4OGAC

Insulin in complex with site 1 of the human insulin receptor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin A chain
publication title Protective hinge in insulin opens to enable its receptor engagement.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone receptor/hormone/immune system
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogaC00
4NIKB 5DGQA 2P24A 5TQ2L 1IZKA 4R97B 2LVCA 4KUZH 5T1LD 3RX7A 1KEGH 3D39E 3WYRA 5GZNC 1UWEH 4MCYA 3RWEA 1CT8B 3O3BA 5DJZA 3D85D 3ZKNC 3SOBL 3R8QA 4E41E 5ADPH 2V2WA 3EYOB 3QQ9D 5GGSY 2PKDA 4M03A 1MHEA 2QBWA 3X14A 2OR8A 5ALCL 4RDQG 3WJLA 1NC4D 5DMKB 1NKRA 5EOQL 2QQKL 5DD0H 1DJSA 1M05A 4O51B 2KL6A 1MFAL 2FATH 2EDTA 3HN3A 4KMTL 1R0AL 1G0YR 1NMAH 3MLYH 1OARL 2ZUXA 4U1SA 1MHHA 3I2CL 2MWCA 1IGYA 4OGAC 3DSFH 2B4CC 4KK5D 2CKNA 4XGZA 4JGJA 5J1AB 1AI1L 4F33A 4U1HA 2GAZA 1WUNT 4HWZB 4GJTB 2Y5TB 4TNVK 3RWJA 4AIZB 4F8TA 2AJ3A 1FN4A 3QHFH 3QIBA 5DI8B 4OZHA 5JQ6H 1P2CA 3BQUB 4CRPA 3DUSA 4MNHA 1S9WB 1CDHA 3MUHL 4XCFL 2WWKO 3PV6A 5E94B 4G6FD 1T4KA 1EFXA 5MI0B 3CFBB 3MREB 4XPAL 1HYRC 3MLXH 3ARDD 3DV4B 1ZHKA 5A2LH 5E08H 2P7TB 2Y06L 4OZIB 3GK8L 4JZNB 3KPRA 4DCQB 4YWGL 2EYSB 4OLWH 5IOPB 5BZDB 3OGCA 3UROR 4N1HB 3RI5F 4MQXC 4MA7L 3MOBH 5CZXC 4OQTH 1U8MA 2DWDA 2IPKB 2JCCA 1TLKA 4QRQB 3PWUA 3KPSE 3HUJB 3KJ4B 3C08L 5ABDE 3PHOA 5GGVY 2E9WA 4AL8H 5J56B 3NGBC 3MRFA 4U6HB 3SDAB 4JB9L 3T77B 4M7LL 1IAOB 3WIFA 3BIBX 1A9EA 2UYLB 2MPAL 1PD6A 4F9PA 2E6QA 1MELA 1A6WH 3VGAB 4N9GA 2EDQA 4M1GL 1EV2E 1CFVH 1EO8L 4B50A 2DQDH 5C07A 1T83C 2JB5H 4J2XA 3CFKB 3G9VA 5GGSB 4DGYH 5HDOA 4J6RL 3X12A 2CKBB 1MI5E 1CDJA 5C6PB 3F58H 3X3GL 1EIBA 1GGCH 4QHKI 3FFCA 4IS6A 2AAVA 4S11A 3PXJA 5I76B 3DVFA 3I6LD 2AABH 5IKCA 1MHCB 1FO0B 4MJ5A 3RGHA 5L2KA 2YWZA 3F7YB 1U8IB 5F3BA 4P23B 4BZ1L 4W6XB 1JPFB 4BFGA 2GSGA 5FCUH 3GIZH 3EDJA 4QTHB 4JM2D 3NCBB 2R56H 1XZ0B 3IB4A 2VDLL 4MQSB 2D4FA 4DOHE 2BSTB 2FD6L 4BELD 4YEFA 3EOAA 4FQQA 4ZO6A 1QYGL 3JTTB 1F4XH 4Z7QE 1EZVX 2KQMA 3W0WE 4KK8C 4GBXB 2XNAB 3ZKMD 4F80A 1U8LB 2X41A 5K59F 4OLYH 3OL2A 1DUZB 1G6RL 5DK3A 3TO4B 3EYUL 4X9BA 3CDFA 1ZT1B 1ZHNA 4ONOA 4WTZG 5B3NA 5KSBA 1KFAL 5HDBF 1CD1A 3BH9A 2OTUA 4P4KC 4WW2F 2XZAL 3C5JA 4P9MH 1F58L 1Q0YL 2EDYA 3EJZC 4K3EH 3SKJH 3D2UA 2CRMA 1NFIA 5MP6H 3WFBL 3N0PB 4Z0XB 2C3GA 2NXYB 2XZZA 4FFYL 4G6AD 1RIVH 2Q8BL 4ZUVB 5FYLD 1J0HA 5B39G 2AKRB 1L7IL 1TVBA 3GBMH 4XPHL 5TQ0H 3KYOB 5SWZE 5D7IB 5IEHA 1IGIH 1DFBL 2LU3A 3BVNA 2BSRA 3PWVA 1A5FH 1RJLB 3EYFB 5C0AD 3LHPL 1YUHA 5CINH 3F5WB 2A74B 3ZO0A 3VXOB 3QYCA 3BRFA 2X09A 1AQKH 3ARGC 3LN4A 4LGRB 4KU1A 1RSFA 5F88B 3Q5YA 4RA0C 3W2DH 5CJXC 3CSYB 5IK3B 3A67H 1VGEL 2WBJD 4Z7WE 4XCNB 2SEBA 5FOBB 1OAZL 4LLWA 1OL0A 4YBLB 3HE7C 3ULUC 4FQLH 1WZ1L 5DYOB 5ISZB 1QBML 4JFEA 4ODVH 2DLTA 1UWGL 3QWOB 3TYGL 3CXDH 3IVKA 3ROOB 3RTQB 2ZUQC 4PV8B 1D9KB 5CKAA 4Y16C 5T3XE 1L0QA 2EEBA 1M71A 2I5YH 4QRRA 4JPKH 4Z95L 3G6JE 3HI5L 4IRJB 2CQVA 4PRPB 5GGRA 3VD7A 5T1DH 5GJSL 2X4OB 3D25A 1P7QA 5CLWA 4ZNCD 1HHGB 2NQCA 4XWGL 4CUCA 1GGYA 4Y0GA 5DRNA 5L6YH 5L7XH 4HZAA 1JPGA 5MHSD 4KK8D 1G7JA 3BN3B 5J6HA 4X6DA 2NY3C 3DJ9A 1WWWX 3I75A 1IAII 3LVEA 4Y2DB 4X7TB 4PJIE 5K9JL 4TVPE 1RZJC 2YUVA 4GRMB 4LQFL 4H25A 3DO7A 2KKQA 3AY4A 3G6AA 4NHUA 1HYSD 1PBYA 1FYHB 3EJZD 4OF0A 3BO8A 4OUOA 1VDGA 1WJ3A 4HBCL 3RWDB 1F4WL 3PWPD 4PJ5D 1LE5A 3TVMC 5KSAC 1R5VA 3O2WL 4RQQA 4GUPB 2VXTH 2R15A 4BQ6A 2O61B 2D7TL 5IG7B 1U0QA 4JPWL 1FE8H 5IHUH 2YD9A 2IAMA 1U3ZA 1GZQB 5CJOH 2ID5A 4M48L 2BOCB 1NSNH 3H9SE 5I1HL 4HJJH 2VAJA 3UMTA 2EXYD 4JY5L 1N64H 1ZK9A 3MLTB 1YNKH 4XP6L 1OQXA 1X5YA 4QXTB 5B8CB 4LGSB 1Z9MA 3ZT7A 3NFPA 5GS1A 5B38B 1CGWA 5J13C 1WBXA 1P4IL 4N90D 4YDVA 4HC1H 4WFGE 1C16A 5DK0B 4JZJA 5IFAH 1UKTA 1YEJL 4KKLC 3VFGL 2BFVL 4QRSB 4GG6A 3KWWA 43C9A 1EGJH 3OR7B 1FBIL 2X44D 5SX4I 2O5ZH 4URTB 3H2WA 3Q2CA 4JY6A 2IH3B 2VZUA 2IQ9L 5GRUH 1A6AB 3GJFB 3C5SB 5HHMB 1J8HD 4ZUUA 3Q3GA 2H26A 3EBAA 4JDVB 3LIZL 1P5UA 3SGEH 1AC6A 3D0VB 1KACB 2HVJA 2AJXH 3SKNB 4F37K 1MREH 2ZCHL 1J1PH 5LAXB 1GCFA 4I0PB 4F58L 3VXNB 3GB7A 4GG8B 4OD1L 3RVTC 4XP1L 1LHZA 5FGSA 5KOMC 1AKJA 5D2LF 1EMTH 4JQIH 4G43B 2NY3D 2BVPA 4YFDB 5E6IB 2CXGA 1VACA 2YD6A 1MQKH 3EOYG 4GW1B 1BGXH 3P4NB 4NJAL 4UT6L 1RJYA 1YA5A 4JG1L 5D8JH 5I1IH 1OW0A 5FYJH 2I24N 4ZDHB 2HVKA 3BJ91 4G7VH 1U92B 1LO5A 3STLB 4ZAKD 2BNQB 5C0DB 5C3TA 3WE6B 4AH2B 3FQUB 3BX7C 3BJLA 4X6CA 3IJYB 3MRDA 4CW1A 2VABB 1HZHH 1BM3H 3IJSB 1FJ1B 4RGND 1FL6B 2X4RA 4KDTC 5F70A 4JRYD 1GGBH 1V3KA 4LCYA 1UADC 2FO4B 1NLDL 1B2WH 3LEVL 3RKPA 3EZJB 1A7NH 3SKMA 3ZKXC 2P8MA 2AJUH 4S1SL 5GSRB 4O2EA 3UPRB 1NLBL 2WUBH 1XF3A 1FH5L 3DVGA 5DA0B 3EYSL 4FQCH 4PJHF 4QF1B 3MLPA 4YHYB 1T22B 3HRZA 4OKVB 4OZ4B 4LVHC 4HX1A 5D9SA 4V1DE 4X80L 4CDGC 4WHYH 3ZTNH 1T7VA 3HHRB 5JORB 1JTOA 4IMLA 4OLUH 1VB9A 3BHBB 3AAZB 3L1OH 1HCFX 2VWEE 4X5XB 4YDIH 1ODAA 1J88A 1NGZA 1HHIA 3D3VD 5I2IB 4XP5H 5D7JB 4FA8A 1W2KT 3RY6A 3MLVH 1UM6H 4MCYB 1FIEA 2HKHH 1HK6A 3GI8L 3KGRA 3NPSB 4Z76A 2H45A 1JF6A 3OXSB 3RVUD 2C5DC 1T1YA 3RVTD 4I18A 1L9NA 2X42A 3D5OF 4IDJL 3ILPA 4CU7A 3WHE1 4IBLT 4LCWB 2AI0L 3QPQC 3V79C 4OCMC 5T1KD 4S1RH 4GKNA 3S35H 2YD1A 1IMHC 3V6OC 4LMQI 3QUZA 3WSQL 2Y1VA 2IALA 2VUYA 3EKCA 1NCBH 1MCRA 4XGZB 1L6XA 3HPLA 4U1HB 4M9PA 3T2NH 1Y6KR 3RWJB 1Q1JL 2AXGA 3KXFD 1FN4B 1V3MA 3T3MF 1EA9C 3E3QE 4J3UA 4OZHB 2E5EA 4F57L 3QISA 1E6OH 3DUSB 4MA8L 4MNHB 3VI3E 3PV6B 1XR8A 2YXFA 3U36A 1X5LA 2ADFL 1EFXB 3ET9F 1DVFA 6FABL 3LDBB 4W4OA 5FGBA 2D03H 3S88L 1GGIH 2FBOJ 4EQ3A 5IMMB 4Z7UB 4LRIC 5GS2D 1OP3K 5JHDD 1F00I 1YY8A 3VXMA 1A3RH 4NC1E 1W72B 2VLJE 2AXHA 1HDMA 3D39D 4IHOB 2VDQH 4B7LA 3VWJA 3S4SA 5C8JA 3IDNA 2JCCB 5KTEH 3H3PL 4FZ8L 5DHVA 3PHOB 4QEGA 1CCZA 4OLVH 5IROC 3N9GH 3MRFB 1KIQB 3GBLA 3ALWA 2R4RH 2FCBA 3UYRL 3WIFB 4A2LA 1LO0H 4M7ZB 2ATPB 3G5YB 4HLZG 4N9GB 1ZHLA 4O2FA 4P4RA 1OLZA 1U93A 4MNQA 2DLFH 4WI2A 1PEZA 4PTUA 3VMPA 3X12B 2BJMH 2J6EH 4CU6A 2P5WE 3BESR 3FFCB 4IS6B 1VHPA 2AK4A 3QFJE 3PHSA 4MJ5B 1AHWC 2BZDA 3QCTH 3HC3L 4Y8AA 1A6ZA 5JXEC 5F3BB 3BI9X 5LGKA 3RWGA 2OL3H 4HK3N 4G9FA 2UZXB 1FSKC 3QT2A 2A6DA 1K2DA 2GSGB 4MDJA 1MWAA 4OV6F 1FYTA 5FF6A 3OHXA 1I85C 1N5YL 2DS4A 4GXUN 5E00A 1S7XB 1AR1D 1RZFH 4KZDL 5F7DA 3OB8A 3B2VL 5K9OB 4WI4A 4MA1B 5CD5D 1NAMH 5F9OH 4OD3L 5JA9A 3SDXE 5JUEH 4I2XA 1F8TL 3CFJA 4PRDB 2FSEA 4HFUL 3OJDA 5GGRY 3LS4H 1KB5L 5KSBB 1ZHBA 3O9WD 4QRPE 2OTUB 1SBSH 3L3JA 1QSEA 1S7RA 2FBJH 5D1ZB 2FEDC 2HRLA 3LMJL 3C5JB 3QG7L 2DF3A 3KNBA 1I3RA 3GEWB 1NFIB 4MLIA 3D0LB 4NO5A 5HYSG 5MEPA 4GKSA 4Z7OF 1QLFA 1MI5D 2GK0B 4M9OA 3K2UL 4JFPA 4UB0H 2GITA 4ZS6D 4KROD 5CLTA 5BV7L 5I1DB 4Y4KA 4XPTL 4RFOH 3R1GL 5IEHB 4HWUA 2XQYK 3SCMD 4FRWA 4LNVA 2AS5M 2WSKA 5FYKU 1IC1A 2GJ6E 3SN6N 1YUHB 2CDGA 4F9LA 4F7MB 3PWJB 3HAEG 4MD5A 2XTJD 4LOUC 3PF2A 4QTIL 2A9NL 3LN4B 4PJFE 4NRXA 5EUOF 3P77A 2NZ9C 5CD3A 1KJMA 2KBGA 3BFOA 5GGQH 3QQ4B 5HHVL 4FXKB 4XX1E 2ZNXA 2CIIA 3QUMA 2J88H 4P3WA 2VSCA 1TJHH 2DD8L 4F15B 5DJ8A 4AM0A 1FZOA 4K7FA 2ZWLT 2BK8A 5LG1A 3D48R 3C5ZA 4IOSD 2AJYH 3M17B 2W65A 2UVFA 3V5HB 3MCLL 1U58B 5F7EL 4IIQA 1HQRB 3WXVH 1M71B 4YXHH 4QRRB 5HJ3A 3DMMB 3ZDZE 5LCVL 4LCCC 2FGWH 2GKIA 4XPBL 3C6LC 1XF4A 4P2QB 5GGRB 2DYPA 1WSST 1P7QB 3BMVA 5C3LD 1KJ3L 3FN0H 4KI5D 4UINL 4CN4A 4DVRH 3A6BL 1IVLA 3H9SB 2VXVL 5GHWL 3KYNB 4XVJL 3T0EA 1F90L 3HNTH 3MQIA 5DRNB 1JPGB 3UTTE 2NZIA 1G7JB 3QPXL 5J6HB 2BNRD 1KPVA 4X6DB 3P30H 3FB5A 1RY7B 3QQ3A 3QXAA 1SY6L 5CILH 1H3WM 1XGRA 5SWZD 3S3PA 3NIFE 3WD5L 1EFQA 2BVYA 1QR4A 3LN5B 5D7SL 3OPZL 5JW5A 4XAKE 3DO7B 4H25B 4MWFA 4C83B 1K8IA 5E5MA 2JB6B 3G6AB 3EFDH 4UU9A 3FMGL 4JANB 3BO8B 2EDKA 4GSDH 1LE5B 2KUTA 3CZJA 4JRXA 2R4SH 1NCWH 1R5VB 1YMME 1J0IA 4RQQB 1I9JL 1ZWIB 4I13B 1JTPA 5I6XC 2ICEA 5IB5B 3ALPA 4ODTL 4UTAH 2I07A 5EFIA 3SE8H 4LPTA 5I66A 2NY6C 4BM7A 1OAYH 4JN1H 2R39A 2DM4A 1T6VN 3TPKA 2IAMB 4HPYH 5AZ2L 4RNRA 5HBBA 1C12B 3EGSA 4EN3C 5J9PA 4FS0A 4HEME 5E2WH 3QHZL 4LKXA 3GMPA 3CU7A 1PG7H 3L3IA 4YE4H 3BKMH 3NAAL 3NFPB 3CVHH 1EO7A 1I7ZB 2QADB 3KHQA 2ZOKA 3R8BB 4ONFL 4XVSH 1C16B 3TV3H 4JO4L 5CP7A 2YN5A 2NTSP 4LSPL 3TZVC 2HWZH 3DETC 3KWWB 4RAHA 1RUML 43C9B 4KXZI 5DRZA 1U3JA 1PQZA 1MFCH 5BS0A 5GISL 4HWBL 3MBXH 4WU7A 1JZ2A 4KGLA 3R0NA 1ND0B 1P7KA 2CJUH 4F7TB 3Q3GB 5IVXA 2YD4A 3C6LD 4R4FH 1I8IA 5SV4A 2EC9U 1HSBA 2N7AA 4WY7L 4TOYH 2HVJB 5FECA 4QWWC 1ZEAL 3SE4A 2ADGB 1UCBL 5TDOA 4JHZA 4PJXA 2E27H 2VC2H 4LP5A 3WKML 5FM8A 5AAMA 3NCJL 2OK0H 1OAKL 5TE7L 5SWSA 1CXIA 2BVPB 3PGFH 2H6PB 4OAWB 4OCYL 1VEOA 3AFLA 5L8LB 2NW2B 2F8XC 3ETBF 1H3GA 4JPVH 5HDQH 2OR9L 1VACB 3MV9A 1MNUH 3FO9B 4GXVL 1U3HB 4OSUL 5D4QA 2VDKL 3GSNH 1RJYB 3HNVH 4ENED 4ONHA 1F6AA 2W0FB 4XTRD 3PE9A 1N2RA 2HVKB 1LO5B 3T3PF 4PJCA 4YQXL 3IXAA 1C1EH 4E42A 4ORGA 3W11C 3BXNA 2NXZC 4NQEE 5HXMA 4WFGD 1PSKH 3EW3B 3T0AA 3MRDB 4CW1B 2Y23A 3RUGF 4JHAL 4IDLA 3HRPA 3K8LA 3P40A 1R3IL 4YHMH 3G04A 4C54A 2Z8RA 1JGVH 2J8UB 4EOWH 4TULH 1WAAE 3DURB 2AK1L 4LCYB 4J4PA 4KY1H 4QGTA 2OZ4L 1CF8L 5FA3B 5B4MC 2VXUH 4HIIA 4YLQT 1X5FA 4S0TD 5IVZA 1UM4H 3NN8A 3HI1A 2WP3T 3UTSA 4X99A 3MJ7B 4HGKC 3SJVD 1JHKL 5T1MA 4EQ2A 4PD4J 4X4YB 2KZWA 1NFDE 5J11C 2J7LA 4M61A 1CU4L 1Q9KB 4APQB 4M7JL 1GPOL 2DQEH 4HX1B 5DMGC 1OAQH 3TZVD 1G1YA 2FHBA 5IWLA 3BDYH 2CLZA 5I1EL 2BXZA 3ARBC 3PIQB 4IMLB 3LSOA 3B5HA 4YHOL 3TBYA 5EU4A 1J05B 1ZGLP 4LLYA 3TT1L 3KPPA 1FVEB 3MZTA 1HHIB 4KK6C 4S1DD 2DQTH 1GOGA 4OB5L 2PXYC 2ZZUT 5IHZA 3K81A 4B7IA 1IAIM 1J0YA 4HUNB 4X6EB 4ETQA 5GS0H 3ZE2E 2BMKA 4EVNA 2DDQL 1KPUA 3ARVA 3LH2L 4KAQH 5CKGA 3ILPB 4XNQA 4HIXL 2A73A 2DBLL 3OJMB 4JJ5A 4NP4L 4RMRA 3VE0B 1R5WA 1AGBA 2VDRL 4GKNB 1YPZA 4Z0BH 2A83B 1QRNA 1JTTA 1S7VA 4R8WH 5JR1L 3JTSA 4W4NA 1RUPL 3IDMA 1WBZB 1YJDL 5KVGH 2AXGB 2PO6D 1BZQK 5CIPA 2XN9E 3MRIB 4LPYA 1DQDL 2AJVH 3TM6A 4GLRI 1LO3H 4NUJA 2YOCA 3S96A 2EH8L 4XNZC 4OUUA 1XR8B 1I1FA 2OJZL 4V1DD 1UWXH 2Q8AL 4Y1AA 3CVIH 3PGDB 3STZB 3I02A 2G9HA 2DQJH 1RJCA 1YY8B 3FQWA 2CRIA 2R0ZH 3VXMB 1HDMB 1S3KL 4FTVD 5IJKC 4B0MM 3VWJB 4Y4FC 3V4PL 5C8JB 3IDNB 5C0BA 4U05A 4PGZA 3VGHA 2Z91A 5DHVB 3ZDYE 4Z7UF 3SQOH 4XHJD 3QUKB 4TPRL 4OCLC 1KBGL 4NPYA 3OKLA 3OQ3B 5H2BB 1JGUH 1FNGB 4YHPB 4XCEA 1IAIL 3MNVB 3C6SA 3FQNA 1CICB 2A6JB 1ZHLB 3IFPB 3SDXB 5H8DA 4P4RB 3HR5A 4YK4B 2BCKB 3TNMA 5EH1A 1U93B 1NCDL 4R2GD 3ARBD 3FO0H 5E1AB 4Y4HC 3F7VB 3B3IB 4UILL 4PTUB 4R0LA 4L4VA 3RZCB 1SVCP 3GJFH 4L8SB 4QRPB 4Z7QF 3TN0A 5E9DE 2AK4B 5IV2B 2KZ1B 1FRGL 2WW8A 1KGCE 3C87A 1VA9A 4G6KL 4KQ3L 5DR5H 1CDGA 1A6ZB 5I18L 1P1ZB 2GY7B 4UTBH 1EHLL 2GCYB 3IDXH 1K2DB 4KK9C 1OGAE 3CMOL 4MDJB 3K8MA 1FYTB 2FJHA 2RCSL 3HNSL 1JYNA 1VFBA 3HKFA 5E00B 2VL5B 4QHMA 2P44B 4MQTB 5D71L 2X7LB 2E9IA 5E70A 4DTGH 2OP4L 5DJXB 1C08A 4P2OA 5F7KC 1NGYB 2B2XL 4PGBA 5BMFH 2DQCH 4I2XB 1ES0B 3CFJB 4WO4C 1H3VA 5GS2H 4I3SH 1LQSR 2YPVH 2EIBA 4YHZL 5EZIH 4CU8A 3AXLA 1ZHBB 3L3OA 4U1KA 1CE1L 1Z9SA 2EO9A 5EU5A 1S7RB 4HPOL 3VFWA 4KZEH 1OSPH 1YECL 3CXHJ 2LU7A 1CDCA 3FZUD 4R97C 3U82B 5AG8A 1I3RB 2Y07H 1RULH 3RWIA 4GKSB 3W9EB 2H8PA 3PL6A 4Z7NF 1RZKH 1TCMA 1ACYH 4YHIA 1QQDA 4Y4FD 2N4IA 3MV7D 3T2QA 5EU6D 3QFJD 5I1LA 3CDCA 1PYWA 5BVPL 3ZSSA 4LARL 2ARJQ 4Y4KB 2XZCL 1WZMA 5IFHH 1QRKA 1UEYA 1JZ6A 3MRPB 2IPUG 1JK8B 5ALBL 1CFNB 4I77L 2CDGB 4IRZH 3G6JF 2VR9A 4JFXB 3IU4H 4MD5B 4X4XA 1TCRA 2OTWA 3QUYB 5DS8A 3SGJA 2F15A 3BUTA 4JO2L 3P77B 1HILA 2R0KL 1BLNA 4OT1L 5DEZA 2Y36L 3QCVL 4N0RA 4E0RB 3QUMB 1EAJA 1RD6A 1KTDA 2FR4A 4EIGB 5BVJB 5EC2A 3KAAA 5DRXA 5DJ8B 1GXEA 3WFDH 3HZYA 1FZOB 1QBAA 4K7FB 4HDIA 5AG9A 4Y19A 5I73B 4Y8DC 4PJIF 5MI0C 3HE6A 1LNUB 3HC0A 1YMMB 4YAQB 4TSCH 2JJSA 1J12A 5BRZB 3I9GL 1IM9D 2IPTL 4AZ8A 1YN6A 5HJ3B 1EBAA 1VKXB 2HJFA 3DHJA 3K2MC 2RHEA 4G7YL 4NZTH 3D6GA 1N0XH 3OR6A 3QWRA 2BY2A 1A64A 4ODSH 2DWEB 3EOBA 4J1UA 1H15A 4D0CA 3KJ4C 1E27A 1N59A 4ORZC 4L5FL 3BOVA 4J3XA 1EAPB 1OTTC 1MHPH 3SDAC 2J8OA 5C0CE 4G6JL 3FB5B 1D5IL 2C1PB 3QQ3B 4YDKL 1E4WH 1T6WA 4KKCD 1XGRB 4RDQF 3VGAC 4LNRA 4KRPD 3G9AB 3N50A 5D7LB 2NY0D 4AG4L 4MWFB 3KPRE 4ZFFA 4UIKH 1K8IB 4CMHB 1V3LA 3MA7A 4NUGH 1EERB 4KKAD 1C7TA 3ZL4L 3RPIA 1W72H 1NANH 4JRXB 1NDMA 5HYJA 3PDOA 4HFWA 4OZGE 1JWSA 3AROA 4HV8A 5EPMB 4TUOA 3S36H 2FHCA 4P23C 2I07B 3FQTA 2FX8H 4FABH 5I66B 1URLA 3PJSA 3RL2B 2QQLL 3PV7A 1F3JA 4LHUA 4BZ2H 2Z9TA 5E7FA 3TPUA 3EGSB 4G8GE 5J9PB 1V5JA 1P4BH 4WUKH 4ELKB 1MRDL 3FO1A 4KGJA 4NO0A 5ITFB 2GYSA 3GMPB 4JDTL 3DRQA 3L3IB 1K4DA 4YDLB 4M6ML 1T03L 4GBXC 1YEKH 1BD2A 4PS4L 5L2KE 3F6LA 3MUJA 3TO4C 2ZOKB 3BQUD 3M8OH 5DWUH 4Q7DA 1Q9LA 4Z9KB 5CP7B 5E2TL 4M5ZL 2PYFB 5KSUB 3VFPB 4TSAH 4PRBA 5J4MA 2E7BA 3MXVL 5F1KC 1JV5A 1NAKH 5BS0B 1X9QA 2JIXA 1FAIH 3HZKA 5HGBB 2MFNA 1GHFL 3O6LH 4LEXL 1PLGL 4WU7B 5IBTL 4CAGA 1T83A 5C0ND 2NXYC 2N56A 1P7KB 3HMXH 4FFWD 5IVXB 3P9MA 3RNKA 3U9PL 1BQHB 2VN7A 3O4LA 1JNNL 3N06B 4L4TE 2HMIC 3GHBL 2XICA 4M1DL 1OTTD 5F9WC 5TDOB 4N0YH 1HHJA 4MXQC 3H42L 1OVZA 1AO7A 2B1HH 2VXSL 5TE4H 1N6VA 2EDDA 5SWSB 4EUPH 2DTML 3BDXA 4S10A 15C8L 5EO1A 1A14L 1EUUA 5DVMA 4W81A 4XP9H 1H3XA 3WCYA 3QEQE 3ARYA 3MV9B 4Y89A 1UM5H 5I17A 4CVUA 3FOMA 4MAYD 2EE6A 5JA8B 3WO4B 1OCWH 4JCLA 3BH8B 5TGBB 3ILQC 2Z31D 1INEH 1N2RB 2AGJL 4YBLC 4GRLA 4U7MA 5T3XH 4X7SH 4DKEH 2YC1A 2QSCH 2EDXA 4ORGB 1BOYA 1L0XA 5C0RL 4UAOB 5DUMH 2ZKHL 3MRJA 5HHOA 3RTQC 3WFEL 5F9AC 1R3KA 1D9KC 2VMFA 3C8DA 2CSPA 4Z7VE 1N26A 4JQXC 5HI3D 1ETZA 1G7LA 4IRJC 1S7UA 4P4KA 1C5DA 2DQUL 4L29B 3H0TB 1C5BH 3S5LA 4HIIB 2Z4QA 5TF1L 3NN8B 2QQNL 3HI1B 3RVWC 3UTSB 1WC7B 2MMXA 2J8UF 4I1NB 1QBBA 1S7WB 4FNLL 2Q1EA 4MA3B 5T1MB 2NX5D 4TVPH 4U1LA 3B9EA 4AMKH 2K7QA 4JFEE 2ENSA 1FORL 3RBSA 4M61B 5IF0B 4Y2DC 3ESVF 3H9HB 3MFGB 4Q9RL 4Q9QL 5IBUB 3BKCL 2C26A 3UBXI 4U2YA 2PUQT 5F1IB 2WMPA 3VGBA 1MWAL 4M7KH 4ZTPH 2EC9T 1KT2A 1NBQA 3PWLB 2XYCA 1RHHA 3TBYB 3S4SG 1GH7A 2YA2A 3B9KB 3RWHA 4KUCD 3MRQB 1RU9L 2X5PA 3DHMA 1KCUL 3ARGA 3ECBA 3RU8L 3BWAA 5DD5H 3O3AA 1LP9A 2CGRH 5HDLA 5CJXA 5FGCB 5IHZB 4IOFC 1MAMH 1S7SA 3O6MH 1B6UA 1BZ9A 4P49A 3VI3F 2BMKB 3HE7A 4J3SA 4TUKH 1TNNA 5GRXG 5DD6B 1MCNA 4DW2H 4XNQB 2A73B 4OV5B 4QHNA 1MFEH 2CDFA 3IKKA 5J1TC 3LQMA 3P4OA 1DN0A 1XCTA 3WS6C 2JJUA 2RB8A 4OFYD 5BV7B 2CXKA 3AB0B 4Y16A 1V3JA 1QRNB 1D5ZA 4PRIA 3P2TA 4UQ3A 5B8CC 3QRFM 3GRWA 4K8RL 4RA3A 4I0CC 4WHCA 3JTSB 4NZUL 1RURH 1NUGA 4C55A 2OCFD 5D1QB 2D7OA 4XC1L 2DLHA 3GZKA 4DKFH 5CIPB 4LLUA 5ISZD 1CXKA 1LEIA 5TQ2H 4HMCA 4NUJB 4XVTL 3S96B 4OUUB 4HZLB 5I1CH 3RTQD 1I1FB 1CQYA 1OOAA 3BSZL 3PHQA 4Y1AB 4UT9L 5K93A 4UI2A 3I02B 3SOBH 5IBLC 3FQWB 3FQRA 4Y5XA 5ALCH 4H0GA 4YUEH 3BPCA 5EOQH 4X7FC 3GGWB 2QQKH 5HI5C 1OGAB 1DQJA 5CEXA 4I0PC 2OI9B 4KTEL 2UUDK 1MFAH 1V7MH 4KMTH 1AP2A 4LSVL 1U42A 5C0BB 1R0AH 1PZUB 5EOCJ 3TVMA 5KSAA 1OARH 3RJQB 3IKCB 4K94C 4H8WL 3I2CH 3KYMA 2H32H 2X9YA 4KTYA 4GG6E 1AXIB 2P4AB 4NPYB 5E6IC 4Y2DD 1AI1H 4HG4K 3VXSE 1NBYB 4XCEB 2J5LB 2FZ3B 3FQNB 4HGMA 4OF5A 3DXAE 5DQ9A 3TNMB 5E8PA 5KN5A 4XXDA 4FFVC 1XF1A 5DRWA 4L4VB 4HWNA 4XCFH 4XH2A 3AVEA 5M94B 1ZLUH 4RRPA 3B43A 3FB8A 2NY1B 3IU3A 5FYJU 3SDXF 4ZFGL 5C7XL 4XPAH 1RZGB 2V9QA 2ZUUA 2A38A 2Y06H 4A2MA 5LGJA 3JUZA 4QOKE 3GK8H 2ZUVA 4CNIA 3VA6A 4YWGH 1S8DA 1OF2B 1CXHA 3L5HA 5B3JE 4DUXA 5FCSH 3LQZB 1HH9A 5T5FL 4MA7H 5ICXA 3TT3H 4NQTA 3RL1A 4NQDA 3ZE0E 1RZKC 1VFBB 1JNHA 4YPGB 4ZUSB 2IBBA 3REVA 3UC0L 5FHAL 5DLMH 4P5KA 4JB9H 1UA6L 4M7LH 3ZKSD 1NMBL 4NKIL 2MPAH 4K9EC 3VFMA 4ZFOL 4YHYC 4P2OB 3DGGA 3GSRA 2NPLX 1N6UA 4M1GH 1EO8H 4PGBB 4X6CE 3UJTL 2N7BA 5KVFL 3OG6B 4J6RH 4J12A 2BHUA 1T7WA 3X3GH 3EFFA 1NC2D 4JFHE 1P9MA 5FHBL 3L3OB 2EKJA 2AP2A 3BUYB 3B2UD 5JOFA 3DYPA 1WFTA 5DUPL 5BQ7A 3VFWB 3JV4A 5ILTL 3G5XA 4XC3L 5D7JC 4ZXBA 4JAMA 4UOJA 5JXAL 2V5TA 2H8PB 3Q6FB 3Q1SH 4BZ1H 5GS3A 3F62A 4I3GA 1Y0LA 5HI5D 3NPSC 4YHIB 1QQDB 4I0PD 5E9DD 1ZLWH 3HZVA 4OBSA 3D9AL 1PYWB 1YEDA 3WJLC 5I1LB 3QDGD 2VDLH 3QIWD 4WI8A 3MUGA 2AXJA 1HHKA 4HF5L 2FD6H 2OR7A 5CCKL 2FECI 5D2NE 5IMOB 1YN7B 1GOFA 1QYGH 3ZDZF 5L2JB 1HXMA 3CDGA 5SX5K 4KDTA 3QIUB 1A6UL 5C0CB 3QEHB 4NQUA 5C0IA 4X4XB 2OTWB 4N0FA 1FL5A 3M1BA 4LMQE 5DS8B 5IW6A 1G6RH 3EYUH 3J7HA 3B5TA 1HILB 4ODWB 2GQHA 5JOPE 1BLNB 5C6WH 1KFAH 1A22B 4JVWA 5GRZA 5JQHC 2KPNA 1QO3A 4PRHE 2XZAH 3GMLB 4YHNA 2FR4B 2FJFB 4M1CD 5DRXB 2QHLA 1F58H 1Q0YH 5C09E 3HZYB 1X5GA 2IQAA 2WWMC 3F7QA 4Y19B 3WFBH 3NIFF 1MJ8L 4PD4K 3LDBC 3HE6B 2CDEA 2XKNA 1AD0A 4NFBA 4WW1A 4FFYH 2J4WL 3CU1A 4JM4H 2Q8BH 2K7PA 3L5JA 3JWDL 4WUUA 1L7IH 1RZIA 3WNPA 4XPHH 4K2UL 4LLVB 1WZLA 3TJHD 5L9DL 3OR6B 3EOBB 4J1UB 1DFBH 1H15B 4D0CB 4R4NC 5E8EB 1E27B 4WEBL 1N59B 1OTSD 3C09B 3K8KA 2A0LD 2VLRA 3MRRB 5ANME 4V2CB 2HH0L 4M7ZC 2P5EE 1CFTB 4LNRB 1I3GL 4ACPA 3V4UL 1R5IA 2OMBA 1AGFA 1VGEH 4HXBL 3VXRE 1BPVA 1MPAL 5HGAA 2Y7QA 3PQYB 4KV5E 1WZ1H 3V6OA 1QBMH 3VFNA 1ORSB 1UWGH 4OQTA 3TYGH 2O5XL 3MRNB 3RPIB 3VXPA 4YFLI 3OKOA 2KH2B 3PDOB 3OTTA 5KAQG 2CO6B 2P8LA 3UAJC 5D70L 3BPNB 4TUOB 1NDGA 3FQTB 3HI5H 4DK6A 1H8NA 2AQ3A 5GJSH 4WIQA 3GSQA 1F3JB 1UB5A 4LHUB 1O7VA 1E4KC 1IKNA 1MY5A 3TPUB 1JE6A 5C0EA 4MNQE 4XWGH 3QNYB 3FO1B 4NO0B 4GOSA 2D2OA 1QVOA 4MA1C 1K4DB 5IESL 2C4FU 4AK1A 1KLUA 2M1KA 1LO2L 5K9JH 1Z9LA 2E8YA 2C7UB 3QIBD 7FABL 3IT8D 4LQFH 3U0PB 1B0RA 4K7PL 3MV11 4NOBA 1Q9LB 1DEEB 2EIDA 2MNUA 1PY4A 4LHJB 2DM3A 4G9FE 4OF3A 4X5WA 5IROA 2EDNA 1WWCA 5JLZA 1ED3A 4PRBB 2IANA 4HBCH 1F4WH 1EFXD 5D1ZC 1JV5B 1JI2A 3FB7B 3MRLA 1NGWA 3O2WH 2JIXB 4ETYA 3HZKB 1BMGA 3KPRD 1NEZA 3THML 4I3RL 4BSWA 3VMOA 3RNKB 5EIIA 3LAFA 1CFBA 1BFOA 3DECA 4JPWH 2CO7B 1YEFL 4NQXA 1U41A 3O6KL 5EBLA 1MJJA 4M48H 1FCCA 5I1HH 3ULVL 2YRZA 3EDFA 4JY5H 1HHJB 4GW4B 1MCWM 3HFML 4XP6H 1RIUL 1MCKA 3L95B 4XCYA 5JXEA 1QSEE 1WAAF 5J0BA 1GAFH 5C07D 4G8GD 5A2FA 1A1NA 1UGNA 2V5YA 3I6KB 4CVZB 1TVDA 5I17B 1N5AB 1T3FB 2VTFA 2HKFL 1P4IH 2Z8VC 3L7EA 4LBEA 1ZGLM 4BA8A 4CL7A 5MENE 3FFCD 1YEJH 3VFGH 2BFVH 1LE9A 2F54A 3LEYL 1S5IL 1FBIH 3O8XB 4EDXA 2LE9A 1NFDF 4GRLB 3CUPA 5L2KD 3LRSA 2IQ9H 2EEAA 3T08A 1F6FB 2F5AL 4I48A 5HHOB 4NQCE 1R3KB 1M7IA 3LIZH 3LB6C 4OZFB 5HHXH 3DMMC 3O4OB 4XMLL 5D96C 1G7LB 2ZCHH 1S7UB 4F58H 1VADB 1KCVL 3BYYA 1C5DB 1I9RL 5ITBL 1UXWA 4XP1H 1MFDL 4FZEL 2X6MA 2Q87A 1UVQA 3CXHK 2ICCA 2Z4QB 3RIAK 3DVNA 1KPRB 2FH8A 3ZTJG 4ISVB 4JHWL 5FM5O 2HT2C 3ZE2F 1WIPA 4KDVA 1KIPA 4HHAA 3ZHLA 4UT6H 3MXWL 2J1KA 4NNYA 4U6YA 4JG1H 1Z0MA 2GSIB 2MQ0A 4R3SA 3RP1A 3VFOB 3T0VA 1FVCA 3MNWB 2WINA 3LKPB 1KT2B 4NKOB 1ZKAA 5DDHA 3D2UD 2YUXA 1ZS8B 2X9WA 3ARGB 5FDYA 4PGJA 1FFOA 3H7BA 4PYHA 1X7QA 1K6QL 3HG1E 3T0EE 2DLEA 4P2YA 3V9FA 3ZT6A 3VJ6A 1MEXL 1LVEA 1QA9A 2X1OA 3GMQA 1NLDH 3C2AL 4J3WA 2RJMA 2LABA 3SDDC 5HYIA 2JLLA 3V4VL 3HE7B 2IAMC 4S1SH 4Q6YA 1PG7W 2OTPA 2R9HD 2ZG3A 5INDB 3T8XA 3A6CH 4L3AA 3TA3B 2HLAA 4P2RA 2CDFB 4N0UE 1DN0B 4MHHG 4NZRL 1FH5H 1JF1A 3EYSH 3MV8B 4WWKC 2PYEA 3E8UL 4NDMA 1D5ZB 4IEFB 4PRIB 3W5MA 4UQ3B 4ZYKA 2FYYB 4MSWA 3ZHKA 2QADC 2VSDA 3J8F7 3DXAB 4ZO9A 4XMPL 3ZDYF 1VFAA 3S7GA 4YC2B 4TQEH 3CFCL 3EAKA 1N0LA 2XRAL 4JFED 4M00A 5JZ7C 4QHLB 2IADA 5IR1A 3QXVA 2ZJSL 4QGYA 4U1GB 2I60L 5I75B 5KS9E 3LB6D 3U1SL 2BVQA 4QRRD 3GI8H 4PJ7E 3VD9A 1D7FA 5JTWA 1JNLL 4P57A 4OM0L 3VA2C 1U6AL 4Y5XB 1T89C 1TPXB 1RJZA 4N8VA 1P7QD 4IDJH 4YZFE 2Z92B 2IBGA 1DQJB 2HG5A 3NCYP 5BJTA 4KRMB 4HC1A 5I8CA 2FIKA 1ZSDA 1X3DA 2BY3A 4YHKL 4PP2B 1X5JA 2HT2D 4AEEA 5CGYC 5A2JH 2EH7L 1EGJA 3TC9A 3EO9L 5D5ME 2NTFA 5L0QB 1QFUH 1Q1JH 1BAFL 1CL7I 1U3HC 2H3NB 4WI9A 1QFOA 4BKLA 2BRRH 5KN5B 4HH9B 2H2SC 4J7RA 4F57H 1XH3B 2F5BL 4PG9A 1OW0C 3U6RA 4MA8H 3UTQA 4Z77B 1G7HA 2Z35A 1NUDA 4LPXA 6CGTA 4CJ1A 1OWWA 3L3GA 3FB8B 2ADFH 3IU3B 6FABH 2GFBA 4Z5RB 4WW2A 4XBGB 3X3FL 4EDWL 3S88H 5D1XB 1Z5LA 4LGPB 2WZPD 4ODHL 2Q3AA 2VISB 4FP8H 5J13B 2OJEA 1S8DB 4PRNB 4KKBC 2YSSB 4UBDD 1MJ7L 1TQCB 3PABA 3UX9B 2IAMD 1OWRM 1R3HB 1SMAA 5T3ZD 3UXFA 2F8VA 4K23L 1GGUA 3RL1B 3H3PH 4NQDB 4FZ8H 3M45A 4OCNC 5GRWA 3OXRB 4DEPB 1QG3A 1CD8A 4P5KB 3UYRH 2B4CL 4P9HL 3T4YA 3KS0J 5D2NB 4YNYA 1DBML 1G9NC 3ARPA 1JZ4A 1MCCA 2QADD 3DGGB 3GSRB 4APQC 5JHLL 5EWIL 2HLFD 4WFHD 3JVGC 1ORQA 4M5YL 5JZ7D 3LKNA 1XGUB 1AE6L 3VXSD 3Q6GH 2MQCA 2DQGL 5F7FA 2Y25A 2YN3A 5C09B 4HCRL 3JV4B 1A9BA 7CGTA 3G5XB 4ZXBB 3HC3H 3RY6C 3JV5A 2DOCA 5IGXL 3BPOB 1UKSA 5FYLL 3KR3L 5F7WC 1YEDB 2LTQB 1N5YH 2ZG2A 1AKJD 5F7NC 4DFIA 5AAWA 4BQ8A 3ROLB 5B22A 4KZDH 3B2VH 4CMMB 3VFRA 4PJ8A 4NKDA 3FT2B 4N9OB 1U8QA 1HXMB 4OD3H 4MS8D 4U7KA 4XWOC 3WIIL 1F8TH 3MRKA 4U2ZA 2W9DH 4N0FB 5IW6B 2OXHA 4AQOA 1CD9B 5I9QB 3RNQA 3V0AC 3HC4L 3VRLE 5KZCB 5F96L 2X4TA 5EOTA 1KB5H 4EJ1C 1SYVA 4L3EA 4ZUWB 1QZ1A 1QO3B 4LHUG 3LMJH 2ICWA 3AU1B 3QG7H 3TJEH 1DQQA 1A1MB 3CFDA 3QDME 4Z8FL 2BC4B 3H7LA 5ADOH 2F8OA 2XXMB 4W4OC 3MBEA 5FGBC 1S78C 1BQLL 5IB1B 1YPZE 3K2UH 1HH6B 5EZJA 1RZIB 3VXTA 4QNPE 1I1AA 2QSVA 1NCAL 2ATKA 5BV7H 4XPTH 3VWJC 3R1GH 4LL9A 3L3KA 3X11A 1QSFB 4UDUA 4OIIL 4OZGF 3MYJA 1AFVL 2P48B 3ULVE 2VJXA 1I8KA 2VLRB 2QV2A 4PV9A 4PJDE 1DL7H 4DZBB 5HHPA 4WCYL 1G7MB 4QTIH 2A9NH 2F53A 3RJDA 1CICC 4M4RA 1I1RA 1R5IB 5HHVH 3K1DA 1I9EA 4M6NH 3MRMB 5MERA 2DD8H 1KELL 3LY6A 2FHFA 3RZCC 1WCQA 5KVEL 1XEDA 4L8SC 4LCIL 1CGTA 1IGJB 3N85L 4Q6IA 5LGHL 1G6VK 3MCLH 4RGMB 5F7EH 3OKOB 2DJSA 2GT9A 1KIUA 1TMCB 4L8BA 3VXUB 5ACLA 1CG9A 3AS3A 4BUHA 4PRHD 5LCVH 3IAGC 4XPBH 2EKSA 2G60L 3BKJH 5FUCE 4X7EC 3QUXB 1IFHL 4I5BB 3D85A 1JYVA 3GSQB 3WS3B 1UB5B 1KJ3H 5E2UL 4UINH 4JFQB 5C0EB 5H94B 3A6BH 2N1KA 2VXVH 3CFIC 3IGAB 4XVJH 2WBKA 1F90H 3QUZD 2CIKA 2J6EA 4GAFB 3RKDD 3QPXH 1QVOB 4D0BA 5DD3L 5D2LA 4AIXA 1SY6H 3WD5H 3OPZH 3WEXB 3V7AG 1B0RB 4JN2B 4MX7A 1LK2A 2OL3A 3ULUL 2GY5A 5MENB 2YPLB 4X5WB 3TYFA 3HMWH 4KH2A 3DX8A 1DVFD 3S5LG 4F7CA 1T04A 1KTKE 1KYOJ 1UT9A 3V8CA 1I9JH 5LBSL 3CMGA 5IB4B 3VXMD 3PP3K 3GSOA 4ODTH 4PUBL 4JFDA 5EBWB 1CLOL 4M6OL 1NAMA 4BSWB 4Y4HA 4PREA 4D9QE 3VWJD 1O7SA 4NQXB 2ZOLA 5AZ2H 3W81A 1MJJB 2W59A 4Y4KC 3V5KA 5HD8D 3JWNC 4QY8B 1NCUA 3P0YL 5I30L 2G2RA 1T21A 4ALAL 3BRGC 4XCYB 2YMXL 4F9LC 4Z7VF 4G6ML 4C56A 2ZSVA 1XGPA 3QUYC 4MNQD 1A7PL 1RZJL 4PJHA 3L7EB 3O11A 2CMRL 4LBEB 3K3QA 4JO4H 3DOSA 2J2ZA 1U91A 2FX7L 2F54B 4H26A 1TZHA 3GBNL 2LU4A 1RUMH 2AK4D 2X1XR 2V2TA 2DLGA 5GISH 5MEOA 4HWBH 1J7VR 3SDCA 1NGXA 3SBWC 5I73C 3OB0K 4WFED 3H3KA 3O3EA 3TFKC 4G9FD 4X6BA 3PGCA 5FV1L 1QFHA 3HG1B 4WY7H 5C0FA 2C4FT 4P3DA 1FYTD 5TPWL 1ZEAH 5EN2A 5E0QA 3HZMA 5C0DA 4E9LA 1HQ4A 1UCBH 5IMLA 5DFVD 3NCJH 3RGVC 1UVQB 4PP1C 1OAKH 5TE7H 3QA3B 1D6VL 4N0UB 4OCYH 5DJYA 3DVNB 2C4XA 5C08A 3L5IA 2J3SA 2OR9H 3NCEB 3WLWD 5EO9A 4GXVH 1KIPB 4HHAB 4HKJA 2VDKH 3SO3B 1UC6A 2RGSA 2ESVA 4ZFOB 1INQA 1INDL 4O51A 4LSDA 2CR3A 1QSED 3AC0A 4UDTB 1FVCB 2WINB 4CMHC 2WM0A 5DDHB 4UV7L 4YQXH 3NTCH 3RBGA 2WIIA 3QDJA 5GPRA 5C2BH 2QR0A 5J1AA 5AUMB 2YRLA 1FFOB 3O3UN 1F3RB 1R3IH 2NY2C 2FLBT 1BX2A 4F8QA 4M4PA 2AK1H 2HAZA 3VJ6B 5D93B 1QA9B 5DI8A 3OF6A 4Y4KD 2OZ4H 2ED9A 1CF8H 2ZPKL 1S9WA 4WVRA 3KLHC 3T8XB 2O5YL 4P2RB 2AJSH 3BP6B 4HWEL 2FECL 4F2MA 1JHKH 3DV4A 2P7TA 5DMIL 2ZUSA 4JZNA 4NDMB 2EYSA 4OCSL 4YDLC 1CU4H 4M7JH 1GPOH 3MODL 4ZYKB 3MMEA 5DVNA 1N7MH 4NWUL 5I8EB 1NL0L 4WHTB 1VFAB 2EYTA 3ES6A 4YHOH 2FX9L 4GG6F 3CD4A 3WO3B 2ENYA 3TT1H 1MCOL 1IAOA 3C5ZD 4QXUL 2OMNA 2WBJA 4PY8J 2DI8A 3TFKD 5E2JA 4NM8L 4JVUA 4RFNB 1ZTXL 1XIWB 3AGVA 4OB5H 3HS0B 2DL2A 3C60A 3WFHB 3GJEA 4L3CA 3LN9A 2DYPD 4N8VB 2DDQH 3CVHA 4HIXH 2DBLH 1BD2E 4LPVA 2GHWB 3WLBB 5FYLE 5BJTB 4O9HH 3T0ED 2FIKB 1ZSDB 1D5BA 1FO0A 3DX6B 2VDRH 3VFSA 3TIEB 4XHQA 3P0GB 1CXEA 1U8IA 3F7YA 5B3JF 1MCFA 4HQQL 1MIEL 3MLRL 4P23A 1BBDL 3QFDB 1NMAL 1YEEL 1HCVA 4NBZB 5C0AE 3MJ8B 1N8ZB 1T0MA 1YJDH 3DSFL 3KLAA 3ZE0F 4QTHA 4BKLB 1XZ0A 3SKOB 5KW9L 1X4ZA 3QNXB 1DQDH 3WO4C 2BSTA 4OCWL 4I9WD 2EH8H 4Q58C 2Z35B 4JRXD 2OJZH 4HT1L 1FGNL 5JQ6L 1UZ6E 4JFOA 1S7QA 4L9LB 2Q8AH 3JTTA 2GFBB 4X6CF 4WW2B 4GBXA 2XNAA 4UAOC 2A6KB 4UIMB 1AO7E 1Z5LB 1IM3A 3PWPA 3C9NA 1QR1A 5ETUA 3PABB 5EIVA 2R1YB 2PF6A 1S3KH 5F7LB 3WJJC 4HS8L 3V4PH 3VFTA 3GSNA 3U0WL 4N68A 4DQOL 3I50H 3C2SA 4WU5A 4TPRH 3FHQA 1KBGH 1M7DB 4YNYB 1IAIH 4PJ9B 4JPIA 4OFKA 4MJIE 3OAZH 1U8JB 4ZUVA 5T33L 3TCLB 1CR9L 4JLRA 1NCDH 2W0PA 4QKXB 3DARA 5FFLA 2DKUA 1A6WL 3KYOA 5IWLC 5D7IA 3U0TA 4CJ0A 4EIZC 2WLZA 3IFLL 5C0JA 3OX8A 3LKNB 4RMVA 5I8OL 3BP4A 3EYFA 5BS0D 4HKXB 3EYVB 4RWHA 1PJ9A 2A74A 4MB4A 4RAUB 3B9KC 3VXOA 4OZFH 1FRGH 5DHYB 2XPGA 2V7NA 2BSED 3GIVA 3D1MC 2UY7A 4G6KH 4KQ3H 4PJ5E 2X40A 3MRCA 2A1WL 4XCCL 3CSYA 1EHLH 5IK3A 4PJBE 4XCNA 4KRLB 2RCSH 3HNSH 4TSBH 1SJHB 2R8SL 3RVXD 2L7JA 2HT4C 2AEQL 1IKFL 3ARED 1MCDA 2GIYA 1D5XA 5DURB 2R56L 5D71H 3ROOA 5K9QI 4L8DA 1UH4A 1D9KA 1DDHB 1TJGL 3AM8C 3AB0C 3VFRB 5BV7C 4HAFA 4PJ8B 1AXSB 4PJDB 4JQXA 2B2XH 3MRKB 1DUYA 1LP9E 3RNQB 3S37L 1UJTA 4OBRA 3H6JA 5D1QC 2AXFB 4PGDB 4YHZH 1HHGA 4KVCL 3WFZA 1IARB 4U0QB 1CE1H 4R7NA 3OAZK 4HPOH 2ICWB 4N90E 5SX4H 1V05A 1RK1B 3ULUE 3UZVB 3CFDB 1EX0A 4IRSC 5I1JL 5F9JB 1FNAA 3IF1A 4X7TA 3MBEB 3P73B 3IJHA 4POZD 1EZVY 3LQAC 2O93L 1JGDA 3MLSL 5EIQA 4GRMA 4J4PD 1WCBB 4KV5F 5EZJB 3GKWL 3VXTB 1I1AB 4HMDA 5BVPH 2ATKB 4LARH 4XPFL 5DTFA 3DROA 4R7DA 2XZCH 3OWEA 2OI9C 2PN5A 3MGTA 4JRYA 4UDUB 2JF1A 5ALBH 3MTRA 4MNGE 3MJGX 5TQ0L 3MSPA 1ITCA 9CGTA 2YPKA 3TCXA 1I8KB 4PV9B 5CZKA 5HPOA 1LEGB 1U8KB 2IPUK 4ZPVA 3W82A 4JO2H 2E6JA 2J5LC 3SDYL 2Y6SC 4JFFA 4R6UA 3W5NA 3LEXB 1NEZG 2HT3C 2R0KH 4OT1H 5FB8B 5FKPA 2Y36H 3QCVH 4YXLL 3LOWA 5MERB 5LQBL 1CFQA 3WS6A 4PJAE 3A67L 4HUUB 2W1NA 2NY1C 4HBQA 4Q6IB 5AZEL 1S9XA 5E24E 4ODVL 1CG9B 5B38A 3I9GH 2IPTH 4TNWF 3CJJA 3E6FB 2ZG1A 4G7YH 2HT4D 3MR9B 3V6FA 4QRSA 5IHBA 3D85B 2NYYC 1XCQB 1LILA 1Q72L 4H1LG 5J12B 5I8KL 2E8ZA 1NC4B 1QRND 2CIKB 5HYQB 1H5BA 3GJFA 3C5SA 2Q6WA 4P0DA 4JKLA 4JDVA 4YDKH 4P2OC 3EZ8A 1CDUA 3SKNA 5JW4N 5L88L 1Z6JT 4B53A 1JPSL 3VXNA 3ULVD 4XP4L 2OL3B 4UV4H 2LV4A 1FVDB 5F6HJ 3TYFB 2V5RA 3VDCA 2H2PC 4Y1AD 5E6IA 4F7CB 1T04B 3BT2H 4JDZA 2VLKA 1WT5C 2ZP0T 3CH8A 3HB3C 4GW1A 1FG9C 1ULVA 3SHSA 4U31A 1N6QL 4DN3L 4LVEA 5HVHB 4G6FB 4K55A 4LIQL 4PREB 3N1PC 3RUGA 2QQLH 5F71A 5CZVL 5E2VL 4ZDHA 4ZNEE 5C0BD 1U92A 2ZOLB 1U8HA 3STLA 1MFBL 5JHDA 1MRFL 5E5RB 3WE6A 1BIIA 3V5KB 3OGOE 4Y5VC 1MRDH 3T0BA 5ERWB 3TWCL 4JDTH 4JCMA 3GSUB 3QO1B 1ZLVK 1T21B 5FUOL 5EA0L 1BECA 4M6MH 4C56B 3QIUC 3DX9A 1T03H 1XGPB 2JJTC 3I85A 4E41A 4Y88A 3FONA 4PJHB 3BW9B 3RRQA 1CL7L 3SGJC 4PS4H 1FZMB 3O11B 4QXWA 1AR2A 3TGXA 5GSRA 4L4VD 4KQ4L 5ID0A 4LAJH 3CLEL 4JKWA 5E2TH 4M5ZH 4W70A 3TN0D 4KHTL 3MXVH 4FQXD 1T22A 3H8NA 3SDCB 1GHFH 1YQVL 4LEXH 1PLGH 5IBTH 3ARXA 4OZ4A 4BSVA 3VXQA 1N3NA 4X6BB 3PGCB 2JJSC 1JNNH 5C0FB 3GHBH 4P3DB 5JORA 4K7PX 4M1DH 3AAZA 4HUWB 5A16A 5EDXA 4WRLA 2F19H 5GGTL 1HQ4B 4X5XA 1QEWB 5IMLB 3KPOA 1A47A 3H42H 5EBMB 2VXSH 4YJZL 1QKZL 3JV6B 5I2IA 5D7JA 2BVUA 5AWNL 4D9QD 3C09C 4NFDA 5DJYB 4P2OD 5DD1L 5C08B 15C8H 1A14H 4MXWL 3OXSA 5C86A 5EO9B 4YGVB 3KG5A 4HKJB 4O2CA 1KXTB 12E8L 1OD7A 3ZZ1A 4MDIB 2ESVB 2D31B 1INQB 2R29L 2DQFA 1KLFA 2H2PD 3KPSA 4LCWA 4N8VG 2GUOB 4LK4A 4YPJA 5D8JL 2WIIB 2YA1A 5FYJL 1NPUA 3QDJB 3NZ8B 2MCG1 1GOHA 4JY4A 2QR0B 5C0RH 4RMTA 4LSTL 3PL6D 3O9WA 1IC4L 5DC9B 3MGAA 4A6YL 5I1GL 2HN7A 3WXWL 1PVHA 3BPNC 1BX2B 2D0HA 1TENA 4DK3A 4OGYL 3KYAA 1MI5A 2DQUH 1I3VA 5SV3A 5KS9F 3G5ZA 5TF1H 1X5ZA 1ADQH 4KJWC 2QQNH 3SEPA 3S35X 4PJ7F 3VDBA 3G5VB 4F2MB 1BJ1J 5IQ9B 1R24B 4P48A 4YBQD 5IMMA 4Z7UA 1FORH 1W72A 4CBPA 4YZFF 3MMEB 4Q9QH 4GMTH 1CBVL 4IHOA 5LVEA 2PTUA 4FXLA 1MWAH 4H0HB 5DMYA 4X8JB 2EYTB 4UNUA 5FYKD 3LPWA 1RUAH 3ES6B 3RA7H 3ZTNL 3JV0A 1KIQA 4Y19D 4F37F 3HE6D 1IE5A 5D5MF 3RU8H 2WBJB 3NCCB 2ATPA 3G5YA 3MRBB 3WNKA 4U7SA 4YDIL 3W0WA 1MCEA 4X9IA 4N5ED 3TEUA 3C60B 4NN7C 3GJEB 4L3CB 3QWRD 1U3YA 1K9TA 3FT3B 3CVHB 2XQBL 3CGTA 2VQTA 5GZND 5IEKB 2XZQL 4XZUA 1WV7T 2BSSA 2L0DA 3FQXB 2OLDA 4NKMB 1D5BB 1Y18A 4PTTB 1BEYL 2XG4A 3ZKND 5IQ7H 3VFSB 1II4E 2Q76A 4K8RH 2IBZY 2IMNA 1G1CA 4NZUH 5JPNB 2COQA 4LCUA 1T0MB 5C0GB 3KLAB 4XC1H 2BHZA 1NCBL 1E4KA 2XTJE 3HMXA 3MJ6A 3T2NL 4LVNB 1S9YB 1S7XA 5SWZA 4OGAD 4HK0B 4XVTH 5D6DC 2UV3A 1KJ2L 4TNWK 5K9OA 3O8XC 3UTOA 2Q3ZA 5HYJD 4GRLC 1F3DH 3BSZH 4JFOB 1S7QB 1PKQE 2HJLB 1IQDB 3MLUL 1NCCL 4Y5YA 3LKSA 1D3CA 4PRDA 4EUPA 3S9DB 4HUXB 1IM3B 1KUMA 3PWPB 2DQIL 3GMOA 3C9NB 1QR1B 5ETUB 4LHUD 3O4OC 4KJWD 3BYTA 1YEHL 4KTEH 2YKLL 5D1ZA 4PBWD 3VFTB 4LSVH 3GSNB 4IJ3B 4NO0D 4H8WH 2A77L 3D0LA 1KYOK 4WU5B 5KTEL 4KI5E 5DZOA 5GZOC 2GK0A 4MQXD 2W91A 1BD2D 4JPIB 4KRNA 4WJ5A 2ZUTA 4PJEE 5CZXD 2KDGA 3G6JA 3KJ6H 4ZQKB 2YK1L 2FJGA 1T1ZA 4JLRB 1LO0L 2BNRE 5I1DA 3GSWA 5AD0A 5EUOB 5F9WB 3U0TB 4DGVL 3OX8B 5C0JB 3BP4B 3DRTB 4OQ1A 3GNMH 2Q86A 2DLFL 2JIXD 4F7MA 4ZFGH 3PWJA 5C7XH 2XPGB 2V7NB 3GIVB 2JE8A 3VRLF 3QZWB 3BGMA 1YYLL 3MRCB 3O4LD 4PJIA 3RY4A 1H3PH 1K3IA 2IF7A 4L1HA 3QQ4A 4FXKA 4P99A 4CVWA 4D9RE 5T5FH 3QCTL 5JNYA 2H1PL 3DYMA 1J8HB 4WFFD 3JWOC 1CVRA 1AO7D 2FGZA 1F45A 3P9LB 3UC0H 3TA3C 5CS7A 3M17A 3V5HA 1NMBH 1D5XB 4HKZB 3OAYK 4MNGB 1U58A 1YPZF 4L8DB 4NKIH 4D9LH 3SE9L 3VH8B 2ADJB 1HQRA 1T20A 4QNPF 1RZFL 2WLYA 3DMMA 2DLIA 4NZDA 3VWKA 1DUYB 1NAML 4KDWA 5KVFH 4P2QA 5A2IH 1B0GA 4YC2C 1F2QA 3V2AR 3ULVF 3H9SA 5D6CA 1RPQA 4R7NB 4MJID 3KYNA 4P46A 4PJDF 5DUPH 4KXZH 3UEZA 1P4LA 3SE3A 3O2DH 3OZ9H 5HHOD 4ZSOE 4PGEA 5ILTH 4U1GC 4XC3H 4ZUTB 2XWJA 5I75C 5JXAH 3IF1B 4ZAKB 3IJHB 5EC1A 3LN5A 1JGDB 2MJWA 1FNSH 3IFOA 5KANG 3S3SA 4C83A 4P4KD 3MRHA 4Y5XC 2JB6A 2UWEB 3D9AH 1TPXC 1CLZL 4LIQE 5DTFB 3DROB 4JANA 4R7DB 4RGNB 3MGTB 4JRYB 4HF5H 5DJCB 5CCKH 3IYLW 1J1XL 1ZAGA 1SYSB 1ZWIA 4YR6A 1HKFA 1U9KA 2YPKB 3LV3A 1A6UH 5IB5A 1NBVL 2MSPA 2ARWA 3PP4L 4ZPVB 5L0QC 1G9MC 1NGQL 3SDDA 1PW3A 1Q94B 1YEIH 4DJMA 4JFFB 1C12A 4QO1A 5FKPB 4GAGL 1FAKT 3SQBA 1CFQB 2VH5L 3ARGD 4X6FA 4Z78A 2X70B 4WWKA 4ELMB 4AEIH 2VZTA 2J88L 2ERJB 1BJ8A 3NPZB 1MJ8H 3B4NA 3HPJA 5ESAA 4XNMB 1S9XB 5D1XC 3IRZA 3T65A 2H32A 1KCSL 2J4WH 1I7ZA 2I25N 3JWDH 1G7IB 1TQCC 3WV0A 3D3VB 3HE7D 3ULUD 3CCHB 2I27N 4K2UH 5L9DH 3V6FB 4YXHL 3BZ4A 2R2CA 3SGKA 4WEBH 1MFNA 1MUJA 4DEPC 4G8EB 2VDNL 4Y16D 2FB4L 4FQIL 2APWA 1PG7X 4F7EB 4PRID 2K3TA 1H5BB 3VGFA 4XBEL 4F7TA 1ND0A 5D2NC 2Q6WB 2HH0H 1CGXA 5B21A 4NO2A 1T89A 3HNTL 1I3GH 3O45B 3QEUB 5CJ8A 3SJVE 3GDBA 3V4UH 1BFVL 1K5NA 4HXBH 3P11L 2ADGA 5BCAA 4U6TA 1DBJL 2VDML 2XT1B 4HXAH 1P9MC 2H6PA 2O5XH 3KXFB 4OAWA 4D0DB 4NN6B 4WI7A 1EVTC 1WF5A 3F12A 3UZQA 4JDZB 2VLKB 2NW2A 5ICYA 4ZXBC 3O81A 2CK0L 3FO9A 4TN9A 5D70H 1U3HA 3O3DA 2R4SL 1NCWL 1ZT4A 2W0FA 5AEAA 3CFEB 3BPOC 1GC1L 1NCTA 2VAAB 3RUGB 4M8QA 5DFTA 3AS0A 4MVBC 1EEZB 5DFWH 5BO1L 1U8HB 5JHDB 2LTQC 5KSAD 2OYPA 3TVMD 1BIIB 4HEPG 1OAYL 4HPYL 3D39B 4Q9BA 3NIDE 5GRJL 5IESH 1I9IL 4BQCA 2J8UA 3DX9B 3DURA 1LO2H 4E41B 4WV1C 3FONB 2BDNL 7FABH 3L3DB 4YE4L 5I9QC 2QEJA 3B9DA 4K7PH 2CKBL 4OCXL 5FA3A 5ESVB 5ID0B 1K4CA 4GLRH 4DN4L 1G0DA 3TIDA 3ZYIA 3MJ7A 5HVGB 2ZCLL 1R3LA 1FO0L 2AEIT 4X4YA 4J3OC 4L1DA 5DZNA 1Q9KA 2CUIA 4APQA 4BSVB 3THMH 3VXQB 3JVGA 3GSXA 4I3RH 1N3NB 3OG4B 2VIRB 1T5XB 5I1AB 5F6IB 4KKLD 1UH3A 2RAMA 1YEFH 4M7LT 2ADIA 2WANA 4NQDD 3PIQA 5GIRB 1G6RA 1OP3H 5A16B 1J05A 3ULVH 3RWCA 1FVEA 3KPOB 1QFWM 4Z18A 3HFMH 1WEJL 4FTVE 1TTGA 1RIUH 2IBZX 4L3EE 3T0WA 1A6VL 5ECJE 3TF7C 1VFOA 3BISA 2V9TA 2OK0L 2F9BT 3PGFL 2CUHA 3TLRA 2HKFH 3EYQC 4X6EA 5IJVB 4O2CB 2VLJA 1UJ3B 5F1OB 4OIBA 2A6IB 4MXVE 1ZLSL 4JM2F 1D6EB 2DQFB 4GQ9L 3VE0A 3KPSB 3ESUF 4NQVB 3STBA 1MF2L 1X4XA 1NMCB 1A0QL 1SMOA 2LQRA 5GGVL 1A6TA 4LEOA 1FQ9C 2A83A 4ZXBD 1F4YH 1E4XI 1HNFA 2HP4A 1U8NA 4JY4B 2F5AH 4JO3L 3BZEB 3O9WB 4RGMC 4LF3B 2RBLA 1ZMYA 1WBZA 2HN7B 2NY5L 5E5UB 3MOAL 1OP5K 1NUFA 2Y72A 3V6ZB 4XMLH 3MRIA 2YUWA 4MLSA 3RVVC 5EO0A 1KCVH 3QUXC 1I9RH 1MI5B 5ITBH 1JGVL 1MFDH 4H5SB 4LLDA 2P5WA 4FZEH 1IKNC 3ALXA 3G5ZB 3MACL 3QFJA 4KY1L 4KROB 1NKOA 4AEFA 5HPMA 3PGDA 3STZA 5HSFA 2VXUL 4D94A 1FL3A 4JHWH 3UTZB 3TBTA 4TTDC 4OFDA 1ZANL 4S0SD 3SCMB 3ZYZA 3MXWH 4EKXA 4BQ9A 4JG0L 4C4KO 1EH9A 1Q9OA 1BVLA 5TH2B 4DGIH 1NQBA 3MOQA 1QFWL 3UCRA 2XTJB 1OAQL 3NIGE 4DOHB 1H8OA 1YDPB 3QUKA 5E6YA 5IW1B 1IGML 1WWAX 5H2BA 5L8KB 1FNGA 1L7TL 4YHPA 3MNVA 4PJGE 1PKQB 1K6QH 1CICA 2A6JA 2P8PB 2YZ8A 3IFPA 3SDXA 4GAJL 5D72L 4WUUD 3W0WB 2BCKA 4RBPK 1MEXH 5E1AA 3C2AH 1JWUB 3F7VA 3EO1A 3B3IA 4WGVB 3V4VH 3RZCA 1A7RL 1UZ6F 4L8SA 4QRPA 5IMKA 3DI2B 3MV7E 5HTSA 1IEHA 5IV2A 5EU6E 4XZUB 5ENWB 2BSSB 4WGWB 2VLRD 4NZRH 2UVEA 3LKQA 1Y18B 4LVOB 3E8UH 5K9QG 2Q76B 1P1ZA 3EJYC 4NT6A 2GCYA 2R2HA 4LCUB 5DQJA 4Z0BL 4BK5A 4XMPH 3P4MA 1SEBB 3QPQD 2EDBA 2BNRB 3T0XA 4PR5A 2EZ0C 2XRAH 5SWZB 2VL5A 2X7LA 2ZJSH 2GJ6A 4HJ0C 2I60H 43CAB 5DJXA 2AJVL 4HUVB 3U1SH 4NNPL 1NGYA 3MUZ1 4Y5YB 3LKSB 1ES0A 1I8MB 1JNLH 4EUPB 5DEFA 4OM0H 3ZYJA 4RX4A 1JZ7A 1C8PA 3CVIL 3GMOB 3QULA 1HE7A 4Z7WB 4Q9CA 3QEGH 3TO2A 1YQ2A 2YXMA 5EU3A 3M07A 5CEZL 1WFOA 1RMFH 2X4PA 1OPGH 3W9EA 3S34L 2Y4SA 2EH7H 1AJ7L 2NNAB 4PJBF 3EO9H 2B5IB 2NR6C 4WJ5B 1PEWA 4LLQB 1BAFH 3UTPD 1QUNA 1IC5L 3G6JB 4PYGA 2PCPB 2F58L 2EYRA 2FJGB 1TETL 3IS0X 1T1ZB 4MAUL 3EJJX 4PPTA 3SO3C 3GSWB 2VQUA 5AD0B 4KJQC 4EI5A 4LASL 5A3IC 2F5BH 2IAND 5A40E 5INCA 1X44A 3MRPA 4FQ1L 1JK8A 1CFNA 2Q86B 1XR9A 2DIAA 4JFXA 3UTTA 1VENA 3X3FH 4EDWH 1YC8A 2RFXA 2ORBL 3QUYA 5FIEA 4ODHH 5EOCL 2UZYB 4JKMA 3BGMB 1TVHB 4PJIB 5D93C 4PLJC 4KHXH 4E0RA 2BY0A 5DR5L 5BZWB 3L3HB 4YDJA 5JNYB 4K23H 4XBPB 3ULUF 5BVJA 5JMOC 2P49B 5FO8A 4X7DC 4B41A 3C8HA 3KDMB 5GJTL 4K94L 3VD3A 3SBWA 2P47B 1FC2D 5JXED 2B4CH 4P9HH 2JKXA 3EJYD 1LNUA 3K4ZA 1YMMA 4YAQA 5BRZA 4U6VL 2E7LC 1T20B 4MD4B 5JHLH 3VWKB 1IGTA 5EWIH 5EUKA 1VKXA 5D96B 3BP5B 2G5BA 1FV1A 5B38G 4M5YH 2DWEA 4FG6C 5EU7E 4HIEA 3RGVA 4HS6B 1AE6H 1B0GB 4LSQL 4QCIB 2B1AH 1EAPA 5D6CB 4MAYA 4P46B 3RHWK 3H9YA 4KJPC 1P4LB 4HCRH 3GI9L 4PGEB 2XWJB 4RFNC 1JUFB 1XIWC 2C1PA 2R2BA 3U79A 1WK0A 1NUNB 2HFGL 4LSSL 4O58L 5D7LA 5EC1B 3SGDI 5IGXH 5FO7A 1BQUA 3IFOB 3MCKB 4OZIE 5FYLH 3KR3H 3MRHB 4PJAF 2FEDD 2M8XA 3WIHL 5F9DC 1RZKL 1AGCA 1YYML 3RZWA 3KLDA 4M8VA 4GAYB 1JPTL 1NCNA 3OV6A 3HUJE 4LAQL 1MCLA 4K9EL 4JHBA 4D9RD 4YR6B 3GSVA 3WDJA 5EPMA 4HG4J 2X89A 3LV3B 3K74B 2UWEF 2HTLC 4DWHA 4XMKL 3WIIH 5TE6L 5IFJA 1SVZA 3SDDB 1MLBA 3HC4H 4IRZL 3RL2A 1X6NA 5A3ID 4O00A 1HI6B 4RSVA 5JOEA 1T1XB 5FDWA 4XAWH 4ELKA 1F4HA 4K07A 5ITFA 1T5WA 4LOUD 2VXQL 4X6FB 4Z78B 4WWKB 5E8NB 1NJ9A 1F6LL 1H3TA 2NZ9D 4L9LC 3HPJB 1GL4B 5ESAB 4N8PA 4WW2C 5IT2H 3S36X 3T65B 2DM2A 1BQLH 2H32B 4PLJD 1CLCA 3K4AA 5BW7C 1A4JB 1NCAH 3OKNA 1A21A 5C1MB 2V17L 4G5ZL 5CSBA 4ELMF 2PYFA 5KSUA 3VFPA 2DBJA 3BZ4B 1IAKA 4ODUB 2HTKC 4OIIH 1MUJB 4NZTL 1AFVH 2PYED 5HGBA 2P1YA 4NQEA 5C9JA 2CLVA 3R0MA 4PJ9C 1BQHA 4NO2B 4PY8I 1WAAA 1HOCA 2NX5E 1K5NB 1DBBL 4XXCC 4QT5B 5CBEB 4OGXL 4NSKA 1J86A 4KJPD 4Z7OE 1CGSL 1GZPA 5J7CC 3FFDA 4JQVC 5KVEH 1JWMA 4LCIH 3N85H 2PO6B 2VZVA 1NBZA 1J1OL 1F42A 3V5DB 5I71C 3F12B 4MQ7B 5ICYB 1NFDA 5J57B 4ZMAT 1UEMA 4X9HA 3O3DB 4P59L 1MCQA 1HHHB 4V1DB 5TDPB 2G60H 4OGZA 5DO2C 1ZT4B 2R69H 4MJ4A 4ZOEA 5I1KL 3BH8A 5TGBA 5DC4B 4M8QB 1KCRL 3V52L 5E2UH 5DEGA 5EULV 2BX5A 5T5NF 1QLRA 4P3CL 5CSGA 5D7IE 4PRAB 1ZVSA 4GS7C 2APVA 5DD3H 2NY6D 4WUKL 1CLYL 4PJ8C 2XIDA 5HYSA 3P0VL 4RMSA 3ZLQC 3SY0A 4EN3D 3WJJA 1MRCH 3MA9L 3WHXA 4RZCA 4L29A 3H0TA 5E1HB 3CX5J 3ULUH 1K4CB 2OBGA 1P6AB 4LSRL 1E28A 3TIDB 1Q38A 1E6JH 1WC7A 4AEHL 4EI6A 1VCAA 1S7WA 4R2GB 4E5XA 1QSZA 4N0CC 4MA3A 1EVUA 1R3LB 5ISZE 1JHTB 5LBSH 2EDWA 5IF0A 2X1QA 3H9HA 2DKMA 3MBEC 4PUBH 1JRHI 3GSXB 4M6OH 2VDOL 1B88A 3BGFC 2ICWJ 3LPGA 3DETD 3DPBA 5F1IA 4D2NA 4UT7H 3O2VL 2ADIB 1I1AC 2XN9A 3HMXL 4BH8A 3PWLA 2IC2A 1G6RB 5FUCC 3KHOA 3B9KA 4PRPE 3G6DH 3MRQA 5FYJD 3RWCB 5I30H 2VLMD 1TFHA 4ALAH 4EXKA 3VD5A 4NOFA 4YFLF 2YMXH 4G6MH 3ARFA 2GW5A 3I3DA 4N0YL 4WDIB 3VFUB 5TE4L 4QWWD 1J5OL 3VG0H 3B9AA 1A7PH 1RZJH 1WISA 4X0KB 3ARQA 4WWID 1FZKA 1TITA 2ITCA 2CMRH 2VLJB 5CJQL 4PB9L 5DD6A 3BIKA 1DSFL 2FX7H 4OV5A 3GBNH 1ONQA 3EO0B 1RK0A 5I15L 2QKIA 1VPOH 1HIML 2YEZB 3IRPX 3AM8A 2WQRA 1OCWL 4DUWA 1A6TB 4LEOB 1U8NB 4Q6IC 5HHQA 5T3XL 1KN2L 4X7SL 4DKEL 4PJGB 2QSCL 3Q0HA 5D1QA 1CK0L 1EBPA 4FQ2L 5KJRL 5TPWH 3U46A 5EO0B 1A7QL 4QRUB 1BBJB 1TJIL 5CP3H 1UCTA 1NH6A 4KWUA 3W11D 2NXZD 4LLDB 2P5WB 4HZLA 5DURD 4IRSA 2AEPL 4P2CG 2FRGP 3MV7B 5J12C 5E9DA 5EU6B 3BIAX 4PJ8D 1D6VH 3QFJB 5HPMB 2VNCA 3K80A 1FL3B 3NOIA 2E3VA 5CEZE 1JFQL 3TBTB 4QRTB 1FLRL 1FG2B 3QDHA 5B4MD 3KPTA 3LKOB 3GGWA 1FDLL 4EUPG 2ITDA 1OGAA 1INDH 1Q9OB 4L3ED 3B9VA 1BVLB 2BY1A 5EZOL 2YD5A 1OP9A 4N0CD 4NRYB 3Q5OA 8CGTA 3IKCA 5CUSH 3QJFB 2HFFB 1LDPL 2PR4L 3O6FA 4X9FA 1I1CA 3ZE1E 2MQ3A 3MBED 5DMGD 1NBYA 1W0WB 1HINH 2FZ3A 3QNZB 3WN5A 3WNMA 1IBGL 5HYEA 3FKUS 4GQPH 5E8DL 1I1AD 4O4YL 3DUUA 4M62L 1SQ2N 3L7FA 5HVHC 3VDAA 3WUZA 1SY6A 3EO1B 1A3LH 1KIRB 4ERSH 3QBTB 4KK6D 2MKWA 1P84J 2O5YH 5IMKB 1IM9B 1MAML 5LJYH 5E99L 4HWEH 1RZGA 3UO1L 5JDJA 1KTRL 1A4KB 4TUKL 2PXYD 3QQNA 3LKQB 4EBQH 3QDGE 4POYA 5C92A 5FM5M 5DMIH 2F53D 2H41A 4N1CA 2EXWC 1OF2A 3ZKQD 1CDYA 1HEZB 3MODH 2YA0A 4NT6B 3LQZA 3CSGA 5DQJB 2R2HB 1S5HB 5AYUL 4NWUH 4XNXL 4J8RB 1NL0H 1DLHA 3P4MB 2ICES 4YPGA 4ZUSA 4PR5B 3QXWA 1KN4L 2XV6B 2EDLA 4MHHI 3AUVA 2NY7H 3OJ2C 4KRPB 3V7MA 4KI5F 1OM3L 4QXUH 1CWVA 2XWTA 4D8PB 2WNGA 2GJ6B 4NM8H 4PJEF 2BNQE 1ZTXH 3QXDA 3TBSA 3SDCC 1MSPA 3BAEL 3HCVB 5I1CL 4H88L 5I74B 4PJFB 4X4ME 2QSTA 5DEFB 3BZDA 4HJGA 5F1SA 5HGHA 1DE4A 3QULB 1YMHB 5CHNB 1HKLL 5T3ZL 3BUYA 4FHBD 3TO2B 1KULA 3GM8A 5GGUA 5EU3B 4YUEL 1WTGT 1WT5A 5CWSB 2V5SA 1B6DA 2X4PB 1AGDB 1CI5A 4HQQH 1V7ML 2X4QA 3Q6FA 1MIEH 3GMRA 3MLRH 4JM2C 1BBDH 5F6HI 1T7XA 1YEEH 5M95B 4Z7WF 4HWBA 1K85A 4LSUL 4P9HC 2EYRB 3N1QC 2VL4A 5KW9H 3NVQA 4OFPA 1IZJA 3EOTL 2ZSWA 4EI5B 4Y5VA 4BFBD 4OCWH 3T0DA 5INCB 3ZKMC 1A7OL 1GYAA 4HT1H 1FGNH 5IMOA 1XR9B 1YN7A 5L2JA 3UTTB 3QIUA 1EO5A 5C0CA 1QBLH 4NCC1 3QEHA 4FMFA 2JJTA 2RFXB 3U4EB 1OHQA 4JFDD 4I4WB 5C2UB 4Y4HD 1AY1L 1KF9B 4JKPL 4Z6AT 3DX7A 4ODWA 2YUZA 1QACA 4FXGB 4MCZA 5JIKA 3ARUA 1JP5A 4YDJB 4HS8H 5FXCH 2DIBA 3GMLA 4DAGL 2FJFA 3U0WH 5FO8B 4DQOH 2FLRT 1EDQA 3NZHL 3INUL 3JZ7A 4G6AC 3TT3L 4NN5C 2EXWD 3T2OA 4CVXA 4LCWE 4U1JA 4C56D 3Q48A 1RUQL 4Q97A 1H9VA 1RHFA 4OZGA 3NABL 5CMAB 5DLML 4KK9D 5CJ5A 1J0JA 4NWTL 5T33H 1CR9H 4JJHA 1IGTB 4G9DB 5EUKB 3V6BR 4NYLB 2G5BB 1FV1B 1TZGL 1XF2A 4LLVA 4RIRB 1IGCL 1AD9A 3IFLH 1T0NA 4HIEB 4G8GA 3RGVB 5I8OH 5E8EA 4OZHE 2OZ4A 1MH5B 4MAYB 1UQSB 3SDCD 3MRRA 1JHLL 1IILE 3RQ3A 1RAMA 2WBJC 4WO4D 1W0VB 2Z31B 5H35A 5JPMB 4RCAA 2R2BB 4CADA 1CFTA 1JGEA 3QJHA 4MGXA 2A1WH 4XCCH 3C60C 4GXUM 5D7KD 3MJ9H 5FO7B 4Z7UE 3DBXB 2PETA 4Q74A 3Q1SL 2R8SH 1KG0A 3PQYA 5JW3L 1AGCB 3ZYOA 2AEQH 1ORSA 3TESA 1IKFH 2I9TB 4P5MB 3MRNA 4MD0A 2JCCE 5C08D 1TJGH 3RAJL 1G9NL 4JO1L 3GSVB 5DMJB 2NY2B 4JVPA 5IFJB 2ESVD 3S37H 5JIHA 1MLBB 5FK9B 4MMZC 4L4TA 2NX5B 4XVUC 1CD0A 4KVCH 5C07E 4FFZL 4LVNC 3QNYA 5FDWB 1XGTB 3QDJD 3BZFA 1O0VA 1T5WB 5DT1L 3FFCE 1JGLL 1NJ9B 2C3HA 5I1JH 1E4XL 1A2YA 1HYSC 4BUGA 5FO9B 3QSKB 4OM1L 4PB0L 2C7UA 3MLSH 3QEQA 3U0PA 3OF6D 3MLZL 1DLFL 2VZSA 4O02L 3EDKA 3GKWH 1CTOA 4UZGA 1DEEA 3OKNB 1MVUA 3A6OA 4H1LH 4XPFH 4JM4L 4HMEA 1KC5L 5I19H 4GT7A 4YH6A 1IAKB 2B7DT 1BP3B 1MCPL 3FB7A 4IJ3C 3HA0A 4HD9A 4NQEB 5C9JB 2CLVB 4L4JA 3SDYH 5IB3B 2EXYC 2PNDA 4Z7VA 5E8OA 3NCFB 1HOCB 3EDEA 1DBAL 5KVMC 1X5HA 4YXLH 1ZA6A 4NSKB 5LQBH 4QHUA 3SDAD 3NIDF 1GZPB 4GW4A 3UZEA 3FFDB 4Z7NE 2DRUA 5KSBE 1JWMB 3L95A 4OLZL 1I7TB 3VFVB 2FL5B 1NGPL 1NBZB 4OLXL 1AXTL 5AZEH 1CXFA 4NHCL 3C60D 4M02A 3I6KA 1NFDB 1QHPA 4CVZA 1N5AA 1QLEL 1T3FA 3BKYL 2HFEA 4Q0XL 1ITBB 1Q0XH 1YNLL 5D6DA 3R06A 1BWMA 1Q72H 3O8XA 5DEGB 1SHMA 4XI5C 4QXGL 3DI3B 2HJKB 5I8KH 1QLRB 1GJIA 1IEBB 1J0ZA 1UENA 4L9DA 4RGOH 5GRVK 1ZVSB 4P23D 1T2QL 5HYSB 2WV3A 4OZFA 3MROA 5F21B 4OF7A 4XVUD 4MZ3A 3SY0B 2GTWB 3BGAA 2J8HA 5L88H 1KTLA 1JPSH 1VADA 3WHXB 4RZCB 4XP4H 1KEML 1R3JA 2X2YA 1WVZA 3IETB 1E28B 1JL8A 5GS0C 4EI6B 3LD8B 1KPRA 4E5XB 3BEVB 1MJUL 4GBXD 4ISVA 5CSZA 1LK3L 5HY9B 1KCKA 2IFFL 3MRGA 3HAEB 3TO4D 2DMKA 2B39A 4MXVF 1N6QH 4ZAKC 4DN3H 1QNZL 4LIQH 2GSIA 4K3JL 5CZVH 3VFOA 4NJ9L 5E2VH 4QRRE 3MNWA 3LKPA 4FQHA 2XN9B 1MFBH 4NKOA 4ODXA 1MRFH 2DI7A 4BH8B 2DI9A 3GMMA 5IW3A 1N4XL 4P2QE 4RGNC 1ZS8A 3FAXA 3TWCH 1KB5B 2NXYD 1BREA 1UYWL 4BFIB 4YO0B 1UXSB 5FUOH 5EA0H 2D0GA 3ARFB 3OKMB 2UUDH 5CEYB 2R1XA 2C9AA 2HMID 4JFYB 3OKKB 4PY7A 1CL7H 4X6DE 5IB2A 1FZKB 3WMSA 2ITCB 2VE6A 4G80A 1WLHA 1GAFL 4KQ4H 4MXQD 3CLEH 1L0YA 3BIKB 5INDA 3TA3A 2H9GA 2FWOA 3AS2A 4KHTH 1ONQB 1WIUA 1RK0B 2QKIB 4H0IA 1UACL 3MV8A 3W9DA 1ACZA 25C8H 3NA9L 1F2XK 1YQVH 2ERJC 1G9EA 2RR3A 2X4NB 2NLJB 2R2EA 3VXSA 1NC2B 5HHQB 2FYYA 3ARZA 3E6HA 3RI5K 2G75A 1J11A 3ILQD 3DXAA 4WNQB 2L7UA 3LZFL 3NIGF 3MYZA 3LKRA 4XI5D 4NM4L 3U46B 1ERNA 2BNUB 1Z3GL 5GRYA 1CS6A 1DBKL 5GGTH 5FOJA 4RWYL 4X7CC 5JIIA 3OAUL 5HHXL 3S6CA 4QHLA 4M93C 1QKZH 2XG5A 4IRSB 2DJUA 4PJGF 1D9KD 5AWNH 4C57C 5T3ZE 5E9DB 5EBGA 3RVUC 5HVWA 2IG2L 1OB1A 1MY7A 3BEWB 1YY9C 3QDGB 5DD1H 1H5BC 3VGDA 4GW5B 3QIWB 3MZGB 4QOKA 1IQWL 1EPFA 1SJEA 1CZ8L 4MXWH 5F1NA 3RPKA 4IRJD 4KFZC 4PRPD 12E8H 1FGVL 2Q20A 5J1SC 2Z92A 2R29H 2ITDB 3GHEL 3QUML 1MIML 3RVWD 5GS0D 4Y7MA 1SM3L 1I1YA 4XX1G 4WFHE 3SPVA 1DTUA 4ZTOL 3EIFA 4PP2A 4RMQA 4PLOB 5ICZB 3O6FB 4QYOB 3SO5A 4NN6C 3U7WL 3DV6A 2DQHL 5CJBA 4LSTH 1CE6A 1IC4H 3WFCL 3NCMA 4A6YH 5J89A 5I1GH 3WXWH 3WN5B 2H3NA 4NC0B 1KLGB 2BOBB 3DUUB 1X5AA 3L7FB 4HH9A 4OGYH 1XH3A 4HGWB 3DTXA 4Z77A 1AC0A 4Z5RA 5I0DA 4XBGA 1XF5A 2R0LL 2D7MA 3K46A 5D1XA 1CIUA 4G8FA 3A6CL 4DVBA 5M7QA 4IOFD 1FNLA