4OG2A

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with leucine
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
total genus 140
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4og2A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4og2A01
4H3HB 5JNRA 5DGCA 4N76A 4Q6WA 4UHJA 3EAFA 3OO1A 1RZRD 1SRRA 4EVSA 1XHFA 2FMIA 4F06A 3IP9A 3B2NA 5IUNC 1IIBA 4Q6BA 3HVRA 3N75A 3W9SA 1BVHA 1L5ZA 1KRWA 5DCLA 3FMVA 5TQJA 5KWSA 5HKOA 5BRJA 5KQLA 3LUKA 3OM0A 4IMIB 3CTPA 3T95A 4MQFB 4WZZA 3LUJA 1NXOA 5BR1A 4Y9TA 4KQ9A 3MF4A 5FWYA 1YMUA 2IPLA 3I42A 4W5QA 2X7XA 1TM2A 3EULA 3H75A 3NNDA 4RY9A 3CFYA 3DZDA 3EJWA 4MQEA 2WRZA 2RDMA 1A0OA 2Q5CA 1APBA 3OMXA 4O5AA 3LFTA 3URMA 2NZVG 3O1IC 1H9CA 2JCGA 1DC8A 3KCNA 5DLEA 3R0JA 1KRXA 3NHZA 1DBQA 1EWVA 1YTUA 1DZ3A 2PL1A 4N0QA 5TQ0A 2E4ZA 2FEKA 1VPWA 1JLKA 4E7OA 1USIA 3QLVC 1MB3A 3TMYA 1ZY2A 3TO5A 3K4HA 1NXXA 3N0WA 2V0NA 3EODA 4IF4A 3H5IA 2E4WA 1UDRA 3C97A 3KYIB 4RY0A 5TPWA 3IP7A 3HDVA 1K68A 3MYYA 3A0RB 3QEMB 3M9WA 4LZLA 2R48A 3QLUA 2WJAA 3O74A 1MVOA 2FQXA 2E4VA 3CKMA 2ID9A 1SXGA 4G0PA 1W9HA 1Z25A 3H1GA 4NICA 1ZDMA 1Z12A 3UK0A 3KS9A 1QNLA 4KQCA 3N8IA 4DQDA 6ABPA 1JYEA 3UKJA 5IUJC 4PZ0A 3DGEC 4NV3A 5KQMA 2GX6A 4MR8B 1E6LA 1Z13A 3BBLA 4ZJPA 3QELB 1W25A 1ZAYA 2LBPA 5T3YA 1QP7A 3CZCA 5ABPA 2L17A 4RZSA 4KREA 3DGFC 2RJOA 3KHTA 3H5VA 2JBAA 4ZYLA 1YVUA 3QEKA 1DRKA 5F64A 5JS2A 4Q7EA 3CS3A 5EWJA 2MSWA 3QX8A 2PMCA 8ABPA 2MYPA 1ABFA 3KLOA 1PNTA 4CBVA 1JH9A 5TPZA 3I5AA 3FDFA 3Q7SA 1NY5A 4RXMA 3SAJA 2LPMA 4EVQA 3SY8A 3CRNA 1LJUA 1D2AA 3HV2A 1VKRA 3O1HB 1T34A 3IDOA 5JNVA 4TN5A 5C5CA 2QZJA 3C3WA 5EWMB 5JNSA 4KK4A 3HM9A 2F8TA 4W5NA 1FFSA 1LBHA 3QEMA 3SQNA 1FSPA 3O21A 3HDGA 3JTEA 3NBMA 4MRMB 2FKAA 4ETNA 5FWYB 4YP9A 2PUBA 5GOTA 4KNYA 1B00A 3I09A 3F73A 1QO0D 2IYNA 1I3CA 1CHNA 1NATA 2R25B 4Z99A 4D74A 3GA5A 4FE4A 2PUEA 1YIOA 4KFCA 4LX8A 3T8YA 2XDYA 3O1JC 7ABPA 1L5YA 3HSYA 3RVNA 3H5WA 1GCAA 1D1PA 3LKVA 4JA2A 5DTEA 1F51E 2CHFA 1JFSA 2MSKA 5CNMA 5CNJA 3EDCA 3C3MA 2JVKA 2PJUA 2ZWMA 2NT4A 3GV0A 2CHEA 1KGSA 4GPAA 4HNSA 2HQOA 3HCWA 4JAVC 3M9XA 4QPJC 3C3KA 1TMYA 5B3JC 5TQ2A 5JNWA 1P6UA 4F11A 2L18A 2VUIB 1U8TA 1PUXA 1Z16A 1ZH2A 2VUHB 3HEBA 4G0ZA 4RK5A 4MQFA 3CNBA 1U04A 4PICA 4MR9A 1PNRA 4RXUA 3OLZA 4IMJB 2PUCA 4L85A 4N0PA 4L4UA 3DLHA 2KYRA 2FLKA 1LK0A 1Z2DA 3HUTA 1DG9A 3P9YA 1D4ZA 5B3JA 4EYGA 4TLMB 1DRJA 4RWEA 3CZ5A 4EYKA 5FWXB 3NHMA 1OXKB 1USKA 5T7BA 3D02A 1YS6A 3T6KA 4HNQA 4RK6A 4EYQA 4H60A 2F8SA 1USGA 1U0SY 1PEAA 4O1IA 1U2PA 4Z9BA 3O2SB 4MAAA 4G0XA 4TLLB 1RPJA 3QLVA 1JBEA 2MYNA 1PEYA 4ETMA 3OO0A 2ZAYA 2CD7A 2R47A 5IC5A 3DBIA 1RZRA 4IGAA 5HQJA 5IULC 4N47A 2PLNA 1J56A 5TPWB 2CWDA 2VK2A 4Z9AA 1BAPA 1ZHHA 5CNKA 1GUDA 4ETIA 1FFGA 4MS3A 4S04A 3LUFA 3HXMA 4XAQA 3H5LA 2QVCA 4RK1A 2YHAA 4WXMA 4YV7A 4Z4IA 3JPWA 1E6KA 2JK1A 4Z0NA 4N41A 3HO1A 1FQWA 1YK1A 1RXEA 3KTOA 3OQNA 1JDNA 3NNNA 2FEWB 4B09A 2IPMA 3EQZA 4PYRA 3HS3A 4MR7A 4PEVA 2IPNA 2HJ9A 1DCFA 1C0EA 5FBHA 5FBKA 4EYOA 3H5OA 3QX9A 4MR7B 1YMVA 2JVIA 3OQMA 3FFXA 4MS4A 2IKSA 4LE0A 2FN9A 2ID7A 3CG4A 3GL9A 3H5TA 4ZMSA 2M1ZA 2FMHA 3BRSA 3D8UA 2NT3A 2GI4A 4RK4A 9ABPA 3RVQA 3GBVA 1E6MA 3MM4A 2OQRA 1BDIA 1URPA 1BA2A 3EGCA 3LUAA 2JB9A 1ZESA 2LP4Y 3CHYA 1DBWA 3F7NA 4OLBA 3KSMA 1F4VA 4YR7A 2LUOA 2PKXA 5IBQA 4MRMA 3FFWA 3N6VA 4YGXB 4F8JA 2FVYA 5IUKC 4Z4EA 1PHRA 3HJFA 3N0RA 1LJLA 1ZGZA 1JFVA 1DC7A 3HZHA 3LOPA 4LDZA 4NQRA 1ZVVA 3A10A 2I6FA 3TD9A 4MLDA 1NXWA 3N53A 4ML3A 1TVMA 3E61A 2P4UA 4MYRA 3ILYA 4GNRA 4P98A 3RH0A 4Z4CA 2WB4A 3RVMA 3LUCA 3ROTA 1EWTA 4XFKA 4YLEA 2FLWA 4IRXA 5C5EA 3Q15C 4RU1A 3VNBA 1R8JA 4RXTA 2FW0A 5HM6A 4G0QA 4MPTA 4EGSA 4YRZA 5JNUA 3KKEA 4MGEA 3JS5A 3EQ2A 1CEYA 2FMFA 4DADA 2FQWA 3KG2A 4MLCA 5KC8A 2FEPA 2B1JA 3BILA 2FTKE 4D6YA 3VNAA 3H1EA 3H6HA 4RSMA 1BDHA 3O2JA 3ROFA 4EVRA 1WETA 2AYZA 2GKGA 3H1FA 2W42A 4MR8A 2HQRA 2FSPA 2RJNA 3OLXA 5TQ2B 2JVJA 4FE7A 5KQGA 1EHCA 5PNTA 1AB5A 1VLZA 4KK3A 1YS7A 2WJWA 2QU7A 3ILHA 3GWGA 5TE9A 1Z15A 3OM1A 2N9UA 1DJMA 5FWXA 5E3JA 1ZGGA 2P9HA 2OENG 3RVRA 4WT7A 5KQPA 1S8NA 4MS1A 2H3HA 3OQOA 1QKKA 5BQ3A 1QP0A 2JRLA 3FGZA 1QQAA 5EWLB 4RKQA 1P6QA 3GT7A 2VYCA 2R4QA 3MMNA 4RY8A 1D1QA 4JB2A 4KVFA 5IEBA 2PE5A 3K9CA 1XHEA 2IPAB 3OLYA 3CG0A 2FN8A 4H3KB 2FXIA 3E3MA 5KC9A 4MS4B 4QYWA 4RKRA 1C4WA 2PUFA 5ED4A 5DKFA 3MA0A 3GBPA 2M98A 1QO0A 5D2CA 2H0AA 3MQ4A 1JWLA 1JYFA 2IDMA 3SNKA 3HK2A 3T38A 3LMKA 1VRVA 5GQSA 4OBBA 1EAYA 3IPCA 3GRCA 4NCBA 2HQBA 1XWWA 2HSGA 3MIZA 2WY2D 1RNLA 1QP4A 2BGGA 3A0UA 2J48A 2L19A 3NNSA 4RV5A 3LUHA 2B4AA 3LUDA 3Q9SA 2FMKA 4RK0A 1EWKA 4Z4HA 1P2FA 2MYUA 2A9RA 3RVKA 1NXVA 4O1HA 1DCMA 2O20A 4QYMA 2QV0A 5EWLA 2LIVA 2A9PA 1ZITA 4MS3B 5TPZD 3CU5A 4W5TA 3I45A 4KMRA 4G86A 4XASA 5EWMA 2AYXA 4LE2A 1TLFA 3IPAA 3IP6A 4XLTA 1JFTA 1QPZA 2E4XA 2WMYA 4N03A 4S05A 3OLVA 1M2FA 1M5UA 3RQIA 1NXSA 2NUBA 3LKBA 3QK7A 3N0XA 4HYEA 1GLGA 2YHBA 4JP1A 4QICA 4RK7A 4EY3A 2L2QA 4HNRA 4NCAA 3C6QA 4OLAA 3Q41A 1SXHA 4KRFA 5I4CA 4P1ZA 3QLTA 5EWJB 1QQBA 3H6GA 5HSGA 4YS6A 3KLNA 1ZN2A 2A9QA 1GUBA 5IX8A 1ISRA 2JBAB 3G1WA 4TMYA 3RVPA 1LBIA 3TB6A 2HPHA 2A9OA 1MB0A 3Q7TA 4KZKA 5KI6A 1ISSA 1ZH4A 5CNIA 2QW1A 4G97A 4F12A 1DP4A 3BRQA 3RVJA 2MSLA 1NTRA 4G0YA 3S99A 2E4YA 4DN6A 1MAVA 3HUUA 4F3TA 1A04A 4LRQA 2FQYA 4JASB 2QVGA 4KV7A 4PE5B 4KPYA 4M88A 4OTZA 4W5RA 4YWHA 1RXIA 4UHKA 2DRIA 4MQEB 3UUGA 4D6XA 5IEJA 3RVLA 5JNTA 2PAFA 1SXIA 3JVDA 1A2OA 1GCGA 1OXBB 4OATA 5JS1A 1P8AA 3SG0A 1Z18A 1YK0A 4WWHA 3F6CA 1JF8A 3CLKA 3KYJB 1U2QA 4FB4A 3SM9A 5CHYA 1NXTA 2MYTA 1Z17A 3M6MD 4LE1A 1Y1LA 3IP5A 3JPYA 3Q7RA 3O75A 1KMIY 4MS1B 3BREA 2RGYA 1FFWA 3GYBA 3TX6A 3G85A 5TQ0B 3L6UA 4XXHA 3JY6A 4JOQA 4XARA 1MIHA 2QXYA 2WWVD 1TJYA 1QMPA 3JVIA 3LUGA 1SD5A 4G0MA 1EFAA 2E4UA 1Z2EA 1NXPA 4W5OA 4YO7A 4YCSA 3F6PA 1AB6A 1DCKA 1CYEA 4RDCA 2QR3A 4JB0A 4IILA 4OG2A 4Z4GA 1E2BA 2PL9A 2GWRA 1JL3A 1HEYA 3QLUC 6CHYA 3RVSA 2TMYA 4WXEA 3RVOA 4WUTA 1BDJA 1M2EA 3A3KA 1Z26A 1JHZA 2PUDA 2GBPA 2NZUG 4MR9B 4ZPJA 4Z4FA 1K66A 1M5TA 4EUKA 1D5WA 1JDPA 3L49A 4LDAA 3QELA 4E7PA 3DLBA 1JX6A 4ZMRA 4G0OA 2IOYA 1ABEA 3OLWA 2QSJA 2PUGA 2PUAA 3LTEA 3O2QB 1DBPA 3KJXA 3FFTA 5BRAA 4RS3A 3OMWA
chains in the Genus database with same CATH superfamily
4MVJH 1F8UA 1IVNA 2F2TA 3LBAA 3MRSA 4ZYUA 5IFKA 2VDOB 2R7NA 2O7NA 2OCKA 2G9VA 3GLGB 3V42A 4YQZA 4XGKA 4X91A 2CC2A 3KKMA 5CVJA 4DCVA 1M6WA 3FETA 2PD3A 4UTNA 2D8MA 1NBEA 2YZNA 3L0BA 2BIFA 4BY9E 2WOOA 1JNXX 4CKWA 3HVRA 1GPJA 1L7AA 3ENQA 1ZUNA 3RC9A 4L5CA 3ZQJA 2F67A 1JILA 1KY3A 1JQJC 2OY0A 2Q99A 1PQ4A 5E9WA 1WE2A 4EENA 3A6EA 3U5ZB 2RGXA 5J2UB 2WG0A 4UEKA 5BW6B 2XZTA 3H75A 5D8DA 1NUSA 2DFVA 5BN1A 4KOEC 4RA9A 2O7VA 1M6HA 2RDMA 5HCUA 1J0DA 1VJ1A 4QWWA 3DLPX 1X38A 1SULA 2IHZA 4LXHA 1KEUA 2IP2A 5I3CA 1TO1E 2VSFA 4LHZA 1H9CA 1Z6GA 4ZCQA 3RU7A 4PR3A 1KRXA 1ZH0A 1PEDA 2C1EA 3EVCA 2R00A 3R2JA 3VC2A 2DQZA 3EC7A 1P17A 2VA9A 3OZEA 3PHCA 4UZFA 3QY0A 3ZZTA 4CMHA 5K5EA 2FN7A 3V9PA 4ARBA 5HF6A 4D8YA 3KIPA 1C9KA 5ENZA 2FFRA 3ANYB 3D7LA 3KOOA 1GKLA 3MD9A 3GEBA 3P45A 1ZY2A 4P84A 3TMYA 1P44A 1Q0PA 2NYAA 4YMVA 3QOXA 1MW8X 1XCOA 2OXTA 1KIAA 1UMDB 1O7JA 1OJLA 3PQDA 2FRXA 3C5HA 4OKIA 3GUHA 2E4WA 5B55A 3W9YA 1KPHA 2QPTA 4DBLC 3A6LA 3PK0A 1L4GA 3VO9A 4X7RA 3A4NA 3CR8A 4WZAE 1YVDA 3SWWA 4EA6A 1G5RA 5DISB 4K9PA 2B30A 2H3EA 3INGA 3PQFA 4URUR 2ICAA 1SXGA 1C3XA 3E53A 4WH0A 4LYGA 2X8JA 3H1GA 2HSEA 3P0EA 4QOSA 5EHXA 4XIIA 4NICA 3MXOA 4EDFA 3E7DA 1YR1A 1RACA 1TNDA 2O2CA 3SF8B 4MHOA 1CEEA 5FHQA 5JANA 1CRQA 1OZHA 1AO3A 3AJRA 1ODLA 3ASZA 3LI2A 2XW6A 4PZ0A 1H4TA 4QSMA 4AM8A 3VFDA 2HNKA 2QAJA 3MJCA 4LKOA 2XCQA 1B8NA 5JAOA 4LWZA 2JIDA 3PCXA 1CS4C 2QM7A 1MN6A 2LBPA 2PXHA 1UFVA 4GOKA 4BMPB 2O8CA 2H08A 2L17A 1QO7A 3K0EA 3VNRA 4BXOA 3H5VA 1UFKA 1N2EA 3UH1A 4CM7A 5EKSA 1H8EA 4GYYA 4JH0A 3IIIA 2V7QD 3N5CA 1B3BA 3O8QB 3OETA 3SYLA 1TK9A 3WTBA 4BQOA 5EHZA 1W47A 4MPDA 4JI2B 4ZI3A 1Q20A 3B1XA 4Q93A 3DNMA 1QYVA 2AI3A 1Q6ZA 4MVJP 5IHXA 1MENA 2Y1CA 4IWYA 5ALMA 3W06A 4ZAGA 4BV8A 3GDOA 8ABPA 1X3LA 1K27A 2XIJA 3CWQA 5FNZA 4B6SA 2FP3A 4ZTUB 3IUJA 2FPKA 1T9BA 2QRUA 2QTFA 1JEEA 2OUIA 5BWCA 3NEPX 4UMEA 1G5IA 2L69A 1TKCA 3CRNA 4KQ2A 4OEHA 5SV2A 4N3BA 2CWWA 4Q24A 2BGWA 4HTFA 2A1UB 3FNQA 4G5FA 3EA4A 2I2WA 4JITA 4ND5A 2E18A 4PCUA 1ST3A 1U2SA 2ZIAA 4KFRA 1PJ2A 5AHRA 5F3WB 4MKXA 2HGZA 1FYDA 3E6AA 1VM6A 1FSPA 5ALEA 4D0SA 1E3QA 3OY2A 4Z1MA 2DFPA 3G79A 2AN4A 3QWBA 2AOWA 2P0AA 4U2BA 4DR3B 4X93A 2ONCA 1P1JA 2AXQA 1OW3B 3MILA 4RZXA 2PT9A 5B1EA 4Q1DA 2HO4A 2NO4A 4Z6KA 3D81A 3UHPA 2ZXUA 1YIOA 4ISBA 2QD2A 1N9KA 2WF9A 3W5UA 2CDBA 1SXJB 5JNLA 2P9BA 1N6KA 3DDWA 1U0OC 3ABRB 2D3TA 3GEGA 3PCRB 3HSYA 3L40A 3MMSA 1Z4JA 3CXRA 4PLZA 5EZ6B 3T7DA 5JCJD 2MTBA 3B2QA 4G23A 4C7XA 1ZK2A 4UDXX 2ZDGA 1CUUA 4FCTA 5K9ZA 1D04A 3EZYA 3B6ZA 1PS8A 1R4NA 4LBZA 1YB6A 3GRPA 1RXVA 3CO0S 3D0RA 1IUNA 1D6MA 1PT7A 1K7XB 3I9OA 2HQOA 4JJGA 5DBEX 1NLZA 2F64A 2BFDB 1Z7BA 2F1KA 2GXSA 4R05A 1N5KA 1OWOA 1V5EA 1AO0A 1MTOA 1T13A 3DB2A 3SDBA 3K70C 2V7XA 4H35A 2Q9UA 2R8YA 4V3BA 2CMFA 1TPYA 3OVMA 1EI9A 1U2DA 4LS3A 1ZH2A 1NN1A 1CUSA 3AJEA 1NVMB 4MQFA 5AVQA 1U04A 1FXWA 5GZ6A 1XD2A 2IY9A 1EE1A 4A8TA 2ZOSA 3OTOB 2I67A 5C46F 5JLAA 3GFVA 4FT4A 3E7PA 1LC3A 1ZC4A 1ZUD1 2EZTA 2PGLA 3EMBA 4H0FA 1S8FA 3MAAC 4H9GA 4LJSA 2QTLA 3SE0A 5JOQA 2C2KA 5DXAA 4HLNA 4CF3A 1I2AA 8GPBA 1QDUA 1RQNA 1J2YA 3VU3A 3CVJA 1P4RA 1GQSA 1QGUA 4L16A 4HNQA 3W34A 1LZLA 1T1SA 4QFDA 1R4ZA 3GJRA 1M0WA 2ZE8A 4L75A 1WP9A 4O1IA 4W4TA 4A36A 1LFDB 1M76A 4MAAA 2FEAA 1QG2A 5C34B 4FN4A 5L3QA 1HOTA 1KFEB 3CCFA 4F84A 2WVJA 2FSHA 1VTKA 5GONF 4YBRA 1W6RA 2LKCA 2X8BA 4ZQCB 1C9JA 1II9A 2QDXA 4CM5A 4KIUA 4CKEB 5IPFA 4EEXA 1AGPA 1OLXA 1JBKA 1N7HA 2AJ8A 2QQ5A 3OCVA 2HA5A 3AFHA 4Y6LA 3BF8A 5FUYA 1ZHHA 4ZDWA 3PXUA 4HNHA 4L8YA 4RL6A 3CZAA 5E4JA 1R5OA 3ZBTA 3T3MB 4OHZA 4BVJA 4BL5A 3IE0A 1OBVA 2NAPA 3Q11A 3KVVA 1YK1A 3C0KA 4J29A 5KDLA 3U0BA 3QMWA 4GOLD 4D43A 2XXAA 4X20A 4I4LA 5A4IS 1AG9A 1K4MA 3H0EA 2ZP1A 4YJ3F 4NK4A 5C9ZA 4B3MB 2DQSA 3ICCA 2AE1A 2JFUA 1I4LD 2PGJA 3RROA 1N2GA 1M7GA 3BTSA 4AJOA 2D2IA 1K7SN 1SUDA 2P0EA 2PBRA 3PRJA 2FK8A 3KU1A 2DP4E 5EJFA 4YCCA 1AA9A 1R37A 4DKXA 2OKGA 2Z2YA 2V3WA 5ARBA 4LE0A 2DHEA 1UBEA 3HR8A 4KU4A 2QG4A 5H4GA 4UREA 5A9SB 3K94A 1QHSA 5EG5A 3GJ6A 1URPA 1LPBB 1HI9A 2Q29A 2BUCA 3HWWA 5AVZA 2P65A 2REXB 2BFBA 2Q0SA 2NIPA 3Q40A 5ECYA 5JSFA 3EIUA 1Z4NA 2JGFA 2EYUA 2IUFA 1RYDA 1W4BA 4UUBA 3ZDEA 4L07A 1WSWA 4BFSA 3TPCA 5IBQA 4D9CA 2NMVA 2ACVA 5KHLB 3HJFA 2RAUA 3FX2A 3N0RA 1HSOA 2V8BA 1FS4A 1AM4D 1ZGZA 5JRJA 2GCOA 1TCUA 3KKQA 3I0MA 3T15A 5JXWA 1DADA 3GA7A 4DAEA 1ZVVA 3OJOA 1UBMS 4X6YA 5EXXA 3DKKA 3SEFA 4EP1A 5M34A 5ISMA 4RYDA 3I1JA 2OT3B 4MLDA 3RKRA 2FKNA 4CQJA 4TYYA 4AY4A 2ILVA 1TJ5A 3SHWA 3E61A 2XUGA 4MYRA 4X63A 5AM5A 4CKBA 3LXMA 4WLUA 5DHPA 1XSEA 1U2GC 4FFWA 2LNDA 5E9AA 2FLWA 2QV7A 1N2OA 4HVLA 3GLFA 3EXFA 3S81A 1NJGA 1BS1A 3PJRA 3UK6A 1UEJA 5AKKA 2Y6VA 5FDFA 4TT3D 5JNVA 3DJYA 3K0FB 3DH0A 4QFBA 2J5BA 1T29A 5HGJA 3RAGA 4AULA 4PQEA 3P19A 4EKEA 4WZBE 4JI0B 2FEXA 2FMFA 3W3AH 3ANTA 3PQEA 5ICCA 3W5DA 6REQA 1SC4A 3FVVA 1J42A 5AWFC 3BGVA 2Y76A 3U3RA 1KDZA 1BMDA 1X86B 4TKLA 4B80A 4D5GA 2KHZA 1H1LB 3H1EA 1KJ8A 4GGPA 4KWCA 3GJSA 4MQUA 3ZGNA 5HQ3A 4EFKA 2HRRA 1NQTA 4D4KA 1UPBA 3HEMA 4Y7CA 2C9ZA 4X61A 4L72A 4RY2A 4A9AA 4KK3A 4AF7A 4B75A 5CFNA 5LP6F 2LR0A 2XCOA 3E9YA 3UWPA 4AWAA 4F2HA 2XMZA 3NYQA 2NVBA 1XALA 1Q0TA 3LOQA 4BN5A 1C2TA 4UEOA 2JJYA 3BEOA 4GX1A 4TUYF 4YCLA 5AK4A 1ZGGA 2P9HA 4MW0A 4PXYA 2Q3BA 2RH9B 5K0BA 4KR0A 3U1TA 1FQKA 3TFWA 4D4MA 3N2YA 4GX0A 2J9YB 1W2GA 3H2SA 2FQQA 2V6JA 3K1ZA 1ECLA 4PC3A 4QBGB 1DRWA 4IJMA 1NF8A 2OGZA 3IE2A 4R9RA 3H5NA 3NORA 3OT5A 2VUSA 4AUKA 3GRKA 2X2EA 2CVZA 1D8AA 5CJPA 1M2KA 1KYYA 4KTVE 4EFMA 5KTRA 4QQKA 3NCTA 1TM5E 3T5GA 2HSDA 3AUFA 3U7EB 1VE5A 1CY6A 5FL7A 5TARA 4ER3A 1VI2A 1QPBA 2DQ4A 1J20A 3INNA 1TQ8A 5CPBA 2H0AA 3DFKA 5D2CA 1WB5A 2IDMA 2VZLA 2DH6A 3TTVA 4CQMA 4BAZA 5BMOA 3T38A 1FSZA 2AH5A 2OV1A 2YXPX 4H7JA 3DBOB 4RGQA 4UNNA 3T1NA 1OA1A 2PMDA 3GRCA 4J0CA 4MW4A 3DMRA 4L27A 3ZI0A 3D2AA 1J0XO 1ZOPA 4L78A 5JS8A 3THYB 1IBMB 1NVVR 1PNQA 4NBLA 5DN6D 1JH8A 2BGGA 3STWA 4C0WA 1VZ2A 1SBHA 2P2CA 3FNBA 4IEIA 4PINA 1UK7A 4BIIA 1WZNA 4JODA 4KAXA 4N5HX 3TLKA 4BNMA 1GG9A 1P75A 3R09A 3WDMA 1WHTA 2R65A 4KQ6A 4B74A 2JF0A 1JDBC 3GNQA 3P0RA 4MCAA 3PFBA 2L42A 5BPFA 5E6SB 3OZXA 2PDAA 2AJLI 2ZUUA 3LECA 5DWQA 5LUBA 3O3OB 2BKUA 4XASA 1ZISA 1P19A 5A4JA 5EMMA 2F8LA 2YVUA 1PYGA 1XJCA 2O07A 1T3SA 2CUNA 1R5JA 4O2BF 4KGVA 4Q4AA 3AJ8A 4ZWNA 4D57A 5L6LB 1E98A 4TMKA 3LBFA 3FSGA 1RQ7A 1ATIA 4LHSA 5A3QA 2PWBA 3O83A 4RK7A 2A88A 4PG8A 1WS6A 2R7MA 1JKXA 1OVMA 2RAPA 4UE3S 1DEOA 5B6IA 2F59A 2VQEB 3HLTA 2CMDA 1TZBA 3ULKA 2YWCA 1XZHA 3WMFA 4AMUA 1T9DA 3W6ZA 4E1BA 2Z2ZA 4KIWA 2HN9A 5TQVA 2ZTSA 2HAEA 2UDPA 3H7IA 1A8IA 1ZN2A 1SHKA 3N2GB 2K7FA 1G2QA 4JP8A 3BMCB 1LBIA 1DKLA 3PE6A 3C41J 1IOZA 3CN7A 3BD6A 4EFNA 1ZGHA 4UBLA 3TW8A 2BDUA 1RYFA 2JLSA 3UENA 2WWXA 1Z7WA 1TAGA 4RHXA 3QU5A 4NK5A 5GADl 3MWGA 4RZIA 1GM5A 5AI6A 4LQDA 4F2GA 2RGNA 3WDLA 3WYNA 5E3HA 5JQGA 3CKKA 2QG6A 4LRUA 2YVKA 2JGDB 1C9NA 2HH9A 5E8JA 3QE3A 3RS7A 2E4YA 3WL6A 4F3TA 1JQ5A 3DOEA 2BKXA 2HEGA 1N9ZA 4ZAYA 2Y99A 3MTAA 2ZZMA 1R3DA 3S7ZA 3PTLA 5IJ9B 1MQ9A 1NSFA 2I9KA 2XB6A 3MT7A 2WOJA 3VJMA 2XADA 2Z09A 1Q1EA 1L0BA 3C15C 1LWOA 4OP1A 1TM7E 3UUGA 4AO8A 5DM4A 2WILA 1XOIA 2PAFA 3RI3A 3NHPA 4N5IX 3FCEA 2R7AA 4BEWA 1I2DA 3RU3A 3SP1A 4GKAA 4JC4A 1FLAA 3A37A 2VTEA 3BD8A 3IPRA 4ZAFA 3KLBA 3KYJB 4DMHA 4QDZA 1B42A 3UK2A 5AVTA 3SM9A 3WQHA 4U8GA 2CFSA 1SPXA 1SA0B 2C4HA 1KR5A 3DEYX 3FHLA 3VHRA 2Z5VA 5ULLA 3TX6A 4TXNA 4DTCA 1RIIA 1X1BA 3IHTA 4RHEA 4FBLA 4ZCTA 1KI6B 3KU4A 1V3QE 2H63A 4Q15A 4HWKA 3W8RA 2Z3VA 4LQCA 5SYAA 4JL8A 2BMAA 4B4UA 4YK7A 2R85A 5FLEX 2KWIA 5JSYA 3FOZA 4Z9FA 3IQGX 1LPMA 3F3YA 3BDIA 1T4CA 1Z7EA 4MDHA 1NLMA 1L9XA 3E2MA 2J0SA 3AF3A 3D6TB 2YXNA 1NMSA 3LRXA 4LZOA 1U7OA 2C92A 1EFDN 1QH1B 4QRIA 4FYHA 2XDQB 1NL3A 4ITVA 4LC0A 1S1CA 4TTRA 2K7ZA 2XIQA 2AOXA 3OZUA 4PSVA 2Y1GA 4KHZA 5G02A 4JI3B 4H1WA 2XNCA 3BMCA 1IPHA 1Y6JA 4GLJA 4ZGWA 1VJRA 3IA7A 4BE4A 1JX6A 4G0OA 2LCIA 2HDHA 1NMXA 3OLWA 2C4NA 2J4CA 4BCCA 2POQX 1AN0A 1K7FB 1IVYA 1DWOA 1QG0A 2IS6A 1Y9ZA 4Y2SA 1G63A 2PIDA 5DDIP 4KQGA 1XRQA 4H3HB 2GJSA 3GH1A 2FWRA 1GUYA 2I3AA 4HNGA 1N0HA 1ZK1A 5LVAA 1SZDA 4FDUA 5ESRA 1YASA 3EVAA 4WOBA 5K4AA 3EAFA 5E2BA 1XHFA 4ZEVA 5A4DA 3JZAA 3ZWWA 4NP6A 3M83A 2AX4A 4KSCA 4BB6A 4YCMA 1ZK3A 3QENA 4JT2A 3TDKA 4HB0A 4FW9A 3BEDA 3VQTA 2G1AA 3NTRA 3OWXA 1CUGA 3DPUA 1DX6A 4M49A 5C5DA 3HKBB 1OI7A 3GRYA 5FLKA 1PJZA 2NO9A 1NDQA 3ADBA 5K0TA 3IIEA 4R98A 1GNQA 5BR1A 4EHKA 2RJ3A 2D7JA 2KQUA 1KU0A 1T5TA 3A1TA 2XUZA 1H2EA 4NCXA 2I6GA 3EEIA 2J59A 2PEYA 3HBLA 2HBQA 1MR3F 2A3RA 3LFTA 3V1KA 1ODJA 4BVGA 4X8MA 1CY7A 2G4LA 3IRUA 2BM8A 3OT1B 4HG2A 4PPYA 4GC9A 3STUA 3VYVA 2WTUA 2POCA 2QN6A 2Y92A 5HS4A 1XZDA 2VPPA 4N0QA 2WQ6A 4HZGA 2Q5QA 4AXXA 3QVXA 4B6QA 2WQZA 1M1YB 3EXHA 4D3YA 5E2IA 4KXXA 5HRUA 2OXFA 2PBLA 2ADMA 4E46A 2DUWA 1YUNA 2CK3D 4FQ5A 2QSYA 2BYTA 5TJHA 2Q0QA 2OOKA 4X71A 1SWVA 2GZ2A 2VS1A 3TLZA 1X87A 1VLHA 2VHVA 5BRNA 3NXSA 5IDWA 1JTVA 4MMXB 5ECGC 1MCZA 4CKWB 3U16A 1L3CA 3DXFA 2V0CA 1TTTA 1EM6A 3MWFA 1YFLA 4BPBA 3A1EA 1UZMA 1XAHA 1K7YA 4HVTA 5KCMA 3B5JA 4DM4A 2O2GA 4IEEA 1P7CA 2C2ZA 5UKDA 2G5PA 4YMUA 1FNCA 3UK0A 1EUDB 2ZBFA 1C81A 5ERYA 3VR2D 3GJ5A 2PWAA 2REOA 3VPHA 3A26A 3W6NA 4FOTA 4R1NA 2C7QA 2NZXA 4BE9A 5CFZA 2P5TB 1E1QD 3SLRA 2AJTA 3PVZA 2BZGA 4Y98A 1XQ9A 2V3CC 5JI3E 1FJ2A 1WB4A 4WQMA 1IMOA 4AQ7A 3SFTA 2VQ3A 1D1SA 2PUJA 4CM4B 1M10A 2NNWB 4YRIA 5JMTA 4WW0A 2ZUFA 1XZGA 4RH3A 5EIFA 2UZ3A 1CWUA 3CZCA 3E3LA 1Y98A 3RNLA 4YXFA 4ZYTA 4DV2B 3BXEA 1RP1A 1FU8A 3PJFA 5HVNA 2JBAA 2IYWA 2SHKA 2X7HA 3TPFA 2MINA 3ELDA 2QLNA 4IGKA 4E5NA 5FTNA 4B48A 1TU3A 2PCJA 3EIFA 3LDHA 2E6KA 1L5NA 1V4NA 4OQMA 3HV0A 3KZOA 5SY4A 1XYGA 3IMCA 2GPNA 5LR6A 3PEWA 2QTMA 2CMHA 4PZLA 3OT4A 4RVNA 2HNBA 2WPDD 3T7JA 3E22B 4WK6A 1R88A 4HI0E 1ZOLA 3PICA 4AB1A 4OYHA 5JCJA 1GP2A 3HV2A 1GG5A 2REBA 1UBHS 1ZRNA 4GPZA 2Z04A 3PBKA 2YJ5A 5JNSA 4Y6QA 3JQAB 4MO9A 4Q4HB 5IJXA 4BEJA 4EB0A 3LW7A 1QVRA 4H3VA 5BWNA 5JSKA 4ARUA 3EE6A 3DTNA 2VRNA 4R3UC 4A6DA 4AX4A 5FWYB 1EDEA 2I7XA 2VDWA 1VP3A 1NJ5A 1C9YA 4ZAXA 2GPBA 2Q1UA 1D6NA 4I36A 2ST1A 5KPJA 3LT4A 1WKBA 1Y4AE 2BEUA 1GZSA 1YRWA 4GNKA 4OXNA 3HKCA 5INTA 4FHFA 1CQWA 5K3FB 4CG0A 5FNVF 2FH5B 1D3AA 3MGCA 2J5RA 4DYHA 3D4NA 3JSXA 4QQFA 2NTYC 3OLCX 1EXMA 4ECEA 2RMKA 4MVCA 1B6GA 3FPJA 3UJDA 1FLDA 1GKKA 1M75A 1Y9EA 3MJSA 5EZ5A 1ZYUA 3DVQX 3VHXA 3T52A 4F11A 3ITDA 1UMCA 2ZVDA 3GPDG 4JP2A 5HKBA 1VE3A 4M8IA 1KS9A 1PR9A 1TB4A 4O0LA 4W5WA 5JI2E 1AGYA 5HKKD 1QHXA 1GAEO 4X0EA 2QQ0A 2O19A 1CCWA 3HO8A 2RI1A 3VC3A 4KXMA 3O91A 4NHEA 5H8WA 5AT1A 1RC0A 4R1UA 4WY8A 4AKTA 2PGAA 1WKCA 3RTEA 4J0QA 2C4MA 2FSVC 1NBOA 2ZE7A 3IXQA 5B3JA 5BQPA 1E2MA 3DR5A 1I2BA 2OQVA 2Z57A 1IEVA 1ES9A 1VG9B 4P53A 2OBXA 4B43A 1GRCA 4PN7A 1JQ3A 4FXPA 5U9CA 1TZKA 1D9XA 2V97A 2K6GA 1FFCA 4GFDA 3TR5A 2BRUA 3E82A 3PGA1 1YQXA 5C4GB 4CTKA 4YNBA 1USGA 2W6PA 5I9MA 4PO8A 4OQZA 1B0UA 5K8VA 3T9AA 4IIXA 1E1QA 2VLIA 5CDGA 4EVQA 3CW8X 1RFGE 1K8YB 4HGYA 3QTBA 4J0FA 2I66A 3QVWA 2G0AA 3TBKA 1U7PA 2D4HA 2ZI3A 1AQUA 2PLNA 2UUAB 1Z63A 3ABIA 3G3EA 1WXFA 4UHCA 1XPRA 1L5HB 1ZA1A 2HNAA 3HZOA 5SZJA 3D5TA 4B3TB 3RC7A 1H6DA 3TJZA 5DNEA 4Q9NA 3OTHA 3AUXA 4E5PA 1LVGA 5I4BA 4P3XA 3GG9A 4WXMA 5TT1A 4FSXA 3V5NA 4CRWB 5G1PA 1NR5A 2EV9A 3K0BA 4B7ZA 4CIXA 1IVSA 2QYOA 5IJZA 1TZMA 5CG1A 4QVGA 2GO1A 4FM9A 3CB2A 3N76A 4UDYX 5JJIA 3R3UA 4KKXB 1M83A 2CMKA 1HL3A 2KLHA 3GQVA 1TCBA 3KQMA 4Y7DA 4A7PA 2YVQA 5LBUA 2CXTA 1H1DA 2JCXA 4RF4A 2CYCA 4CV2A 5MN6A 2AR7A 3FMOB 1KI3A 4WSOA 4X60A 5EJ6A 4OPMA 1GVNB 3TI7A 5AYVA 1RCFA 1WD7A 4MTCA 1YMVA 3HN7A 3TMKA 4UOZA 4WXYB 1RAGA 1JXAA 2OV3A 3BULA 4RMIA 3T4PA 1BU8A 1T3LA 4LVNA 1V2GA 4HNTA 1T2VA 2J45A 2JJ1D 3CW9A 4XWYA 1EVJA 4KXFB 2PGXA 3ZVMA 2R6JA 1QK3A 4OIFA 3CRRA 1TEHA 4HTAA 3TRIA 4GQAA 3PT9A 1ZIDA 2W11A 2W98A 4BVFA 3TE6A 4HUQB 1BDHA 2X6QA 4RCYA 4KO4S 3BSSA 3WL5A 5C1DA 1L5HA 4YJ2F 3A4VA 2JAXA 1S6YA 1H2FA 1UKAA 2IXDA 2O0HA 2GJ4A 3G9UA 2XMSA 3VR3A 4TS1A 1OKKD 5CM9C 1C8KA 5LCXA 5L7TA 1G17A 3G5UA 4R4JA 1N6HA 3OFJA 3WB2A 4L50A 1KFBB 1UANA 1FRVA 2XNDA 3EPPA 3HZHA 2EGGA 3PDWA 4FD2A 1N2HA 2C7RA 1EFHA 3H84A 3Q0IA 3P9XA 4I0WB 4DTIA 1VQ1A 2HY7A 2EX1A 2ON6A 1W88A 2OZPA 3LKZA 3HJCA 3PE3A 3UJ8A 1U0GA 5B7NA 4NZZA 5DNWA 3LUCA 1QZ3A 4NEGA 2W71A 3RVMA 3VBCA 4XWWA 1N7JA 4YLEA 1ZNWA 1B93A 2DOKA 2Z98A 4HDMA 2FK7A 4JHLA 5FUWA 1NLYA 1R16A 4GM0A 3VNBA 2YKGA 1FU7A 3IOBA 1NQ5A 4PGFA 1YCGA 3PXBA 4KQWA 5AM4A 2CL7X 2O8VA 1KI9A 1A2QA 2CBGA 3GGDA 2FQWA 4J49A 4RM3A 3WL7A 1DLJA 4XI9A 1MVLA 4XLLA 4FDAA 3RKSA 5DHFA 3O2JA 3B6JA 1VHQA 4NFYA 2CFRA 1PJCA 1K9VF 2I34A 5NLLA 1G7CA 1H85A 1G8PA 1NWCA 4ZOLA 4D26A 3OJLA 1I2ZA 4C30A 1JG1A 1NVDA 4JN6B 4CIDA 2QPLA 1BMTA 3I9MA 5LYYA 4BV9A 3OQIA 4LNHA 3AB3A 3D8NA 2R1VB 3U56A 1TQ4A 5D84A 1WUJS 3BC1A 5FLYA 2WE7A 4R0NA 3AJDA 2EEZA 4PLYA 5KKNB 3ZC3A 2RGCA 4M7WA 1CZNA 4QTZA 4B45A 1XLTC 1BG6A 2V7TA 3HKEB 2W0MA 4JXJA 5LZ2A 1LNSA 2CNOA 2OENG 4KDEA 4LMRA 4PYIA 3KQKA 1OLSA 4JYAB 5E6SA 4P33A 2VPQA 4FSHA 3GJTA 4PSUA 2FAXA 4TLDA 3SZMA 2O6LA 2Z6QA 2GCGA 2Q2VA 5EWLB 3GLQA 4BX8A 2GTPA 2WF6A 2R6FA 4R8VA 1B2RA 1HZJA 2R4QA 3IMEA 3PT5A 4GX2A 5H82A 3ZDRA 1CB0A 1LBQA 1SIOA 2CL6X 2HA7A 1ZJ6A 1Z62A 3ZK9A 1L7DA 2FW6A 2PE5A 3OC0A 4M22A 2C29D 2UYGA 3L8MA 3W2TA 4Z3OA 4H3KB 1TKBA 3ZXSA 2FXIA 5DGIA 5E4YA 5F21A 4AP5A 1K86A 5ER6A 1AIPA 5I45A 3DFFA 1UPUA 5KOJB 1FRQA 1SKYB 1JYFA 3C2QA 3P1JA 2ZQ5A 1NHGA 4V0MA 5F23A 5LOVB 3U7HB 5JXIA 1DMRA 3KOMA 1BOOA 5KS2A 1TU4A 3GCXA 4LZJA 2J85A 1EAYA 2AMJA 3WL3A 4QAQA 1PYOA 4EK9A 4G3XA 2PUTA 2P8SA 4HDRB 4PZEA 2ZYIA 4R8KA 3FDJA 3WYCA 4EW1A 3OX1A 3A0UA 3CY6A 4HX2A 3F5QA 4CGZA 1EWKA 4E51A 1YKGA 3HZZA 4NZMA 5CVTA 5ITVA 1DAGA 4F9TA 3LYAA 1LS1A 4UAVA 5BVGB 4WNAA 4HAZA 4MWGA 2CHUA 4L22A 4ALJA 1FUIA 2PWZA 2NSDA 2R00C 3KL2A 3R5KA 4WJZA 1RPTA 1TVEA 3BMXA 5TPZD 1XQVA 5IT5A 3IMGA 5EAIA 4RZUA 1WU8A 2G83A 2H9YA 5F4BA 4CM4A 5C37A 4TS9A 4HWRA 2PN1A 2TS1A 3VSEA 4D9MA 3GJYA 1NX9A 5C7LO 4ALKA 1PGOA 2AC7A 3WRVA 4M7PA 4HP8A 2HD4A 4KR6A 1M1XB 2RG1A 5IARA 2P2GA 2DXIA 1CC1S 1KO7A 2EKLA 1M2FA 1M5UA 5AK5A 3ILSA 3T3OA 1XO1A 4PZZA 3CVWA 4LGCA 2D4AA 2D1SA 4NCIA 3TEMA 3P2JA 2YQ4A 2WA2A 3GIWA 2AT1A 4FHEA 4H7KA 1XJQA 1IZ0A 1S8AA 5JYBA 3MUFA 5T4BA 3ZK8A 1QYCA 3A6FA 4XTRA 1YO6A 2CUTA 4PSDA 3T3EA 5CR9A 3ZKAA 3HY6A 4RENA 4B3XA 1WR8A 1KYIA 1GUBA 2O2DA 3NXKA 2JBAB 4TMYA 5BQOA 2ZGVA 5F2NA 4A03A 4ICIA 4NV0A 4FILA 5DM60 4AWBA 5IT0A 1JJFA 4AURA 2YCLA 3L0IB 3WHPA 3RW9A 1RAEA 3Q6MA 4KE8A 2XOXA 3EQ9A 3K5WA 4WJLA 3M70A 5CNIA 1JDUA 3HB7A 2JATA 3LPCA 2QW1A 2VXCA 3A9TA 4FK8A 1A5ZA 1O6FA 4KWIA 5I7VA 1JPUA 4EO7A 2XODA 3WJ1A 2VDLB 4IDNA 3WY9A 5EJ7A 4RAQA 3B6EA 5T8KC 3JD0A 3OPXA 5A9TA 2BR4A 2F3RA 2MSLA 5BSVA 4JEHA 4OX9Y 4MUKA 4PPFA 1XMQB 4L8LA 4MV7A 3SSAA 3T7KA 5KSPA 3IUNA 3GP8A 1QGOA 2A5JA 4CM3A 1NR1A 4M88A 5E9QA 1XJWA 3AFIA 2PSDA 5IM4A 5F73A 4YWHA 3S5UA 5FWNA 2ZBDA 4EQ6B 1SKMA 3L84A 3B89A 4UXHA 3BSWA 2K2WA 3EBPA 4FFSA 4OUDB 4OH1A 4RH1A 3EGXA 1R6DA 1SIUA 1JPNA 4MCIA 3UUWA 3VZDA 3ESYA 3CXUA 2H4HA 3OCXA 3ZS9A 1F7UA 3UOGA 4AF6A 5AVXA 1R0XA 3EIQA 3PDIA 3AHEA 1UZLA 1RI2A 2I6UA 1L4MA 3AUKA 3JWHA 3P9NA 5CBPB 4B8YA 1OH8A 2MYTA 1U5AA 1Z5UA 2WU3A 1TECE 3F96A 3S2ZA 4DS3A 4PNEA 2AI2A 3X2SA 2NQTA 3RM3A 1H23A 2YS7A 3RHTA 1OXXK 1Y4SA 2RGEA 5CBKA 4PLGA 1FFWA 3UJCA 3DHNA 3ND5A 2YC4C 3L6UA 1M7BA 3JY6A 1LBTA 1F17A 3DKIA 3OJXA 4X54A 4G63A 4LQLA 5FBQB 4Q9AA 1A98A 1P2GA 2BFCB 1X1AA 2GZAA 1U1GA 3E5HA 3F97A 3KR1A 4LRXA 4P6VF 3ZHXA 4MV1A 3VUEA 1HA3A 4H0NA 4D0GA 5LDDC 3R8FA 1V5GA 1M5RA 2HXYA 2QR3A 4JB0A 3KZKA 1RT9A 1P4SA 3R74A 2CDAA 3M3HA 2Q3HA 2IBTA 1U3DA 4JLVA 3L4KA 1NVEA 4LMAA 3DE0X 2XCRB 3RDPA 3O4GA 4UD2A 2NU6B 4BNVA 3TG8A 2ZRLA 1Z26A 3B3JA 3FKJA 5BNTA 2JLUA 1WOYA 2CV1A 2GBPA 3TIXB 5GV8A 3H5AA 1JDPA 2O5RA 3QELA 3C8ZA 1XGKA 2VYND 2JGRA 3QI7A 3DLBA 1V6SA 4IIVA 4BQFA 5DI9A 1P0PA 1JQEA 1RMYA 4XUEA 5DP1A 3RNOA 1OR8A 4EHBA 1QKIA 5AFSA 4J0IA 1O6GA 3AK4A 1ZMBA 2Z8YM 1EK1A 3HU1A 4KC0A 1U1IA 1M2NA 1Z73A 1I01A 1AUVA 1SVLA 3CNNA 3H9BA 1JHXA 3QNUA 5DM0A 4JB8A 4ZK2A 2OHOA 1Z22A 3SK0A 1W85A 1Z39A 5K0ZA 4V0ME 5EP4A 4EVSA 3FD8A 4YQFA 2ZAOA 3K6JA 1KA9H 4DY4A 3CJTA 4HL6A 4C0LA 5IUNC 5AHWA 5TJ9A 2ZWIA 4MLZA 4E5VA 3R3XA 2UYYA 1NBHA 1H0HA 1BQEA 1Y34E 4QASA 1O0SA 4YN3A 4F5YA 2WIGA 3M1LA 2DQYA 1X42A 3GFPA 3Q1LA 1B1AA 4U6QA 4MQFB 3AERA 3O8OA 4CCYA 3LUJA 1DG1G 3OKCA 3RFVA 1RAFA 3ANMA 3RABA 3I42A 4YAOA 1BFKA 5IM5A 1XJ0A 2H1HA 3E35A 3R23A 4EAAA 3F6EX 1VE9A 4BBPA 2WABA 4RJJA 5BSHA 4FOLA 3MOGA 1XPUA 2PGNA 1X80B 3T9DA 1EJ6A 4P93A 5IYZB 1R4NB 2C83A 3IBYA 3IIKA 4CIBA 5AKHA 3ZUGA 4HDKA 5I47A 2RGDA 3TKLA 4UZEA 4ESHA 3PDCA 1EQAA 2ORED 2Z0MA 3IAS1 2ET6A 4WK0B 3SC2B 3ZDQA 2VT2A 3C16C 3AUYA 1M1NB 3LO5A 1OVGA 1H9AA 3LC0A 1IJFA 2FWPA 5F4ZA 3NO4A 2Q7OE 2FDCA 3U7FB 1A50B 6AT1A 2QP9X 5AW7A 3F46A 2KMLA 5KYGA 3ZBQA 1HPLA 1VFPA 3AB8A 2HYIC 3PA8A 4YJ3A 4KL8S 3B9BA 4RJKA 2AR9A 3OQHA 2IZ7A 1NY6A 5EGSA 1Z2NX 1WULS 2ZSJA 3GLRA 3M3PA 4IX9A 4XYLA 5B6JA 2RGRA 1US8B 2GFHA 1SAYA 2WJAA 1RC8A 2YMMA 4Y67A 2JIZA 5LYJB 1MX5A 1VKJA 1S4QA 2ID9A 3DV0B 2X4LA 4G85A 2DFNA 3FOFC 2HRCA 3KQSA 5HK8A 4IFBA 4ENPA 5AI4A 1RJ9B 2C4TA 3IEVA 2ACEA 1OFUA 1F8GA 3TRKA 1HR0B 1PZMA 1QYXA 3ZBPA 4ZCMA 1QTNA 4CLEA 2Y1KA 1B23P 1DX4A 1Y3DE 3R0IA 3LHSA 1JIIA 1PU2A 4KE7A 4EHJA 5I3ZA 1Q0ZA 5JRZA 1VMDA 2ZSHA 2ZJAA 1C0PA 5JSHA 2YYAA 4D4IA 4AG5A 4ZJPA 5CIWA 2DHDA 1LVUA 1S7CA 1W25A 2CE2X 3TW8B 1YZNA 1UMKA 2PU7A 4G01B 1JWAB 2QD5A 4NX2A 4QAJA 4QTUB 5KYUB 1DXOA 3C6YA 1PS9A 2WUFA 3KHTA 2F6RA 4HLDA 1YSCA 4QXQA 4X00A 4KLAA 2DPYA 2IZ1A 3GFQA 2B9VA 3EF0A 4JMLA 2PVSA 2X42A 3IS3A 2FA9A 2CNWA 1IOWA 1NMZA 1OPRA 1YS4A 4G4SO 4ZT3A 3SQDA 4TV9F 2ODQA 1ABFA 4ZDIA 4M0LA 1BFUA 2C99A 2OP0A 3SF8A 5ELXA 4X85A 2ZCUA 1ZKDA 4EKIA 5TRTA 2LPMA 1L6RA 1D2AA 2VTKA 2YFHA 4Q4AB 1THMA 1W5AA 5LB4A 5DMXA 3RFTA 4ABYA 2FX2A 4XDZA 4I7EA 1QFSA 1HGXA 3JD3A 1LBHA 2EJUA 4JX8A 4UM7A 3HDGA 1AXEA 3EIHA 3GGCA 1P5ZB 4RAOA 1H93A 1QS0B 1UK8A 1YIDA 2KPOA 2BFPA 3ABQB 1E77A 2HFJA 3OOEA 4DKJA 4DB2A 1I3CA 4UPVA 3RSZA 2JFVA 3LBNA 3O4RA 3PYLA 4FE4A 2RHBA 1YJAA 5AKZA 4CLRB 1EA5A 1RQ2A 2GN8A 3DVAA 1G64A 1ZUNB 1J0CA 4HPWA 3UHAA 2C4UA 3JQAA 2AJCA 2R9VA 2B20A 1CE8B 1E58A 1JJVA 2VTDA 4RFLA 3V1UA 1Y8QB 2XCLA 3IMFA 4U4AA 1Q21A 4E3ZA 5AXCA 1RKUA 1U8FO 1GEEA 3G2OA 1UBGA 2ZS8A 3PGKA 2NT4A 2PKWA 2PJRA 2W4QA 3JZDA 3ITEA 3MBIA 4H7EA 4MWOA 5FXMA 2R2AA 4OI1A 4DQVA 4BFUA 1D4AA 5CFRA 5EKDA 5AW1A 4BMCA 4G26A 5F9MA 4TKZA 5IN4A 2BFWA 2KX7A 1XMXA 5LZ5A 3IP3A 1HC7A 4KLNA 2HCTA 3T9FA 3EPHA 1L3IA 3D3KA 3LF2A 5LU8A 4EJFA 1JE0A 3S2UA 1KZGB 1D2EA 4MVJD 3TAUA 4WBNF 1E2DA 3TN7A 1V11B 1VHTA 4J2HA 3EVNA 4KMSA 2V74B 2XQGA 1D4ZA 2GCEA 4BLQA 4HYYA 4IJKA 1L8OA 2V9CA 1ZSVA 2H4FA 3USZA 4U39A 1OXKB 2XECA 1MOSA 3ZXIA 1XVAA 3CBQA 3R9IA 2A84A 1EFCA 1B14A 4GP7A 4IIJB 1KC1A 4AK9A 2BZ0A 1PDWA 3UYLA 1K2VN 4QDJA 1T3GA 3K15A 1JSLA 4M0FA 2BEWA 4ZHQF 4AI6A 4KWEA 3WRXC 4BRWA 1U0BB 3O4VA 4WESA 2J0QA 1QK5A 1H2XA 2DFDA 4QQNA 3OSUA 4MARA 2HIHA 3TCNA 4J1NA 1BDBA 3QQ5A 1QCDA 5B58T 5DNVA 2ATVA 2C31A 3IX7A 3MTJA 3OEHA 5KSOA 5CB4A 2W2KB 5CXSA 2IIVA 5E1OA 1WCWA 4F5WA 1F4LA 2FP4B 1OAAA 2YHAA 5A0FA 5LKRA 4Z4IA 5J4VA 2B35A 1LUAA 4BB0A 1XZCA 2BGJA 1E6WA 2ORVA 4UPDA 1YZHA 1G8MA 4UQOA 2DTDA 5FPQA 4OHCA 1HO3A 3R7FA 1FK8A 4GBED 2PH7A 2XMRA 3VNVA 2FEWB 2IQIA 3LXRA 3WAJA 5JZVA 5ALIA 3HS3A 3T3GA 2QUJA 3FA2A 3I01M 4URFA 2SCUB 2ZU6A 4PRZA 4EYOA 2LE0A 3ZGVA 1WZCA 1T2EA 2JVIA 2WG2A 3CEAA 2X41A 1L5FA 3GRZA 3EGWA 3FFXA 4JNCA 4KQ1A 4M21A 4W1PA 1S3SA 1PG2A 3CG4A 1U6KA 2BBOA 5CH5A 1CJBA 4OAPA 2GYUA 5AM1A 3A6JA 3TDMA 1SBTA 5EP2A 3RAFC 4EF5A 4BPRA 1NUAA 5EUCA 4QQ8A 3WYFA 1L4EA 1JA9A 4MA5A 5EN4A 2RSLA 1KPIA 3IIMA 2ZJ2A 3MJEA 1JLSA 2A4KA 2Y68A 1DXYA 2ZRFA 4FUQA 5F2KA 4C3OB 3BWVA 3DEFA 4OCZA 4DCCA 4DWWA 4JQYA 4TXHA 4DIEA 5HFAA 3O4IA 4DCTA 4JV5B 3H4MA 1MB2A 2C98A 4JJKA 2XF8A 2YYZA 3VZBA 4AX8A 1NQXA 3AZQA 1M0TA 3U13A 2D2XA 2BMDA 2HWXA 2IEGA 5CAEA 2FPGB 4KQFA 2OBLA 3ND7A 2PUWA 2R1UA 4DLUA 4WIAA 5AKEA 1KY2A 1EWYA 2ZR7A 3NDIA 4ZCLA 3TD9A 5CGQB 2X5OA 3AR9A 4TSFA 4ML3A 3HO6A 3W7VA 2Q45A 4K6FA 3GUYA 2F3UA 4URHA 1XE3A 5LP1A 3FKSA 5KTMA 3VA7A 1I4TD 1PW5A 4IRXA 4P2GA 1GRNA 1KZ7B 1IIRA 4HAXA 3WGIA 4W5OA 3AO0B 2C7VA 2YXBA 4TL7A 4DCMA 3U26A 2XNHA 1GUZA 2E48A 1U8XX 3NH9A 5EE0A 1P5RA 3X44A 4EPVA 1Z5GA 2ZDQA 1E5QA 2R8ZA 4MLCA 4DADA 2VBGA 4G5HA 1RRCA 1M1YE 3CEPB 4YRLA 3VVLA 2WWRA 4RSMA 2UXDB 4KPUB 2DE0X 3ROFA 1U3UA 3D3JA 3OE7D 4NE2A 1TVKB 2CLEB 2AL7A 1T4CB 4BGEA 3QF4B 1Z4KA 5I9SA 2FXVA 1W1UA 4URXR 4V1CI 3PJEA 4AG6A 4JJ7A 4YMIA 3MHTA 4G84A 2QY6A 1JGTA 1SD2A 4DQKA 3C3JA 1FXSA 5TE9A 1KHTA 1UDXA 1V95A 3O1LA 3NJ8A 2OZEA 3OM1A 4GRAA 1AMUA 3IEIA 4X1KA 5E3JA 3TYXA 4BO6A 4WDRA 3E9DA 2V4MA 1SGWA 4BYGA 3KB2A 1RR6A 2X19A 4LYHA 3ZGYA 2I87A 4XPIA 5I7EA 3PX2A 2JGAA 3OQOA 1QKKA 4JI7B 1Z37A 1HZZA 1V1RA 2A94A 2Y0DA 2AG1A 2Z5LA 3ASYA 1BYUA 3CX8A 1P6QA 1E3IA 1VG0B 2BVNA 2GZHA 3QTTA 3ZIAA 1DO2A 2OHXA 2WSYB 4J0JA 1M6NA 4Q34A 2GKOA 3W8NA 1INLA 1VSVA 1E1CA 1YA8A 2OV2A 1BMFD 2JEZA 4Q7MB 1AK9A 6Q21A 3DL7A 4WK2B 5EWMB 4LHVA 1OXTA 3V2HA 5IVKA 4UQPA 4FLEA 4P36A 1ORRA 1VCOA 1Z5ZA 4LXQA 5DASA 4RLSA 3NHKA 3EUAA 3PHHA 1DVRA 1T5OA 3LK6A 3L7NA 4CI0B 1H5QA 4FHGA 1XZAA 4OBBA 3KYDB 4PWYA 3DVLA 3TF5A 2FPIA 2PJDA 5LXTF 2AD1A 3PYXA 3NYWA 3W9BA 2HU5A 1SM4A 621PA 3LUHA 1T0JB 4BNIA 3IBFA 2O8BA 4KQMA 1PWYE 1VGRA 2XUDA 3LQFA 1GR1A 1ZG3A 2FWBA 3G9TA 4OY3A 4RF2A 3VR5A 4B32A 3OAAA 4QXPA 1ILWA 1QRRA 2A4MA 3D59A 2C97A 4IIGA 4C5AA 3TAHA 2QRQA 5E4FA 2GDZA 1KI1A 1LQ2A 3EPLA 2XBMA 1W4RA 4PBRA 4BNDA 4ER6A 3ZZ0A 4EL5A 4QYSA 2O2EA 1J06A 4JP3A 5MFZA 5BYAA 4KMRA 1I6WA 2P5YA 3OBBA 3UANA 2RCNA 3WGUA 3U60B 3DXYA 2A1UA 3WLKX 2Q3MA 1DQRA 2PA0A 3UT5B 1CYEA 1ZWKA 2HRBA 4ND8A 4YDHB 4EPYA 1XPOA 1DIHA 3O8LA 1W4CA 1W75A 3L8ZA 1UWKA 1NXSA 1P9NA 1YRLA 2FHSA 2OHIA 5AVOA 4ENRA 1DKMA 3PQ6A 3WGZA 4BX0A 4X7PA 1U6JA 2O2ZA 4E1AA 4YAIA 3JVEA 1BDMA 4OJNA 3VR4D 4KZPA 4QBKA 1FE8A 4P1ZA 4RORA 4NNJA 3FDZB 1E99A 1XKXA 4Q66C 1ZM2A 4D9FA 3BGIA 1GG2A 4UVIA 1YR8A 2XZPA 5G1NA 3RVPA 4NBVA 1ADJA 1ONBA 3ZDZB 2VJMB 4GGMX 4JJIA 4DLLA 3E9EA 1Q1ZA 4PX2A 3DZGA 3TR0A 4MDFA 1QRSA 2WFLB 1AQ6A 1B7GO 4KODA 5K4GA 1S3GA 2IZ5A 4F12A 4DDWA 4YPVA 3N7UA 2HRDA 1F2TA 1PIWA 3LFHA 3NONA 1O58A 1ADYA 3RVJA 5JY6A 3HTXA 3VKUA 2OXCA 3GT0A 1KF0A 3FHJA 3BWEA 4LRQA 3GDFA 1DUSA 1X1SA 3URKA 5CFLA 1TTHA 3HQ4O 1L4NA 4G0NA 4R68A 1JMYA 1VECA 2WUDA 3LU1A 4LFBB 3WWEA 1Y8QA 2FFQA 2B2XA 1ISPA 5FYQA 1EH5A 1EFLA 3AG5A 3AYZB 3W78A 1A9OA 2C42A 4AUNA 4EB3A 2WU8A 1C30B 4EMSA 3KQVA 4UBJA 1UBFA 2FSFA 2FW9A 1M2WA 1E3TA 3HL0A 1P8AA 3L8DA 5B3AA 1Z18A 3ZIAD 1FTSA 2XKAA 4FKBA 4NBUA 5FJJA 3SHVA 3VU8A 6YASA 4Q3LA 2QROA 3GRAA 3OF3A 3AW8A 4QGHA 5HOEA 1MFPA 2R8BA 3F3MA 2P9TA 3N6XA 3GA0A 5AJHA 2H1LA 4LMBA 2ZWAA 5CK4A 3PNVA 4MS1B 5HYVA 5ETJA 4Z7JA 4RFSA 1Z0ZA 1EQ2A 2YS6A 1WEHA 4M9SA 4NQZA 3U9TA 1D8TA 3C7KA 5LDGA 5L3ZA 5H3HA 3SYTA 4NPHA 2AKAB 4FE3A 4I46A 3WLNA 2FR8C 2J0UA 4R41A 1TJYA 2V65A 3HNRA 3JVIA 3V00A 2PSEA 2VRWA 1A88A 4WA7A 4AJ1A 1NXPA 1U0EA 2PUEA 1NFRA 3F6PA 1J5XA 3CZQA 3MOSA 3DD5A 3OQ1A 4AJ4A 4N7RA 4AJPA 2FZCA 2XUJA 4LV5B 4CMKA 1RLTA 4M7OA 1XZ8A 1KJJA 9ATCA 1ZD8A 2G71A 2SICE 3LXXA 3Q8WA 2HW8A 2GZ3A 1Z06A 2WYIA 4FMPA 4I66A 4JWTA 4PZCA 4ESVA 3EHDA 1EM8A 3W1VA 1TAQA 1V5WA 4N0EA 3VKVA 2Q3CA 1LJ8A 4QD3A 1WA5A 3HVKA 4JZKA 1V25A 4K28A 4JVMA 5K3AA 5JPIA 3UAYA 3USES 2GM9A 2AE2A 3QKIA 2ZIFA 3ZEIA 5H80A 3P9QA 5FV4A 5JBIA 3K9FC 2WYOA 1QCYA 1RJEA 2DFKB 1MEJA 4QJ4A 2G36A 3FPLA 3FFTA 2ZTHA 2NACA 5AJZA 2O8FB 4FHDA 4RO0A 1EDDA 4O1MA 4E0BA 1VKNA 4E11A 5EPUA 2IW1A 2XCUA 1X74A 2AQIA 5JO9A 2V1XA 4IVNA 4FDVA 5AXAA 3UXHA 1Z6TA 3EXIB 1LTKA 1GKIA 4IHQA 5IMBA 3WMXA 5JTTA 1IN1A 4OQPA 5A2GA 1UBJS 1UWLA 1IM8A 3PFHA 2ZUCA 5CT5A 3CH7A 5K0CA 1HDEA 2E2WA 1Y5RA 1M34B 1QH9A 2O6HA 1PHPA 2PS3A 1HYEA 4ISCA 1JEAA 4BFCA 1NI5A 1RLJA 1EINA 2BFBB 2EGUA 2ECFA 3AXTA 2IELA 3WNBA 1QRAA 4CF5A 1A2KC 1H8HD 3Q8MA 4M6WB 5KQRA 4MGYR 1RKBA 1I6KA 1RAAA 1HYQA 2X6TA 4MZXA 2A35A 2GOYA 3DZDA 4GPTA 3ZHCA 4BJ6A 4BLPA 5HJ2A 2O8BB 4BMZA 3FOBA 4LBWA 3V7NA 4O5AA 4MUFA 1NJ1A 1SBYA 2W6JD 4GW3A 1STOA 1U0LA 2WHXA 2YIMA 1L7NA 3W4JA 4M0EA 1PGQA 3IEUA 4C88A 1R3UA 2GXQA 1XL1A 4DSUA 1MXFA 4XCVA 5KJCA 1E9AA 4YRJA 4L7QA 1JSZA 1MEEA 4BWYA 4A73A 3R6LA 1Q16A 4K3VA 2JFOA 4FOPA 4DANA 3VR0A 4BFLA 2A5FA 1XNRB 5CRIA 1T36A 1YTLA 1JEOA 1IH8A 2D5AA 3HYLA 2QTGA 5LFAA 1N9GA 4WEOA 1Q50A 4M8NE 1KNQA 1MF7A 4TT8A 3H11A 3CPEA 1BJKA 4IF6A 3HWSA 5I9NA 1SCUB 3JQ8B 4WAUA 4CKEA 1X7YB 4E2XA 5CGZA 2FZKA 2I4TA 4JUFA 1JEDA 4MVWA 2R48A 4FGKA 4PVCA 4BFXA 4QPPA 2WT8A 4MUGA 2FSSA 3HVIA 4J3FA 2XSZA 3FSJX 3GVXA 3RTCA 4BZWA 1E59A 1GAWA 1WU7A 4EI8A 1BXGB 2UYQA 4JL5A 3ORSA 1W8IA 1KEZA 2ZYHA 3DZIA 4QM7A 1JSXA 4B3HA 5JG7A 2B1IA 1LLQA 1GITA 1O89A 2QJWA 2X5JO 2ZK7A 3EFOB 4FYWA 1B43A 4B85A 4DCUA 5KVCA 1O95D 4TM8A 4RHFA 5BSRA 3R9KA 3UZUA 2HA2A 2HUNA 2WTXA 2Q49A 3BM5A 3P9CA 3QWAA 2G28A 5T4HA 4ZGBA 4LYJA 3ICOA 5D5HA 3W05A 2YNMA 1YNOA 3JQ8A 4IFEA 4IDOA 4TV8F 4ZT6A 3W7BA 4R8SA 4YLYA 2GHIA 2IEYA 3P20A 4DSNA 1UL1X 1UCFA 2I4NA 1ZINA 2QLBA 2R6R1 3AY3A 3RJ5A 4GM4A 2REQA 3SE7A 5HIAA 4R84A 1B6SA 4ENSA 3EQ7A 4D99A 4EY8A 2XVMA 4MDEA 4ND2A 4K3UA 3PQ4A 2P69A 3TTUA 4J7CA 1QSGA 3CS3A 2CXNA 4ZCIA 2V4UA 1F9AA 3QE2A 4O0MA 2ZAGA 3LDAA 3FYUC 1HDYA 2WJ4A 3HJNA 5DLDA 3EFOA 4OXIA 3TSAA 3QYPA 4V0SA 1AQYA 3VDMA 5C80A 4DM7A 3DCNA 3Q5EA 4RXMA 4XOUA 3W2FA 4EOGA 4PAQA 3R6WA 4LXGA 3SY8A 2ESRA 2GZMA 1G6Q1 3AVPA 4FC6A 4G07A 5CW2A 5EMHA 2ZJFA 3AKEA 3C3WA 5C5CA 1XRNA 1WCYA 2VH2A 3UA3A 5FA5A 5F35A 5AW4A 4ZHQA 3DEZA 1R4MA 3NBMA 2OILA 4MRMB 2B9EA 1NKTA 1GCIA 2NZ2A 2OO3A 4ZK6A 3QMPA 3JQGA 2AEEA 1RXCA 1UZNA 2QBYB 4RMJA 2AFIA 1SBQA 4C0QC 5AW3A 3B51X 4RTNA 4MW6A 2QE7D 4J0HA 2ZZNA 4L8FA 4PIPA 4DDKA 2VWPA 3OU6A 4HQFA 3C3PA 2EYQA 2Z43A 3FWNA 4LSGA 3H5WA 5ALGA 3LL7A 4AZ3A 4F6CA 5DTEA 3OSZA 1V8DA 3A2NA 4CIAA 4M9CA 3OFKA 5JR3A 4PS0A 4A26A 1E79D 1KBZA 2ZJ5A 4KN5A 4ROTA 2RHTA 4MUXA 4PYMA 3JQPA 1SVNA 2PKEA 3TLYA 4OU4A 4XYEA 4ZZ1A 1A5BB 2IU6A 4C43A 4PFQA 2XMGA 3L4BC 3QIVA 3T94A 3UOAB 3M9XA 2ZT5A 5C3MA 4IOLA 1EGMB 3S8EA 2ZWOA 3QFTA 4I5EA 5GPBA 3U80A 3EGIA 1YWGO 5JV5A 1PTJA 4RK5A 4LNAA 3LT2A 2GARA 3CZPA 4PNHA 3AKCA 1E3MA 2JKVA 2XD9A 3D8HA 2F1RA 3NBUA 2W6ID 3OECA 4L51A 1HDXA 3P9RA 3BD9A 4N8DA 4UAUA 2X1VA 2KYRA 1E5VA 4Q01A 4GM1A 4EA7A 1GUFA 1LC0A 2O57A 2FZEA 2VG8A 3HC7A 2PWPA 1WPRA 2FPMA 2R1TB 4GI1A 3Q4GA 3MJDA 3ETGA 1DSSG 1RPAA 2PO5A 2YINC 3ZY4A 5FWXB 5EIAA 5ITZA 3PFFA 1X6VA 4QL3A 2HMUA 2DFTA 4HWPA 3S7TA 3D8RA 4BNXA 3KQOA 2D00A 3HRKA 4MW5A 2GAJA 3OZRA 2TMDA 4KQHA 2WSLA 4YYEA 4I8XA 3O2SB 3CKYA 3ZZ1A 1WB9A 3M4YA 3QFRA 2GN9A 3TNYA 3HLYA 3NUZA 4LYFA 4ND1A 3QKWA 1EXDA 2IQ5A 2R47A 4J1TC 5IC5A 3U6KA 3DBIA 1AY0A 2EJWA 2IITA 2R60A 3ZNQA 2D5BA 3ZW7A 3EWNA 4CL3A 3L8CA 2JKYA 1JEQA 5EVCA 3T0IA 1FDUA 1WDWB 1KEKA 3AKYA 4FI3F 3U4IA 3BGSA 1E0JA 4C6SA 2PT7A 3WNZA 1YBFA 3ZY3A 2IPXA 2ZRHA 4O4IB 4RQUA 3X1ZA 1A8UA 3ZH9B 1EK0A 5A4AA 1B6TA 2A8YA 2NZJA 4I9HA 3S44A 4S1NA 2Z1DA 4S12A 3IAAA 2F43A 4UXIA 4X65B 2JFGA 4LI0A 1U7WA 2GSDA 5M3BA 1K88A 1T24A 4LG1A 2OMEA 4JJAA 2HJ9A 4IIEA 3ZYCA 4R2KA 3SSMA 2INGX 4MQBA 3L79A 4Q4DA 4UVHA 3T5DA 3W5CA 2R1ZA 1HE5A 3NRJA 4HSGA 1RRKA 4J16C 3G02A 3VYRB 3PFIA 1QIFA 1KXZA 2IT1A 3SI7A 1U7HA 5IC4A 4LK2A 3I39X 1DDOA 1NW3A 2HWUA 2GI4A 2PX8A 3QPDA 1E6MA 1W4AA 3NFYA 2YJ4A 4O4IA 3LUAA 2Q28A 1JTEA 1NA5A 3B2EA 3DONA 2VDQB 3P27A 5A6SA 1Y6GA 5FP0A 2OGWA 1LV7A 2HA6A 1C4XA 3FLMA 4JI5B 4J6EA 2HWKA 2NUAA 3WK5A 1NI3A 3FYUA 4RNCA 4YV2A 2K4MA 2I54A 3IALA 4L6IA 4IG4A 3QVGB 5EHGA 2GNOA 3EZLA 2OXIA 2GEDA 5I6DA 4ON9A 1EMDA 2PKYX 1UOEA 2GHQA 3BWYA 2WI8A 4KBYA 2FPLA 5BSEA 1FSSA 3L18A 3RYIA 3RIXA 2P3OA 3QU9A 3KAKA 4MRNA 2O3JA 4LHEA 3ZU4A 1D0VA 1FUEA 1G3IA 4NQRA 4QEKA 4AW9A 4EL0A 3SHQA 2UUCB 1JJ7A 2BKLA 4NEQA 1WSBA 4ATNA 1Z82A 1Z74A 2AYYA 2FF7A 3DMTC 1LW7A 3L1JA 3HA3A 3UT0A 3KO8A 3QJ5A 3TRFA 3EGDB 1I94B 1Q92A 1TD1A 3WK8A 1I7QB 1GPUA 3DHYA 1LK5A 2VYNA 4QOJA 2ZB2A 3QSYA 4E4TA 1Z0SA 3DA8A 4XVUA 4DHEA 1QIGA 3B82A 4FZ5A 1N5RA 4NU6A 4YRZA 5KKCA 3ONEA 3AJ9A 4PCVA 5EMLA 3WP0A 4NYMQ 1KO8A 1GZUA 2BR3A 2EC5A 4BMOB 1T1JA 1PD1A 4Z1MD 13PKA 1N1GA 3GCGA 4TX1A 4DPKA 1TM4E 3RRNA 3S1AB 1GQYA 3GB9A 5BSKA 4WJKB 4F4CA 1YS9A 4D6YA 1E4EB 2PY6A 4WN9B 5DX0A 2Z4TA 3NEAA 1WETA 1CR4A 3D6JA 2JFXA 4B6OA 1Q0SA 4MV9A 4DNQA 1P31A 3MS2A 3N2EA 4FQ7A 4PO9A 5F12A 4D80A 3EZGA 1KERA 3Q3HA 2AK2A 3RKUA 2IYXA 1EIZA 1W88B 3IQWA 4JMPA 3ROPA 4U5QA 3GDGA 1XMSA 1QC5B 4E88A 3E0QA 2O3SA 4G4JA 4FS8A 4ND8B 2IUUA 4B76A 1ZGAA 2N9UA 5HUHA 1PTKA 3FY4A 3JTMA 4RZQA 5H16A 5JC1A 2WIFA 3F0TA 3RCBA 4D3FA 3HR7A 4M55A 1SIBE 3M6LA 3ZWAA 2OOSA 3EXG1 2AN1A 1A7UA 3NRCA 3MUEA 4I1SA 3HA5A 1KE2A 4AMVA 5JC8A 2J5XA 4G5RA 2MJLA 2N46A 4YRNA 2Y2VA 3K9HA 3FSEA 3MMNA 4ZZ2A 1Z28A 2HPZA 4UU7A 4DJAA 3UCXA 3DL4A 1R12A 1GFZA 1T2NA 1P3DA 2WU1A 4IDDA 4KW7A 4ANFA 4RPCA 5T4EA 2V58A 3BVPA 4P5EA 1C80A 1GTVA 5A03A 1YDHA 3E5NA 4FGLA 3IVXA 3SC2A 2OG2A 3ABOB 8OHMA 4LQ4A 4ZVNA 1MX3A 4WCDA 4A5OA 3B60A 4D0LB 2ZQZA 3GEEA 4G1UC 4HEJA 5JFOA 1FB5A 4WERA 3K0KA 4WKCA 2WY2D 5HUJA 5KNCA 2X5KO 2JJ1A 3MJHA 1E6UA 1G7TA 3AKDA 1G8GA 4R1MA 3BJRA 2WWHA 2B4AA 4WFIA 4RK0A 4MITA 5CX4A 1H3NA 5G40A 2A9RA 1XRPA 4AKIA 3H42B 1DL5A 4RKFA 1OCEA 2GQ0A 4N48A 4PPNA 1GGNA 2ZBPA 2HRZA 4X7BA 3RK1A 4QQRA 2OO7A 3TR6A 2OGUA 2VJYA 1OX4B 3O8CA 5CDTA 2WVHA 4KQEA 2CBZA 3R20A 1E2IA 3EIXA 4M38A 3RFCA 1YQGA 5HEKA 4C4OA 4EX7A 1TLFA 5JQWA 1ZD1A 1HDCA 3NIGB 3PQ3A 1XI2A 4YJHA 2WMYA 3OLVA 2D6FA 2ZLBA 3NHWA 5T5QA 5DGCA 1Q7GA 3LTNC 3IVAA 2ZYUX 4LBYA 1L5GB 5IXSA 4Q05A 3SD7A 4P4NA 4AS1A 4RV9A 3G8AA 5LLDA 2R44A 1GSOA 3K6RA 3ABSB 5E6RB 4Z2AA 4P7GA 2ZBRA 5CLHA 1XD8A 3O6VA 1X7ZB 3QLTA 2X8WA 3VRHA 3EMKA 5BR7A 3EIWA 3M8KA 3QBTA 1K89A 3A28A 4MVJF 2OFPA 3W4IA 1XZQA 2UZAA 4H4EA 2B4TO 1IHXA 4UKDA 3TNLA 6NULA 1QIJA 4Q82A 4V0NA 3H2BA 4LX0A 1N2SA 2A33A 3FFAA 1ZFNA 3HA7A 1J5EB 2AR0A 1AZWA 3MCZA 1QRDA 3GI1A 4E32A 2YCBA 1AZTA 2B5WA 2GK7A 4Q7JB 2V1UA 2BI4A 3P2KA 3KZNA 4JLDA 4CM9A 2B5VA 1BIFA 1TTPB 1UK9A 3HNOA 4TVOA 3FPCA 3QVJA 1Y48E 4KPFC 5F1PA 3V8VA 3OTQA 5KTYA 2CCKA 2X0DA 3S99A 1ECGA 5B1IA 1IQRA 2P2DA 3IUYA 3VPBA 3ANLA 3KJEA 3ONDA 4KWTA 2XR1A 4R7ZA 3INTA 1ZIYA 4Q1AA 2DKNA 4R1OA 3CNQS 1LPAB 2DPMA 2GPWA 2MMGA 3KJIA 4EEKA 2XJ4A 2OECA 1P9LA 4MS1A 5JAQA 4AJJA 1TA4A 1LD3A 2VAMA 1V71A 1PFVA 3LX5A 4RJIA 3WYAA 1OXBB 3H11B 5KWIA 5ADHA 1XRMA 3G23A 1O96B 4UASA 1PV4A 5TMBA 2NXCA 3L7YA 3OE5A 4O2BA 4K8RB 4LXIA 2CCJA 2R8XA 3AVOA 2LCFA 3JPYA 3V3TA 4D42A 2LD4A 5IAAA 4DCNA 4EHDA 1LCIA 3X1KA 2WMNB 3VYSB 4WOJA 3WMWA 2HV8A 4Q3NA 3REGA 1SU6A 2KB0A 5COAA 3DBLA 3H3XA 3I9V6 3CVOA 3G8BA 4XKJA 4IXMA 1T4MA 1DFIA 1L7VC 1R9NA 1Y80A 2JLCA 1Q17A 1SD5A 3PV0A 3OA0A 3LOUA 3QZUA 3SGLA 1U7DA 1HORA 1Z2EA 4XDHA 1TJ3A 3CR7A 2CZGA 4PQGA 4YCSA 2WTEA 2AI1A 1UC4B 1Y4DE 2MCFA 4D9KA 1CNMA 2HHAA 4XUGB 2PD6A 3I76A 3HBMA 3I1FA 3MLAA 1LSSA 2G6BA 1QOPB 1V4BA 2VJOA 1TJ4A 4W9NC 5J4LA 1JKJA 4YRAA 4EBFA 3U4HA 5KAPA 3EW7A 3NG1A 3C7TA 5I7WA 1JHOA 4PGMA 2GUGA 1VCIA 4RVHA 1SHLA 1SOAA 1NVVQ 5EUMA 5JISA 2F55A 1LSJA 3VU9A 5IDVA 4LTMA 3BDAA 3PUYA 3AF0A 3B1YA 4O4JF 3WLIA 1R5BA 2DZDA 3FHOA 4UM9D 3FH0A 2BZ1A 2ECPA 1Q7TA 4Q1EA 4QYIB 4G1BA 3S0JA 2IBSA 5GGXA 2BM0A 2H16A 5FJIA 3AHJA 1FMTA 1SCAA 4ZVRA 5A7HA 2OPHA 2A0WA 3AETA 2OZKA 2JZOA 5A5DA 1EP9A 3JR7A 5C8YB 4WESB 4CHGA 4ME6A 3TL3A 1RDFA 3KNZA 4BP1A 5IKMA 4YRMA 5CM8B 1C3EA 3RR2A 5I5EA 2YZ7A 1X14A 2NU9B 4B3BA 1Y7IA 2CVPA 2G80A 3QEAZ 4BNYA 2B8TA 1VIVA 1RZRD 4LW8A 4IOJA 4PG6A 1VJCA 1JI3A 2QEQA 4P4SB 2GJAA 5JZ9A 3EPJA 1GFSA 2FMIA 3OQVA 2P1DA 3D6VA 1PG5A 4RFSB 3WNQA 5G0SA 5F9HA 5TQJA 4P4UA 2D1QA 4OQDA 2NUAB 3PKJA 2BGRA 3I1YA 3L7BA 3LHIA 3E05A 5JD5A 3BIXA 3GF4A 4N6OA 3T95A 4I9NA 1JR6A 5JVDB 4M8KA 3HB4X 3BTOA 4CHTA 3MF4A 3K6SB 4R2HA 5C3UA 4F45A 2W2TA 1NMEA 1K92A 3LCUA 5EMJA 2JGEA 3CH5A 3QLEA 3EJWA 4FFOA 4QEZA 2V98A 3CLVA 3R7NA 1ISFA 1PZHA 1QQ5A 3L6DA 4ZVOA 4C2AA 4DDTA 2HU7A 2O0JA 3GEIA 5AJUA 3URMA 4DG5A 5LUAA 2HCRA 1DO8A 1T9HA 3UCFA 2WF8A 1TL7C 4BDSA 2P62A 3GZTB 4B6RA 3D1VA 2VP6A 4U00A 1ESNA 1U3GA 2BFFB 2CD9A 2WFZA 3Q3JB 3T4EA 5BSTA 2Z8XA 3KT3A 1JJIA 1W34A 4KN9S 4QPNA 5JLJA 1LRKA 4TMFA 3L4JA 5J43A 1D2CA 1SEVA 4K05A 1J7JA 1X1CA 1H05A 1R6UA 3IPLA 3WBJA 4AJEA 3C8MA 4JZYA 4E33A 4HDQB 2OSBA 5AUPB 3QEJA 3FBTA 4C2BA 3DMHA 2QXUA 2W43A 3EXEB 1O95A 2Y67A 4IF4A 4MUAA 3RLIA 5KMGA 1ISGA 1TW2A 3GU3A 3WGYA 2ALJA 2HI0A 4MIKA 5CDUA 2VSYA 3OZAA 4DDHA 3AEUB 3KD2A 1GO2A 1I8TA 2QL5A 2JD0A 7AT1A 1E18A 3A0RB 5AH0A 3SKYA 4BB9A 2J7PD 4M9QA 4ZOCA 3FNHA 3WIUA 1JHYA 1OXUA 1DCTA 5E3IA 3T54A 1W9HA 2PKCA 3NDJA 3DV9A 1ZZGA 1J97A 3EVGA 5EQTA 5CIYA 3ECSA 3CB4A 1ZGJA 3MERA 1RLMA 3LH5A 3PHGA 3MRTA 4KQCA 4MWBA 4DG8A 1BXZA 1F2TB 3JQ9A 5L51A 2ZI9A 2CNBA 1ECBA 3DT9A 5KQMA 2HF9A 3PD0A 3U61B 4B3GA 1RYYA 4O4IF 1HE8B 3F67A 1G66A 2QNIA 5DRYA 1T5BA 5HK9A 4B4VA 4TUYB 2V54A 1VRWA 2EKZA 5F5XA 4NIMA 1MAWA 1SMKA 2WICA 1S2DA 2OA0A 2E1RA 1FNDA 1GL9B 3TD6A 2R6AA 3O84A 3DGFC 3TCKA 3CX4A 3L1VA 3LK7A 3F2VA 3TZLA 2J9FA 5KJFA 5IBCA 3JD1A 4JYZA 1F5SA 1HTTA 1C1YA 4HDMB 1GTRA 3NV7A 3RANA 1WMSA 1BSVA 2W6ZA 4ER5A 1Q5PA 3WQSB 5KX5F 4E1VA 1Z0AA 3HKDA 4G5YA 4CIWA 4UATA 2CE7A 1QOZA 2J3HA 3WLAA 1DJPA 4L3OA 5IP5A 1QH0A 3EDOA 1IXKA 2BFNA 3IVRA 3O1HB 3SAJA 2RHWA 2QRKA 1T34A 1Y63A 3LBHA 4LY0A 1OI4A 4B5LA 5LZ9A 4GLBA 4WLNA 4DARA 4R2JA 2PGOA 5H0IA 2F7SA 2HF2A 2QKYA 3M6UA 3LNCA 4U6SA 3V1TC 2JCSA 2B1GA 4CQLB 2E5LB 4KNYA 3FMPB 3HRHA 3I09A 1VJGA 4MIEA 1WHSB 4HEA6 1OFIA 1BQ4A 1A5SB 2JI9A 1C7FA 1SURA 4RCVA 3G17A 5LB2A 4NBNA 4ZJYA 1PQYA 2QGZA 4WFQA 5E95A 4L0DA 1CDOA 1Z0DA 1I6LA 4AXBA 4CKCB 4QLOA 4D46A 2JDID 2B61A 3GFGA 4GXRA 1PKEA 1YS1X 2VJDA 4DG9A 4YAKA 1GPLA 3P9PA 1JNYA 1K6MA 3DDCA 1YVRA 4N3AA 1FDTA 4US2R 1R0LA 4AY5A 4GO1A 1K9SA 2FG7C 3AP3A 4H31A 2A0KA 1UPAA 5A9RA 3HWX1 4BLUA 2XZDA 3GN1A 4YRFA 1E0KA 2CLLB 3U48A 3AIMA 3CLUC 3JALB 5BUSA 4KPUA 5ADWA 3KJFA 2L18A 2WMOB 1CEQA 3NTVA 4L0MA 1O54A 3QNMA 5ECWA 1KAQA 3RARA 2PPLA 3ESZA 5C4IA 2CEAA 2IV3A 3KE9A 5C53B 1YBVA 2Q4DA 1WDTA 3LY5A 2N75A 3BHIA 1ZCBA 1F60A 3G5MA 4CMIA 2CLKB 1BNCA 1A9PA 4MV4A 3V8BA 4QTTB 3ZHBA 1L5RA 2ATCA 4BJ5A 1FP7A 1MIOB 3IKJA 3O38A 3GJZA 1DRJA 3V7WA 4E03A 4RSGA 1XEXB 4JELA 1E5TA 3RHFA 3REQA 2RIRA 2XT9A 4LSWA 1EZ4A 3DKPA 3OIVA 1IZZA 4FJ0A 4FYPA 4GI3A 4YY3B 3QPWA 1NDUA 5B7QA 3MINB 2WU4A 3HACA 2MYNA 5A5GA 2TECE 3QUSA 2G5GX 4HLCA 3QVSA 4IRMA 3PUIA 1JR2A 2I03A 3PNQA 1PAUA 5FPTA 3C43A 1J56A 5TPWB 1M73E 3VTZA 5CA0B 3PIIA 5CNKA 3TEFA 3TLGA 1MAAA 2O8NA 4EGCB 3UMSA 3T7EA 4O8ZA 1A9TA 1D2GA 1L2TA 1E9CA 3N8HA 1MPXA 1R9MA 3E9MA 1U1EA 4K9QA 4AN4A 1LF5A 4PYKA 3U31A 3EDQA 2JH8A 5IVPA 2I0FA 1L4UA 4REQB 2L82A 4HF7A 5M2QA 2HHJA 1GJRA 1G55A 2TYSB 2E5WA 2I3DA 3L0SA 2C5LA 5I7AA 1H8HA 1GN8A 4YUZA 4OMCA