A;  2F51 A;  3D4M A;  3RHC A;  1ZYN A;  3DIE A;  1YY7 A;  3I9V 2;  3CSH A;  3R2Q A;  2LRT A;  3W8S A;  4YQM A;  5F07 A;  5ECI B;  1S3D A;  4TR0 A;  1XW6 A;  2TRX A;  1U87 A;  3VUR A;  5CRD A;  1PD2 1;  5B6N A;  1O81 A;  3IC4 A;  3WGX A;  4O5R A;  4ZXG A;  1UVZ A;  2HXK A;  5G31 A;  3GTU B;  3TKP A;  3LWA A;  2H0G A;  3DVX A;  4XRD A;  2IMI A;  2HZF A;  4KDY A;  4YKF A;  1Z6N A;  2X49 A;  4RQR A;  3CYN A;  4OD7 A;  2R0P A;  1F9M A;  5J4U A;  5AIV A;  2VUP A;  2N5F A;  3TKS E;  1EWX A;  1OAZ A;  3KIJ A;  2V1M A;  1ZGN A;  4EE0 A;  2GQL A;  1ERV A;  4MJC A;  2L5L A;  4TR1 B;  2DIY A;  4XCS A;  2LST A;  1ZL9 A;  2OBK A;  3HD5 A;  2KLX A;  4OWY A;  3HCZ A;  1X5D A;  2H6X A;  5IPG A;  2OAD A;  4XRA A;  1GH2 A;  2VO4 A;  4ZB8 A;  3IA1 A;  1K0N A;  2EIQ A;  3F0I A;  3IHQ A;  5AIS A;  1AXD A;  1Y25 A;  4ECC A;  4F0C A;  1XWB A;  1B8X A;  4FYU A;  2GQK A;  1O8X A;  4XTS A;  1UN2 A;  5IMV A;  2VCV A;  2QKE A;  1AQX A;  1B9Y C;  1GTI A;  2JAC A;  1SVO A;  5EVO A;  3WYW A;  3QAG A;  5IIZ A;  3M1G A;  1GSQ A;  4O92 A;  3D21 A;  1M2B A;  2V2G A;  2C1Y A;  2E2M A;  2HSH A;  2A2R A;  3FHK A;  1PGT A;  2K6V A;  5DQS A;  1G0T A;  2PVQ A;  3M8N A;  5EY6 A;  2V41 A;  2X4A A;  1JZO A;  2H01 A;  4LL4 B;  2O5V A;  3QPM A;  4WF5 A;  1GTB A;  2MMA A;  2XPD A;  4PTS A;  3DKS A;  3WT2 A;  5CYY A;  1QGV A;  4ZB7 A;  2CA8 A;  2CVD A;  2VCZ A;  1FG4 A;  1RQM A;  2G2Q A;  3LFL A;  1OYJ A;  3VLN A;  6GSU A;  3G7J A;  2GGT A;  1YZX A;  4N11 A;  2GZY A;  4LL1 B;  2VL3 A;  2IME A;  2H66 A;  2DJ3 A;  2FD3 A;  4MZC A;  3ZVJ D;  1SKW B;  2I4A A;  4MA9 A;  1K0C A;  3ISO A;  4XS6 A;  1DE2 A;  4ISD A;  3IBH A;  2PBJ A;  2FWG A;  2RII A;  2PER A;  2DJJ A;  1A8L A;  4ECJ A;  1SL0 B;  3UVT A;  1T00 A;  4HDE A;  3IE3 A;  3D0Z A;  2R0G A;  4AJ7 A;  2PVO C;  3L78 A;  1ERT A;  1HYU A;  3C71 A;  3F63 A;  1PKZ A;  2ZUP A;  4DSS A;  5BRT A;  4KH7 A;  2HZE B;  1G7O A;  2IFQ B;  17GS A;  3IV4 A;  5J3R A;  4KCE A;  1HNB A;  2H75 A;  2B5Y A;  2CVK A;  4FIW A;  1EV4 A;  3WGE A;  5HFK A;  1GNW A;  2J9H A;  2FUG 2;  1GTA A;  4CY8 A;  5ABR A;  4BL7 A;  4KCA A;  3QDN A;  1U3A A;  3C7M A;  5GAN D;  3MDK A;  5FWG A;  1TW9 A;  5DCG A;  3L4N A;  1TTZ A;  2HSY A;  5G1L A;  4K0G A;  1PRX A;  4ZL9 A;  5D93 A;  3M9J A;  2VM2 A;  4F9Z A;  4WKW A;  1K0A A;  4HI7 A;  5J5N A;  3VI7 A;  1AQV A;  5KOX A;  3L9V A;  3ZL5 A;  4BPY A;  2H76 A;  1AC1 A;  3LG6 A;  2I1U A;  4JE1 A;  5D8I A;  5IPH A;  2LV3 A;  4DVC A;  4X1U A;  3P2A A;  2B1K A;  2NDO A;  2YWI A;  5AGY A;  3APS A;  5DCH A;  3Q6O A;  1A23 A;  5HR3 A;  3C8E A;  2M72 A;  5J9C A;  1YEP A;  5G5E A;  2G0F A;  1SU9 A;  3FZA A;  4ZBB A;  1PMT A;  2LJK A;  2E2G A;  2GLR A;  1PX6 A;  4TKY A;  2F8F A;  5ID2 B;  3E3E A;  5KN0 A;  1EOH A;  1R26 A;  4BVY A;  3VPQ A;  3TJG A;  5ECP B;  2HRA A;  4J56 E;  2QC7 A;  2JSZ A;  2H6Y A;  4RUV A;  19GS A;  1XBS A;  1XPV A;  4RQX A;  2DIZ A;  1XWK A;  5IMD A;  3TKS A;  4Q5N A;  3FR6 A;  4PQ1 A;  1QXH A;  1TXX A;  5HFG A;  3ZIJ A;  1SL2 B;  2GDR A;  3TJB A;  5CAX A;  3K8N A;  2CAQ A;  4DSQ A;  1Y1U A;  2VD0 A;  2ZNM A;  1SJ6 A;  4PQH A;  1K3O A;  1A2L A;  1FB6 A;  1BJX A;  2WDU A;  3ZZX A;  1T7P B;  4BWQ A;  4MPG A;  3IXR A;  8GSS A;  3TJF A;  3FZ9 A;  1BF5 A;  1GRX A;  5A5H B;  4K5S A;  3LYP A;  1URM A;  2PUK C;  3BCK A;  1HD2 A;  3G7I A;  3ZIV A;  4EXJ A;  6GSW A;  4BWS A;  4TN8 A;  1WWJ A;  3ZFL A;  3CTG A;  2FWF A;  4K9Z A;  4Q5F A;  2M80 A;  4IP1 A;  2X64 A;  1M7T A;  3DGQ A;  2LTK A;  4NV2 A;  4MMM A;  5EPF A;  2O8V B;  2CVB A;  3I43 A;  3UBL A;  22GS A;  2FCH A;  2LEG A;  5G2Z A;  1XW5 A;  1JZR A;  1OE8 A;  3P7X A;  4N0Z A;  3E9J B;  2LQQ A;  3GN3 A;  2H6Z A;  5A4U A;  3GKN A;  4HZ4 A;  1FO5 A;  1K0O A;  1EP7 A;  3DRN A;  3LXZ A;  4E68 A;  2RUF A;  4KUN A;  3EWL A;  4ECB A;  2O89 A;  3EIN A;  4JR6 A;  2CX4 A;  2RUE A;  5ECL B;  2C3Q A;  2HT9 A;  2YJH A;  4D73 A;  4EIQ A;  2D2Z A;  2LQO A;  2FA8 A;  6GSS A;  4QQ7 A;  1GP1 A;  1TDI A;  3ZLP A;  3GMF A;  2IPA A;  1WOU A;  4MAB A;  4TXV A;  1EGO A;  1PN0 A;  3GSS A;  1WPI A;  2GZZ A;  2NTO A;  1JZD A;  2FWH A;  3C1S A;  5HR1 A;  2KP1 A;  2B6M A;  1GSY A;  5C00 A;  4K2D A;  4EDZ A;  4IJI A;  1H4O A;  3VK9 A;  3D5J A;  4Z2U A;  3HKR A;  1OC9 A;  3EU3 A;  2H72 A;  5D9W A;  4HZ2 A;  4FYC A;  4TR4 A;  1SL1 B;  5D73 A;  3MNG A;  1XFL A;  4IHU A;  2R2J A;  2VAF A;  4TXO A;  4RI6 A;  2R0C A;  4HEA 2;  3TKS C;  2B7J A;  1NW2 A;  3IK7 A;  4ZL7 A;  1M2D A;  4X43 A;  4TVE A;  3FKF A;  5B7C A;  4NHZ A;  4MJE A;  5CO3 A;  1NSW A;  1LU4 A;  3UL3 A;  1PSQ A;  3EE2 A;  2VIM A;  4J2F A;  3VWW A;  4G2E A;  2ON7 A;  4NV5 A;  2TRC P;  3RBT A;  4JR4 A;  1FOH A;  2CAI A;  5HFI A;  2VL2 A;  9GSS A;  1GL8 A;  2C4J A;  1N8J A;  4BVX B;  3I69 A;  2PGT A;  4XIH A;  1IYH A;  1BYE A;  1PQN A;  1XWG A;  4GDF A;  3OR5 A;  1XWC A;  2KHP A;  4I5Q A;  3M0F A;  18GS A;  1FAA A;  2BTO T;  3KP9 A;  2I9H A;  4GTU A;  2H71 A;  2GST A;  1R7H A;  4JZQ A;  3MWH A;  4I8B A;  2RM6 A;  2TIR A;  1VGL A;  3GYK A;  1C72 A;  2YN1 A;  2HNL A;  1T1V A;  3IRA A;  2DBC A;  2GSQ A;  3R3E A;  2VKZ G;  4IJ3 A;  2HSM A;  6GSV A;  1M9B A;  1PL1 A;  2B5E A;  4CW9 A;  3WT1 A;  5GST A;  2WB9 A;  4KDU A;  2GZP A;  2LS5 A;  5C04 A;  4IN0 A;  3ZFB A;  5DDL A;  5IM9 A;  2EFE A;  3O3T A;  3CBU A;  3IOS A;  1GUH A;  2HRF A;  2OBI A;  4FQU A;  3CTF A;  3HJP A;  1K3Y A;  2V6O A;  2OAC A;  2IN3 A;  3O6T A;  1ZCP A;  3CSJ A;  4MPF A;  3BJ5 A;  1YQ1 A;  2HQT A;  2EFD A;  2MMN A;  5A5K A;  5JWO B;  1GNE A;  1GSS A;  2L6D A;  3PPU A;  4TRX A;  3CRT A;  4KE3 A;  1YVL A;  4AKX B;  4N30 A;  2M46 A;  2R4V A;  5JCU A;  4G0L A;  4OFT A;  2O7K A;  2NPB A;  3ZRD A;  2AUV A;  4WBJ A;  1X9W B;  4PUA A;  2VCT A;  4OO4 A;  5BMU A;  1YDK A;  1PL2 A;  3LXT A;  4KAE A;  1MD3 A;  4N10 A;  4K5R A;  4YAV A;  3DWV A;  1Z7R A;  3HMJ G;  1HNC A;  1EOG A;  2FWE A;  3SBC A;  3PR8 A;  2GT6 A;  2H74 A;  1O73 A;  2XPE A;  4KGI A;  1QFN A;  4QMK A;  3EPT A;  2VCQ A;  2CV4 A;  4AJ8 A;  5IOX A;  4NXI A;  4MH2 A;  4OO5 A;  1YJ6 A;  4ML6 A;  2F8A A;  4G19 A;  2H1D A;  3DYR A;  3H8Q A;  6GSY A;  4NHW A;  3TKR A;  4ZBA A;  4CDO A;  1BAY A;  1ZZY A;  4NAX A;  1O8W A;  1VF2 A;  2A4H A;  3KCM A;  2JAD A;  2ALB A;  4E8E A;  1GWC A;  4O7H A;  3WGD A;  3GKK A;  1YF1 A;  4FH8 A;  4MDC A;  2IMK A;  5FT3 A;  2XC2 A;  2EC4 A;  1TK0 B;  2VL2 C;  1ERW A;  5E4W A;  1UA5 A;  2C0G A;  5H5Q A;  4MF5 A;  4L0U A;  3QCP A;  4F0B A;  1U3I A;  1GSF A;  1FHE A;  1DBY A;  1F3A A;  4K0N A;  2HSN A;  3SWL A;  3KTB A;  4KF9 A;  3F4T A;  3DML A;  4AI6 A;  3KH7 A;  3N5O A;  11GS A;  3PGT A;  4NPB A;  2R6K A;  1KNG A;  4AGS A;  5IMZ A;  3UEM A;  1PKW A;  4KDX A;  14GS A;  3RDW A;  1TKD B;  4ID0 A;  2I3Y A;  2QGV A;  1K0D A;  4MNN A;  4DEJ A;  4DSR A;  2B3S A;  2FHE A;  1J0F A;  5IO2 A;  4HQZ A;  1TJD A;  2IWT A;  2WRT A;  3QD9 A;  3TRP A;  4WET A;  3EUR A;  4NWY A;  1GSE A;  5DJL A;  4YQV A;  1TU7 A;  4KX4 A;  10GS A;  4Z2T A;  2MMZ A;  1XVW A;  3TOU A;  3NZN A;  4IBP A;  3LSZ A;  2HRK A;  1U6T A;  2O85 A;  3EVI A;  4DSS B;  1I9D A;  2XHF A;  3ED3 A;  13GS A;  3ME7 A;  3GH9 A;  2X8G A;  3GL3 A;  5F05 A;  1N25 A;  4Q5Q A;  5IQY A;  3UVH A;  1SEN A;  4IQ1 A;  2MZC A;  2R3X A;  1MTC A;  4MH3 A;  4HU7 A;  1S3C A;  4MZW A;  3KMO A;  4IQA A;  5CRH A;  4BL7 B;  1GUL A;  3G7Y A;  4OCF A;  1XOA A;  1XOB A;  4RI7 A;  1EV9 A;  2YJ7 A;  2YP6 A;  5E59 A;  1X0R A;  3IDV A;  3HVX A;  4MCU A;  2YV7 A;  1THX A;  3GST A;  2L4Q A;  3P90 A;  4HQS A;  5DJM A;  4FO5 A;  1XZO A;  3D6I A;  2CQ9 A;  1Q98 A;  2NBS A;  1M0U A;  1TXU A;  2H73 A;  2C0D A;  4V2M A;  2LJA A;  2R5G A;  2IJY A;  3GA4 A;  2CZ3 A;  1F6M C;  4GST A;  1QQ2 A;  3Q19 A;  2K9F A;  3LYK A;  1XWA A;  5CRG A;  4PQI A;  1Z9H A;  2L5O A;  1Q4J A;  4KB3 A;  4TW5 A;  4L5O A;  2WFC A;  1KEB A;  5ELG A;  4HS1 A;  1ZYE A;  5J40 A;  4O32 A;  4BVY B;  1QUW A;  1SYX A;  2K8S A;  4PGT A;  2EIO A;  3FZ5 A;  2DJ1 A;  2FNO A;  1AUC A;  4F82 A;  2GSR A;  5FHI A;  3CSI A;  1W89 A;  3A2V A;  4ULX A;  3ZYW A;  3FW2 A;  4LMV A;  1ERU A;  2RLI A;  20GS A;  1PN9 A;  5ECH B;  3TOT A;  2XBQ A;  2VCX A;  2HRN A;  1MDJ A;  3ZML A;  4KND A;  5CP1 A;  2ON5 A;  2H0I A;  2HYX A;  2H8L A;  3GIX A;  4NMU A;  1ZOF A;  2YPM A;  2F3M A;  2X99 A;  3H1N A;  1AQW A;  3F8U A;  3HYP A;  3TJJ A;  1LBK A;  4AKI A;  2I81 A;  4YH2 A;  1A8Y A;  5J9B A;  2PU9 C;  2PMT A;  3HJM A;  5ELA A;  1M9A A;  3ERF A;  4IEL A;  3TB2 A;  1DE1 A;  1W4V A;  1JZW A;  4POM A;  2LRC A;  4O5Q A;  1FVK A;  1R5A A;  1GUK A;  1SKR B;  3EYT A;  7GSS A;  2N5B A;  1Y6E A;  3D4T A;  4HJM A;  3GV1 A;  3BOA A;  1DSB A;  2WS2 A;  2C80 A;  3S9F A;  1A0F A;  5AIX A;  5JCW A;  1M2A A;  5DAK A;  5B6M A;  4V1A p;  2E7P A;  3GRX A;  3QR6 A;  5HR2 A;  5G5F A;  1X5C A;  1GLP A;  5J4Y A;  3HDC A;  2RM5 A;  3HVV A;  3KH9 A;  3ME8 A;  1B4Q A;  3TKQ A;  4YKG A;  3ZIT A;  4EUY A;  2X8H A;  4IP6 A;  3P8W A;  1VF3 A;  3GX0 A;  3TRQ A;  5A34 A;  5A4V A;  1YKA A;  4LA1 A;  1K0M A;  1CQG A;  4ACS A;  2YWO A;  1Z5Y E;  3KJY A;  2UV8 G;  2C0E A;  3Q74 A;  4PXO A;  2WCI A;  1S3A A;  3GKM A;  3DVW A;  3J7Y k;  2L6C A;  4G10 A;  3CMI A;  2C3T A;  4X0X A;  5ECR B;  2V32 A;  5A4W A;  4D73 B;  1OE7 A;  3GKX A;  2OE3 A;  4XHM A;  1OC8 A;  3VFI A;  1E2Y A;  1NHO A;  3A2W A;  2PN8 A;  2NVL A;  3TDG A;  2LJR A;  4ZBD A;  1OKD A;  3EMX A;  1R5P A;  2JSY A;  2X8C A;  4HOJ A;  5D9T A;  1JFU A;  1X9M B;  3HZ8 A;  4ILF A;  2VM1 A;  3F3R A;  1OKT A;  3APO A;  4EIP A;  3ZMK A;  1SK2 A;  1THO A;  4IVF A;  5DAL A;  4EDY A;  4V2L A;  1OC9 B;  3MAK A;  4I97 A;  3GFK A;  5JWR B;  2AJQ B;  3LJR A;  2LKU A;  4YAP A;  5COH A;  2JZT A;  4MZB A;  3HXS A;  1A24 A;  1ILO A;  4TXO B;  5LCZ A;  4G0I A;  5CNW A;  2VOC A;  3UMA A;  3GUS A;  4AF2 A;  2FLS A;  1IYI A;  4L8E A;  5B8B A;  1GUM A;  3L9S A;  2QA1 A;  4GQC A;  12GS A;  2WUL A;  3ERG A;  4G9H A;  1A2M A;  2JZS A;  1YKC A;  5HQP A;  5A1N A;  4H86 A;  3FEU A;  4I6X A;  1XXU A;  3KP8 A;  3PH9 A;  1VF4 A;  2P5R A;  4Z7X A;  1K0B A;  4XS4 A;  3WD6 A;  2MBT A;  3TUE A;  3GH6 A;  1WIK A;  3PIN A;  1EZK A;  5B8A A;  1T4Z A;  5L71 A;  2P31 A;  4JU5 A;  5KOW A;  6GSX A;  4GQF A;  1YF0 A;  2N5A A;  4CHS A;  1TRW A;  2IL3 A;  1BX9 A;  1TRU A;  3TRX A;  2A2P A;  1FVJ A;  4WR5 A;  1U88 A;  2A4V A;  3GTU A;  2O87 A;  2HE3 A;  2HSM B;  2AV4 A;  2WGR A;  1OVN A;  4EO3 A;  2XBI A;  1JLV A;  2K8V A;  3H4K A;  2J23 A;  1BG5 A;  1B48 A;  4AKH A;  4AKG A;  4GWR A;  1V58 A;  5JWQ B;  2LNT A;  2LNS A;  1V2A A;  5CRW A;  2REM A;  2CZ2 A;  4F03 A;  2AB6 A;  2YOI A;  5JCG A;  1ZYP A;  1PX7 A;  1BED A;  2L57 A;  4TR1 A;  3GX8 A;  2H1B A;  3ERW A;  1G6Y A;  3TGZ A;  3V1W A;  2MMO A;  2HFD A;  3FR3 A;  5IOW A;  2C0F A;  1SK0 A;  5IMA A;  16GS A;  2IMF A;  4OFM A;  3BD2 A;  2YNX A;  5ECK B;  1B4P A;  1MDK A;  5LNK e;  4L5L A;  1SYR A;  4OCE A;  2OT3 A;  2F9S A;  5BMU B;  3UIW A;  4ML1 A;  4IGJ A;  2AAW A;  1ABA A;  2H19 A;  1RW1 A;  5AN1 A;  2QSI A;  1XW9 A;  2GSS A;  1T4Y A;  3TCO A;  1ST9 A;  2DJ2 A;  2VLT A;  5KN3 A;  3F3Q A;  4JRR A;  5ENU A;  5G30 A;  3IK9 A;  1PA3 A;  2DSA A;  1JLW A;  5J4V A;  1GLQ A;  4KSM A;  5GZZ B;  1FB0 A;  3J7Y b;  1J9B A;  2YWM A;  1SKS B;  2K18 A;  3KXO A;  3FY7 A;  1J08 A;  4EL1 A;  2CT6 A;  3HY2 A;  1ACV A;  5F0G A;  3I6A A;  3W8J A;  5KN2 A;  3DEX A;  3DXB A;  2YAN A;  2P0G A;  3F6F A;  5LD0 A;  4ZIL A;  3A5I A;  4F2I A;  1T3B A;  3LGC A;  2L4C A;  2FY6 A;  1FW1 A;  2DLX A;  1SD9 A;  1V98 A;  2FGX A;  4V1A g;  1A2J A;  3VWU A;  2DKI A;  2OKA A;  4GLT A;  2EFC A;  1BG1 A;  3CWG A;  4N3Z A;  3IHG A;  4AJ6 A;  1M99 A;  4ZIJ A;  3HZ4 A;  1SJZ A;  3LEF A;  5DBQ A;  3CRU A;  2HSN B;  2VCW A;  4ZB6 A;  1TRV A;  3LOR A;  2H1A A;  3QFB C;  2DKH A;  5CRE A;  1DUG A;  1HQO A;  3H79 A;  5DQY A;  2LUS A;  4PX1 A;  5IO0 A;  1EP8 A;  4O5U A;  2DC5 A;  2AYT A;  4TR3 A;  4XS1 A;  1SVL A;  3G9B A;  2BJX A;  3RPN A;  1O7U A;  2FA4 A;  1NM3 A;  4A5P A;  3QAV A;  3ZTL A;  1TK8 B;  3HA9 A;  1MEK A;  1ZYQ B;  2OJL A;  4K2X A;  5DVB A;  3W6G A;  1SJI A;  3DD3 A;  1XIY A;  2P5Q A;  3U5R E;  3QAW A;  3GL5 A;  3IAM 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...