4OG2A

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with leucine
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 140
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4og2A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4og2A01
4MPTA 4Z9AA 1QO0A 1XHEA 1W9HA 1ZGZA 4WUTA 3OMWA 4NCBA 2R25B 3OQOA 5C5CA 4RWEA 3CHYA 4PEVA 1QKKA 3EODA 2Q5CA 1QQAA 3H5LA 1JYEA 3D02A 4M88A 3HUTA 4Z9BA 3OQNA 1GUBA 4MQFA 2OENG 5KC8A 2IYNA 1FFGA 3HM9A 3ILHA 3W9SA 4JB0A 2O20A 3B2NA 4Y9TA 4ML3A 2B1JA 4YR7A 1Z13A 3Q41A 2FQXA 3MIZA 5F64A 1RPJA 2GKGA 1EWKA 3QLVA 4NCAA 2P4UA 1T34A 4F12A 5CHYA 1DRKA 5HM6A 4EYQA 3LUKA 4W5RA 3UKJA 3HCWA 1JYFA 2FN9A 1JFVA 2WJWA 4QICA 4MS4B 3SNKA 4N41A 1NTRA 4YLEA 4EGSA 1CEYA 4IILA 1LJUA 3FMVA 4XLTA 1ZVVA 4H60A 1A0OA 1GUDA 2IPMA 2JBAB 3RVNA 1BAPA 2WMYA 4LDZA 3RVRA 3CKMA 5TPZD 1NXVA 3GT7A 2E4UA 2OQRA 4E7OA 1RXEA 1USIA 2R48A 2W42A 1NXTA 1PEAA 4OATA 3DLHA 3URMA 4W5NA 1FFWA 2M98A 2N9UA 4O1HA 4PE5B 1RZRA 4EVSA 2CWDA 3C97A 5EWLA 4QYWA 1F51E 4PYRA 3O2SB 5EWJA 1U8TA 1TLFA 1Z17A 1L5YA 4RXTA 3HDVA 5DTEA 1Z12A 3F73A 4RK4A 4TN5A 4YO7A 4Z4IA 3QEMB 5JNWA 4LX8A 3GBVA 4MS1B 3MQ4A 2TMYA 3C3MA 5KQGA 1YTUA 2WJAA 5FWXA 5DGCA 2GX6A 1KGSA 1PEYA 3F6PA 3QLVC 3CZ5A 3L6UA 2L2QA 3JTEA 3LOPA 3RQIA 1BVHA 1LJLA 3EQ2A 1QP4A 3O1HB 5JS2A 1E6MA 2HQRA 1TVMA 3N0WA 5JNVA 4ETIA 6ABPA 3BRSA 2DRIA 1DRJA 5C5EA 4Z4FA 4HNQA 3H6HA 1JL3A 4KK3A 3LTEA 3CG4A 5T7BA 2LBPA 4ZMRA 2MSKA 3MM4A 3EQZA 4MS3B 5BRAA 3RVQA 1QP0A 4IMJB 4YGXB 3QEKA 2R47A 3CLKA 5IULC 4H3HB 1Z2DA 4LE2A 3HS3A 2IOYA 4OLAA 1DCMA 3LKBA 2L18A 4G0XA 2GBPA 2X7XA 1B00A 5KI6A 1NATA 3KG2A 3KYIB 5TE9A 3OO0A 4MRMA 2VK2A 2FEWB 1DJMA 1P2FA 3O1IC 2IPNA 1NXPA 3N53A 3IP5A 3IP7A 4QPJC 1DBQA 4MLDA 3OLVA 4RKQA 1OXKB 3NNDA 2ID7A 3H6GA 1XWWA 4P98A 2FMKA 2CHEA 2LP4Y 2P9HA 2AYZA 3A0UA 5IEJA 5FWYB 5BQ3A 3HUUA 4RSMA 3QX9A 1SXGA 4KZKA 1EAYA 3RVKA 2RDMA 3N75A 4F8JA 1WETA 2JRLA 1YS7A 1JFTA 1TJYA 1ZDMA 4WZZA 1U0SY 4G97A 1Z26A 4S04A 7ABPA 3L49A 3CZCA 4RXUA 3H5WA 5KQLA 4WXEA 4CBVA 5IC5A 4N03A 5B3JA 3N8IA 2NT4A 4KQ9A 3CFYA 1Z15A 3TD9A 3G85A 1F4VA 2A9OA 3LUAA 3M9WA 4OTZA 4KNYA 4F3TA 3NBMA 4G0PA 4LZLA 4WT7A 3OO1A 1D4ZA 3Q7TA 5DCLA 4Q6WA 2B4AA 2ID9A 3RVSA 2IPLA 4MR8A 4XAQA 1QQBA 4FB4A 2WRZA 5TQ0B 3RVMA 1W25A 4L4UA 2AYXA 1YMUA 2QSJA 4MR9B 4JB2A 2JK1A 2V0NA 1U04A 2HQBA 5TQ2A 3KTOA 1J56A 4JA2A 4TMYA 3RVJA 2QV0A 1ZH2A 1A04A 1EHCA 2HQOA 3Q15C 2QVGA 3H75A 3QELA 1ABEA 3HEBA 3RH0A 3NHMA 5JNTA 2ZWMA 3I5AA 4EVRA 3SQNA 2QR3A 4G0YA 3OLYA 1D1QA 3FFTA 1BDHA 3N6VA 3UUGA 3H5OA 2FEPA 2QVCA 3O75A 5DKFA 2IKSA 2L17A 4Z99A 1FQWA 2QU7A 2WY2D 3TB6A 3C3WA 3KJXA 1JH9A 3JVDA 3MYYA 5B3JC 1IIBA 1L5ZA 4RK5A 5T3YA 2RGYA 1DZ3A 3KSMA 3MA0A 3LMKA 3HK2A 4MAAA 1PNRA 3IP9A 3OMXA 1C4WA 2PL1A 2E4VA 2L19A 1ZITA 4W5OA 1Z25A 2FMFA 4IF4A 4G86A 1USGA 1AB5A 2FMIA 4MQEA 2PUGA 4F06A 2PLNA 1NXWA 2IPAB 2CHFA 5BR1A 1OXBB 1CYEA 3HSYA 3C3KA 5D2CA 3LFTA 3I45A 4MLCA 5EWMA 2FQYA 3ROFA 2H3HA 3P9YA 1Z2EA 1ZN2A 5TPZA 5JNUA 4KK4A 4OLBA 4TLLB 1USKA 4N47A 2F8TA 1BA2A 2E4XA 1MIHA 4MQFB 4Z4CA 3OLWA 6CHYA 3KKEA 4LRQA 3HZHA 3BRQA 2FVYA 1U2QA 4KQCA 3OQMA 1P8AA 4ZJPA 2PMCA 4N76A 3LUDA 3DZDA 4RK7A 3F7NA 3H1GA 4UHKA 1PNTA 4RKRA 1K66A 3LUGA 4EVQA 4P1ZA 4KPYA 3ILYA 1CHNA 2R4QA 1R8JA 3H5VA 4PZ0A 2FQWA 1DG9A 2JVIA 3H1FA 4FE4A 3IDOA 3A10A 4MGEA 2F8SA 4YCSA 3RVPA 5CNIA 2MYNA 2LUOA 3EGCA 3Q7SA 3K4HA 1TMYA 2HPHA 3IPAA 4E7PA 4WWHA 1ABFA 2PAFA 4N0PA 3KHTA 5KWSA 1D2AA 3JY6A 3BREA 5JNRA 1AB6A 1NXSA 3A3KA 3HDGA 3C6QA 4Z4EA 1LBHA 2NZVG 3GWGA 4O5AA 1YVUA 1GCGA 3DBIA 3DGEC 3T6KA 1JFSA 2H0AA 2FEKA 2RJNA 3OM1A 5EWLB 5FBKA 5KC9A 1ISSA 2FN8A 4MS4A 4XASA 1JLKA 1ZESA 4RXMA 3LUCA 2XDYA 5EWJB 3O2JA 4QYMA 2FLWA 1UDRA 1YK1A 4JOQA 2JBAA 4PICA 3IPCA 1QO0D 3JS5A 5GOTA 1QPZA 2J48A 3RVLA 3BILA 1SXHA 2FMHA 2A9PA 1RXIA 3R0JA 4JP1A 4ETNA 3KCNA 4KREA 5FWXB 3VNBA 1Z18A 4ZYLA 4IMIB 3SM9A 4TLMB 1U2PA 1DCFA 4GPAA 4KV7A 4HNSA 4Z4HA 3H1EA 3G1WA 1YS6A 4KFCA 4Z0NA 1DC7A 2QW1A 5DLEA 1E6KA 2ZAYA 1VPWA 1H9CA 3HXMA 3GYBA 4HNRA 4Z4GA 1TM2A 4MYRA 3LUJA 1JDNA 2MYUA 1NY5A 3O2QB 3O21A 2YHAA 1EFAA 3JVIA 1M5UA 3SAJA 4OG2A 5TQJA 3EJWA 5PNTA 3QEMA 5BRJA 2WB4A 4MS1A 1ZHHA 3LUHA 1M2FA 3FFXA 4RDCA 2HSGA 3KS9A 1DC8A 1SD5A 3QLUA 1DBWA 1M2EA 2NZUG 4G0MA 5KQMA 4JAVC 3T8YA 3VNAA 4RK0A 2PE5A 5JNSA 2FTKE 2MSLA 3Q9SA 1ISRA 4IGAA 4MRMB 2JB9A 2PL9A 3LKVA 3CTPA 4RS3A 5IEBA 2FLKA 4LE1A 1HEYA 2PJUA 4ZMSA 1I3CA 1K68A 3FDFA 3JPWA 3CNBA 3I09A 3N0XA 4RK6A 4MR7A 4MS3A 4O1IA 1P6QA 4N0QA 1MAVA 3I42A 1LK0A 1RZRD 2LIVA 1BDJA 2JCGA 4G0OA 1C0EA 2BGGA 4KVFA 5CNKA 1KMIY 4RU1A 1YMVA 3NNSA 4RY9A 3A0RB 1NXXA 2MYTA 3HVRA 1JX6A 2LPMA 2MSWA 1EWTA 4LE0A 4D6YA 4XARA 1ZH4A 5HQJA 3GRCA 1URPA 3CS3A 3ROTA 8ABPA 1JDPA 1NXOA 3NHZA 3E61A 4RK1A 1QP7A 3EULA 2JVJA 3SG0A 2VUHB 1A2OA 2PUEA 2GWRA 1SXIA 3BBLA 3OM0A 4XFKA 1Y1LA 2CD7A 1KRXA 3JPYA 4Q6BA 2YHBA 3GA5A 5TPWA 5HKOA 2PUBA 2A9RA 1JHZA 4G0ZA 5FWYA 2I6FA 4YWHA 1Z16A 3SY8A 2QZJA 2RJOA 3FGZA 3QLUC 5IUKC 3GL9A 1MB3A 4MR8B 3H5TA 3O74A 3GV0A 1MVOA 3H5IA 1MB0A 1RNLA 3T38A 2FSPA 1P6UA 4ZPJA 4UHJA 4OBBA 5TQ2B 4G0QA 4D6XA 3E3MA 4YP9A 2FKAA 3DLBA 2M1ZA 3Q7RA 1FFSA 5IBQA 1GCAA 4B09A 4RY8A 1D5WA 1KRWA 4EY3A 1QMPA 3O1JC 4D74A 4Q7EA 2PKXA 4HYEA 1EWVA 5KQPA 2IDMA 3RVOA 3QELB 2PUFA 2FXIA 3FFWA 5GQSA 5IX8A 1GLGA 1S8NA 3UK0A 3KLOA 4FE7A 3S99A 2PUDA 3EDCA 1VKRA 4GNRA 3HO1A 3LUFA 1QNLA 3N0RA 5HSGA 1DBPA 3D8UA 5TQ0A 2WWVD 1DP4A 4MR7B 3F6CA 3IP6A 3K9CA 4MR9A 5FBHA 3TX6A 4YV7A 1E2BA 5JS1A 4KRFA 1YIOA 2NUBA 3MF4A 4NICA 4DADA 2A9QA 5CNJA 4W5QA 2PUAA 4JASB 4NV3A 4YS6A 4WXMA 4NQRA 1DCKA 2E4WA 4XXHA 1JWLA 1BDIA 2NT3A 1PUXA 3MMNA 1XHFA 2E4YA 4DN6A 1SRRA 3KYJB 9ABPA 4KMRA 3OLZA 4L85A 4MQEB 1M5TA 2GI4A 2JVKA 4RY0A 1VLZA 4H3KB 1PHRA 5ED4A 4ETMA 1ZAYA 3TMYA 2FW0A 4RZSA 3TO5A 3OLXA 5EWMB 4S05A 2KYRA 3EAFA 3QLTA 4EUKA 4EYGA 5TPWB 1FSPA 5CNMA 3CG0A 1APBA 2HJ9A 2VUIB 3T95A 2E4ZA 4RV5A 3M9XA 1LBIA 1D1PA 4DQDA 4EYKA 4W5TA 5E3JA 4YRZA 4IRXA 5ABPA 4LDAA 1E6LA 4F11A 3M6MD 2VYCA 3HV2A 4EYOA 3HJFA 1JF8A 3QX8A 3KLNA 2PUCA 3CU5A 3NNNA 3QK7A 2QXYA 5IUJC 5IUNC 1JBEA 1ZY2A 5I4CA 2MYPA 3CRNA 3DGFC 3GBPA 1ZGGA 1YK0A 1VRVA
chains in the Genus database with same CATH superfamily
3VHQA 3O4FA 1RP1A 4PX2A 5G0WA 3TNYA 4WUTA 1ZS9A 3DTVD 4OIMA 5GY7A 2R25B 2CSUA 4NCBA 5IVDA 2CGEA 3N58A 4RF2A 3H5LA 4J0QA 4UEWA 3ZI0A 1RLUA 3GU3A 1WXXA 1SZJG 3I9MA 2E85A 5EHIA 1UBKS 3MWDA 2EBFX 4FNOA 2OV1A 3CJQA 3NH9A 4BE7B 1EG2A 2IYNA 4DY6A 2CHUA 1GAEO 3U4DA 3ILHA 3OZSA 1YDMA 1Y7IA 2PQ6A 2FETA 3K9HA 4I81A 3IVRA 4Y9TA 1G7TA 3R9WA 3Q87B 1XTIA 5C8YF 2ZROA 2GKGA 2R8PA 1VBMA 3R2JA 4GMFA 4LGVA 2B5OA 3VO8A 5FUQA 1PWZA 2CL5A 2GCOB 2WLTA 3AEUB 2ZJOA 1H0HA 4MW5A 2Z5FA 1SPXA 5FL7A 1YZFA 6AT1A 2CXSA 4BFTA 4PF1A 3VH1A 2ZBVA 2D0DA 2WJWA 3T7CA 1IZ8A 1JT2A 4RD4A 5KU1A 4H16A 4XB1A 4D3YA 4XLTA 1GGVA 1PD0A 3ZJ4A 2H07A 4MCJA 3RS2A 3HYLA 3JQBC 2EYQA 4TSKA 3QSYA 1WAMA 5M7EA 4R16A 2ZVPX 3DM9B 2GMWA 5AJVB 5AOCA 2OXRA 2PDAA 1TOAA 4A6DA 3DV9A 1MC1A 3WLLA 1M2KA 1YU9A 2Q5HA 2R48A 1NBIA 1LVGA 3F6SA 2FWMX 4KQFA 3URMA 2FSIA 4PCLA 5TRTA 4DV3B 1EX9A 3GLHE 3SNHA 3ZJUA 1X1DA 1R4AA 1YQ9A 2MR6A 3GFFA 3NJ8A 3MEQA 5THQA 1AD2A 5K05A 2GKOA 3TOXA 4C0WA 3Q8KA 1ZUNB 3ER9A 4IIFA 3DD1A 5IBRA 4FHEA 1TLFA 4ATNA 1L5YA 3F73A 2DLDA 1T36B 1HZJA 3BN3A 2W2QA 3SLGA 5JS8A 3Q9NA 1CQJA 3VHRA 3PC7A 1PT5A 2EL7A 1P60A 1XDSA 5H81A 3THRA 3WHPA 1YTLA 2ZFUA 1O89A 3SXJA 3UO8B 5EMMA 2YKGA 2CUTA 2J6IA 2BTEA 1DKQA 2W2KA 3QXHA 1ZBDA 1BVHA 5DB4A 4DIDA 2A30A 4A1FA 4AYWA 3HXKA 1TI7A 4XSGA 2QPOA 5B4UA 5M2QA 1RJGA 3OUZA 2QX7A 1MXFA 1BKSB 1H23A 3R40A 1UFRA 4FCVA 4CUKA 4Q7QA 1W88B 2CJFA 2J5RA 4YGXB 3WKAA 5ALWA 1IN5A 1TKBA 3FPLA 4HGOA 5LBTA 5A9TA 2GM5A 2RE8A 1BCSA 1CJSA 2XDQA 1W4LA 2W2NA 2D3TA 3SYKA 1SGWA 1Z2CA 4QOIA 3DOIA 1CF2O 3ZQUA 2QVLA 3B9PA 3B85A 3ZYCA 3GNSA 2DJ5A 1EFLA 2GBPA 3C3YA 3E8SA 3O95A 4OYHA 3KHSA 5J4HA 1EXMA 4Y6LA 2GXSA 5CM9C 3AM4A 1YZYA 3QA9A 521PA 2VFAA 1E59A 2VA8A 4M1TA 2CXRA 2BZ1A 4TPKA 4OQMA 1U4NA 5JCZA 3F6RA 3SPXA 5JHGB 4DBZA 4L5JA 1KI6A 1QR6A 3LV8A 3QBTA 1R5NA 1RRFA 2D2VA 4Y6GB 4ND5A 5CEFA 2LP4Y 1X7ZA 1E3IA 1W46A 2FY8A 2HNKA 1Z2NX 3HUUA 4QE3A 1FMCA 3LDUA 5FUBA 3DDOA 4UXHA 3AL2A 2EBHX 1PZFA 1KNQA 2XQIA 1THZA 4P82A 4P58A 1Y3BE 2EJCA 4HAWA 3FHJA 4G56A 4WOBA 1JRLA 3NORA 1NBWB 1VCMA 5KQLA 1XSEA 2NZWA 1SKQA 3RRJA 1IUOA 2HMAA 1A9RA 1UEXC 1G98A 4DA9A 4Y2VA 2J3EA 3N28A 3UMVA 1EFHA 2CNOA 4QGAA 2ZCVA 3R41A 2PWZA 4TXNA 3DHWC 5AM1A 4ARZA 4E13A 3GAMA 1ID8A 1JIQA 2WILA 3ANNA 3AHGA 3FETA 4OTZA 1VMAA 3SJAA 5BWBA 4CM5A 4LC9A 3KYBA 3JZIA 3IAS6 3QPWA 3QYAA 1TYEB 2FAXA 3IPYA 3OAAD 5AM0A 4AZWA 1M0SA 1Q6YA 5D6OA 4BP3A 1JJ7A 3NALA 4XAQA 4YYZA 2ZUVA 5CVCA 2R6CA 2Q3BA 3RBZA 1WHTA 4NOLA 3THOA 4F5EA 4QHSA 1HDEA 2YIVX 4OA8A 1G2PA 2O4UX 4DV4B 3K2BA 4UUPA 2OAP1 1CS4C 1KO7A 4DIBA 2IE0A 5AO9A 1XPRA 1OZAA 4TMYA 3C6XA 3SICE 4P3NA 4RL6A 1AA6A 2H7YA 2TS1A 5JLJA 3DLIA 3ESBA 4L74A 3UBMA 1OCEA 1R10A 4IO0A 1KVQA 4QUHA 4MZDA 2HQOA 3LBIA 4QOJA 4U2GA 4JFAA 3HI4A 3REQB 5LQKA 4ZOCA 2HCTA 3S8YA 3HXPA 5LLTA 1FW8A 1Q14A 2JIDA 3E03A 4M9QA 3HJAA 3IMKA 3T9DA 2PN1A 3HY6A 3CVUA 2QJTA 1J0AA 1WCV1 2VPQA 1O58A 4HUTA 2J31A 3LDFA 4ZT3A 4K9SA 1PV4A 2H06A 1D7AA 1H9BA 2QVCA 1ONSA 3H5OA 1V16A 3E1GA 3H9UA 3PS9A 4JVSB 1IJBA 4TKUA 1MJ5A 4BTEA 3TF5A 5KOHB 3ZDXB 4MDFA 1HT3A 2J08A 2NP6A 3Q6NA 3FTNA 3MCTA 2W00A 2CB9A 3F7MA 4RVSA 5CH5A 1NPTO 2GEDA 4JEUA 1GNSA 4L57A 1KS9A 1TDJA 2ZR0A 3KXPA 1LLCA 5T3YA 3RUIA 4CM8B 3UHJA 5ITVA 2IIVA 3PNSA 2W6NA 1TUEA 1T0JB 4B6OA 5K3FA 6REQB 2FUG6 1DUIA 3DOEA 1SD1A 1ESEA 3H9GA 4KU4A 3GAAA 5DBEX 4ZZIA 5JR3A 1USGA 4XIJA 3OZUA 4D98A 2ZIZA 2C8LA 2CXQA 2P4SA 3IT3A 1K9VF 1ZVKA 2I8AA 3DDCA 5H0IA 4L0QA 1U3TA 2XLCA 4PS0A 3SQXA 3QE9Y 1RCTE 2JA1A 4TV9A 2GD2A 4HUQB 3LAWA 4OXNA 3ZE0B 1TIPA 4RVOA 1YGPA 4RTOA 2O06A 4PY2A 1XRJA 1GQYA 4A9AA 4C2BA 4TLLB 4Y30A 4NXMB 1CUYA 4N47A 5UKDA 2F8TA 1OIXA 3HYTA 1HNXB 3A4TA 1SHKA 2BHTA 3SZLA 4DKJA 1HLDA 2FEMA 3KKEA 3FFAA 4H7PA 4WHMA 4IOMA 4FMBB 2BD0A 4U7TB 4ZQEA 2H2WA 1YV9A 1Z37A 4UJ5A 3GOHA 4X8HA 1RZUA 4KKXB 3U60B 2IX3A 2ZSBA 5HCIA 4A2QA 2IWRA 4J1TA 4EPXA 4QFMA 1LWNA 1B73A 1Q20A 2R4QA 5D3QA 3PITA 3THYB 4ZJYA 4CNBA 3O73A 3D5EA 1WQ1R 3H1FA 1IM2A 2BAGA 1X8XA 2VDLB 3UT0A 3E7FA 1KEWA 1X80B 1AUPA 2ANBA 3PT5A 3QITA 4JIGA 4KGDA 4RD1A 4E09A 4EH1A 4HNTA 5IDXA 2ES4A 1MCZA 4XWKA 4EATA 3K5HA 4NZZA 4P92A 5KCZA 1TEZA 2CLKB 3FOAA 4CF5A 3STXA 5CDYA 4IJKA 5CB0A 1ZMTA 3UPDA 2JD2A 3JY6A 3LXUX 2QNRA 1RADA 5DO9A 1NXSA 1KEEA 3FAZA 4GNKA 3F5FA 5IXSA 1PV2A 2HTEA 2PANA 5DW0A 4DQKA 2GAIA 1E3LA 1P9RA 5LYJF 1JFSA 5FBKA 3MINB 3C3XA 3AERA 3IVMA 3KZOA 5DOVA 1ULBA 4MVJA 4P35A 3GJ6A 4B8ZA 1PX2A 4HWPA 3RS0A 4HQ6A 2EHDA 4URVR 3U4QA 1HNNA 3IT0A 2XTMA 3G68A 3O2JA 2YDXA 2OFPA 4HZUA 1T2FA 1DAEA 1X70A 1KBZA 3UH0A 4ZEVA 3TM4A 4G1EB 5C4IA 2QG6A 4YVFA 2IV2X 4JVMA 3ZHBA 5EIXA 5FFNA 2B94A 1R4MA 2XB6A 3F78A 1HFJA 4MWOA 4V0ME 4MVJM 1SOVA 4K40A 3BXPA 4HLNA 1DCFA 1MTOA 2I2AA 4TZKA 5B58T 2VNKA 4B32A 1OWPA 5C80A 3G1WA 4KFCA 5TF4A 2HHAA 2OUKA 2HT1A 4U7HA 1YBAA 4XD2A 1T1EA 1VPWA 5L45A 4MDYA 2EL9A 3EY4A 3CM0A 3EFHA 3JQRA 1NY5A 3O21A 2GM3A 2QT9A 3KKLA 3N2GB 3P9RA 5CX4A 3WGUA 3A9SA 1MR3F 4OG2A 3JQDA 3WMGA 3EJWA 3KSUA 4E5UA 4HYQA 3GG2A 4KLNA 4MUEA 5C81A 3PGJA 2V7QA 3ZIDA 1Y9DA 2A86A 3QGMA 1EHIA 2XGOA 2CV0A 1Y6JA 5HE9A 1GPNA 2AHRA 4K46A 1QP8A 2WJJA 3ZWVA 1UAAA 1QRRA 4J90A 4IWYA 4ZVMA 3T8YA 2Q46A 5EPOA 4UOZA 3D6UA 2W48A 2PL3A 2DPXA 2X9QA 1GITA 3OZEA 2QRNA 2CUKA 3IHKA 4MRMB 1Z3CA 2PL9A 4FHGA 1GA6A 2XYVA 4O1MA 1QS0B 4PC3A 4W1QA 4LRSB 3RSFA 3KEGA 1OXMA 2F67A 2GVNA 3B13B 3KALA 3VJKA 3ZH9B 4EMTA 2F9FA 1GAJA 1I3CA 2YY6A 3PCTA 5FBRB 2EKZA 3L43A 3N0XA 2A58A 2RMKA 4L28A 4R05A 3FTCA 4IKOA 2HU2A 3RYIA 3SR0A 4UTOA 2IHBA 1BYIA 3AEYA 1P2UA 4RIHA 2AN9A 1ZA2A 1ZSNA 2JCGA 1USVA 3P32A 4DNPA 4NP6A 4KR7A 1W2WB 1FY2A 5JSHA 1XXHE 4BNKA 2MYTA 3ZU5A 2CCJA 1JX6A 2WJGA 4LXYA 1C3EA 3HKCA 4FEYA 4CTKA 3ILXA 4L08A 1B0AA 2KW5A 1ISIA 4YAJA 1NUAA 2C59A 1OZHA 5SYMA 4YFYA 2HJHA 5JDCC 2VH1A 2DERA 3KKOA 3BGOS 4CG3A 2FXVA 2WMDA 3VAZA 5HUHA 4DC0A 1M67A 3DMDA 5G3ZA 1U0EA 2O3RA 3OOWA 3UYLA 4DIKA 5KSOA 5EERA 3GA5A 4CKXA 3A1SA 4NENB 3OVMA 2HJWA 1JHZA 1HY3A 1MRZA 4BNWA 1NYTA 3AHFA 1QTRA 1T5SA 3A9CA 3FUTA 4FFBA 4AP5A 2RJOA 1OD6A 3PHGA 1X7WB 1BRMA 2BJHA 3ER8A 3HWRA 1SVOA 4PONA 1MVOA 1LKZA 2JGIA 2Z1NA 5JFOA 4E21A 4EG3A 4IM7A 4UE2A 4MVJP 3ZBPA 1LBEA 4JNKA 4PX9A 4EW1A 1H2EA 3H2JA 3WK6A 3VUFA 2HSZA 3UCEA 3L1IA 1KJ9A 1SB8A 2FSVC 4KKVA 4DMHA 1JHXA 4NPCA 3GAFA 5FF9A 4EY3A 2QL5A 1TCBA 4HDNB 4J2HA 1YU6A 2VI5A 3KIPA 3MGBA 4IW3B 2IDMA 2XQGA 2XQJA 3B36A 4LKOA 1K8RA 2FPIA 3BD9A 5AD1A 2WYIA 3R7FA 2ZDQA 5IX8A 4YASA 3TRIA 3E1SA 4KE9A 4N5NA 1PGJA 2F7SA 1OSNA 1ZNYA 2REOA 3H5RA 3ORQA 3RDPA 2VRBA 5CXXA 1YFJA 1Z62A 1QNLA 3N0RA 4LVOA 1UC9A 3B3AA 1N4DA 4WTOA 3SXUB 4B3BA 2B25A 4JLVA 2OCXA 2XBMA 3BB1A 1SCQA 3CX8A 4ALNA 3TX6A 1IUKA 1PFYA 5AM2A 2VZ8A 3CEHA 3PVZA 1T5HX 1ZX1A 3Q11A 4D79A 1LXCA 4MA4A 4N8DA 2C84A 1T8UA 1T0BA 1A2KC 1VPDA 2PJDA 4YS6A 2NVOA 1U90A 3IEIA 1QIGA 4US2R 1DCKA 2WTEA 4DV5B 1JWLA 3AV0B 2P40A 2UYYA 1SOAA 1AIPA 1D9XA 2WF7A 2VLBA 1XHFA 3FB4A 5GADl 2IYYA 4Z3DA 3NATA 3OIGA 3LA6A 1E3DA 4ACAA 3IGFA 3KSZO 1U2RA 3OTWA 1E4YA 2H16A 1Y1PA 2AMVA 2WKWA 4GDMA 2I76A 3A04A 3TOZA 1GPWB 5A0FA 1KVSA 1RHRA 4UU8A 2ZAGA 2VUUA 5HUQA 5IJZA 4JT8A 1QHIA 1E2IA 1Q0TA 1VHDA 3SE0A 4QPPA 3RYCB 2VBIA 3KZCA 4PAGA 1XDUA 1RQNA 3V3KA 1OXVA 5AKYA 2VT2A 4R2XA 1UBSB 2CYAA 4O59O 5KO2A 4PBTA 3KPWA 3V4SA 3KKZA 3CPHA 4UZEA 1ORVA 1QDEA 2A9JA 1GGMA 2H08A 2WAYA 3INYA 1JE0A 3OCXA 5TQVA 3RTEA 3TM5A 1AT1A 3PZRA 3NEYA 3AV3A 1R5JA 3QRWA 4GPZA 3UOAB 1G2QA 3HJFA 3BZUA 1M1YE 5IUJC 2OM2A 2R44A 2VDUE 3CWCA 4RF4A 4ZDJA 3NQ41 2B92A 4CFSA 4QZVA 1J5EB 3QWAA 4M36A 1ODJA 3OPYA 2YZNA 1WV1A 4E51A 4EAAA 5CLIA 2A0FA 3M1LA 4PYIA 1NVFA 2H2DA 4G6ZA 4PG7A 4K28A 4EY7A 4LBVA 4TM8A 4MV8A 5CIWA 3HJGA 1NMQA 2FFRA 1VA4A 5A3QA 1W5FA 1VLVA 3D02A 4QQKA 4FDVA 2GRAA 2ORED 5CLGA 2BKVA 2XQKA 3CO0S 4TMKA 4BQFA 2VQ6A 2PD3A 3R1IA 3VTFA 1ONPA 1NUTA 3B2NA 1WNTA 2XNJA 2AUMA 5LQAA 2B1JA 5FOUA 4O02B 3RS4A 3WQRA 1PFKA 3QF4B 2DBZA 4NVRA 4FFRA 1AKRA 4LJ8A 3KKMA 3FVRA 5EG5A 5LZ7A 4E3WA 2WOJA 1QE0A 5CURA 3P94A 4F84A 4RAQA 3KP1A 1MQ8B 2DPMA 2F1HA 1FDVA 3TSAA 2O7RA 5JXHA 1N3LA 1VLLA 2QIPA 1LGYA 3G0BA 2FWPA 3TZ6A 3ZDQA 4ED9A 3VJRA 5CFZA 2XGSA 3O7MA 1KMNA 4MS4B 4ZODA 2O8EA 3A14A 4HVTA 1LDMA 3IKLA 1LJUA 1OWLA 5F7OA 1ZVVA 1WHSB 3MBKA 4AYXA 3WLJA 4I6JA 1XAGA 4BXOA 2JBAB 4Q9HA 3NEAA 1QIDA 4KVGA 4AY4A 4M7OA 6LDHA 2YZGA 1JG1A 1UFOA 3Q10A 1Z82A 3WVNA 4EI9A 2VDRB 1AQIA 3O82A 1USIA 1B1CA 1WCYA 4GE0A 5EXTA 4GYWA 4KSYA 2IYFA 1T5OA 1XZIA 3KZKA 1BMDA 2OESA 4XTCS 2UKDA 1CEXA 1EFTA 1FRFS 4BB0A 1L4MA 3SZRA 1MX3A 3QMVA 1DTEA 3W1WA 4ZXPA 1ESZA 1B0PA 2X23A 2CJYA 3KJIA 1TF7A 2G76A 1F0PA 2HIHA 2ZI5A 2HRDA 3T34A 4EJ0A 2ZQZA 5JYCA 2FP4B 3HYCA 4RK4A 1KDTA 2Z8YA 2VHVA 3GZJA 1E2HA 1SVKA 4WK4B 1LLUA 1QRDA 2NNLD 2VTDA 3RHSA 4AICA 4B3FX 1K7XB 3UYKA 1FTNA 3QVWA 1JAXA 1CRWG 3T15A 3RUEA 5AVRA 4URFA 1YKGA 1SXJA 2AFIE 3KUXA 4EFMA 5JE8A 3DEJA 2V7UA 1VMIA 3ILVA 4DM7A 3QA3E 1H8ED 1PR0A 1SWWA 3CZ5A 3PNYA 1QKJA 2JKZA 3GFSA 1KFEB 4X65B 4GX0A 3GLRA 3SYLA 2NTVA 4L9AA 4P4SA 1VE5A 2JARA 1BQ4A 2Z8YM 4G8JA 4KLCA 3AI2A 1Z6YA 1SCDA 4KH1A 4UD2A 1BKYA 2A9KA 3EXHC 4BPRA 1AXGA 3EFBA 1IRXA 1QLWA 2C4WA 5F4ZA 1QP0A 5HK8A 4TYNA 3KJHA 4H31A 3S55A 3K6RA 3TZCA 2I33A 2P2DA 2DY0A 2OBYA 3GVPA 5B1DA 4FHZA 3LHDA 4DDKA 4TWBA 3O8LA 3HS3A 4FI3F 1SPBS 4L6IA 4MPJA 4UQPA 2NSHA 1ZM4A 4R2KA 5IK2A 2L18A 2C2MA 4G0XA 4WPGA 3RWOA 1AHIA 1SVLA 4TLAA 1M66A 5REQB 5LMCA 5E1MA 3QE3A 1GSIA 3KM0A 4MW2A 4YJHB 2VF2A 1W4ZA 2C20A 2OBXA 4GWLA 5CK5A 4BJ3A 4UUMA 4J0EA 5DI3B 3WADA 2IPNA 1NXPA 1PTKA 1Z88A 1J49A 2GCPA 1Z7YA 3G0CA 3IP5A 4I2VA 3TDNA 5LYJB 1YQEA 3E81A 3ABQB 2D3WA 1FVXA 1OXKB 1R0BA 5CCEA 1BMTA 5BW5A 4JIMA 5F98A 3EQ6A 1MA3A 2Y1KA 3ZUPA 1JJAA 5FORA 3D3JA 1TM5E 2JJQA 2QMEA 3D4IA 1E2JA 2VSOA 3FRHA 1WG8A 4IZOA 4MV1A 4OJYA 2I4LA 1JLLB 4E4YA 1P2TA 1E3JA 3UJ3X 1GN8A 3B9QA 5KMGA 7ABPA 2Z5LA 4YGYA 4BATA 3QKSA 3G5MA 4F2HA 1UK9A 3LWDA 2C54A 4D43A 4DSTA 1KDPA 3M89A 4JI7B 5I5EA 2G5GX 4D8UA 3PLAE 2O57A 3AP3A 4M86A 4BJ6A 4C03A 5L3SA 2RGRA 5K3AA 1PQWA 1VMKA 1W5SA 3LRXA 3VDMA 4CM7A 3VPDA 2Q5EA 4TLEA 2J59A 5AUQA 1IY2A 2PV7A 1IXZA 2O1XA 1JNXX 3IALA 3O3CA 5DTJA 3FHTA 2NQ8A 2KJQA 4UDNA 1CIJA 1T2AA 2YINC 3KWMA 4N65A 3A6DA 2IPLA 2C9YA 3ISTA 5CPFA 2JI6A 1ZC4A 2KLHA 3K0CC 3VHXA 2NXNA 4BO7A 4A15A 1UZAA 2MOKA 1QK3A 2R751 1W4CA 4GOMD 1CFJA 4O2BB 4L4UA 3OE7A 1JUDA 1Y4AE 4RA6B 4CXMA 3QFTA 1BE6A 4JB2A 4XB6B 3H0EA 3L1JA 3NRCA 1OI7A 2AXQA 4QDZA 1UMDA 3ZK7A 4Y67A 4MIOA 5BW6B 3ADPA 2JLRA 1ZD4A 2XZOA 2OM6A 5BR8B 3TLBA 4KFRA 3KQVA 1L1RA 1UKEA 3Q15C 2R6HA 1OFVA 4Z5XA 5KTPA 4OGKA 3RQSA 3QELA 2XKKA 5AK3A 1U80A 5FA5A 1IZZA 1RXCA 5CT9A 2Q5FA 1XFDA 2RD2A 1WXHA 3DBRB 3LQFA 3VZPA 1C9DB 4HB2A 5DI9A 2IKSA 2A1TR 3QEOA 4KXLA 3EUAA 4ADSG 3C3WA 1JEAA 4GR9A 2B2NA 2PX5A 4HFMA 4RZ2A 3THWA 4A0SA 2HBQA 2G9UA 2JRCA 3TJZA 2E21A 2IYOA 4GAEA 1E20A 3ZE2B 1J42A 1HTWA 4V0OA 4N7MA 1GADO 4DRXA 3L79A 3SHQA 2OFXA 1N6PA 2YZMA 5A71A 1PZNA 1WPQA 5DMHA 4TYYA 1GEGA 2ISSD 1ONNA 3P2YA 4IIJA 1ES9A 1UBTS 1Z25A 4LSMA 4MMZB 3BQMB 2YX1A 4G86A 1LW6E 3RO7A 2J6HA 2NPIA 2YH2A 1SU6A 4X6XA 4F3RA 4I46A 1Z2PX 1BEUB 3GQBA 4H3SA 1Y9ZA 2AQKA 2DULA 2FR0A 5EHQA 2RJ3A 3G2QA 3SXPA 2NG1A 3I4CA 4MB0A 1AX9A 4O08A 1Y82A 3VGJA 4D92A 1RHQA 2R9VA 3A4MA 1ZINA 3IELA 2ZDHA 5BUQA 3W9UA 3O5AA 2IF0A 1EP2B 1YA8A 2R85A 1Y63A 3L04A 4PLGA 1D1TA 1XQ6A 5EIFA 3T9BA 3VOSA 4G0NA 3DXZA 1L7DA 3ZDYB 2NTNA 2XCQA 4Y2HA 4UTPA 4I3GA 1NBMD 1CZLA 3AM3A 4QGBA 4LTNA 2BZGA 4ZVKA 2NTEA 3TINA 5F9MA 4D8VA 4NFYA 4J1SA 1BTOA 2EP8A 3OX4A 4KWHA 4L16A 3G02A 4B1FA 1SBHA 3A9WA 4E08A 4W9MC 3UTDA 2HJGA 5GM1A 1YQDA 1KEPA 4G4SO 1CP2A 2JF0A 2PMKA 4REQB 1L5HA 4ZTUB 2WP8J 3W5BA 1NVDA 1HKUA 2P6OA 2V74B 3HO6A 2JJ2A 3SIPA 4Z7QB 4POAA 1S4QA 4NE7A 3K30A 3TW8B 1NJSA 1WLSA 2AR0A 1VG9B 1TL7C 1USWA 4MI1A 4BRUA 1IBMB 2HSDA 3WQBA 1WQ3A 1HEIA 2ORYA 5FADA 3EVBA 4QU8A 3U13A 1JI0A 1CQIA 2Y9MB 3GCZA 4U2BA 4ZQBA 3A6KA 3F5QA 2WWFA 3TRFA 3CRQA 1NUQA 3RVPA 3V8QA 3KZMA 2CMFA 3T7RA 4EX7A 5C31A 4DMKA 4NZNA 2WM8A 3MJCA 3RUFA 2ZWIA 1PG5A 5JLAA 4XGRA 3PWKA 2Y4OA 4XX0B 2IUSA 1II0A 2QKYA 4FDAA 2HAEA 1G4UR 2BDUA 1NVUQ 2I4IA 4BWFB 1X7YB 5JJCA 4M76B 3SHTA 2FF5A 2W4IA 2NN3C 3PUKA 4P0QB 3CB2A 5ED0A 1LZKA 4PU0A 1N2CB 3WRXA 1I9GA 3HC7A 3MSCA 4ND3A 4DMFA 1EUDB 3BDVA 4RACA 5J3JA 4HAOA 3FPGA 2XDYA 3T4UA 4DMMA 1SVMA 2O5RA 5LJIA 4OHOA 1UDRA 4CW7A 1JG4A 1L3IA 4LXTA 3A9TA 3FPEA 2C9DA 1TT7A 3C0KA 3BWVA 3JYQA 5ESXA 1RXVA 1ZR4A 1XQVA 5I7UA 2DCUA 3KCNA 3H7IA 4Q4JB 1P7ZA 2WSMA 3B6MA 3C1OA 3K1ZA 4IMIB 1SY7A 3EIOA 2XWPA 1X0XA 3R5SA 4NECA 5DHRA 4Z7JA 4V24A 1FQKA 4B83A 4YMHA 4UEJA 4JYPA 4A5SA 1ZM3A 2NUPB 3DBLB 5EIEA 4AECA 4LRTB 4A92A 3IE0A 4EHFA 2P3OA 1NZFA 5MN4A 1IG3A 2Z3ZA 4HNRA 2X5OA 1TM2A 1G41A 1L7RA 2BISA 2OC9A 5EMKA 2JIQA 4FN5A 3SBXA 3R5FA 1JQBA 4ABYA 5F2NA 1V37A 3SAJA 2WAXA 3E9QA 2BKAA 1TQ4A 4JVNA 4FDUA 3MBOA 3HN2A 4DMCA 2DKNA 3RNOA 4DC1A 3TL3A 5CB4A 5HM8A 1EVZA 5F77A 4WOJA 5EJ8A 3JSXA 1W0JA 1XDDA 3ROZA 3B9BA 1K8QA 4IPTA 2DHDA 4BYGA 4EJSC 3JQ7B 3UG6A 1TFRA 1SD5A 2R6FA 2VNHA 4O4HF 5SZHB 1K7CA 2GAAA 4RD0A 4WY8A 5ERXA 3PFHA 4RK0A 5E2AA 1TYCA 4GFDA 2I6GA 5JZBA 1RMYA 1SC3A 3OJEA 4JT4A 3WMFA 3NLLA 1OWMA 1U31A 2IL1A 4K7JA 2FLKA 2Q2NA 2ZB3A 2UVPB 3BHJA 3GCGA 5THXA 2OXIA 2Q1SA 1QGZA 2L69A 3OTGA 5CUQA 1E79A 2P9BA 4QUBA 1ZG3A 2CXOA 2Z57A 3BMNB 4RK6A 3VH3A 4NYIR 1XQYA 2Q3DA 1U8FO 2RGGA 5D7NA 2H0RA 3CLRD 5ALRA 3U3JA 3NT2A 1R2QA 3AUKA 1G5TA 3T3DA 4DLWA 5KYWA 2I4OA 4RNDB 2ONKA 4KFSA 5CNKA 4RU1A 2ECOA 4QDJA 5CK4A 2ZIFA 4FCCA 4W5OA 3IPLA 4QTUB 1GUFA 4WJZA 2WFZA 8LDHA 1EWTA 5CDGA 4DOMA 4XARA 1DS6A 1DKUA 2EIHA 1JEEA 3HEAA 3X1WA 2X0JA 4EJ6A 3A32A 4XE5A 4H2DA 3WBKA 4ISBA 1BXZA 1K06A 3WZMA 1XZAA 4YRIA 5C1IA 3DJYA 4FZVA 5IWCA 5FEUA 1FQOA 2G1UA 3VU9A 4OXRA 3ND9A 1JSCA 2GN8A 3S1LA 3BKXA 2M1XA 3OLQA 5AW2A 2CD7A 2VBFA 2UYHA 4PTYA 3JWGA 2CLOB 2FZCA 1EU1A 2K4MA 2AZMA 2UZ1B 3E58A 1Z5WA 1HE8B 3ETDA 2C2ZA 1Q2XA 5KNBA 1H3EA 3QMWA 3PYLA 5EHGA 3T5PA 3WFIA 2C98A 2PKYX 5D3MA 3L84A 3UAGA 1G8MA 5ILGA 4EGAA 1RHJA 4FYYA 4QXQA 3SEZA 3CF6R 1M1UA 4UATA 2QUZA 2COKA 2VRWA 5FTLA 1GP2A 2B1RA 4HZIA 1G1MA 1SM4A 5HJEA 1N3YA 1SCNE 1IE3A 2EEZA 4S3MA 4C0QC 4EI8A 3MJDA 5C7YA 3FBTA 2CXUA 4WCFC 4I19A 5K0ZA 2G09A 1XQ1A 4J76A 4C0SA 1KRWA 1W1WA 3ZJTA 4AKIA 5EIOA 3PQEA 1EWVA 2IU3A 1NQOA 4K6OA 1JS1X 3VU8A 2X7HA 2AIRA 1N33B 1TNDA 4ESOA 2P4QA 3ISJA 5C3MA 1GXSB 2XKBA 1V41E 1IPFA 5KNLA 1RZ3A 4HCJA 4X1OA 2HGZA 1Z29A 1A77A 4GNRA 2B8WA 2FDXA 4KE8A 1P19A 4L5CA 5E4YA 5T6BA 3R74A 3IURA 3VR3A 2YC4C 2ZREA 3AUSA 3TLAA 1K5DA 3RF6A 3B60A 2JI4A 3IIEA 2ZIAA 3FLEA 1SHZA 3U37A 5JSFA 3TN7A 5KNDD 4QRDA 4BMNA 4NMMA 2AL7A 1V9CA 1G8JA 2AOXA 3JRNA 3KQTA 3GH3A 5KWEA 4GF5A 5F7XA 4AU1A 5A02A 2MHCA 2BEUB 1KOGA 4RZQA 2C0CA 4R9VA 4AJLA 2EJUA 2IYUA 5AOBA 2W6QA 3DAOA 3L0IB 1GTSA 1J2YA 2VDPB 3PDIA 1K8YB 1KK2A 1NP6A 3OT1B 4P3KA 5NLLA 3D6FA 1KO1A 2GF0A 3Q40A 2AE1A 4XUDA 4IWNA 4DN6A 1EVEA 4ZAGA 1KL7A 4ZOQI 2XI4A 4J16A 5FPKA 5JC8A 4I50A 1XUOA 1SVSA 4MYCA 3CLSD 1C0PA 3E4DA 4FR0A 4BNLA 5H59A 3QP9A 4WVLA 4L76A 2V7VA 4RZSA 2CL7X 1B8NA 5BNIA 2R79A 3FOFC 1O6FA 3K2IA 2J4CA 5LWHA 1XZNA 4KQGA 1AF7A 4OSEA 3U81A 1FSPA 1QK4A 4EJFA 2WKSA 1PKEA 4JMLA 3ONDA 2WA2A 1XHLA 4WLOA 4YA6A 4LF6B 3F1LA 2NAFA 2QE7D 3BMOA 4F60A 3UMYA 3JD2A 1KORA 4Q05A 3U5TA 5GGYA 1FF9A 4YMTA 1E1CB 1CUZA 2Z30A 1AGYA 4GLOA 3LPCA 1UT5A 1CUVA 4NONA 2PUCA 3KT3A 1ZI6A 3QK7A 3C5EA 4PANA 1NSTA 1IL0A 4X94A 4PG8A 3PE4A 3AGQA 5ELMA 4CNQA 3E0XA 2BLLA 4ENWA 5C1OA 2QTFA 3D7KA 3PGXA 1CY8A 4MPTA 4Z9AA 1XHEA 1OTHA 5KSPA 2XUAA 3N9IA 3U61B 2QROA 2J4FA 3CHYA 3I2GA 4OP2A 2R1TB 4HFJA 3WGVA 4O0MA 3LC7O 1VGVA 5CLJA 1NF8A 2IVFA 1ILEA 3IV6A 4RTNA 1VI2A 3E15A 2VP0A 2ZJ1A 3J80A 2BFBB 3OQNA 4I2NA 2SKDA 3HABA 3G59A 4FKBA 2UAGA 4DSOA 2Q4BA 1OV4A 1N8KA 3FNFA 3L46A 1GNQA 2ZQYA 5T57A 5FLXA 5CVUA 4LZOA 1EQAA 1NBHA 2PBZA 2I99A 3UA4A 1NRXA 4A0FA 4PCAA 3W7BA 4CIBA 4N5IX 4YPFA 2I9PA 3AONB 3QF7A 2J5KA 3UA3A 3COSA 4Y9DA 4BNDA 1N6KA 1NASA 3PQ7A 2IUEA 4K8RB 1NNUA 4WVFA 3DLTA 3ZOKA 3UKJA 1U2DA 1ZN7A 2PZMA 5JMWA 5B36A 5ULLA 5JD5A 1Q0QA 1T2CA 2C00A 1F6DA 2F90A 1YJBA 3KVYA 4UTNA 4CIWA 3GX1A 5C0OE 3FMVA 3ZVRA 3NBAA 1NBME 2O2IA 2RHCA 3NC4A 5K4HA 1GUDA 4FYJA 4E4RA 1BAPA 1OILA 2I7XA 1VFNA 2PY6A 2F3UA 4DB2A 4J0KA 1C3XA 3GEEA 3V1MA 4E22A 3B5IA 3BFVA 3JYNA 2IELA 4PR0A 2V0CA 1HX7A 3FNRA 2KMLA 2W42A 1QM5A 2JBHA 3K0FB 3W3AH 1SUFA 4IQGA 3TSOA 5EJ7A 4DCGA 4L02A 4YRNA 1JSXA 2XOKA 4NABA 1N2JA 3MWLA 1SD2A 3SR4A 5DH9A 2OLJA 3RROA 3FOZA 2IEZA 1F51E 4JLPA 4PYRA 1Q3KA 3UT6A 3ZD8A 4UARA 4S1OA 3F8WA 1G7RA 4XIIA 3X1DA 1DBVO 5TV2A 1AMUA 2I1QA 3LL7A 3TD2A 1XQXA 3N2NA 4BB5A 3HKDB 1QE3A 1P1HA 3F97A 3S8MA 4J43A 3C3MA 1R64A 2VDWA 3OFKA 4IV0A 4NU0A 1VG0B 2W6ID 3VPHA 1U6JA 3NAQA 3HRKA 3SU8A 3U4MA 2JGDB 2PCLA 1XGKA 2AQIA 2J46A 3QLVC 4IEFB 4JUBA 5AKLA 3KZVA 3T1NA 3UJCA 5FR2A 3EWIA 3JTEA 4ZVLA 2X7JA 1EFKA 5JJIA 4EGFA 2Q9CA 4BVLA 4M38A 1JEQA 1CY1A 5J2TF 1E63A 3NOVA 2I4RA 2IYQA 5F12A 3H6HA 1EPUA 1JEYA 5T67A 1N8TA 1M75A 1FSGA 3WTBA 1PNQA 3L6BA 2BOVA 4TS1A 4CQLA 5A4KA 4CFYA 4V1CI 1IOWA 5JALA 3EA0A 4H27A 4AXBA 1II9A 3P2JA 5JVDB 1PJ4A 3UHAA 1T10A 5CEJA 2DT5A 4TUYA 1H4VB 1DVRA 3CMCO 3PENA 3C98A 4IIHA 4MSUA 2W6MA 3Q4GA 2N1BA 3CLKA 2KWIA 3IDFA 4M98A 3ZEAA 3ZI4A 4B6PA 2NYUA 2WHEA 2QL6A 2WJPA 1VA5A 4LHSA 2FSGA 2RCNA 1FBNA 2C94A 3II6X 1KY5A 3T0IA 3VV2A 3H2SA 4OKNA 4G3XA 4YPVA 3TE7A 4B33A 2WSSA 3BKWA 2X22A 2ZJ8A 3CT6A 1TJ4A 4Q3BA 1QH0A 3P4YA 3JAKB 3CGGA 3KZ1E 4EFKA 2BEVB 4CCSA 2KB0A 3ZYZA 1LFDB 3IEXA 2AR9A 1UBLS 2IOFA 2ZUFA 2YJZA 4S2EA 3TXXA 4P4TA 2ZVDA 1QRSA 1WCIB 2QJFA 2J5BA 3B8HA 4JI5B 3I53A 1P5ZB 4D9NA 1YHYA 3WP1B 1YS1X 4ID9A 3CB4A 4LC1A 3IHLA 1LV8A 3FI9A 2P68A 3DVAB 4M0FA 1LFAA 4Y0VA 2ONZA 4QIHA 5T64A 3EYAA 4GRIA 4BE9A 3JD3A 3AFNA 1DNPA 2I2DA 4RPCA 4TVSA 3FMFA 2QF7A 4JKIA 2DLNA 2IYLD 2BEKA 2PRSA 2VRCD 3MJSA 4LJSA 4KPFC 2CNBA 4RXUA 3TXYA 3VUEA 1ZD9A 4DNXA 3P1JA 4AY3A 4DA0A 4EDHA 5KREA 4OQYA 4IQ0A 4YJ2A 1TT5A 3DH0A 4IP0A 4KODA 2CDBA 4U2EA 1Z47A 3EF1A 4EARA 4FE3A 1L5NA 4R1UA 4FOSA 3ELUA 4WK0B 3ISVA 3BQNB 1N0HA 1J9ZA 2XNDA 5IJ9A 1ODIA 4FDMA 1D4ZA 2A84A 1KSGA 2HLDA 4KCGA 3AZQA 2O8CB 1K3UB 3RVSA 1TC2A 4V0RA 4I4TA 4XQGA 1SA0B 1R5BA 3CR8A 4KMOA 4BQNA 3H4TA 1YZKA 2QY6A 2AYXA 2XB4A 2REXB 2QSJA 3K1AA 2GETA 4O4HB 1JJVA 2V0NA 3O4IA 1R0RE 4K5QA 4XDHA 5AI8A 4EVIA 1DKPA 4K9KA 1MZVA 2X0DA 3SSOA 3KYCA 3SJUA 2H4XA 2P9TA 4DT1A 4ESHA 3LA8A 4NESA 3C7CB 4AY2A 2H9AA 3PNLA 3C70A 3ASUA 3PJDA 4URHA 5DBFA 4YCMA 2Q9AA 5JAZA 4LYFA 3NHLA 2YQ4A 4MKIA 3F9CA 2JAOA 4GPBA 1NI5A 1KIFA 1D1QA 5DP1A 3EXFB 2C1XA 2IW3A 1HR0B 3PPIA 2QG9A 2BM0A 1I4LD 5DWVA 4EIWA 2VSYA 1B0UA 3H11B 2UVQA 3WSWA 5JISA 3AVYA 1BCRB 1EX6A 4OI4A 1I0ZA 1KAEA 1SUIA 3GNLA 5EGSA 4HI0E 1GRRA 1QIIA 3ORYA 1GZHB 1TUBA 2NU8A 3PD0A 2D1YA 3GO4A 4TL9A 1I1QB 1UDBA 2X2EA 3AEXA 3SQLA 5I48A 2GJAA 2QTHA 3K8YA 2ZZMA 1QRTA 1VSBA 1WBBA 3JQAA 4YJGA 3EWNA 4G5GA 2FMFA 4FYVA 4LN1A 5EJMA 3D7NA 5KHLB 5IN5A 2KE5A 1L4EA 2FMIA 3Q72A 2F64A 3ADBA 2GYVA 4MWSA 3QPUA 4YAOA 3AG6A 2CBGA 1J22A 1TA0A 2OO5C 3EC1A 4UFNA 1GZDA 3QVUA 4CCYB 5AMXA 2G4VA 1ZCJA 5D2CA 2NVBA 5EUQB 5JTTA 4ND1A 3ROFA 5JRZA 3CRZA 3P9YA 1Z2EA 3B3GA 3EPPA 1XL0A 5TPZA 3TLGB 2W8BB 1GRQA 2R7AA 5K3EA 4C7VA 5FJIA 3W6OA 2A5DA 2BGNA 4MIKA 2JLYA 3UMGA 1SBIA 4Q12A 4WGFA 1SVIA 3RSLA 4Z4CA 2PUHA 2HDNB 1YRLA 2YWEA 3MFQA 3Q85A 3AOEC 3SF8B 4B31A 4YCJA 1NHGA 3QUQA 2I6QA 3MGCA 3OCCA 4MH0R 3S81A 1E4EB 3COYA 4MWCA 2PX2A 5FNVF 1QR2A 3IXMA 1AOXA 2E1PA 2PVCA 3BWDD 1MHTA 1EK5A 1Z0SA 2W6OA 3CH4B 5J40A 1I14A 1CUWA 3DBOB 1V3UA 1VE7A 2RG1A 1D4FA 4IOJA 4ER0A 2JAUA 2VYVD 1ND5A 3L0ZA 4V1CB 2A57A 4AN1A 1EDEA 1WXWA 1J5PA 4YRPA 4KFTA 3U1VA 3BOSA 1MO4A 4MGEA 3O8RA 2QMYA 1TA4A 3D4LA 2DBVO 3C3CA 5KYYA 4NEQA 5FPYA 3W5UA 3FYCA 1O1YA 4YP1A 4TSFA 1VYTA 5MFZA 1ZU5A 1XDZA 3GA0A 3GJ7A 4HEA6 1IWPB 3OCZA 3O8QA 5IG2A 5IT0A 2GEJA 3PHIA 1HTBA 3PGMA 1CJBA 1CSEE 3C6QA 3DDSA 3EG9B 5IP5A 3V2UA 3IR6A 3TGPA 3QSGA 2Y76A 4PSAA 4RCYA 4FWIB 1J7JA 1V47A 3QW4B 5JZVA 3TKLA 4RFSA 4EHNA 2CBXA 4MI6A 4R1MA 4ZV4A 3GNTA 4P53A 5EWLB 3GEIA 2CMKA 1ISSA 1GTJ1 2R8OA 4K9MA 1YACA 1NN0A 1FC0A 2NO5A 3ODGA 4RXMA 3AF3A 3KFXA 5IDYA 1HFEL 4X9XA 3PXGA 2RHDA 3EIEA 1HKHA 4M1ZA 2OQVA 1E5XA 1BXGA 1II8A 3LSTA 3MMSA 4EMUA 5GOTA 3QPDA 3FHCB 1T3GA 2IXGA 4JWTA 2C4NA 4UBIA 4NBUA 1Z0IA 3GLTA 1U2SA 3E3OA 1S1MA 4IUYA 4ZV7A 3TOCA 1CF9A 3UV6A 1DKOA 2N1MA 2OHHA 1DT5A 4MKGA 4D96A 1RQRA 3WTCA 2WKPA 5JZSA 1PI3A 2HIAA 2A88A 2PX8A 3A31A 3E18A 3GDGA 3NI2A 3ADKA 4YR9A 2CHGA 4E2YA 1WXGA 2RBEA 1EM6A 1L1EA 4PIPA 4BO0A 3D5TA 5P8WA 3KQKA 4OM8A 3Q3JB 1O0BA 1KARA 3N7AA 4P38A 3PUJA 5FL7D 5L3QB 1G21A 1V5EA 3DT9A 2WU0A 4BMSA 2O7SA 2ORIA 4QHYA 2I4NA 4D9GA 4TL8A 2GFIA 4XDZA 2ZJ0A 4UBMA 5AH0A 2G63A 3VR1A 1ATIA 2NZUG 1VSVA 3DL4A 4RORA 4JAVC 2X9NA 4A6XA 4G23A 1AQ6A 1ETUA 5JNSA 3E0QA 4A23A 3JCZA 3I8OA 3GGDA 3W06A 1RAEA 1YVEI 2PUJA 3MJVA 4I4NA 3EDQA 4KQWA 3ZCTA 4OYLA 4ZQHA 2WKQA 3IOBA 5I8ZA 3PEWA 1ZGJA 4NY1A 3BT7A 4YQYA 4HUJA 2IS1A 4CKWA 1YRWA 1GU1A 1VI5A 3OCWA 4RSRA 4XKJA 1IATA 1FFAA 3F3YA 1CR2A 3CLTC 4AMGA 4D46A 3U4IA 1UZUA 3QX3A 1QYVA 5GV8A 1OBHA 2GDJA 3HVHA 1C0EA 4A7PA 1F48A 2BGGA 3CLSC 2W37A 1IZ7A 1GUYA 1NXXA 5ALGA 4MWTA 5EINA 1NV9A 4D6YA 3OJFA 1C29B 2O9JA 1BMFA 3G23A 1R4NA 5F3DA 3NHZA 3VZCA 3E61A 4EL5A 2LRHA 2X4DA 1OYYA 2VZLA 3SG0A 2RHJA 7REQB 3AT1A 3GVCA 4K8OA 4GD3Q 4JFRA 5A62A 5HHTA 1GPBA 4WJKB 2GF9A 1GL3A 4IIBA 1W1IA 2IP1A 5FDFA 4LZJA 4LOHA 1IAQA 2YICA 2QAGA 2WU8A 3LOQA 4HY3A 4OXYA 1US8B 4GOJA 3I30X 4F0JA 1J7KA 3U7JA 3I61A 1X94A 2Q3LA 1O94A 3B20A 2GBLA 2PPLA 3L7DA 4NG4A 4PZAA 4RELA 5FOWA 1FYFA 1MKYA 3CGWA 1XLTC 3U7GA 4Q3KA 4DM3A 1M1NA 4RHTA 2WU3A 1NLMA 1WW2A 3DP7A 1QV7A 3U1BA 4MV6A 4FCTA 2QM7A 1M3SA 3EEBA 4LY9A 1VJRA 3T94A 3W7VA 4G0QA 4MP8A 4FJ1A 4LUCA 3ECSA 3QQ5A 4L9WA 4OP3A 1QKIA 2PGOA 2OSVA 4L8YA 5K51A 1TLTA 4LYGA 2FPGA 3RLFA 1A69A 4CF3A 5J2TB 2Q29A 1I2BA 2MCFA 1UZNA 4HYEA 3WB1A 4YFVA 1B74A 2IZ0A 1LVUA 3KJGA 4F21A 5GQSA 3KB1A 1NGSA 5FTJA 5IVHA 2I4TA 4PXAA 3MN1A 1FFHA 3VDXA 5KTNA 4YV2A 4UHDA 3SYTA 2JLAA 4QUIA 4M9XA 4Z8XA 3DVQX 3QV1A 1XVAA 3WWYA 3EOZA 3UW3A 3GP3A 5I7WA 2IEAA 1EVLA 2HC9A 1QX4A 2QTAA 4R31A 5BQFA 5CAEA 4BNYA 1ZR2A 1XJQA 3G2NA 2VDNB 1GQSA 1UDCA 3AU8A 3BCHA 1WY5A 4UVGA 3OY7A 2VDVE 3TI9A 1ZHOA 4B73A 2EFYA 4BUZA 3B2QA 4A8TA 2GBIA 2ERYA 1ISHA 3QVJA 4IUBS 1YQWA 2QZZA 5DX8A 1ZN9A 3NIDB 2NT3A 2WTAA 5JJKA 5BSHA 5I8WA 1VL5A 2ZWAA 1PR1A 5AJZA 1N6IA 1N2ZA 2PLRA 3R8XA 1T1SA 3IDZA 4MQEB 1PYGA 3FE2A 4PZDA 1NMEA 4MQLA 1MX9A 4ETWA 4QU9A 3RC3A 1FXUA 4N7BA 2K2WA 3COPA 1PR3A 2NVUB 4RTPA 1RQPA 2ZI4A 5AKZA 4DV0B 3CZQA 3QLTA 4QU0A 5H5JA 2ZU6A 4JP3A 2QP9X 2ZP1A 3EZYA 2IYPA 3CG0A 3N8HA 1J00A 3DCIA 2IIBA 1Y48E 4GLLA 1E3QA 2D54A 2MSCB 1YS9A 2IHZA 1EHYA 4MWZA 4BEVA 4F46A 4HLQB 1OROA 3L4JA 1VPLA 3P96A 4P3PA 1U2GC 1XMXA 4WAUA 1MT3A 1Q1ZA 2BCEA 5DYNA 4LWZA 3IBTA 4OJMX 2NPFA 3V1UA 4HYYA 1NNEA 2BGKA 3C1TA 4CLOB 3H4IA 3NHWA 2BGTA 2F2TA 1SUPA 1P0MA 1ATZA 1IHOA 1CR4A 4NU8X 1T4MA 3CW2A 3MJ4A 2Q1WA 4ZA2A 3E3LA 5IUNC 4MMXB 2VJBA 4HLDA 4EQZA 5HUJA 1QWOA 1P7CA 4IVRA 3WSTA 3AVPA 1MPTA 2H11A 1PQUA 2G9RA 3H9BA 1GY8A 4UKDA 4FGKA 3FGPA 2G70A 2RH5A 4YAFA 4F38A 5K2OA 3IODA 3FVQA 3GJTA 3V4LA 1IVSA 1EQUA 4FGSA 4MX8A 2VRNA 2DH5A 5CJ2A 2ZTSA 2PKQP 2FW7A 5LA6F 4YUVA 2HF2A 2XGJA 1YJ5A 4Q19A 2VK8A 2ZJFA 3ZQ4A 2D5BA 3CVVA 1AUOA 2AKYA 2AQHA 1I7DA 3I52A 2C88A 5FYDA 1KH3A 1KDOA 2QN9A 3BXHA 4DYDA 3HCWA 5JANA 3R9IA 2OXCA 4N40A 2HADA 5H9WA 4QVKA 2R5NA 4R98A 1YHZA 4YLEA 4AT1A 1RAFA 1DX9A 3UK1A 1U02A 4LMAA 1N2IA 4M0UA 2IPMA 1JKIA 2B7LA 2WMYA 2AEMA 2XUOA 3Q5EA 4BFSA 3S1AA 3ZDBA 3IEVA 1NXVA 1POWA 4TGLA 3ELYA 4KQHA 4D56A 3D1VA 3P45A 2VP6A 1O9HA 4BV9A 1PEAA 1BJTA 1RRMA 1J8YF 2QZ9A 3O4RA 3I9FA 4OATA 1N4AA 4D0NA 4W5NA 4KDFA 1JIXA 3EOBI 4Q3CA 4MYDA 5EZSA 5FP0A 4O1HA 1GCUA 4PSKA 1JB1A 1QXSA 1GQFA 1JQ5A 4F4DA 3O2SB 4FHCA 4YV1A 1A98A 2BFCA 2JFUA 4L8VA 4D5GA 2GEBA 1GT6A 4BB9A 1R0KA 3R4CA 4I8IA 3AXTA 3WOHA 4TM7A 4YO7A 3ITNA 1M34A 4O4JF 1Y6FA 2GT1A 3QEMB 3V4PB 3NAGA 1P9WA 5I7VA 3VSCA 5KQGA 1DT3A 5L7YA 5KINB 5LWQA 4JROA 5F21A 3C5HA 3EVTA 3E05A 3WRYC 1A1VA 3SBEA 4JNCA 1U5BA 1XZMA 3BH0A 3BTUA 1VFPA 5FNVB 1UMBA 5HKAA 2CE7A 1T9KA 2W0SA 1TVMA 3N59A 5KYTA 6ABPA 3L0YA 1ENZA 4EX6A 1QVVA 4FMCB 5DSZA 1FRNA 1RE1A 1G38A 3DEHA 3AHDA 4AAYA 3DCJA 2GRUA 4YAGA 1WU7A 3OQPA 4TYPA 2FMTA 1R7RA 3IV7A 1PL6A 1P81A 4DCUA 1T9BA 1VIVA 4HH4A 3ZHCA 3G2KA 1XALA 4MVJD 2BMEA 3MWEA 1FUUA 1H85A 1GU7A 5CT8A 3RI3A 4RVHA 4WI1A 1AGRA 2WTUA 2Q0SA 4MUIA 3ZX5A 2BMAA 1WVGA 4BNIA 3IP1A 1HTTA 4ND7A 2BMWA 1I3OA 1ORIA 2AOVA 4IDQA 2H54A 3ZH2A 3U31A 3AW8A 1H2WA 1PDOA 1NFQA 1UCFA 4ZI7F 1NQWA 2QSZA 5ITWA 3EEOA 2A78A 1Y9JA 4R2JA 3UATA 2KX7A 4ENQA 1U7DA 2P2GA 3IP7A 4TTJA 4UJ3A 3WA6A 5K8TA 1P91A 2G07A 4IDDA 1ZNWA 3D7SA 4CDNA 2ZM6B 1XWWA 2PSSA 4CKCA 3W4JA 2CHEA 2O52A 1E0JA 3BZWA 4IUCS 3TJRA 3RASA 2AYZA 5BMVF 1D6MA 3VA7A 1YJQA 5CMLA 4ZVQA 4L4RA 5A4MS 2V6BA 2O7NA 2NZ8A 3MQFA 2Q3MA 3VSAA 3AIMA 4BJ5A 3AZPA 3QWBA 4F8JA 5U9CA 2B6NA 3RV3A 4BN0A 4WZZA 1FJ2A 2E48A 4MVWA 4JL8A 1QORA 2IYRA 2OV6A 2V7QD 3CZCA 2GGSA 1DAFA 4H7FA 3TJMA 3UFBA 1VCOA 1FVFA 1Q7GA 5C8VA 5IJXA 2FFQA 4YMWA 4PYJA 4LJKA 1L4BA 3AEQA 4TXJA 1N1MA 4G4IA 5G1PA 4ZHQA 4OOFA 1Z6TA 3GZNA 5FTNA 3SSMA 2QLMA 1E2GA 2A9OA 5DLQC 1ICIA 1P33A 2YMMA 4OHUA 1L3CA 4QDKA 2ZRNA 3UWKA 4F3YA 2CNWA 2RIPA 2ZE6A 3KVNA 3DW3X 3SMVA 5DCLA 4AMZA 1YB6A 3H0KA 1VG1A 5K99A 3O8DA 4HXFB 5K0TA 2EFDB 1AKTA 3S29A 2PBRA 4L0DA 2I7CA 4EA7A 1KZ7B 2A0KA 4HEQA 1SG0A 2XMCA 1NLZA 1U0OC 3U7RA 5CFMA 1HM5A 1PK7A 1YB1A 3LNTA 1SIBE 4ZT4A 1COWD 1FYWA 4ZHSA 3N8KA 2AC4A 3D4PA 4CG2A 1ZWKA 1EHCA 3CUYA 3TDKA 2I34A 3GLHB 5SY4A 3F4LA 3A6PC 3PDUA 3LUBA 3PIIA 3DDHA 4MIEA 4IZ6A 2P11A 4TRNA 4BGDA 4ACBA 4BL5A 2AEFA 1CT9A 1NLFA 3I1IA 2XUIA 1BQEA 5AK6A 1CJTC 1Z33A 3SC6A 2OB1A 4II3A 4EVRA 2I03A 4CEJA 5MHTA 3VR4H 2IP4A 2LW7A 1NVVQ 2GD6A 4MEAA 4WINA 4QUEA 2R6GA 2WAOA 3GJ3A 1VE1A 1SC6A 3EGOA 2PTGA 1EBFA 2WY2D 3TZBA 5F2OA 3ZWXA 1XAIA 3WY9A 5BN5A 2EGUA 3KAPA 5E2IA 4BVFA 4ZYXA 4RVCA 2RHGB 3KC2A 1M1XB 5HCUA 3KXDA 4CEIA 3EZ7A 1BH6A 2TECE 1CUGA 3HFSA 1QH8A 1MN6A 3FUUA 1ODCA 1I80A 1OX4B 4JOSA 1L6RA 4OHRA 2IUUA 2H5IA 3TCKA 1GAQA 2EXXA 4IF4A 4NTZA 4TKVB 2V7BA 1CW2B 1H69A 1MOSA 3S3TA 3CLHA 3EVEA 4L8GA 1P3DA 1ESCA 1SUWA 4KTVE 1TMGE 7MDHA 3Q3EA 2AKEA 1AS2A 2FLVA 3C3KA 3MAJA 2GCEA 2VPZA 1N0UA 5IDWA 2D7JA 4MQ4A 3LHSA 4KGXA 1ZN2A 5TEVA 3WGJA 2R66A 3G7SA 4Q1BA 3HJTA 4AUEA 2KI5A 5GZ6A 3TIGA 4L5AA 4P7BA 3T1VA 5LMZA 1DG3A 4ZO8A 4GP7A 4CLRA 5BUZA 5GIOE 4ZYYA 1WOYA 3GLFA 1Z7WA 2ZCJA 4MUNA 3EY9A 3JATB 1C0IA 6CHYA 2GPYA 1F38A 2IFTA 2WNSA 4OPMA 4RZUA 2QN6A 3WLKX 2FE4A 5LD2B 1T8RA 3DJFA 4YB8A 2GJ9A 4YJ3F 1S7CA 1V1MB 4JC4A 2XR1A 1L5OA 4LBWA 5IU6A 3CONA 3V4RA 3OC0A 1JA1A 1LQUA 4Q00A 1AH2A 1WSDA 2X0EA 4W1RA 2FPWA 2SECE 4M4SA 4QJ5A 4QWMA 3DT6A 3NC1C 1BVRA 4G5FA 4Y2XA 4KJZA 4Y3UA 1YNOA 5C8DA 5KS2A 4J3FA 4M0MA 5TLSA 1W4RA 4X3OA 1GG9A 3DYVA 2VTEA 3KOXA 3LO8A 2ANCA 1CHNA 2ZKIA 3T1OA 3I4LA 2DPYA 5D00A 4KX3A 2CBZA 2IZ6A 5ANRB 1XCOA 5GZ1A 4QAJA 1IY8A 5E9WA 2LZ0A 1E9EA 3GJRA 5KYXA 1L4GA 1WDTA 2VUSA 3VNQA 1VGRA 2Q6LA 1WP4A 2QN7A 4OBXA 4Q1AA 2ODEA 2AE2A 1UDXA 2RHRA 3MERA 1NZJA 1A8QA 3CA8A 4JVOA 4E7PA 2JGJA 3KHTA 4GZ5A 4D4LA 5ALQA 1AB6A 3LQ2A 3FJOA 3Q3CA 1ZL0A 1CDEA 3HCBA 1M2JA 1MUUA 3JAMA 3LYUA 1LBHA 1W93A 3GWGA 4E5SA 4KE6A 4O5AA 5K9ZA 4A0RA 1KJNA 5EEHA 4ZU3A 3C7DB 1JXQA 1OJLA 4X1IA 2C96A 4X20B 1WS6A 3T0GA 1FX1A 1ULTA 2G04A 3U26A 1H94A 1KEUA 1QG4A 1XJ5A 3N7TA 1ZEJA 2PT6A 3P8ZA 4CTOA 4C5CA 4X7RA 2IYXA 2UYQA 1WR8A 4MQ5A 5MGNA 1G64A 2FSUA 4NHEA 4TOIA 3GEMA 3IIKA 4DSZA 2CFIA 5A4IS 1QVZA 3RM3A 4BX8A 1RQ7A 4JUIA 5HXAA 2QTVB 5ENZA 4G8CA 4NI5A 4HDKB 2XE8A 2WJ3A 3ANYB 1UPTA 5FI0B 2XRYA 3R0JA 4LEIA 2VDJA 2O4CA 4KDCA 1E1QA 5HCNA 4NATA 5KYVA 1OREA 4LJRA 1XJCA 2PKRA 3RF7A 3BH7A 4ZZ3A 2ZS7A 2JI9A 1TCVA 1JMVA 1C7IA 4NJEA 4RENA 2C7PA 3VR6A 4HNSA 2IH2A 1IQUA 2D62A 3WDLA 4HT3B 4B43A 1A88A 2QW1A 3PQ4A 1O87A 2WWXA 4EPTA 4IY1A 4FN4A 1IFXA 2R8ZA 1A5ZA 3BC1A 3RSGA 2Y1DA 3OEEA 2ZT7A 3VFDA 2GVDC 3HBNA 5FBWB 3UAYA 2PT9A 3BMCA 3Q0EA 4L3VA 1YF3A 2HA4A 5HA5A 2EG9A 4ALMA 2GYUA 4Q18A 4QOFA 2H7VA 4DLYA 4DRZA 1E2FA 1EFPB 5AOVA 5PNTA 2X6TA 4BVHA 3KOZA 4S2UA 2KHZA 2VT6A 3JD1A 3GFBA 5EMLA 4HG2A 1W76A 1XZLA 4F4HA 5EHXA 3ZLJA 3C3BA 3F96A 4WK6A 3BRCA 4JODA 4RIFA 2WD7A 1CVIA 2WZBA 1Z4NA 1SQFA 4P4UA 2AVDA 3EIFA 1DBWA 1AG9A 1ZGBA 1V95A 4BTLA 2G25A 3L4BA 2XE4A 5DT9A 3NOXA 4AJ9A 2A92A 1N3BA 4I4IA 1SG6A 1F2UB 1DEKA 2Z4SA 4IDPA 5GJCA 5B6PA 2H52A 2QTMA 1A8HA 1ZAKA 1AXEA 2RH4A 3DE3X 1EAMA 4FYPA 2DWQA 3CKYA 4FMDF 1P18A 3CVJA 4FNMA 4RLSA 1LPNA 4IFIA 4O4LA 1VECA 4K9PA 4ZRDA 1NI3A 5DGDA 3UN1A 2OO7A 1JDVA 1NDQA 2GK3A 4RF5A 5F4BA 1KMIY 3H9CA 3OQJA 4CIVA 4P33A 4MZXA 4EKDA 1AGPA 3ESQA 1WBJB 3ENKA 3FUVA 4IFTA 2MSWA 1CBUA 3NGXA 4FU0A 4EECA 2ORVA 3ROQA 4KR3A 2FUEA 2QY9A 5AW7A 2XAAA 5DYTA 3WKDA 1XYGA 1ZH8A 3QX7A 4UOEA 1S8AA 3K1YA 1VKJA 1PYOA 3HUEA 3AG5A 3D6HA 3OZBA 1SXJD 2AK2A 3DD5A 2Q3EA 5HS4A 1SXIA 3C4JA 1UBJS 2C95A 3RFVA 5MDHA 1RPNA 4XFKA 2P7IA 2QRVA 2XV1A 1AQNA 4U2DA 1F5NA 1XZJA 3MCVA 5EUCA 5EMJA 2JHPA 3RTAA 2X4IA 3I04A 4ZANA 3UHOA 4ODIA 5LLDA 4UHBA 3RYCA 4CODB 5HKOA 4JJGA 2PUBA 4HJXA 5LL6P 3GEPA 5JAQA 3DOJA 4IGKA 2AZXA 5KX5B 2R00C 2Z0MA 3Q5GA 4MVJE 1ZXBA 1UF9A 2QMQA 2IYVA 3BWEA 3KPVA 4O4JB 3CYFA 5CLQA 1Q21A 2ZTUA 4S12A 1P1IA 1CUDA 2OCBA 3NYRA 3PFBA 4FLMA 4DWJA 2IHTA 4F8EA 1PG0A 3I32A 3RRYA 1SXQA 1Q12A 4XJTA 1ZN8A 3FDJA 4J4BA 4B3GA 4CF4A 4M9SA 1P6UA 3PIRA 2FMXA 1VQ1A 2C9BA 2J0UB 1M7GA 3ZWMA 2FKAA 4BKRA 1UK6A 1TW2A 2JCXA 3Q7RA 3T1TA 3IH5A 4LTMA 5IK2D 1NXQA 2PXXA 4XYEA 4L15A 4ZGGA 2P67A 5IMSA 3O1JC 3R7SA 1Z0DA 4MGYR 1KE2A 1NLYA 3EE6A 3RVOA 2O05A 1GT91 2FUCA 5IH3A 3TRJA 2DTEA 4BMPB 4BVEA 3DTVB 1BDBA 1NT4A 2C8JA 3FR7A 2JZNA 3EDCA 4CMEA 1IIRA 2OSBA 3VPGA 4EPYA 5KVSA 3LOUA 1CB7A 3IBSA 1AGNA 1RWWA 4KL8S 4OK6A 4L4YA 4MJLA 2W71A 3K9CA 5LIRA 1GR0A 1X1BA 4MO9A 4PLHA 1IEVA 5FBHA 3N1UA 4DVJA 1VSTA 5BSGA 3IQEA 3SF0A 3OJCA 4TXLA 2X8LA 5CNJA 4CV3A 5JD6A 2ZSAA 3JYOA 3PNMA 4U9HS 2A1UA 2IBSA 2NIPA 2XA9A 1TU3A 3G5LA 1MXHA 2OA0A 3UJ8A 1SCBA 3T41A 4HB3A 1YR1A 1WE2A 3V48A 4EITA 3NUGA 3TPFA 4JV5B 2G4CA 4MRRA 3RG2A 1SRRA 5LA6A 1OU4A 1YB7A 3DA8A 3ASYA 1SQGA 2TYSB 4DR6B 3WB9A 3FOBA 1WHSA 2HA5A 4PRLA 4X1KA 4KO8A 1Q0HA 1JLSA 3NJ4A 2ISCA 4MKHA 2WDPA 1IG0A 2FOLA 3F2VA 3X3HA 2KYRA 2VPWA 4O33A 4JQSA 4FGUA 3ZLVA 5LNK6 1IZ0A 1SNYA 2JFHA 4L50A 3WL7A 3JD0A 1U0JA 1OA0A 5TS2A 3PPVA 2HJ9A 2QN2A 2IH5A 3MK31 2DUUA 2ZI6A 3WJAA 3O92A 1WKVA 2GILA 1JHAA 1C9JA 1SH7A 1WZEA 5ER6A 3MAGA 3ZWOA 3MS7A 4D9CA 3OE7D 1HH4A 2PZJA 1Z4LA 3PUXA 5AICA 3WO1A 2O8BB 5KYUB 2OT3B 2DC1A 5K2MA 3Q9LA 5BSUA 4WOCA 4EYOA 2I80A 4OI2A 4HXEB 4C2UA 2ZUDA 1VBNA 1P2DA 5JH7A 4EHJA 4C30A 1ZY2A 5TNXA 3DGFC 2IZ5A 3UB4A 3WR5A 4G01B 5ELLA 4BMZA 2CVOA 1DC6A 4M87A 2H1RA 5A4JA 2OZLB 3A2LA 4DJ5X 1WL8A 2C1EA 1DLJA 3OMWA 3H4MA 4JVLA 4RWEA 2Q99A 1XXHB 3MCWA 2GN4A 3SCZA 1KKUA 3QM1A 1QHNA 3IIMA 1NN5A 3VU3A 4N5MA 4XSHA 2D5LA 4MW4A 4MQFA 2XUJA 5KC8A 5ADHA 3I62A 1O2DA 3G1TA 3KQSA 5LN1A 4F6LA 4J2TA 3PR3A 4GBGA 1TC1A 4EA8A 1COZA 1FFCA 1S9HA 2Q6OA 4BDSA 2EKDA 3MRTA 3DWIA 1M6HA 4XWOA 1JSRA 5D5PA 4IXTA 4JYBA 2AF4C 2NUTB 2E0IA 1O7JA 2ZSKA 1PSDA 3AM5A 3Q2IA 1XD2A 2HF7A 1PR5A 2RKWA 3HQ4O 1NFRA 1S7GA 2OC4A 2PUTA 2YW2A 3IT1A 3MGAA 4QICA 1W73A 4Q9KA 3T99A 1LUAA 4N41A 4JHXA 3DE4X 2NVWA 1D2HA 1I1NA 3MVEA 3V42A 2ZIXA 4GS5A 2P9YA 1A0OA 3E6AA 2J9ZB 1XD9A 2NU6B 3OSZA 4YJHA 1U9YA 4ZKDA 5HX7A 4OM7A 5LP6A 1FYVA 3PLRA 3QJ5A 3T3EA 2BN4A 3PGKA 5IYZA 4HDQB 1A9XB 2OQRA 3LBAA 3DE0X 4N6NA 2CLIB 1S3GA 5FRDA 1K6IA 3AO0B 5AJTA 3PUZA 3CRMA 1QZ3A 1EXVA 1BZYA 3FNBA 5I9NA 3W7AA 5JG7A 1RZRA 1GG8A 1VM6A 1VMDA 4PZPA 5B12A 1KP9A 2BLNA 2WE7A 3I9V6 3LBFA 3QPAA 3WL6A 1QU2A 4RO0A 5M5BA 4DF3A 5CLHA 5K09A 2JJ2D 1Z17A 3ABOB 1OXXK 3SIRA 1Z12A 2CFRA 5BMVA 2BFFA 1QF6A 4AIRA 3LCVB 4LX8A 3GBVA 2E7ZA 3GJQA 4M1YA 1VLHA 5LQSA 2O2ZA 3M81A 1YTUA 1QZZA 3KYDB 4GRAA 4DS3A 4E32A 1AKNA 1PEYA 4IHAA 1JTFA 5AJXA 4XGQA 2QTGA 3CV3A 1XZBA 4N39A 1NJ2A 3MHPA 1FX0A 4YJ3B 1CU1A 4D25A 4IEIA 2C4TA 3GJZA 3EGEA 1EVJA 4LC0A 4QQRA 1L5KA 2HQRA 3K09C 4MKXA 4ETIA 3DTYA 4YRGA 5T8KA 3TS1A 1ZRSA 3AZOA 4DLUA 2B5WA 3OE4A 4X6YA 2D4AA 4E07A 2YJ3A 1JQLB 2CFCA 1V7CA 4OHZA 3R7BA 1CWUA 4MS3B 4RA6A 5TT0A 3RVQA 3UB3A 3I1FA 3S7ZA 3FZGA 3UNXA 3ESXA 2NYAA 5G0UA 3H87A 2J9FA 3PC8A 3E4CA 4YRMA 4O8CA 4ZN6A 2ZIGA 3KKPA 1H6AA 2W6JA 3QVXA 3JYPA 4AX4A 4EY8A 4BB6A 2K5UA 5CB8A 2XF8A 2D0PB 2C9ZA 5EZYA 1LA2A 2II6A 4WNAA 3VYRB 5BW8A 2FSFA 2F1KA 2B36A 1P0QA 3HJNA 1Q22A 4EF4A 2OZPA 2A94A 2OZKA 4RNCA 3S27A 2XZPA 3DS8A 3C41J 4F6CA 4U63A 1M1YB 3WLFA 3GRAA 3IOEA 3OLVA 4JA0A 1NVVR 2VDQB 5JPIA 4ALJA 4BVKA 5JYEA 4N48A 3DM5A 2C5SA 3UQYS 2W2MA 1YR6A 4P98A 1LNSA 3QJYA 4UMVA 4MYSA 4D9KA 5BMOA 2UUAB 4QBKA 1E64A 3FHOA 1LF0A 1KSHA 3E3AA 3O4HA 2JRLA 2KM1A 4H0NA 2LCFA 4N4AA 1I51A 4PZEA 3VNRA 3ZD6A 3FTEA 1WY7A 4DLNA 1S5PA 4QJ4A 3K6SB 1SU7A 3H13A 5BV2P 4D0GA 2GTIA 2DUNA 1UAGA 2IDZA 4XWTA 1G20A 3NM4A 4DDWA 1E2QA 1NFFA 1W0JD 4JP8A 2H51A 3Q3IA 3TZLA 4CDMA 1U2EA 2IOFK 1BS2A 3N8IA 3OPQA 2NT4A 3OG9A 3SJ7A 1QLHA 2HI0A 1Z36A 1EK6A 1KZ9A 1FYEA 4UVHA 3D5QA 2B4RO 4F3TA 1DHRA 2EF1A 4Q9NA 3U3DA 2A8YA 3CUTA 1E79D 2VHWA 2B9VA 1VTKA 4O4IF 4RZIA 3ZVMA 2WABA 1OC4A 3P9CA 4DJEC 1WMEA 4MR8A 3U62A 4MDEA 1H2AS 5HF8A 2F43A 4K9RA 4BIMA 3W3AA 6ADHA 1VKOA 3PQDA 3CVYA 3OEYA 5JMOA 1HDRA 4CMBA 4F2GA 4PHCA 2HQBA 1CJCA 1J56A 5C3UA 2CHQA 2HMYB 1SXJE 2HRQA 2V1UA 1DTWA 3R6LA 2O3JA 5DX0A 4ZVUA 4YT4A 16PKA 4RFVA 1Y8RA 1R1DA 2IEGA 3DEYX 1UPAA 1E9AA 2WVJA 3H2HA 5LXTA 2Q6VA 3ETLA 2V7PA 4FMDB 2F3RA 3H75A 1IMOA 1O5OA 2P2ZA 1A8UA 4LF9B 2XXBA 3QNUA 2XCTB 3UK2A 2WVAA 1E2KA 1HZZC 1WIWA 3LVBA 1CY6A 1E1RA 2DU8A 3E3NA 4IKEA 4WOKA 3RC1A 1BDHA 4B4OA 1U0LA 5BSFA 4RW0A 2CNDA 5KNBD 1FQWA 2H1CA 4Z6KA 4E2XA 3BGWA 4IHJB 3U3XA 4AN4A 4ZVPA 1EB9A 2ADOA 2BM1A 2VYNA 2VWPA 4G5YA 4K1XA 4MUJA 2IV3A 1A1SA 2AFIB 2J3LA 2R7MA 3AHCA 1RI2A 3WLSA 3AVWA 1KI8A 3AFMA 4TS9A 1ODLA 4EPWA 1MHPA 1QCYA 1AM4D 4I99A 1W75A 3P2KA 2W4QA 3OESA 4KXNA 3KVRA 5DJ5A 1EFCA 2B4QA 5FBLB 1DU4A 3VC3A 2HOQA 4MDHA 1PT8A 3IR5A 2G0TA 4QNNA 2OK8A 3HVJA 5LB4A 4F9GA 2HTFA 1KDVA 3TUIC 1KH1A 3KE9A 3FB1A 3VU1A 3LC1O 1THMA 3P9NA 4ZOLF 5G41A 3SHOA 3WHKA 3DZ8A 4C7BA 3SR3A 1U8XX 2GZAA 4AJHA 3L07A 5B4VA 3VYSB 3KB8A 4L2IB 2ZBFA 1FTGA 2WP0A 3VR3D 2XTJA 3PFWO 3V8VA 2XBUA 1EXNA 5JXJA 1B23P 3JW8A 2IPOA 3IHWA 2V3CC 2FPPA 3AR4A 3LM8A 5DWQA 5K7SA 1NPDA 5J2UB 2AHOA 5JQGA 1V6AA 2Z8ZA 2ZRIA 3L02A 4JKOA 4E5PA 3HN6A 3HZHA 4LRQA 1VB5A 1WA5A 3TL2A 4CQNA 1FMLA 2WT8A 3KOUA 3O1LA 4JLNA 4QSMA 5FI1B 4IL5A 3BULA 2QYHA 1SAYA 3MCZA 1KR2A 4ZREA 3W0LB 4I6EA 4HX2A 1IM8A 4R1OA 4Y6QA 3SEFA