4OG1A

Crystal structure of a putative enoyl-coa hydratase from novosphingobium aromaticivorans dsm 12444
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
257
Chain Sequence
b'MPNMNFHDRVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHSVKGVRCVVLSGAGRSFCAGLDLSSLTERTHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDMAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVADDPLAGAMELARVVAEKSPNAVRGAKTLSNRAPDLTVDDVLMAESIAQHELMYSRNQMEAVKAGMEKRAGDFVDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase
publication title Crystal Structure of a Putative Enoyl-CoA Hydratase from Novosphingobium aromaticivorans DSM 12444
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Lyase
total genus 91
structure length 257
sequence length 268
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4og1A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4og1A01
1SZOA 3V5IA 3L3SA 5E0NX 4ZDCA 3K50A 4EMPA 3H0SA 3GMAA 1N6DA 3BPPA 3ZWBA 3KTHA 1J7XA 4OLQA 3H81A 1HZDA 1HNOA 4F47A 3T88A 5INIA 4GHNA 2D3TA 4JSBA 3BF0A 4MXIA 3KTKA 1ON3A 4G2RA 2QQ3A 4GM2A 4QFEA 2ZL2A 4FN7A 4ASIA 2VX2A 3H0QA 3QKAA 2X58A 5CTCA 3RSTA 5DUCA 5C90A 4ZDEA 3TVUA 3TLFA 4U0HA 1UYTA 3GKBA 2X24A 2FW2A 1TYFA 3BEZA 3ZW8A 4KNPA 2ZQRA 3TRRA 4JYLA 1ON9A 2VSUE 4JCSA 1K39A 3JU1A 2VSUC 3LAOA 2ZL0A 3MOYA 3M6NA 4I4ZA 3PGQA 4MI2A 5MGBA 4JOTA 4ZDDA 2Q35A 4FZWA 1UYVA 3TVWA 4Z0MA 1DCIA 3DJAA 4JJTA 3ZW9A 2UZFA 4KPKA 4U1AA 1UYSA 1WZ8A 1Q52A 1UYRA 2PPYA 5DKPA 1W2XA 4RYFH 2BZRA 4ELWA 3ZWCA 2PBPA 2ZQQA 4RCNA 4YLHA 2VSUF 2IEXA 5INFA 5E0SA 1OD4A 4KD6A 2W3PA 5DZKA 3NJBA 2GTRA 4NNQA 1OD2A 2EJ5A 3IB9A 5DU4A 3QK8A 3QXIA 3TT7A 4WZ8B 1XNWA 4ZDFA 3TDCA 3Q7HA 3QYRA 3R9TA 1XNVA 5FIFA 3KTIA 5DUFA 3ISAA 1TG6A 3DORA 2DUBA 4MOUA 2C8TA 2J5II 5E0SH 5DZKH 3R9QA 2VSSA 4JFCA 3NJDA 4U0GA 4I52A 4I42A 3MT6A 4FN8A 1RJNA 3P2LA 1WDKA 1YG6A 3QWDA 4ELXA 1SG4A 5C9GA 4RYFA 5JBXA 2J5GD 1EF9A 3IBBA 4FJWD 4L8KA 1DUBA 4FZWC 2VREA 3STAA 4K2NA 1N6FA 1FCFA 1WDMA 1EF8A 3PE8A 3N6RB 5INGA 4WCZA 4U0GH 4B3JA 4IZBA 4JCTA 2FZSA 3KTJA 2A7KA 5DL1A 1YG8A 3FF6A 3Q0GA 4B3IA 1Y7OA 3SWXA 1XNYA 5DTWA 4ELSA 4FNBA 3RSIA 5G1SA 2F9IB 2Q34A 1PIXA 4KWBA 2F6IA 4HNKA 1PJHA 3ST9A 2A7SA 3H02A 3FDUA 3H0UA 2F9IA 3PEAA 4U18A 3MFMA 4L6WA 3ZWAA 3U9SB 1FC7A 4JYJA 1WDLA 3R0OA 2F9YB 4EMLA 4FNDA 3TV5A 2Q2XA 4WYOB 3IAVA 2HW5A 3HE2A 1EY3A 5KJPA 4DI1A 3HINA 3TT6A 5DTPA 2F6QA 2J5IA 2VSSE 3QMJA 2F9YA 3OMEA 2ZL4A 3HP0A 1XX4A 5DU6A 1UIYA 4OMRA 3MYBA 1FC6A 1XO6A 2ZL3A 3PZKA 2PG8A 3G64A 1JXZA 1Q51A 3WG5A 3HRXA 3GF7A 5DU8A 1N6EA 4ZU2A 3P5MA 3LKEA 3RRVA 4JCRA 4IZDA 4OG1A 2CE3A 3M6MA 4B3HA 3T89A 3SLLA 1O8UA 3R9SA 3V5EA 2VSSF 5KDRB 4LK5A 3VIVA 4QIIA 3QXZA 3HLN1 3K8XA 3P85A 4HC8A 4ZDBA 2WTBA 5KDRA 3KQFA 4Q1IA 3OC7A 4JWVA 2VSUA 3OT6A 1K32A 1VRGA 3T3WA 4NEKA 3QREA 1FC9A 2CBYA 2J5SA 4U19A 1X0UA 3TZ3A 3I47A 3GLMA 3T8AA 5G1RA 1MJ3A 1HNUA 5G1QA 3Q0JA 4K3WA 1NZYB 3Q1TA 3R6HA 3T8BA 4JVTA 3U9RB 4IZCA 5JBWA 4QIJA 4FB8A 2NP9A 4K29A 2J5GA 5IKLB 2FBMA 1NZYA 3KTGA 5FUSA 4JCQA 5CTBA 4EMMA 2DEOA 3GF3A 3H0JA 3U9TB 2J5IB 2A81A 1RJMA 4Q0GA
chains in the Genus database with same CATH superfamily
1SZOA 3V5IA 3L3SA 5E0NX 4ZDCA 3K50A 4EMPA 3H0SA 3GMAA 1N6DA 3BPPA 3ZWBA 3KTHA 1J7XA 4OLQA 3H81A 1HZDA 1HNOA 4F47A 3T88A 5INIA 4GHNA 2D3TA 4JSBA 3BF0A 4MXIA 3KTKA 1ON3A 4G2RA 2QQ3A 4GM2A 4QFEA 2ZL2A 4FN7A 4ASIA 2VX2A 3H0QA 3QKAA 1UX5A 2X58A 5CTCA 3RSTA 2YJGA 5DUCA 5C90A 4ZDEA 4J2UA 3TVUA 3TLFA 4U0HA 1UYTA 3GKBA 2X24A 2FW2A 1TYFA 4NARA 3BEZA 3ZW8A 4KNPA 2ZQRA 3TRRA 4JYLA 1ON9A 2VSUE 4JCSA 1K39A 3JU1A 2VSUC 3LAOA 2ZL0A 3RQGA 3MOYA 3M6NA 4I4ZA 3PGQA 4MI2A 5MGBA 4JOTA 4ZDDA 2Q35A 4FZWA 1UYVA 3TVWA 4Z0MA 1DCIA 3DJAA 4JJTA 3ZW9A 2UZFA 4KPKA 5HUQA 4U1AA 1UYSA 1WZ8A 1Q52A 1UYRA 2PPYA 3A4MA 5DKPA 1W2XA 4RYFH 2BZRA 4ELWA 3ZWCA 2PBPA 2ZQQA 4RCNA 4YLHA 2VSUF 2IEXA 5INFA 1OD4A 5E0SA 4KD6A 2W3PA 5DZKA 3NJBA 2GTRA 4NNQA 1OD2A 2EJ5A 3IB9A 5DU4A 3QK8A 3QXIA 3TT7A 4WZ8B 3A4NA 1XNWA 4ZDFA 3ADDA 3TDCA 3Q7HA 3QYRA 3R9TA 1XNVA 5FIFA 3KTIA 5DUFA 3ISAA 1TG6A 3L8IA 3DORA 2DUBA 4MOUA 2C8TA 2J5II 5E0SH 4GEHB 5DZKH 3R9QA 2VSSA 4JFCA 3AM1A 3NJDA 4U0GA 4I52A 4I42A 3MT6A 4FN8A 1RJNA 3P2LA 1WDKA 1YG6A 3QWDA 4ELXA 1SG4A 5C9GA 4RYFA 5JBXA 2J5GD 1EF9A 3IBBA 4FJWD 4L8KA 1DUBA 4FZWC 2VREA 3STAA 3W8HB 4K2NA 1N6FA 1FCFA 1WDMA 1EF8A 3PE8A 3N6RB 5INGA 4WCZA 4U0GH 4B3JA 4IZBA 4JCTA 2FZSA 3KTJA 2A7KA 5DL1A 1YG8A 3FF6A 3Q0GA 4B3IA 1Y7OA 3SWXA 1XNYA 5DTWA 4ELSA 4FNBA 3RSIA 5G1SA 2F9IB 2Q34A 1PIXA 4KWBA 2F6IA 4HNKA 1PJHA 3ST9A 2A7SA 3H02A 3FDUA 3H0UA 2F9IA 3IRBA 3W8IB 3PEAA 4U18A 3MFMA 4L6WA 3ZWAA 3U9SB 1FC7A 4JYJA 1WDLA 3R0OA 2F9YB 4EMLA 4FNDA 3TV5A 2Q2XA 4WYOB 3IAVA 2HW5A 3HE2A 1EY3A 5KJPA 3ADBA 3HINA 4DI1A 3TT6A 5DTPA 2F6QA 2J5IA 2VSSE 3QMJA 2F9YA 3OMEA 2ZL4A 3HP0A 1XX4A 5DU6A 1UIYA 4HDTA 4OMRA 3ADCA 3MYBA 1FC6A 1XO6A 2ZL3A 3PZKA 2PG8A 3G64A 3AJMA 1Y64B 1JXZA 1Q51A 3WG5A 3HRXA 3GF7A 5DU8A 3O4XE 1N6EA 4ZU2A 3P5MA 3LKEA 3RRVA 4JCRA 4IZDA 4OG1A 2CE3A 3M6MA 4B3HA 3T89A 3SLLA 1O8UA 3R9SA 1UX4A 3V5EA 2VSSF 2P63A 5KDRB 4LK5A 3VIVA 4QIIA 3QXZA 3HLN1 3K8XA 3P85A 4HC8A 4ZDBA 3A4LA 3RQEA 2WTBA 5KDRA 3KQFA 3L8JA 4Q1IA 3OC7A 4JWVA 2VSUA 3OT6A 1K32A 1VRGA 3T3WA 4NEKA 3QREA 1FC9A 2CBYA 2J5SA 4U19A 1X0UA 3TZ3A 3I47A 3GLMA 3T8AA 5G1RA 1MJ3A 1HNUA 5G1QA 3Q0JA 4K3WA 1NZYB 3Q1TA 3BPTA 3R6HA 3T8BA 4JVTA 3U9RB 4IZCA 5JBWA 4QIJA 4FB8A 2NP9A 4K29A 2J5GA 5IKLB 2FBMA 1NZYA 3KTGA 5FUSA 4JCQA 5CTBA 4EMMA 2DEOA 3GF3A 3H0JA 3U9TB 2J5IB 3RQFA 2A81A 1RJMA 4Q0GA
chains in the Genus database with same CATH topology
1SZOA 3V5IA 3L3SA 5E0NX 4ZDCA 3K50A 4EMPA 3H0SA 3GMAA 1N6DA 3BPPA 3ZWBA 3KTHA 1J7XA 4OLQA 3H81A 1HZDA 1HNOA 4F47A 3T88A 5INIA 4GHNA 2D3TA 4JSBA 3BF0A 4MXIA 3KTKA 1ON3A 4G2RA 2QQ3A 4GM2A 4QFEA 2ZL2A 4FN7A 4ASIA 2VX2A 3H0QA 3QKAA 2X58A 5CTCA 3RSTA 2YJGA 5DUCA 5C90A 4ZDEA 4J2UA 3TVUA 3TLFA 4U0HA 1UYTA 3GKBA 2X24A 2FW2A 1TYFA 4NARA 3BEZA 3ZW8A 4KNPA 2ZQRA 3TRRA 4JYLA 1ON9A 2VSUE 4JCSA 1K39A 3JU1A 2VSUC 3LAOA 2ZL0A 3MOYA 3M6NA 4I4ZA 3PGQA 4MI2A 5MGBA 4JOTA 4ZDDA 2Q35A 4FZWA 1UYVA 3TVWA 4Z0MA 1DCIA 3DJAA 4JJTA 3ZW9A 2UZFA 4KPKA 5HUQA 4U1AA 1UYSA 1WZ8A 1Q52A 1UYRA 2PPYA 5DKPA 1W2XA 4RYFH 2BZRA 4ELWA 3ZWCA 2PBPA 2ZQQA 4RCNA 4YLHA 2VSUF 2IEXA 5INFA 5E0SA 1OD4A 4KD6A 2W3PA 5DZKA 3NJBA 2GTRA 4NNQA 1OD2A 2EJ5A 3IB9A 5DU4A 3QK8A 3QXIA 3TT7A 4WZ8B 1XNWA 4ZDFA 3TDCA 3Q7HA 3QYRA 3R9TA 1XNVA 5FIFA 3KTIA 5DUFA 3ISAA 1TG6A 3DORA 2DUBA 4MOUA 2C8TA 2J5II 5E0SH 5DZKH 3R9QA 2VSSA 4JFCA 3NJDA 4U0GA 4I52A 4I42A 3MT6A 4FN8A 1RJNA 3P2LA 1WDKA 1YG6A 3QWDA 4ELXA 1SG4A 5C9GA 4RYFA 5JBXA 2J5GD 1EF9A 3IBBA 4FJWD 4L8KA 1DUBA 4FZWC 2VREA 3STAA 4K2NA 1N6FA 1FCFA 1WDMA 1EF8A 3PE8A 3N6RB 5INGA 4WCZA 4U0GH 4B3JA 4IZBA 4JCTA 2FZSA 3KTJA 2A7KA 5DL1A 1YG8A 3FF6A 3Q0GA 4B3IA 1Y7OA 3SWXA 1XNYA 5DTWA 4ELSA 4FNBA 3RSIA 5G1SA 2F9IB 2Q34A 1PIXA 4KWBA 2F6IA 4HNKA 1PJHA 3ST9A 2A7SA 3H02A 3FDUA 3H0UA 2F9IA 3PEAA 4U18A 3MFMA 4L6WA 3ZWAA 3U9SB 1FC7A 4JYJA 1WDLA 3R0OA 2F9YB 4EMLA 4FNDA 3TV5A 2Q2XA 4WYOB 3IAVA 2HW5A 3HE2A 1EY3A 5KJPA 4DI1A 3HINA 3TT6A 5DTPA 2F6QA 2J5IA 2VSSE 3QMJA 2F9YA 3OMEA 2ZL4A 3HP0A 1XX4A 5DU6A 1UIYA 4HDTA 4OMRA 3MYBA 1FC6A 1XO6A 2ZL3A 3PZKA 2PG8A 3G64A 1JXZA 1Q51A 3WG5A 3HRXA 3GF7A 5DU8A 1N6EA 4ZU2A 3P5MA 3LKEA 3RRVA 4JCRA 4IZDA 4OG1A 2CE3A 3M6MA 4B3HA 3T89A 3SLLA 1O8UA 3R9SA 3V5EA 2VSSF 5KDRB 4LK5A 3VIVA 4QIIA 3QXZA 3HLN1 3K8XA 3P85A 4HC8A 4ZDBA 2WTBA 5KDRA 3KQFA 4Q1IA 3OC7A 4JWVA 2VSUA 3OT6A 1K32A 1VRGA 3T3WA 4NEKA 3QREA 1FC9A 2CBYA 2J5SA 4U19A 1X0UA 3TZ3A 3I47A 3GLMA 3T8AA 5G1RA 1MJ3A 1HNUA 5G1QA 3Q0JA 4K3WA 1NZYB 3Q1TA 3BPTA 3R6HA 3T8BA 4JVTA 3U9RB 4IZCA 5JBWA 4QIJA 4FB8A 2NP9A 4K29A 2J5GA 5IKLB 2FBMA 1NZYA 3KTGA 5FUSA 4JCQA 5CTBA 4EMMA 2DEOA 3GF3A 3H0JA 3U9TB 2J5IB 2A81A 1RJMA 4Q0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZO A;  3V5I A;  3L3S A;  5E0N X;  4ZDC A;  3K50 A;  4EMP A;  3H0S A;  3GMA A;  1N6D A;  3BPP A;  3ZWB A;  3KTH A;  1J7X A;  4OLQ A;  3H81 A;  1HZD A;  1HNO A;  4F47 A;  3T88 A;  5INI A;  4GHN A;  2D3T A;  4JSB A;  3BF0 A;  4MXI A;  3KTK A;  1ON3 A;  4G2R A;  2QQ3 A;  4GM2 A;  4QFE A;  2ZL2 A;  4FN7 A;  4ASI A;  2VX2 A;  3H0Q A;  3QKA A;  2X58 A;  5CTC A;  3RST A;  5DUC A;  5C90 A;  4ZDE A;  3TVU A;  3TLF A;  4U0H A;  1UYT A;  3GKB A;  2X24 A;  2FW2 A;  1TYF A;  3BEZ A;  3ZW8 A;  4KNP A;  2ZQR A;  3TRR A;  4JYL A;  1ON9 A;  2VSU E;  4JCS A;  1K39 A;  3JU1 A;  2VSU C;  3LAO A;  2ZL0 A;  3MOY A;  3M6N A;  4I4Z A;  3PGQ A;  4MI2 A;  5MGB A;  4JOT A;  4ZDD A;  2Q35 A;  4FZW A;  1UYV A;  3TVW A;  4Z0M A;  1DCI A;  3DJA A;  4JJT A;  3ZW9 A;  2UZF A;  4KPK A;  4U1A A;  1UYS A;  1WZ8 A;  1Q52 A;  1UYR A;  2PPY A;  5DKP A;  1W2X A;  4RYF H;  2BZR A;  4ELW A;  3ZWC A;  2PBP A;  2ZQQ A;  4RCN A;  4YLH A;  2VSU F;  2IEX A;  5INF A;  5E0S A;  1OD4 A;  4KD6 A;  2W3P A;  5DZK A;  3NJB A;  2GTR A;  4NNQ A;  1OD2 A;  2EJ5 A;  3IB9 A;  5DU4 A;  3QK8 A;  3QXI A;  3TT7 A;  4WZ8 B;  1XNW A;  4ZDF A;  3TDC A;  3Q7H A;  3QYR A;  3R9T A;  1XNV A;  5FIF A;  3KTI A;  5DUF A;  3ISA A;  1TG6 A;  3DOR A;  2DUB A;  4MOU A;  2C8T A;  2J5I I;  5E0S H;  5DZK H;  3R9Q A;  2VSS A;  4JFC A;  3NJD A;  4U0G A;  4I52 A;  4I42 A;  3MT6 A;  4FN8 A;  1RJN A;  3P2L A;  1WDK A;  1YG6 A;  3QWD A;  4ELX A;  1SG4 A;  5C9G A;  4RYF A;  5JBX A;  2J5G D;  1EF9 A;  3IBB A;  4FJW D;  4L8K A;  1DUB A;  4FZW C;  2VRE A;  3STA A;  4K2N A;  1N6F A;  1FCF A;  1WDM A;  1EF8 A;  3PE8 A;  3N6R B;  5ING A;  4WCZ A;  4U0G H;  4B3J A;  4IZB A;  4JCT A;  2FZS A;  3KTJ A;  2A7K A;  5DL1 A;  1YG8 A;  3FF6 A;  3Q0G A;  4B3I A;  1Y7O A;  3SWX A;  1XNY A;  5DTW A;  4ELS A;  4FNB A;  3RSI A;  5G1S A;  2F9I B;  2Q34 A;  1PIX A;  4KWB A;  2F6I A;  4HNK A;  1PJH A;  3ST9 A;  2A7S A;  3H02 A;  3FDU A;  3H0U A;  2F9I A;  3PEA A;  4U18 A;  3MFM A;  4L6W A;  3ZWA A;  3U9S B;  1FC7 A;  4JYJ A;  1WDL A;  3R0O A;  2F9Y B;  4EML A;  4FND A;  3TV5 A;  2Q2X A;  4WYO B;  3IAV A;  2HW5 A;  3HE2 A;  1EY3 A;  5KJP A;  4DI1 A;  3HIN A;  3TT6 A;  5DTP A;  2F6Q A;  2J5I A;  2VSS E;  3QMJ A;  2F9Y A;  3OME A;  2ZL4 A;  3HP0 A;  1XX4 A;  5DU6 A;  1UIY A;  4OMR A;  3MYB A;  1FC6 A;  1XO6 A;  2ZL3 A;  3PZK A;  2PG8 A;  3G64 A;  1JXZ A;  1Q51 A;  3WG5 A;  3HRX A;  3GF7 A;  5DU8 A;  1N6E A;  4ZU2 A;  3P5M A;  3LKE A;  3RRV A;  4JCR A;  4IZD A;  4OG1 A;  2CE3 A;  3M6M A;  4B3H A;  3T89 A;  3SLL A;  1O8U A;  3R9S A;  3V5E A;  2VSS F;  5KDR B;  4LK5 A;  3VIV A;  4QII A;  3QXZ A;  3HLN 1;  3K8X A;  3P85 A;  4HC8 A;  4ZDB A;  2WTB A;  5KDR A;  3KQF A;  4Q1I A;  3OC7 A;  4JWV A;  2VSU A;  3OT6 A;  1K32 A;  1VRG A;  3T3W A;  4NEK A;  3QRE A;  1FC9 A;  2CBY A;  2J5S A;  4U19 A;  1X0U A;  3TZ3 A;  3I47 A;  3GLM A;  3T8A A;  5G1R A;  1MJ3 A;  1HNU A;  5G1Q A;  3Q0J A;  4K3W A;  1NZY B;  3Q1T A;  3R6H A;  3T8B A;  4JVT A;  3U9R B;  4IZC A;  5JBW A;  4QIJ A;  4FB8 A;  2NP9 A;  4K29 A;  2J5G A;  5IKL B;  2FBM A;  1NZY A;  3KTG A;  5FUS A;  4JCQ A;  5CTB A;  4EMM A;  2DEO A;  3GF3 A;  3H0J A;  3U9T B;  2J5I B;  2A81 A;  1RJM A;  4Q0G A; 
#chains in the Genus database with same CATH topology
 1SZO A;  3V5I A;  3L3S A;  5E0N X;  4ZDC A;  3K50 A;  4EMP A;  3H0S A;  3GMA A;  1N6D A;  3BPP A;  3ZWB A;  3KTH A;  1J7X A;  4OLQ A;  3H81 A;  1HZD A;  1HNO A;  4F47 A;  3T88 A;  5INI A;  4GHN A;  2D3T A;  4JSB A;  3BF0 A;  4MXI A;  3KTK A;  1ON3 A;  4G2R A;  2QQ3 A;  4GM2 A;  4QFE A;  2ZL2 A;  4FN7 A;  4ASI A;  2VX2 A;  3H0Q A;  3QKA A;  1UX5 A;  2X58 A;  5CTC A;  3RST A;  2YJG A;  5DUC A;  5C90 A;  4ZDE A;  4J2U A;  3TVU A;  3TLF A;  4U0H A;  1UYT A;  3GKB A;  2X24 A;  2FW2 A;  1TYF A;  4NAR A;  3BEZ A;  3ZW8 A;  4KNP A;  2ZQR A;  3TRR A;  4JYL A;  1ON9 A;  2VSU E;  4JCS A;  1K39 A;  3JU1 A;  2VSU C;  3LAO A;  2ZL0 A;  3RQG A;  3MOY A;  3M6N A;  4I4Z A;  3PGQ A;  4MI2 A;  5MGB A;  4JOT A;  4ZDD A;  2Q35 A;  4FZW A;  1UYV A;  3TVW A;  4Z0M A;  1DCI A;  3DJA A;  4JJT A;  3ZW9 A;  2UZF A;  4KPK A;  5HUQ A;  4U1A A;  1UYS A;  1WZ8 A;  1Q52 A;  1UYR A;  2PPY A;  3A4M A;  5DKP A;  1W2X A;  4RYF H;  2BZR A;  4ELW A;  3ZWC A;  2PBP A;  2ZQQ A;  4RCN A;  4YLH A;  2VSU F;  2IEX A;  5INF A;  1OD4 A;  5E0S A;  4KD6 A;  2W3P A;  5DZK A;  3NJB A;  2GTR A;  4NNQ A;  1OD2 A;  2EJ5 A;  3IB9 A;  5DU4 A;  3QK8 A;  3QXI A;  3TT7 A;  4WZ8 B;  3A4N A;  1XNW A;  4ZDF A;  3ADD A;  3TDC A;  3Q7H A;  3QYR A;  3R9T A;  1XNV A;  5FIF A;  3KTI A;  5DUF A;  3ISA A;  1TG6 A;  3L8I A;  3DOR A;  2DUB A;  4MOU A;  2C8T A;  2J5I I;  5E0S H;  4GEH B;  5DZK H;  3R9Q A;  2VSS A;  4JFC A;  3AM1 A;  3NJD A;  4U0G A;  4I52 A;  4I42 A;  3MT6 A;  4FN8 A;  1RJN A;  3P2L A;  1WDK A;  1YG6 A;  3QWD A;  4ELX A;  1SG4 A;  5C9G A;  4RYF A;  5JBX A;  2J5G D;  1EF9 A;  3IBB A;  4FJW D;  4L8K A;  1DUB A;  4FZW C;  2VRE A;  3STA A;  3W8H B;  4K2N A;  1N6F A;  1FCF A;  1WDM A;  1EF8 A;  3PE8 A;  3N6R B;  5ING A;  4WCZ A;  4U0G H;  4B3J A;  4IZB A;  4JCT A;  2FZS A;  3KTJ A;  2A7K A;  5DL1 A;  1YG8 A;  3FF6 A;  3Q0G A;  4B3I A;  1Y7O A;  3SWX A;  1XNY A;  5DTW A;  4ELS A;  4FNB A;  3RSI A;  5G1S A;  2F9I B;  2Q34 A;  1PIX A;  4KWB A;  2F6I A;  4HNK A;  1PJH A;  3ST9 A;  2A7S A;  3H02 A;  3FDU A;  3H0U A;  2F9I A;  3IRB A;  3W8I B;  3PEA A;  4U18 A;  3MFM A;  4L6W A;  3ZWA A;  3U9S B;  1FC7 A;  4JYJ A;  1WDL A;  3R0O A;  2F9Y B;  4EML A;  4FND A;  3TV5 A;  2Q2X A;  4WYO B;  3IAV A;  2HW5 A;  3HE2 A;  1EY3 A;  5KJP A;  3ADB A;  3HIN A;  4DI1 A;  3TT6 A;  5DTP A;  2F6Q A;  2J5I A;  2VSS E;  3QMJ A;  2F9Y A;  3OME A;  2ZL4 A;  3HP0 A;  1XX4 A;  5DU6 A;  1UIY A;  4HDT A;  4OMR A;  3ADC A;  3MYB A;  1FC6 A;  1XO6 A;  2ZL3 A;  3PZK A;  2PG8 A;  3G64 A;  3AJM A;  1Y64 B;  1JXZ A;  1Q51 A;  3WG5 A;  3HRX A;  3GF7 A;  5DU8 A;  3O4X E;  1N6E A;  4ZU2 A;  3P5M A;  3LKE A;  3RRV A;  4JCR A;  4IZD A;  4OG1 A;  2CE3 A;  3M6M A;  4B3H A;  3T89 A;  3SLL A;  1O8U A;  3R9S A;  1UX4 A;  3V5E A;  2VSS F;  2P63 A;  5KDR B;  4LK5 A;  3VIV A;  4QII A;  3QXZ A;  3HLN 1;  3K8X A;  3P85 A;  4HC8 A;  4ZDB A;  3A4L A;  3RQE A;  2WTB A;  5KDR A;  3KQF A;  3L8J A;  4Q1I A;  3OC7 A;  4JWV A;  2VSU A;  3OT6 A;  1K32 A;  1VRG A;  3T3W A;  4NEK A;  3QRE A;  1FC9 A;  2CBY A;  2J5S A;  4U19 A;  1X0U A;  3TZ3 A;  3I47 A;  3GLM A;  3T8A A;  5G1R A;  1MJ3 A;  1HNU A;  5G1Q A;  3Q0J A;  4K3W A;  1NZY B;  3Q1T A;  3BPT A;  3R6H A;  3T8B A;  4JVT A;  3U9R B;  4IZC A;  5JBW A;  4QIJ A;  4FB8 A;  2NP9 A;  4K29 A;  2J5G A;  5IKL B;  2FBM A;  1NZY A;  3KTG A;  5FUS A;  4JCQ A;  5CTB A;  4EMM A;  2DEO A;  3GF3 A;  3H0J A;  3U9T B;  2J5I B;  3RQF A;  2A81 A;  1RJM A;  4Q0G A; 
#chains in the Genus database with same CATH homology
 1SZO A;  3V5I A;  3L3S A;  5E0N X;  4ZDC A;  3K50 A;  4EMP A;  3H0S A;  3GMA A;  1N6D A;  3BPP A;  3ZWB A;  3KTH A;  1J7X A;  4OLQ A;  3H81 A;  1HZD A;  1HNO A;  4F47 A;  3T88 A;  5INI A;  4GHN A;  2D3T A;  4JSB A;  3BF0 A;  4MXI A;  3KTK A;  1ON3 A;  4G2R A;  2QQ3 A;  4GM2 A;  4QFE A;  2ZL2 A;  4FN7 A;  4ASI A;  2VX2 A;  3H0Q A;  3QKA A;  2X58 A;  5CTC A;  3RST A;  2YJG A;  5DUC A;  5C90 A;  4ZDE A;  4J2U A;  3TVU A;  3TLF A;  4U0H A;  1UYT A;  3GKB A;  2X24 A;  2FW2 A;  1TYF A;  4NAR A;  3BEZ A;  3ZW8 A;  4KNP A;  2ZQR A;  3TRR A;  4JYL A;  1ON9 A;  2VSU E;  4JCS A;  1K39 A;  3JU1 A;  2VSU C;  3LAO A;  2ZL0 A;  3MOY A;  3M6N A;  4I4Z A;  3PGQ A;  4MI2 A;  5MGB A;  4JOT A;  4ZDD A;  2Q35 A;  4FZW A;  1UYV A;  3TVW A;  4Z0M A;  1DCI A;  3DJA A;  4JJT A;  3ZW9 A;  2UZF A;  4KPK A;  5HUQ A;  4U1A A;  1UYS A;  1WZ8 A;  1Q52 A;  1UYR A;  2PPY A;  5DKP A;  1W2X A;  4RYF H;  2BZR A;  4ELW A;  3ZWC A;  2PBP A;  2ZQQ A;  4RCN A;  4YLH A;  2VSU F;  2IEX A;  5INF A;  5E0S A;  1OD4 A;  4KD6 A;  2W3P A;  5DZK A;  3NJB A;  2GTR A;  4NNQ A;  1OD2 A;  2EJ5 A;  3IB9 A;  5DU4 A;  3QK8 A;  3QXI A;  3TT7 A;  4WZ8 B;  1XNW A;  4ZDF A;  3TDC A;  3Q7H A;  3QYR A;  3R9T A;  1XNV A;  5FIF A;  3KTI A;  5DUF A;  3ISA A;  1TG6 A;  3DOR A;  2DUB A;  4MOU A;  2C8T A;  2J5I I;  5E0S H;  5DZK H;  3R9Q A;  2VSS A;  4JFC A;  3NJD A;  4U0G A;  4I52 A;  4I42 A;  3MT6 A;  4FN8 A;  1RJN A;  3P2L A;  1WDK A;  1YG6 A;  3QWD A;  4ELX A;  1SG4 A;  5C9G A;  4RYF A;  5JBX A;  2J5G D;  1EF9 A;  3IBB A;  4FJW D;  4L8K A;  1DUB A;  4FZW C;  2VRE A;  3STA A;  4K2N A;  1N6F A;  1FCF A;  1WDM A;  1EF8 A;  3PE8 A;  3N6R B;  5ING A;  4WCZ A;  4U0G H;  4B3J A;  4IZB A;  4JCT A;  2FZS A;  3KTJ A;  2A7K A;  5DL1 A;  1YG8 A;  3FF6 A;  3Q0G A;  4B3I A;  1Y7O A;  3SWX A;  1XNY A;  5DTW A;  4ELS A;  4FNB A;  3RSI A;  5G1S A;  2F9I B;  2Q34 A;  1PIX A;  4KWB A;  2F6I A;  4HNK A;  1PJH A;  3ST9 A;  2A7S A;  3H02 A;  3FDU A;  3H0U A;  2F9I A;  3PEA A;  4U18 A;  3MFM A;  4L6W A;  3ZWA A;  3U9S B;  1FC7 A;  4JYJ A;  1WDL A;  3R0O A;  2F9Y B;  4EML A;  4FND A;  3TV5 A;  2Q2X A;  4WYO B;  3IAV A;  2HW5 A;  3HE2 A;  1EY3 A;  5KJP A;  4DI1 A;  3HIN A;  3TT6 A;  5DTP A;  2F6Q A;  2J5I A;  2VSS E;  3QMJ A;  2F9Y A;  3OME A;  2ZL4 A;  3HP0 A;  1XX4 A;  5DU6 A;  1UIY A;  4HDT A;  4OMR A;  3MYB A;  1FC6 A;  1XO6 A;  2ZL3 A;  3PZK A;  2PG8 A;  3G64 A;  1JXZ A;  1Q51 A;  3WG5 A;  3HRX A;  3GF7 A;  5DU8 A;  1N6E A;  4ZU2 A;  3P5M A;  3LKE A;  3RRV A;  4JCR A;  4IZD A;  4OG1 A;  2CE3 A;  3M6M A;  4B3H A;  3T89 A;  3SLL A;  1O8U A;  3R9S A;  3V5E A;  2VSS F;  5KDR B;  4LK5 A;  3VIV A;  4QII A;  3QXZ A;  3HLN 1;  3K8X A;  3P85 A;  4HC8 A;  4ZDB A;  2WTB A;  5KDR A;  3KQF A;  4Q1I A;  3OC7 A;  4JWV A;  2VSU A;  3OT6 A;  1K32 A;  1VRG A;  3T3W A;  4NEK A;  3QRE A;  1FC9 A;  2CBY A;  2J5S A;  4U19 A;  1X0U A;  3TZ3 A;  3I47 A;  3GLM A;  3T8A A;  5G1R A;  1MJ3 A;  1HNU A;  5G1Q A;  3Q0J A;  4K3W A;  1NZY B;  3Q1T A;  3BPT A;  3R6H A;  3T8B A;  4JVT A;  3U9R B;  4IZC A;  5JBW A;  4QIJ A;  4FB8 A;  2NP9 A;  4K29 A;  2J5G A;  5IKL B;  2FBM A;  1NZY A;  3KTG A;  5FUS A;  4JCQ A;  5CTB A;  4EMM A;  2DEO A;  3GF3 A;  3H0J A;  3U9T B;  2J5I B;  2A81 A;  1RJM A;  4Q0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...