4OGAC

Insulin in complex with site 1 of the human insulin receptor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin A chain
publication title Protective hinge in insulin opens to enable its receptor engagement.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone receptor/hormone/immune system
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogaC00
5EDXA 1QRNB 1R24A 5CINL 5J7CC 4DGYH 4K8RH 1WQVT 5C0FB 4MD0A 1FG2A 5EO9B 5I75C 1NGQL 3QUZA 4Y4FD 5SWZB 3GJFH 3HG1A 4JFDB 3B2VL 2Z31A 1UA6H 2VXQL 5EORH 2FEDC 2XYCA 4FQQA 4OSUL 5HVGB 3DX9A 2ADFH 3T4YA 1BBJA 2HRPL 1A7PL 4RGOH 4WWKA 4JJ5B 1Y6NR 3QPQC 4AL8L 4A6YL 1UJ3A 4R96B 4JY4B 1FPTH 2FATH 3KPRD 4MSWB 3KWWA 3T04D 3WL9B 1U2CA 1R5IB 1TDQA 1GZQB 4ZUTA 2FGZA 2FECI 1JYWA 1F3RB 1DLFL 4OZ4A 4QHLA 4OZHE 1QSFD 4HX1A 1LP9F 5JUEH 1VADA 3MRMA 1C5BH 1LGVA 1XR8A 4EBQH 5ID0A 5CBEB 4XCCL 3TPUA 5EBGA 12E8H 4ODSL 5KOMC 3ROLB 3F58H 2AK4A 3ZYZA 2DQJL 1B2WH 3PGDA 1HSAB 2YA2A 3DVGA 1EEYB 4G8FA 1U8KA 5JOFA 1YY9C 4DKAA 4JE4B 2Y72A 3BWUC 3LEXA 1C1EH 5I1HH 1U8LA 4LLMB 2BXZA 4JPKH 3O4LE 4RIRA 1SVCP 5KVDL 4G9DB 2VAAA 4K3EL 3VI3F 1DEEA 3TNNB 5JZ7D 2XQYK 5F7WC 1FNGB 3S36L 3HI6H 4XPTL 5FYKL 1AJ7L 2GAZB 2NNAA 2DRUA 4EVNA 3BH8B 4PYHA 5EU7C 1MIML 1VDGA 1UM5L 1QFUL 3L3GB 1VGKB 3OPZH 2XN9A 5IIEB 5KJRL 4KWUA 2DQGL 1LP9E 4OZFG 1ZWIA 4GKZB 4MLSA 3C6LB 4Y16B 5EBWB 4PRAA 3TBVA 4OCYH 3SKMA 4PB9H 4XMPH 1CBVL 3A6OA 4MGXA 2R69H 3NA9H 3PXJA 3BP6A 3QIWC 4AT6A 4PIRF 4KUCD 1F6AB 4ODUA 2IBZX 4MJID 5F6HI 4BZYA 4QRSA 3QG6B 3IETA 1P7HL 1F42A 4LFHG 1XFPA 4O5LL 4UU9B 1EMTL 1IKFL 1RURL 5IQ7H 3RAJH 4EI6A 3WN5B 2F53D 2FX8H 2ZKHL 5HI4D 4N0FB 1NMAH 2JJWA 3DVNA 5J3HD 4KZEH 3BD4A 1IEBA 3MRPB 4WU7B 5DS8B 5T1MB 1T1XA 1KT2A 3G5XB 4HPOH 4EDXA 4GMSH 2R1XA 4P23A 3CH1B 4XMLL 3V7MA 4GMTL 1MCSA 1DBBH 3GI9L 3SDCB 2VITB 1SQ2N 5FYJE 4OKDA 1WTLA 3VRLE 2YZ1A 1U91A 3DXAB 1FAKT 3GBNL 5D2LB 4LHUD 1AE6H 5ID1B 1A9BB 5D7LA 4NN6B 4CN6A 4LCWE 2D31A 3GSUB 3L5XL 3I6GB 1GGTA 4N0YH 2NYYC 2W38A 1S9YA 3HNTH 3MV7D 4Z7QE 3VXSD 2ARJA 3B9KA 4RFNB 2VN7A 3PP3K 3TA3B 3P11L 4F15C 2H32A 1N4XH 5ESQA 4PJ7F 1MHEA 1E6JH 5F8RC 2JCCA 1R6VA 3ARWA 3O41A 2XTLA 2QHRL 4CU8A 5E1AA 4PJFB 4WENB 3QEQB 4OZGE 4QOKD 4P3DB 3C09B 3ARGD 2AJZB 3NFNA 4Y0GA 4YHYC 1D5BB 3GBLA 4NRYA 1WIOA 5FKAB 4N0RA 3LZFL 3WFDH 4IDJH 3VA2C 5ESVB 1UACL 2PKDA 4NQXA 4YHZH 1EUUA 2F8XC 5DMJB 2HVKA 1UYWL 4X7TB 2B20A 2FLRT 4ZO9A 1MY7A 1NFDB 3MRQB 4N8VB 2X05A 5FO9A 5IW3A 1JGDB 5SV4A 4C4KT 3BPCB 5BS0E 3LN5B 5DD5H 5DJ2A 1GC1C 2CDFB 1ZKAA 5JDSB 1NKRA 3D48R 2NY1C 4NSKA 3NN8B 5I8CB 2CLVA 4PJ7E 4ZXBA 1OHQA 3ELAT 4ELKB 5A16A 1RZJL 4Y5VA 1BAFL 1QEWA 1YYLH 4JPWH 4PFEA 2NXYC 4BKLA 2O61A 1LO5B 5JIKA 2F54E 5HDBE 3WUWG 3MMEA 1TVHA 1VACA 5KG9B 1I9IH 3M1BA 4IOSD 3CVHB 3MGAA 1FIGL 3U6RB 1IMHC 3DHJA 4EJ1C 2HJKA 1KLGA 4K9EC 1MCRA 4C83B 3QNXA 2CIIB 3BFOA 3B9EA 3F62A 2YD8A 4WHYG 4F9PA 1C08A 4GAYA 1KJ3L 2NY6D 1CICD 2EE2A 4WTZG 4MB4A 3BWAA 5C09E 2HYMA 5E5RB 3FQUB 2WIIA 4JG0H 1BQHB 1NEZG 4OFIA 1QPPA 4APQD 2VOTA 2EH7H 2GSIA 5F8QC 4LSUH 5C2BL 1YEDA 3WXVL 1AXSB 2B4CC 2IQ9L 4Y4HC 4X83A 2IPUK 3FQXB 2VLRD 2QQNH 4HIJB 5GRZA 4BSVB 1P7QB 2ED7A 3A6BL 1MAMH 1MCIA 5HYFA 2NLJA 5CEZH 2H32H 1MQ8A 1EBPA 3T2QA 4HBQA 1SEQH 2FWOB 1ZEAL 4P5KB 4P2RE 2OTPA 4PPTA 4OGZA 3NFSH 1NUGA 2MJWA 4ODHH 4GLRI 1JNJA 3PV7A 5KSVA 3JV6A 3FQWB 4KY1H 4F3FB 2G9HA 1U95A 2X4NA 4PGEA 5ISZD 2APTA 1IM3A 4B53A 4HUWB 2Z91B 5A2LH 1NBYA 3BGFB 3ULVD 1LDPH 1IQDB 5DUBA 5D6DA 4PG2A 4U1HA 1GL4B 2ORBL 2Y1VA 4BFIB 5E2VL 4NN7B 4OQTH 1QKZH 2UYLB 1Z9SA 2W60A 4GAJH 4MQTB 4DN3L 5IKCB 2W65A 2ZOLA 3O9WD 4NKMA 1S9VB 5D1QA 3GMLB 4I0PC 4HXAL 3SE4A 1SM3H 4Q2ZB 4G7VL 3SY0B 4JFXA 3MFGB 4ZFOB 4DKFH 5FUZL 2FEEI 1H5BB 4H25A 2VQUA 3WIIL 4EDWL 4K23L 4NCDA 2EDXA 1F8TL 1WZKA 4Z7VA 4L29B 2LAGB 1ZVSA 4ACPA 1U93B 4IRJB 4ZUWB 3F12A 1IBGL 2BERA 3H9SB 4XNYH 2Q7YB 4HC1L 1Z0MA 3L7EA 5CAYB 4LVOB 4LSQL 2VABB 3KPSD 2NY3D 3N9GH 3QUYD 3UO1L 1DBAH 4KUZH 2SEBA 3BDXA 4XPGH 5BZWB 5E9DB 4NRZA 5CCKH 2F58H 3OGCA 3V4PH 1VFMA 2A0LC 3LKOB 5DRWB 5BRZB 2BNQD 5ELIA 3SDDC 5DD0L 3QFJE 1DR9A 4LCIL 4PJIF 4TULL 2KUTA 4X4XA 1XCQA 5F1NA 4KHXH 4OGAC 5I1DB 3NH7H 1CXLA 3RZCD 1NGWA 1FYTB 2OJEA 4ODXA 2V5SA 1T0MB 3C8KA 2K9UA 5GS2H 2CIKA 1C5CL 3CSYB 4AENB 3N85L 4ZNEE 5I1IH 4JDZB 3L3KB 1KFAH 3LCYA 3CLFH 3KPLA 4HKBB 1F3JB 2CDGA 5TF0A 2WBJD 5DZLA 1CLYL 3QNYA 3FAWA 4H8WL 2XV6B 4HGWB 1QA9B 1W72A 4NQCE 3H6JA 5J06A 3QH3B 4P4KB 5H35A 1X7QB 4TOYL 3GSOB 5B4MD 1UM4L 4MZ2A 4Z7OF 1A7NL 3AC0A 1RIUL 1ZSDB 1DLHA 4PP1C 4F33B 1HXMB 4LSPL 1CDBA 4U33A 1JHLH 4CAGA 3VXME 4GKNA 3VDCA 3CXDL 4N5EC 4FOMA 4CUCA 3K46A 2Y5EA 5KZCB 1JTPA 4FQXD 4JVPA 4JQXA 1IAII 1PKQB 4GQ9H 4K7FB 3ARDA 1G9NC 3TO2B 3MZGB 3QHZH 2VZUA 2EEBA 2HT2D 3P0YH 4UIKL 3UYPA 2VLMD 5GGRY 5HHPA 4MNQA 2NXZD 3SDAC 1AKJB 4KAQL 1MFAH 3MJ9A 3DOSA 1F00I 5DA4A 1R5WA 2UY7A 4OCWL 5BXFB 1T03H 3FOLB 3T1FA 4PGJA 3H3BC 4L4TD 1NGXB 3CD4A 4CDHA 1JGUL 4XBGA 4JPIB 1FORH 5LAXB 4X99A 4OGXH 4OKVA 1A6ZA 1P4LA 3TBYB 4P9HC 4R7NA 4WO4D 1IGJA 3QDGD 4Z7OE 3CFCH 3G08A 4U1JB 4WCYL 3SJVD 4K3JH 2EZ0D 4I18A 4JR9H 5SWSB 4UQ2A 3MRKB 3QIUB 1KELL 2YS4A 1NBQA 5ALBH 5EIIA 2P24B 4ZNCD 2KQNA 3QWOA 3FT2A 4YPGB 3OZ9L 4MQ7B 3NFPA 1GC1L 2YA0A 1JV5B 1AP2A 1NDGA 3IRZA 1KTKE 3K2MC 5DQDL 2F53A 4BFGA 3O2WH 3WFBL 1QNZH 2XKNB 4Y19B 4UMGA 3KLAA 4UTBH 1KGCD 1RPQA 1B0GB 1A6PA 1ORQA 3BEWA 4WW2B 5AEAA 5FYLE 1QOKA 5KBNC 4O2CA 5I15L 3HUJF 3L3IA 3HG1E 2WINB 4LEOA 1W0WB 2P48B 5IMLA 2YD7A 3RHWK 2DQCL 2VZTA 4HKJA 2R0LL 1BGXH 4GRWB 4W6XB 3KPPA 3WLBA 5I16B 4K9EL 3P9LA 1UXSA 4JZJA 4NWTH 3JWOH 1V3JA 3RNKB 5L8LB 1EFXB 2BNUB 3MCG1 1TIUA 5F7EH 2GJZB 5D7KE 4N0UE 1QRND 1MFDL 4NQDB 4K7PH 1IT9L 3QI9C 3W11D 3T0EE 4GG6A 3ULUE 4LSRL 5E2UH 5SWZD 5BV7H 3NCMA 2DQUH 4NJAH 3M17A 2A6IB 2EDFA 4JFDD 1IM9A 4UNVA 3R0NA 4LPVA 3E8UL 1AGDA 5CJBA 5DC9B 2B5IC 4HIHA 4Z78B 2J7LA 2R0WL 5JORB 2DMCA 5KS9F 1T7WA 1AFVH 2PO6C 4F57H 2JELL 2IANE 2X4QB 4N1EA 2QHLA 4LKXB 4TRPL 4LLYA 4DFHA 2QR0A 4WNQB 3ZSSA 3MV9A 3TBWB 3MJ7B 2AVGA 3WO4C 1CLOH 1KCVL 2W0LA 3FB7A 5EOTB 2NZ9D 3IDMB 2QQQA 4L4VA 3QA3A 5TPWH 1NUNB 2P8PB 1KSRA 4D0DB 2QSCH 3K1DA 2NY4C 4EZMA 1DL7L 1XGQA 4IBLT 1DQQA 3BEVB 4FZEH 1B0WA 5GRVL 2GK0B 3EO0B 1MFEH 3U9UB 1JPST 2L7JA 2I9LA 1OARH 2E8ZA 3ZE0E 3UYRH 2A73B 3MNVB 3BHBB 3BGMA 3IDNB 4FS0A 1OPGL 4L8CB 4I3GA 1I8MA 4AIZA 3TT1H 5C0NC 5I1EH 4I5BB 4E0RB 1WITA 1MQKH 1QP1A 4S0SD 1G7MB 4LMQI 5FUCE 5DA0B 3PWPB 5EU5A 3C6LD 4QXTB 3SKJH 4Y16D 1WT5A 3MLRL 1CDIA 3MQIA 4TNVF 4JM2C 4P5MB 1N26A 15C8L 1JF6A 5EH1A 3OJDA 4G6AC 1S8DA 4J6RL 1V3KA 3QCUH 5CJQL 3F7RA 1QLRB 3FO9A 1K4CB 5D7SL 5GRUL 1MIEH 1X4YA 3FMGH 3W39A 1NAKL 5HI5C 2EIBA 4MXQD 5L8KB 5EWIH 4NZUL 1AQKH 1URLA 4ZTOH 4MA1C 2EH8H 4Y2DA 2YPKA 1RZ8B 4GJTB 2XRAH 1KBGH 5CKGA 1OLLA 3ZYIA 5I75B 1I7RB 1ORSA 2C26A 2GJ6E 3BIBX 4OCLC 2WIMA 4JCMA 5ISZA 5D6CA 4WU5B 1XGRA 5CILH 1EGJL 3SDCD 4PJHA 1SJXA 3VJ6A 3HE6A 2JCCE 5DJ0B 3KPNB 4G9FB 3DXAD 2IFFH 2M1KA 4Q6IC 3SGJC 1G7IB 2ICCA 3QXUA 3A67H 3F7YB 1P6AB 4PJDB 2R56H 2FJHB 1KB5L 2F5AH 1CU4H 4WUUB 2AJ3A 1Z9MA 4O51A 2Y9RT 4XP9H 5C0CA 4DZ8A 3L3OB 1FLRL 1G9NL 3TA3D 3WJLA 4Z7WB 5I8KH 3CVIL 2AGJH 5E8PB 1UEYA 5DSCB 1EXUA 3HMXA 1HIML 2XA8H 5DJCA 5C0GA 1ZHLB 5JOEA 3IFNL 2XXMB 3I6LE 1TCMA 2VL4A 3Q3GB 3QEQD 5SX5K 3QUYA 4QLRA 3DYPA 2G75B 1VCAA 4BSWA 5E2WH 3FT4B 4OT1L 2HLFD 4F7TB 4M6OH 1JHKL 1JJUA 1UWXK 1TJGH 5KSAA 3JZ7A 4MMZC 3FN9A 2BCKA 2XZAH 1B90A 1LE5A 4JFFB 3QNZB 2AJSH 5CEXB 4OZIB 4PR5B 4BYHA 5INDB 3D9AL 5CWSB 2VLKB 5D5MB 4YGVA 2EDQA 3EOTL 3EYUL 1OTUD 4YO0A 4M62L 4NQVB 4Q58C 4R26H 3RZCA 2AJYH 1A3QA 4TSBH 5IVXA 3H42L 1S5IH 2IADB 3S37H 1NUFA 4DTGL 3T4AA 1YPZA 5H2BB 5IFHH 3GI8H 3C6SA 2P7TB 4QKXB 4L9DA 5JPNB 4JKPH 1RMFL 3OWEA 3OF6A 1EUTA 2UUDK 5FCUL 4JY6A 3T65B 2R8SH 5FXCH 1DQLL 2AQ1A 4AH2B 2W91A 1Y6MR 5TH2A 3K74B 2HAZA 4NQSB 2NY5L 4Y5XC 5DRZB 2M2DA 3G5VA 3R0MA 1QR1B 5CD5D 4JAMA 4XVSH 1J11A 1SJEB 3EGSB 5CJXC 4YEFA 4KMTH 2OTUB 2ILLA 1KG0B 3BPOC 3VGBA 1TNMA 2WP3T 1FJ1B 5DYOA 5CJ5A 4YAQA 5IB4B 4DGIL 3V6OC 3MOBH 2VUOA 3SGEI 4S1RL 5E8OB 3N1MC 5DJZB 2A83A 2EYRA 3INUH 3KS0J 2N7BA 4IIQB 2BVPA 2X10A 3D1MC 1KCLA 5EUKA 2H45A 4KJWD 4YUEL 5J57B 2IG2L 4OFYA 2QBWA 1M05A 3QO1A 3TJHD 1TCRA 1RU9L 3ZKNC 3OKDA 1I1AB 5FFLA 5EB9A 4IEFB 3L5WB 5MEPA 3VXOA 1KCRH 4PJ5B 4G43B 2R0KH 3RWEA 2Y36H 2O5XH 3ZDYF 4X98A 3K3QA 3TJEH 2VDPH 3LN4B 1JPGB 3TLRA 4G6MH 4M48H 2CR3A 3CFEA 5GS1A 2VXSL 1NBVL 5C08A 3SE8H 2HH0H 1VSCA 4MCYB 4GT7A 4OCXL 1INQB 5EU4B 3VA6A 2XKUA 1NQBA 1IGIL 1P7QD 3LSOB 1KYOJ 5DJDA 2BRQA 2RIKA 2YOCA 5HDQH 3HMXH 3LDBC 4UQ3A 4XPBL 4F15B 2VQ1A 1DJSA 4NKIH 5BOZG 4F80A 5TDOA 3VG9C 2ZG1A 1Q1JL 2V7NB 3MBXH 2ZPKL 2DQHH 1AR1D 1MNUL 4YZFF 1OAQH 2J8UF 1PX4A 4LU5L 2Q76B 5HDLA 1RZFH 1CGYA 4YHYB 2G2RB 35C8H 1HOCA 2E7CA 3EO1B 1O7SA 2HKFL 3RWGA 1G6RL 4H26B 3MACH 3DO7A 1J1PH 4X4YB 3MNWA 3E0GA 3GNMH 3K8MA 5E8DL 5T3XL 5IR1A 2Z8VC 3H9HB 2AXGA 2D0FA 3WNMA 4DUWA 3ZDYE 4R7DA 4NRXA 1AD9A 2OSLB 4RDQG 5DRNA 2BHZA 2UWEF 4H0IA 4YFLI 2DJSA 5EO1B 5B39G 3LS5H 4RA3A 4WI9A 1OP3H 4KRPC 3U0PB 3QG7L 1ITCA 4YXLL 1DTUA 4WRLA 5H8DA 3RA7L 2NY1B 5EBLA 1NAMB 4ZS7H 5IVNA 3UP1A 3GSNB 4IRJD 3KPRE 3RP1A 2O5YH 3BO8B 1KIRA 3I3BA 3H9SD 1KCSH 5F7DB 1OT1A 2NXYB 3WKML 4R4ND 3DBXB 5D1XA 2L4OA 5TE6H 5F97E 1QSFE 3VFUB 1CD1A 5JHLH 2EEAA 4HIEA 2P4AB 3W9DA 3UTZB 1RFDH 5AD0B 2LU7A 4JFYB 4B5EA 2GTWA 3FO1B 5L2JB 4LLAA 1SY6L 3X13B 5T5NG 3WS3B 5HD8C 1HI6B 2FB4L 5HHNA 5BRZD 5C3TA 4HK0B 4XH2B 2MPAL 4JFOB 3GBML 1OGAB 1J12A 1Z3GH 4Y5YA 1BWWA 5CGMA 2ZUUA 3V52L 1UXWB 1YNLH 1A4JB 2VDOL 3VFTB 4QRRA 4Z76A 3MUGA 4GAGL 1FCGA 1P2CA 4LNRB 2NX5A 4K3GA 2R39A 1FYTD 1RIVL 5GGVH 1XIWA 1KLFA 2ENSA 5ANMB 5ICZA 1QHOA 3PXHA 4QHKI 2VSDA 4H88H 5CIPA 1CG9B 1EHLH 5B38G 5E8NA 4I0KA 5F89B 5IEHB 3GKZA 3QEUA 4AEIH 5EZJB 3RGHA 5BZDA 1HHKB 1GIGL 3K80A 4PJEA 4P4KD 2X4UB 3TESA 3RNQB 4WV1C 1N59B 1T2XA 1YJDC 2ZG3A 2H1PL 2H2SD 1H3WM 2HKHL 5EC2A 2VZOA 5E2TL 1NCDL 4FP8H 4O2FB 4QEGA 3VXRA 3QR2A 1BFOA 5GS0L 4CADB 4P5TB 3B4NA 1UH4A 4NP4L 3MOAH 4UINH 3RVTD 1HH6A 4ODVH 2DQTH 4MJIE 5KZCD 2FLBT 4NZDA 4X6CB 1K8IB 5E6IA 3M8OH 3RL2A 4K3DH 4K8RC 1KXVC 1N8ZA 3STZA 2I9TB 4PJIA 3RDTC 4RFEA 1K6QL 4RAVB 3UTTA 3EJZC 4I4WB 4RMVA 2DQEH 5FM5O 2V2XB 3OMZA 5A2FA 4TVPD 3FOMB 1VGKA 4H1LA 2VKXA 1AKJD 3QUMA 4LHJB 4OZFA 2F53E 4YPJA 3NIFF 3W9EA 4LASL 1LO2H 2OL3H 3PQYB 5TE4H 5I76B 3OJ2C 3HC3H 1P7KB 5TDPA 4U0RB 2Y5TB 3TVMC 3EYOB 5JNYA 5A1AA 1DN0B 5DI8B 2VC2L 3MCKA 4KI1A 3DI3B 1J5OL 1KJ2A 2PN5A 4FXKB 5SWSD 3ZHLA 3DUHA 3TN0C 1Z0NA 1YECL 3QIUD 1K3ZA 5DHVH 2JJTA 3QSKB 4V2CB 3MLSH 5AZEL 5IQ9A 1EO7A 5L0QC 1KIPB 1BVLB 3DSFL 3AAZA 3HZYA 1DDHB 1MHHB 2ZOKA 3MV7E 3K0WA 4WHTA 2YC1B 3RL1B 1MCJA 3SCMC 1I9RL 3VXSE 1CFNA 4ZFZA 4Y19D 3WIFA 1FBIH 5JHDB 4IOIA 3GMMB 3K2UL 4KTEL 1FZMB 2APVA 4HWNA 1OAYH 5F7MC 3D18A 1VESA 5HHMB 1RUKL 2EDYA 1MJ7H 3UYOD 1JNNL 4EXKA 5KTEL 5D2LA 4HFUH 1XH3A 4QOKE 4HCRL 3FRPG 4P57B 4KU1A 5CIPH 2F8OA 5HI3D 4J3VA 3O11B 1OP5H 4DVRH 4ZFFA 3BKJH 3VRJA 1LO4L 2OZ4L 2PR4H 1S7VB 1CCZA 4RISL 1I3RA 2VLJB 2EIZA 1EFXD 5HGDA 1TETL 5D7IF 1CE1L 4NWUH 2DMBA 3JV5A 4KI5D 1NFKA 4JFQA 1YMMA 2CJUH 6CGTA 4NC1E 5GQBA 1QSVA 1G84A 1FP5A 3FTGA 3NZ8A 2AJUL 1HKFA 3ROOB 4PGDB 5IT2H 1JGVH 4KVNH 3V5HA 4OTXH 3HZKA 2D7TL 4X6DE 1MAJA 3DX6A 5IB5A 3S3PA 5I66B 2C1OA 2Z31C 1OWRM 2XKSA 3IS0X 5I18L 3QUMH 4OZFH 3BKMH 4ODBD 3VW3H 1I8KB 3SDAB 2DTMH 5CD3B 5LGJA 5EU3A 4WWKC 4NFDA 5L9DL 2R1WB 4FFYH 2GY7B 4JEGB 2EDLA 4G80B 3L5HA 1IGMH 4U1LB 1U92A 3N1PC 3QCTH 4XVTL 3CX5J 2A6KA 1RK0A 3VFRA 4X6FA 2EKJA 2YBRA 2D3VA 5HGBB 4QRTB 2ATPB 4JO3H 3CAFA 4J1UA 1YEGL 3WUWA 2Q6WB 1CGWA 2VLRE 3PDOA 4QRPB 2BY2A 2C3VB 3LV3B 3T2NH 3DUUB 5KS9A 2WNGA 4D9RD 1JWSA 3QJHA 4PTUB 2D7QA 4NM4L 4YHIB 1BEYH 4XI5C 4WTZA 1HK6A 1U41A 4Q0XL 1FO0A 1KB9J 1DFBL 1HQ4A 2BC4B 2FHBA 3PWPD 1NEZA 1K3IA 1ZOXA 4HXBL 4PJCA 1A21A 5D72L 1XF3A 5LCVH 1DVFC 1KEMH 1XZ0B 4QHMA 4X80H 5ISZE 3SDXF 5K9QG 1AXSA 2LAAA 4Q9BA 2F5BH 3KPMB 4IRZH 4FQHB 1V7NL 4U05A 4PJHE 4TSCH 4HUVB 2H6PA 2VH5H 4ETQA 3ULVE 2JTDA 5CJ8A 4RFOH 3ZKMC 5MENB 2JIXB 4AQOA 1KXQE 2VAJA 3CMGA 3HB3D 4HQQH 5ADPH 5DJXB 1KJMB 1K5NB 4G7YH 3WDHA 1T7XA 1MHCA 3I50H 1MFCL 3HAEB 3QI9B 4TUKH 4EUPB 4TTGA 5LBSH 3QJFA 4P2OC 3SOBL 2PW2B 3IXTA 3E3QE 4G3YH 1MFBL 2KBGA 4C56B 3UC0H 5E94A 5I1KL 1KOAA 1OD9A 4KQ4L 1WCBA 5E4EC 4NJ9L 3SBWA 4FNLH 3IT8D 3MODL 4HWEL 2PO6B 3CCHA 1YJDL 4L3CB 5CHNB 1MCOH 2I07A 3IJHB 4G9FD 2FO4B 2ITCB 3I75B 3QWQB 3KPSE 3DTXB 4XAWL 2PF6A 2Y07L 3VG0H 1SJVA 3MGTB 4NNPH 3SDXE 3WO4B 3N1QC 2R4RH 4CU7A 4P23C 4MCZB 2GFBB 3QXDB 4RGMC 2XFXA 1IAOA 2YPLB 2VR5A 2R29H 2IH1A 1UC6A 4WUUD 2AEPH 2BNQE 2WW8A 2E7LA 2AXFB 4JG1H 2W59A 3STLB 2EDTA 1OSZA 2NY4B 4PRIB 2UZYB 2YKLL 1AHWA 3H7BA 1B4JH 4QXGH 2IBZY 1CLCA 2FO1A 3MRIB 2ADFL 2R2EA 5JW4R 4PS4L 1SEBB 3R8QA 4OF8A 4TNVK 2G60H 3RPIB 1JUFB 3KJ6H 4HS3B 2OK0L 2ERJC 1W0VB 1QSZA 5BRZA 4WHYH 3C9NB 4FQ1L 4JFFD 4LPTA 1ULVA 4UOW1 2P8MA 5FAAA 4YBHA 2CDEA 5JUEL 3Q6FA 5TGBA 3WUZA 4UB0H 1FO0H 3L6FB 1A3RH 1C5BL 2VLKD 4BH8B 1T5XA 4X6BA 1S7SA 4JPVL 3GK8H 12E8L 5FGCE 1W8NA 5HJ3A 1B2WL 4ISVB 4CJ0A 4KHTH 1P84J 1R3KB 3GDBA 2ATKB 4JLRB 4JM2B 5F96H 1BFVH 1DE4B 3U0TB 3AREA 5ALCL 1EJ6A 4YHKL 4U6TA 5I1HL 3ZMRA 4PJBA 1WAAA 4M7JH 5I8EA 1GGYA 1PSKL 2VLME 1J05B 3RWDA 4RWYL 4ZUVB 1UB5B 4HS6B 2GTZB 2JJUA 3RGVB 1HDMA 2AKRB 4FQLL 1PY4A 2VZ1A 1MREH 1Q9KB 4HKXB 4A6YA 1CIUA 1JWMA 4YDJA 3HI6L 3KLSA 4U7MA 4MA1B 2V2WA 4ZXBC 1MOEA 4H5SA 4Y5VC 4L4TE 2RCSL 5E8EB 3VXNA 2MMXA 1YEIL 4MAYB 4GSDH 4CW1A 1E28B 3JTSB 3QDGE 3D25A 3LMJH 1BLNB 3SJVE 3BVNA 4ZOBA 1TVBA 3VFNA 5FB8A 4ZPTB 2GSGA 2RB8A 4PB9L 4GW1B 4OD3L 1UKSA 4XMPL 4CVZB 3T0DA 4D0CA 2AW2A 2MSPA 1YEKH 3NA9L 1I1AD 3C5SB 3BP5A 3MGOB 4DW2L 1Q8MA 2AJVH 4PJ5D 1CT8B 3KXFA 2EO9A 2VYRE 5GHWH 1S7QA 1XGUA 5D2NA 1NC4A 1AGFB 1I9JH 1NJ9A 3IDJB 5T3ZE 4GRLB 1FVCB 2W0PA 3QDMA 3DURB 4LLUB 1KGCE 1BZ7A 1B3JA 1ZXQA 2NYYD 3U2SA 1AD0A 5IQ7L 3RWHB 3I02A 3GSRA 1F5WA 3VH8G 4FN0A 2F74B 1QRKA 3BN3B 1ONQA 2FX8L 4LNVA 4ALAH 2VIRA 2X4OB 3IFPB 3EJJX 3EZJB 1DUYA 4KC3B 4S1SH 2JKXA 1LEKA 3QIBA 5EU6A 1T0NA 3C5ZA 3P9MB 3TBTB 5E5MB 4GMSL 1YY8B 3P77B 4L5FH 4LF3B 2OCFD 5HPMA 5EUOF 2VE6A 1MLBA 4GS7C 1KN2H 4NO5A 2NR6C 3PWUB 5HYIA 2J4WL 3TV3H 3ZZ1A 4F58H 5ILTH 4MVBC 1UKQA 4O2EB 2DWEA 4M6MH 2OLDA 4PB0L 2H26A 4FTVB 1QRNE 2F9BT 3LEYL 1KXTB 3UMTA 4UIMB 2XQBL 3G6DH 1CE6B 3GMQB 3O4OC 5J6HA 5FDWA 3RKPA 3BPNC 5SWZE 3E6HA 3NMEA 5CINH 3KYAA 2KPNA 4GXUN 5IHLB 4X8XA 3MRBB 4GG8A 1YC8A 4ZAKC 5D6DC 2BVOA 4PG2C 1NGQH 3L9RB 5AUMB 1BIIB 2NY1D 1GGBH 2EYTA 3P4NA 1WISA 5D1QC 2XG4A 4OSUH 4W81A 2FIKA 2HRPH 2NX5E 1U8MA 4AL8H 4A6YH 2NXYD 4Y5XB 3JUYA 1TJIL 4HULB 3BDBA 3WFDL 5L2KB 5KANI 4I3SL 4A2LA 4NCC2 1B4RA 2BVQB 1F4XH 5K93A 3MROB 2A6DA 2I24N 1OGAD 1AGBA 3MLPA 2X1PA 3QUXA 3BIKA 1HHGA 1UWEH 2DQJH 1FL6A 3KYNA 4JFEB 4NZRL 1Q94A 5DD5L 2VDKL 4HMCA 2WQRA 3OKOA 3VFOA 2UWEA 4WDIA 3RX8A 3MFFA 5ESAA 1U8NB 1X44A 2D7OA 5KVDH 4R8WH 4PYGA 2DQDL 2X4TB 1YYLL 4ELMA 2BNRB 3KHOA 1DANU 4K3EH 1RV6X 4LP4A 2QKIB 4DVBB 1FGVH 3GMOA 1NGYB 3QHFL 5FYKH 2JB6A 1AJ7H 4O02H 2ICWI 4LBEA 5FA3B 1I9IL 3JBG7 1QFUH 3GO1H 2W9EL 3PE9A 3PWJA 1DQJA 5KJRH 2N56A 4P5TD 1UZ6F 4LAQL 4UI2A 3JWOC 4RAUA 3OAZK 3RBSA 1A6WL 1WTGT 1CBVH 2B1HL 2VKWA 3RU8H 4I77L 4JG0L 5FA4A 4I48B 3B3IB 5FYKU 5C0IA 2H3NA 1RQ5A 3ZE1F 1EO8L 4LSUL 4AMKL 2HN7A 1R3HA 5BV7C 1X6NA 1JCKA 2QQNL 3LPGA 3FONA 2OX5A 1OTTC 4I0PD 4O5LH 1MAML 4U1MA 3PQYD 3BX7C 4PJFF 2AP2A 1IKFH 4JQXC 1RURH 1PQZB 3VWKA 1JE6A 3MRDB 4U1GC 1SEQL 1JBJA 4KRPB 3TIDA 1D5MB 3V7AG 3O2DH 3DWTA 3EW3B 3NFSL 5I73C 4X5WB 3F6IA 2ESVA 4D0BA 4FQ2H 3FQNB 5DJ8A 5D2LE 5IB2A 2PCPB 3GI9H 2YXMA 3BZ4B 2RAMA 4MAUH 1FN4A 4XWGH 2EEDA 5F9AC 3VMNA 1XF5A 1U8HB 4RCAA 4DK3A 3GBNH 1NFDF 1PZ5A 2UV3A 3JTTA 3X17A 1M7XA 4KZDH 4OQTL 5GIRA 3BQUA 4I18C 4GAJL 4POYA 5JOPD 1M71B 3L3JA 1BOGB 1T7YA 3L5XH 1RD6A 3LRHA 4PJ9B 5JHDD 5DQ9B 1X4XA 1SM3L 1KIQA 3TIEA 4KXZI 1X5YA 4MX7B 5CP3H 2NY7L 5DHYB 1FNHA 1A6TB 3NVQA 5HHMD 4LSDA 2WZPD 3PL6A 5J12B 1T22A 5D1ZC 2WM0A 2OXHA 5DDHB 4PJFE 3V6ZA 3QO0B 4MZ3A 5D7JB 1X6LA 2DL9A 3DHMA 1IFHH 5IMKA 5C2UB 4S2SA 5JMRA 1N2RB 3T8XB 1FG9C 5K33A 1PZUB 3BZEA 1H8NA 3S5LB 4CMMA 2VLJD 1EVUA 3NABL 3X14B 3IF1B 4ZSOA 1DBAL 3D85B 4LSTH 4PGBA 3UTSB 5IEKA 1UACH 1NFDE 1U8JB 4WV1B 4RGNC 1M1SA 43C9B 5F7LB 2F58L 2IPKA 3V4PL 5GGUA 2X1OA 4JZJC 3CU1A 3PWVB 2AK1H 4F2MB 5DFTA 5K9JH 1FZKA 3JV4B 2VWEC 3GHEL 1GVIA 5HGHB 2JLLA 1FC1A 4KHXL 3ORJA 2MHAB 4NFBA 3NH7L 1A7QL 3DIFB 3V79C 1N64H 1RZJH 3U1SH 3RDTB 4PRHA 4M03A 5FF6A 3B9AA 2C4XA 4JRWA 2GITA 4MA7H 1S7XB 2WBWB 4LLQB 5F3HA 3KYOB 2FZ3B 1V7ML 3SDAD 3VRIA 3PWNA 1H8OA 4HC1A 1WWBX 4IJ3B 1FZJA 5ERWB 3NGBC 2IPTL 4TUOA 1NGZB 1PG7X 3I85A 5ACMA 4NQCB 3QIWA 3TVMB 4WEUD 4R0LC 1FIGH 3B8SA 4TVSa 4EI5A 4G8EB 4AM0B 4YDVA 4ERSH 1T3FB 1BJ8A 4PJXA 1U58A 3TN0B 4PJ8C 1KJ3H 1T4KA 5A3ID 4OBSA 5C0JB 3OBAA 3VFMA 5L0QB 1C5DA 3OB8A 3S4SG 4R4BA 5C9JB 5I0ZA 1YYMH 3FFCB 4QRPD 4ZQKB 4P46C 3SE3A 2IQ9H 3WXVH 1HCFX 1IJ9A 1FGNH 3GMPB 1FH5H 3AS1A 3FT3B 4MD4A 3S9DB 5F1KC 3A6BH 2I25N 3AVEA 3F6LA 2LU3A 3B9VA 1EEZB 1T03L 5C0BA 5FO7A 4J3XA 4PTTB 4ZPVB 3VXTA 2BOBB 3BPLB 1BOYA 5I6XB 1I9EA 1FORL 2PYED 4OGXL 4UOW0 5FO8B 2RGSA 2CUIA 4LCCA 3GSXB 1G7JB 5T1KD 4NIKB 2OMNA 3ZL4L 5ALBL 5MEND 1CGXA 1JYXA 2JIXD 1MH5B 3EBAA 1WT5C 1U8IA 3CFBB 4XBEL 3PGFL 3CMOL 2DLEA 4FQJL 2ORBH 1P69B 3RIFF 1QNZL 1IEAB 3QI9D 1UB6A 4DN3H 3OHXA 1INEH 5HHOB 3PDDA 1XF2A 4HMEA 3U9PL 4HXAH 2VXTH 3SGDH 3NIGF 5J9PA 5IHZA 4C56D 3G5YA 4HUKB 2CLZB 5T1LA 4R2GC 3MBEC 4EDWH 1MCWW 3LD8C 4K23H 1ZLUK 5DT1H 1R24B 5KW9H 3FCTA 3TZVA 3U83A 4Y2DC 5I74B 3H9SE 3DARA 2PO6D 2PXYA 5EBMA 1FG2B 3QUZB 1QSEA 4YK4C 3EYVA 1K85A 5MEQA 4OB5L 4BZ2H 1BGXL 3HG1B 2Z31B 5KOVC 1IBGH 4X9GA 4C4KO 4S10A 3D0VA 4FQQB 3FL7A 4HC1H 1X9QA 5DMGC 1VEOA 3DX9B 2KQMA 3T4YB 2YPLD 1BBJB 3RIAK 5B39A 4WWKB 3HE6C 5IHUL 5BRZE 1UJ3B 3KWWB 3DI2B 4M1DH 3OXRA 2NY4D 4PRID 4ZUTB 5E2UL 5BV7L 2DQUL 4NJAL 4OZ4B 4QHLB 1SBSH 1X5LA 5DD0H 5IK3A 5ITBL 4HF5L 1M7IA 4YHMH 4HX1B 1X5ZA 1VADB 1FYTE 3MRMB 2BVUA 4MMXC 1XR8B 2XQYG 5ID0B 3TPUB 3HC0A 3NIGE 5DVKA 4XB8A 1AFVL 2AK4B 2FL5A 3WFCH 3PGDB 2Q8AL 4AG4H 4LMQE 3WJLC 3BJ91 3D69A 3DVGB 4G8FB 3LKPA 3K8KA 2BSRA 5JOFB 1T1YA 4F7CA 3LEXB 4MXWH 1U8LB 4H8WH 1EHAA 4RIRB 3HPJA 4UV7L 5C0ND 5CZVL 4URTB 2NY2C 2VAAB 3B2UC 4K3HA 1E0OB 3BH9A 1DEEB 4NHCL 4RRPG 1UM4H 3O3DA 4Z9KB 5TPWL 1A7NH 5HYSG 3AS3A 4TSAL 5KSAC 1RIUH 3TO4C 4JM2D 2NNAB 4EVNB 5B38A 3ZKQD 4JZNA 4NT6A 4Y4HA 3J8F7 2ADIA 3CXDH 2R4SH 1PKQE 5HVHC 2XN9B 3CZJA 1TQCB 1ZWIB 4R97C 4U6VL 5JXEC 3X3GL 4PRAB 4MJ4A 4PRPA 3TBVB 3UYRL 4TVPE 3SKMB 4X7EC 3RGVD 3UAJC 5D2NE 3BP6B 4UIKH 4AT6B 4HAFA 3VXQA 4JANA 4ODUB 3JV0A 3TT1L 4AEHL 4KAQH 4OLYL 1G7QA 1RUPH 1MCWM 1MQKL 4MAYD 3L1OL 4GRWF 1M4KA 4QRSB 3IETB 3ET9F 2AABL 2K7PA 1X3DA 3Q6GH 5SWSE 3OG4B 2OP4H 1T5WA 3U36A 3GRWH 4S1QL 1KEGH 4EI6B 5EU6E 4LL9A 2VDML 1JPFA 4KI5F 4FFVD 4IHOA 4HV8A 3DVNB 3MNZA 1IEBB 4O00A 1KELH 1AH1A 4GW5A 4KK5C 3QCUL 1T1XB 1KT2B 4EDXB 1JPSL 4I0PA 3WNOA 2R1XB 4P23B 1MIEL 1PEZA 1NSNL 2BSSA 4KTYA 4RGMB 4XPHL 5C3LD 4Y19E 4GRLD 5DQDH 1SYVA 3WFBH 1U91B 5EWIL 1AQKL 3FRUA 3VI4F 2V7HA 1EX0A 3GSQA 3CXHK 3WHXA 2XRAL 1KBGL 1JZ5A 5D7LB 2D31B 4FQIH 2W0FA 1KACB 1EHXA 3EOBA 5I15H 4PGZA 1S9YB 2ARJB 3B9KB 1IC1A 2NY0C 2DQCH 2GK2A 3BJLA 1XF1A 3H7LA 2H32B 5TFSH 4UTAL 5ESQB 1HWHB 3O6FA 1MHEB 4G8GA 2ERJB 2JCCB 3U7YL 3O41B 4FTVD 4KI5E 5M94B 3OXSA 1D6VH 3SDDA 5E1AB 4RMUA 4F7EA 1NEUA 1CU4L 3ZTJH 3O81A 3NFNB 1ZHKA 3QXWA 1MFDH 5DK0A 4XP9L 5FHBH 4MQXC 1IT9H 2DLGA 3FRPA 4NRYB 1KTRL 2VDRH 4U3HA 1VERA 4K55A 4LPYA 5I8KL 2P5EA 1VPOH 4NQXB 1KPVA 2CXGA 3A6CH 1PGRB 3QWRA 2P42B 2HVKB 8FABA 4WW1A 3V0VA 5H94A 5FO9B 5L6YL 4Y4KA 1EGJA 3TPKA 2R23A 4PJAA 5DJ2B 2EIDA 4UT7L 4ONOA 3DUSA 1TJGL 5L2KD 5EUOA 4NSKB 4OI8A 2AJSL 2CLVB 4ZXBB 3X12A 5A16B 3MO1A 4Y5VB 3WDJA 1ZT7A 1QEWB 4XNZC 4XVUC 4BKLB 5D1XC 2O61B 1LD9A 4KKNA 1DZBA 1KB5A 1GAFH 4JFED 3GHBH 4RMWA 1JGLH 4HIIA 1S5IL 3MMEB 1KJVA 4WWID 3S37L 2IPUG 1TVHB 1DL7H 3GMNA 1VACB 5I66A 1H3XA 5IFHL 3E2HC 3ZKND 4ODWA 3M1BB 3G9VA 4HFWA 4P59H 3U4BL 5T33H 5DRXA 4ZD3L 2HJKB 4NNXA 1KLGB 2DLTA 4G6KH 3HZVA 4Y5YC 2R8SL 3QNXB 2BNRD 1ZT4A 4V1DA 1C08B 4GAYB 5JQHC 1V05A 4XVSL 3IAQA 4D9RE 3BWAB 4N8CL 2WIIB 3OR7A 4F7MA 1OPGH 5JIIA 1XIWC 3LKNA 1YMHA 4L8SA 3LRSA 4HK3J 2GSIB 3PWPE 3GSWA 1YEDB 4CDGC 1G7HA 1F4YL 3F8UB 1BPVA 3O3UN 3U7WL 4NYLA 1RK1A 4EEEA 3MLRH 2NLJB 3C5JA 4PJDF 1KLUA 4GS7B 1Z9LA 3P4LA 2PTTA 4KDWA 3O6KL 4J6RH 3OAYH 1KCRL 2R2CA 5CJQH 2QJDA 2O5XL 1XEDA 3SO3C 2IJ0C 3JV6B 3TJEL 4Z7WF 5KSVB 2DOCA 3QFDA 4M48L 1NAKH 1EIBA 1Q72H 4LIQE 2HH0L 2G9HB 1U95B 2X4NB 4LVHB 4PGEB 3BPNB 4N9OB 1JNHA 4EXPX 1IM3B 2Q86A 2PYEA 5E6IC 1IGYA 1QO3A 4QRUA 1NBYB 1HNGA 1OOAA 2X89D 4RMQA 4LGRB 3HMXL 3LIZL 5DUBB 4WGVB 3EOAA 4KRPD 4U1HB 2R2HA 1YEHL 5FOJA 2W60B 4NKIL 5T1KA 3CSGA 4MJ5A 2IFGA 2W65B 3LAFA 2ZOLB 4NKMB 4G9FE 5D1QB 3MBXL 2DYPA 2KZWA 1EGJH 3KPOA 1L7TL 4OZIF 1YN6A 3L7FA 5GPRA 4JFXB 5IBTL 1MCHA 3FN0H 5ENWA 4XTRC 5D5MF 4TYUA 4N9GA 4H25B 4WJ5A 3MRCA 4OM1H 35C8L 4PJDE 4EKXA 4EUPA 4Z7VB 3LQZA 4PJGF 4WUUE 1ZVSB 3MACL 1J1PL 4QGYA 2YPVH 4DUVA 3DVIA 3OKYA 2HWZL 1BX2A 3F12B 1MCBA 1NCTA 1KB5H 2DDQL 5HD8D 4PJ9D 1HYRC 5DMKA 2YA1A 2JJTC 3L7EB 4Z7WE 1G0XA 2BJMH 5KVEH 1PDKA 3RI5K 3C8DA 3P9WB 5FUOH 3LS5L 1IC5L 2SEBB 1FVDA 3CVIH 4M7LL 5D7JD 4NRZB 1HIMH 3OGCB 1NCCL 4DN4H 2A9ML 4Z7UA 3IFNH 4U1KA 1TZGH 3UPCA 2BSED 4BK5A 3HRZA 5DFVC 4HUNB 5I1AA 1CWVA 1KCSL 5IWLC 5EIQA 5LGKA 4X4XB 1XCQB 5F1NB 1JHKH 3O8XA 4JFFE 2BY1A 1JZ7A 2YMXL 3NCJL 4P2CG 5EU7E 3D85D 1A4KA 2VLKE 1NGWB 5D5ME 3UTSD 2OJEB 4ODXB 3C8KB 1ZVYA 2CIKB 2KDGA 2B8OT 2HP4A 4JHBA 1G6RA 1A64A 3KS0H 3KPLB 2CDGB 5C1MB 4DZBA 4M62H 3QNYB 1J88A 4HD9A 2AXJA 2GCYA 1OF2A 1W72B 1IAKA 5H35B 2ICWA 3AROA 1GOHA 5B3NA 5A2IH 5DJ6A 3IU4L 3PP4L 2AQ3A 1F90L 3CC5A 1ZT1A 2DM7A 3C9NA 1DLHB 5D93C 3OKNA 2A6JA 4K8RD 2YWYA 3F7VA 4M8VA 3RDTD 4OF0A 1DQLH 1EHLL 2AEIT 3EJZD 4GKNB 2EECA 1UG9A 3CPLA 1SYSA 2DKSA 2NY5H 4M00A 4AEIL 5BO1H 1Z5LA 5C6WH 4X7DC 3NPSC 3ARDB 2X42A 4NQCD 4DGIH 3TVMD 1HHJA 4S1RH 4YC2B 1DBJL 1SY6A 3ZO0A 5HHPB 1EV2E 4MNQB 2VZSA 1MRDL 4FFWC 5AG8A 4YUEH 2CPCA 2ICEA 4ODVL 3UZEA 2DQTL 3TN0D 1R5WB 4PJ5E 4OJFH 2UVEA 3T1FB 1PAMA 1G7PA 3EUUA 1RU9H 4XBGB 4X99B 4OKVB 4K3DL 1A6ZB 1P4LB 5E6ZA 3V2AR 4R7NB 1IGJB 3FFCD 3G08B 4HKZA 3IDIA 5F7KC 2IALA 3VWJA 2FD6H 2Y06H 4I18B 1FZOA 1N6QH 2BP3A 4UQ2B 4JN1H 1NMBH 1S5HA 5LG1A 5E4IA 1CVSC 5EIIB 4RAHA 1JZ3A 1TZIA 1I85A 1IGIH 3QWOB 4JJHA 3W0WB 5J89A 1LO2L 2OL3L 3FT2B 2YUVA 3NFPB 1AP2B 1NDGB 3V0WL 2E8YA 4XPBH 3CLEH 2F53B 3HC3L 3VGGA 2J88H 2GEEA 4Q6IA 3FQTA 4JFHD 4PLKC 2DB8A 3TYFA 3KLAB 4ZTPH 4U2ZA 1MNUH 2E9WA 1ORQB 3BEWB 4LU5H 3WJJA 3VFPA 1RHHA 3GMRA 5F88A 1KV3A 4O2CB 1JZ4A 1LNUA 2IAMA 4ZOCA 3BD5A 3ARFC 3L3IB 4DUXA 4LEOB 1H8SA 2HKFH 5IMLB 3VH8A 4Z7NF 1CXFA 4HKJB 1N3NA 1RUML 1WWAX 4RGNB 3KPPB 3WLBB 3P9LB 1NGPH 1UXSB 4JZJB 5HHOD 4M61A 5DURB 4KK8D 2MQCA 1QHPA 3BIAX 3WS6C 3UJTL 1QACA 5J1AA 1RHFA 3PHOA 2KH2B 3ETBF 3WD5L 1OSPL 1CL7L 3L95A 3RA7H 4P9ML 2CQVA 5FYLD 1QLFA 3QQ3A 4GG6B 5EO0A 1XR9A 4CVUA 1C7TA 3QUZD 5E6YA 4IRSA 3M17B 4DVRL 4UIMA 3HG1D 5JW4M 2Z31D 1IM9B 4NC2B 4MA3A 2PR4L 1AGDB 2FJGA 1X5KA 4I2XA 1GRWA 1FNAA 4HIHB 1Q0XH 4YXKH 3SBWC 2MNUA 2W1NA 3CVHH 1TJHH 1IVLA 4WWKD 4MNHA 5TQ2L 2ARJQ 3NGBB 4LLYB 1OGAE 2QR0B 1SY6H 4X6CF 3MV9B 4Z7NE 3HI5L 1KPUA 2MPAH 4M43H 2ZG2A 2ZZUT 1DQTA 3P0VH 3WIHH 3FB7B 3V52H 5ANME 1MCQA 4KVNL 4L4VB 2E7LC 3QA3B 2AK4D 1U42A 1AHWC 1OQXA 4HCRA 1XGQB 3JVGC 4NZTL 1DQQB 3V6OA 2Z0BA 1I1YA 3BKML 4YJZL 4NOFA 1ZLWH 3D3VA 2E6QA 2DTML 1QFPA 2OZ4A 5IP4A 1FFOA 1GIGH 5IOPA 2I9LB 4FQCL 2VXUH 2CRMA 2MQ0A 4F8QA 1IGML 2H2PC 2MQ3A 3QCTL 4C58B 3BGMB 1MEXL 4IMKC 1X5XA 2HKHH 5E2TH 1I8MB 4AIZB 5DTFA 1DVFD 5GS0H 4YBQD 4X6CE 2AERT 4NP4H 3RWFA 2CR6A 4YE4H 5DEFA 3TCLA 3D39A 1MCFA 2ZSWA 4JO3L 4BUGA 2XN9D 3ZKMD 4DVBA 5D8JH 5EU5B 3LPFA 1RJYA 4XPFL 4S1DC 3UBXG 1K6QH 3HHRB 5F6IB 3AREC 4ZDHA 3OJDB 3PQYE 1S8DB 4OD2A 1QTYT 5IMOA 4P2OD 3FO9B 3MV8A 4LASH 2VZ3A 3W39B 1BEYL 1K4DA 1HQRA 1ZVHA 2VMFA 4R2GB 5EPMA 1D5XA 3LD8B 1GOGA 1EPFA 3DLQR 4Y2DB 2YPKB 4XNUL 5LCVL 3SQOL 2CGRL 3VFGH 1FQ9C 4I0CC 2VC2H 4KVCH 1ORSB 4YK4B 5E95B 2F5BL 4IRZL 1AGCA 2R15A 2BOCA 1A47A 1Q9LA 3MV11 4RFOL 4KTDL 5ISZB 5D6CB 4P23D 1JRHH 1NLDH 1XGRB 5AZEH 5JOPE 4XRCA 1SHMA 1D5IH 1RJZA 4PJHB 3VJ6B 1TZHA 5ADPL 2WK2A 3N1GC 3MRLA 3HE6B 5JHDE 5JR1L 4M1GL 5FEBA 4GH7B 1GZPA 1I9RH 4TUKL 1A22B 3ULUL 3SDYL 5D7LD 4CN4A 1KB9K 1T66C 3CFIC 5LBSL 1YZZA 3WE6A 2D4FA 3PABA 1A1OA 3UC0L 3CDCA 2AJ3B 5KTEH 4O51B 3HFML 5C0CB 1DCLA 3B9KD 1ADQL 1H15A 2WWMC 2VLJE 5CEZD 1CDJA 3X11A 3P73A 4UAOC 4ORZC 5DJCB 5C0GB 2OZ4H 3C5ZC 4Y1AA 4NNPL 3RKDC 4DQOL 1GHFH 3HI1A 4U49A 1CE1H 3QUYB 3DNKA 4BSWB 1E4KA 1RULH 3S96A 4UUJA 5E00A 1A6UH 5KSAB 2BCKB 5DVOA 4JGUA 1LE5B 4ORGA 1IKNC 5DO2C 4QXGL 5DEZA 4HLZG 5KVGH 4HJJH 3NAAL 3P4OA 4YGVB 3X14A 1O5DT 1LO0L 1UM6H 4YO0B 5HVHB 4WTXA 4QWWD 1RZIA 2Z8SA 4Y4FC 2ED9A 3RZCB 1YNTA 1ERNA 4R97B 5HYJD 4TVPH 1TTFA 5IVXB 3FZUC 3T4AB 1YPZB 4OIIH 2FX7H 3C6SB 1S3KL 1BF8A 1NCBH 5IM7A 2I60H 4ZXBD 4HLJA 4JY6B 1BZQK 3RVXD 4TUJA 4PUBH 1FO0L 3KLDA 4QHUA 5L9DH 5IJKA 3BRDA 5TH2B 1HSBA 3G5VB 4HAGA 4JHWL 4JAMB 1OD7A 2DQFA 3RHWF 5JLZA 4KHTL 5DYOB 3KNBA 1CR9L 2D03H 4YLQT 5KVMC 4OD1L 4YAQB 5F96L 4XHJC 2LTQC 1YN7A 3ISWA 2DN7A 2XI9A 4U4BA 3GJFA 2EDOA 4M7JL 2A83B 2EYRB 1MVFA 3QUXC 2W92A 4QRPE 1A6AA 2BVPB 4BK4A 1UFUA 3D0LA 5EUKB 2CUHA 2ZNXA 1OAXL 1X5JA 4QYOA 1M05B 3QO1B 1TCRB 1MREL 3OKDB 2ZSVB 3TVMA 5IJVA 5MEPB 3VXOB 5EC1A 1WC7A 3RWEB 4CKVX 4PV9A 4NM8L 4X98B 3SKOA 4WFGD 2PYEE 5CGTA 5GS2D 1P84K 3CFEB 5C07A 5GS1B 3S88H 5C08B 5JZ7C 5HDOA 3VGEA 4Q0XH 5J4MA 4GRWH 2CRIA 3TH2T 5LJYH 3S4SA 5D72H 1XGTA 5DJDB 2NR6D 4Z95H 5MENE 3B6SA 4UQ3B 1I8IA 4KFZC 1R3LA 2VQ1B 5B8CA 5GRXG 3SCMA 1V7NH 4YNYA 4M3JA 3BKYL 5TDOB 1WZMA 1JMXA 5GHWL 2WWKO 2WV3A 5TQ0L 4WI2A 1CXEA 5DWUL 1MFCH 1WBYA 1HOCB 4C56E 4LEXL 1PVHA 3RWGB 3SOBH 3GEWB 3DO7B 4ALAL 3MNWB 3KVQA 3AUVA 5I1GH 1MFBH 5IR1B 4RBPK 1RZJC 4S1SL 2AXGB 4WI6A 3UTPD 2J6EA 4XCNA 2J8HA 5I1KH 5ACZA 3EDJA 5D1QD 4XVJL 1U8PA 1WFTA 2BFVH 4KKAD 3OB0K 1AD9B 4R7DB 4F8TA 5DRNB 4NJ9H 2QSQA 4OQ1A 2ZUVA 4HWEH 1AXTL 1KN2L 3VWKC 3EO9L 3FJTA 1P5UA 3TV3L 3AS0A 1FAIL 1CDHA 4XAWH 2BSTA 2FGWH 2YPLE 2Q3ZA 2Y07H 3WV0A 4M6ML 5EBLB 1A2YA 1IARB 3SKNA 1JN6A 1KIRB 1BD2A 3RWCA 1WCQA 4PRIE 2EIEA 5D1XB 4GUPA 1CD1B 4HIEB 3W9DB 2XZQH 2IF7A 3QHTC 2GTWB 4CGTA 3BQUC 2YKLH 1BVKA 4K94H 5LVEA 3E2HB 3EYQD 1GGBL 2AS5M 5HHNB 3T77A 4HDIA 3I6KA 4Y5YB 5L88H 3OR6A 2EXYD 4DGVL 3PL6C 4PS4H 4KJYA 5TF1H 3U30C 1MAKA 3IJYA 4QRRB 5CUSH 5J1TC 2OQJA 4Z76B 3MUGB 1P2CB 3HS0A 1FNEA 2NX5B 2OK0H 1XIWB 5ICZB 1E4XL 4FQ1H 4J3TA 3QULA 1F4XL 4JDVA 1RI8A 1HILA 1F6LL 3KDMA 5CIPB 3N1FC 5E8NB 5SWQA 1A1MA 4XZUA 4JPVH 1PLGL 5ICXA 3QEUB 2I5YH 1VFBA 5BZDB 1UWEL 2DI7A 3BUTA 3QDAA 2A77L 4JY5H 3WMSA 4PJEB 2EC9U 1MI5D 1BQLH 2FH8A 2UVFA 3R06A 4K07A 2EXWD 5JW5A 4P2QA 3QDJA 4X6EA 5C0RL 4JZOA 5ALCH 4YHKH 5EC2B 1UJTA 1KCUH 1IC7L 3VXRB 1BFOB 3O3BA 5EN2A 5BCAA 4R8WL 3SO3B 1PSKH 4HJGA 1P1ZA 2X44D 4RWYH 5I1JL 1HH6B 4W6WB 4RRPA 4FQLH 5HYSA 4WVRA 1FGVL 1OTTD 2HJFA 4D3CL 5E6IB 3RL2B 1A14L 4C59B 2H9GA 1N8ZB 3STZB 1DVFA 4O02L 3ARDD 4PJIB 2RCSH 4RFEB 2J6EH 5GRJH 3UTTB 1YEIH 1L7IH 3V8CA 3GO1L 2XICA 1JWUA 4MNQD 4H1LB 4OFPA 3QUMB 4OZFB 3VRLF 4G8IA 4YDKL 3W9EB 1ZGLM 5C92A 4OM0H 5TDNA 1DQDL 4OD3H 3S3JA 5TDPB 3RU8L 4DW2H 3G6AA 2IC2A 4EI5C 5JNYB 4U31A 4PP2A 1OY3B 1I3GH 3EOYG 4P2OA 1KNOA 3MCKB 1C12A 4Z7QF 1KJ2B 5IG7A 4NN5B 1IILE 4HJ0D 3RWJA 4UILH 3W0WD 2W07A 5IQ9B 1JK8A 3O6LL 4NNYA 3AAZB 3HZYB 3L5IA 1S78C 4BM7A 3SE3C 2ZOKB 3IDYC 4WHTB 3O2DL 5BQ7A 5B3JF 2D2OA 1CFNB 4LKCA 4OZGF 4ZFZB 3WFHA 1MCLA 3WIFB 4FQ2L 4IOIB 4XP1H 4MHHI 2NQCA 1MJ8H 4H8WC 3D18B 4MAUL 4XB7A 1D6EA 1HHHA 3OTTA 2WQ8A 1S7WA 2J4WH 4XWGL 1J0ZA 3PHSA 4FTVE 1XH3B 4X7SL 1FDLH 3IFOA 2MCG1 4KZDL 4L8DA 1HINH 1KIUA 4PB0H 3F7PC 1LEGA 4QRQA 4LCCC 3TT3H 3LEYH 3OKMA 1OM3H 2XQBH 4RGND 4MA8L 4ZFFB 4G42A 3VRJB 5H37G 1AO7A 1I3RB 5BMFH 2VN4A 2EIZB 5JW4N 5DURD 4Y89A 5HGDB 1IZJA 2Z4QA 3MSPA 1C8PA 2HFFA 1I3UA 2K7QA 5AG9A 2F15A 4JFQB 1YMMB 1IFHL 1EAPA 5I1CL 1ZGLP 5D93B 2VL5A 1FSKC 5B3JE 1IM9D 3FTGB 3NZ8B 4MS8C 5HDBF 3QQ4A 3E3QC 4KGJA 5L2KE 5HTSA 3RY6A 3MYZA 3BRGC 5LKNA 5FHAH 3V5HB 1TJIH 3HR5A 3HZKB 3TZVC 2PXYC 3BD3A 3ES6A 4LSTL 4ZFGL 3G04A 4NUJA 3WDIA 3DX6B 4I3SH 3NPSB 5IB5B 5F9DC 1RZGA 2C1OB 4KKLC 3MC0A 2JK5B 4LVNC 4JFEE 3MV9D 5CLTA 4OQTA 1OCWH 2AK1L 1L6ZA 5K9JL 1IGFH 3T09A 4HH8A 5LGJB 2DJ4A 4YDLC 5EU3B 3UPRA 2FBJL 2I26N 5HYJA 4NZRH 4PLJC 3VGFA 1CQYA 4L4VD 2VDKH 3QUKA 1U92B 3MCLL 2ZCKL 2BNRE 2A6KB 1RK0B 1N64L 3EYFA 4Z77A 4XWOC 3VFRB 2HMIC 3U1SL 4X6FB 3REVA 2DQDH 5M95B 1ZTXL 3PV6A 5EFIA 4MA7L 2YBRB 1N0XH 1RIHL 2VTFA 1ES0A 1QFOA 4WGWB 3IS1X 4OV6F 1RZKL 5GGSA 4J1UB 3WUWB 2LU4A 3QHFH 4YEEA 5F70A 3WFZA 3PDOB 3PP3H 4OLZH 3UZVB 3FAXA 3O6ML 1DQMH 2ZCLH 5KS9B 2W9EH 3CU7A 1DSFL 5DVMA 5F9WC 3LS4L 1YUHA 4TQEH 4J4PA 4X9FA 4ERSL 3B83A 1JWSB 4LAQH 3QJHB 4ONGH 1L4IA 2MCPL 3PJSA 2YZ8A 1A6WH 1CF8H 2B1HH 1FO0B 1HQ4B 4I77H 1NEZB 4PJCB 4GAFB 4LOUC 4WIQA 5EA0H 4J3SA 5IB1A 1XF3B 1EO8H 1YYML 2OTWA 4QHMB 4AMKH 2YEZA 1FGNL 1FH5L 2H6PB 3OKLA 4ETQB 3VXUA 1NAMH 2VUYA 2HT2C 2XTJC 1T6VN 4LQ1A 4R2GD 4M4RA 1NL0H 4YHLL 1MHCB 1NCNA 1DEDA 1BHGA 4Y2DD 3HE7C 2E6JA 3QJFB 1EAJA 2BY3A 4E41A 3IXTB 3D5OF 2VDLL 1G1YA 1CXIA 4J3WA 5E94B 3ZT7A 1IZKA 1F3DJ 4WO4C 2A1WH 2XWJA 5DMGD 1WCBB 4GBXA 5DGRA 2EZ0C 3HE6D 5GRVK 3CCHB 4ZAKA 4P48A 5FECA 2I07B 1G1CA 1GGIL 3G6JA 4PY8J 1INEL 4G5ZL 5KSBA 2C5DC 3Q5TA 1FFPA 3ILQD 2VXTL 5I8OH 1H3TA 2XFXB 2C7UB 1IAOB 2NY7H 3BUYA 2OR7A 4QY8A 1NCAH 2IH1B 5DT1L 5KW9L 5C0CD 5GJSH 3DGCR 1T89A 4JFZH 3OGOE 3MXWH 1OSZB 2DM3A 1NC2A 2CKBA 2VLLA 4LPUA 4L3EA 4BZ2L 1AHWB 3H7BB 2Y6SD 3GIVA 5DK2A 4I1NB 3UTSE 4HUMB 3NABH 3OKEA 2WANA 1E4WL 3LKRA 2R2EB 4JRYA 1EH9A 3UJIH 3B2UD 5C0AA 1FNFA 1ZGLB 3O6FC 3TNMA 4M1DL 3TYGL 5KSAD 3N0PB 2VSCA 2W9LA 1SBSL 4YHML 4QT5A 2P8MB 5TGBB 2CDEB 3Q6FB 3GHEH 2DWDA 1T5XB 4X6BB 1S7SB 4F7PA 2DLHA 4X5XA 3MUHL 3RVWC 5HJ3B 2X4RA 1A7QH 3WFCL 4AG4L 2QV2A 2LV4A 4OV5A 3UAJD 4N1CA 3AREB 1TQBB 2GI7A 3OF6D 4LSVL 4MXWL 1Q0YH 4XHQA 1V7MH 4PJBB 5I8EB 1UH3A 1KPRA 2A9NH 3MRFA 1MI5A 3QDHA 4Y4KC 3NCFB 4O9HH 3RWDB 2IPTH 2DIAA 3ARRA 1HDMB 4QTHA 1ZHBA 4A6YB 4YDJB 1JWMB 1PD6A 2E9JA 1MWAL 1T21B 2V2WB 5CGYC 2NZ9C 4H5SB 1BWMA 5EZIH 1N0LA 2EYSA 3VD7A 1JGEA 3NOIA 3VXNB 2E3VA 4CW1B 2R4SL 1CXHA 4MB5A 1Y6KR 1XGPA 3FFCE 4KK5D 1FNSH 3D25B 3PIQA 1X4ZA 3BVNB 1TVBB 3VFNB 5FB8B 5DVNA 2GSGB 4OFYD 4MJ2A 4D0CB 3S97C 3BP5B 5F1IA 1T04A 2EE3A 5IVZA 1D9KA 3KXFB 4OFVA 1S7QB 1XGUB 5D2NB 1NC4B 1RUPL 1NJ9B 4RSVA 4BQ6A 4JFHE 2FECL 4EN3A 2HFEA 5IBUG 5C08D 1LDSA 3QDMB 1AR2A 3QEGH 1QZ1A 2BRRL 7FABH 1BZ7B 3Q6GL 2CKBH 5CEYA 3U2SB 2OP4L 3GRWL 1AD0B 3MYJA 1KF9B 4L8SC 1KEGL 3BP4A 3I02B 3GSRB 4U1NA 1ONQB 3KG5A 2GQHA 2VIRB 1I1FA 4UAOB 1OTSC 1DUYB 3U46A 3ZL4H 1LEKB 1A02N 3QIBB 5EU6B 1T0NB 3C5ZB 2EE6A 3W0WA 2ENYA 2XIDA 5K9OA 4XBEH 3PGFH 5HPMB 1ITBB 2VE6B 3CMOH 1MLBB 1JIBA 1UQSA 1S7RA 4NO5B 3QQ9D 5HHOE 4FQJH 3ULUF 5D1ZA 4KMLB 3RX7A 4MQXD 2YD1A 5T3ZD 1J1OH 4LCUA 3OJMB 3S7GA 4ONFL 2DWEB 1KTLA 3BP7A 2H26B 3U9PH 4FQIL 4MXQC 1CZ8H 1GYAA 5JTWA 2AQ2A 1LO3H 1U36A 2DKMA 5J6HB 5FDWB 1WLHA 1J86A 4DEPB 1WJ3A 5SX4H 3E6HB 2NY5C 4Q9QL 4D8PA 4GG8B 3BOVA 3AM8C 1I7UA 4Q97A 4R3SA 2BVOB 1MRFH 3DRTA 4CU6A 5TFSL 4LAJH 1II4E 4OB5H 3HNSL 1WWCA 3T0VA 5C71A 4KPHL 3EYSL 2EYTB 3P4NB 3SDCC 1PYWA 2Z93A 3ZT6A 2NTFA 5ADOH 1D6VL 2FIKB 2FSEA 1U8MB 5IHUH 4KJPC 4XVUD 2H41A 5LWYL 3MLVL 5FHBL 5D1XD 4NN6C 3VGDA 4POZC 2E27L 4XX1E 4XGZA 3RUGA 3V5DA 1QUNA 1B6DA 1ETZA 2VDRL 3N06B 4Q6YA 4MJ6A 5ITBH 1VPOL 4HF5H 1ACYH 3A6CL 2XWTA 2AK4E 5K59E 2LTQB 4PLNC 3ILPA 4O4YH 1F6FB 3ZE0F 4BUHA 2A6DB 2A74A 2QLVB 3QDJE 3TA3C 3H3KA 1AGBB 3QUXB 3M07A 1OL0A 1HHGB 1J1XL 3BIKB 1FC2D 1FL6B 3KYNB 4JB9H 2Q8AH 1Q94B 2PW1A 4QRRD 2NX5D 3OKOB 3P30L 4E42A 1ZLVK 3VFOB 3NIDF 4R0LA 2UWEB 4WDIB 1XIWD 2PTVA 3MFFB 1QLEL 5ESAB 5KSUA 4UV7H 4X8JA 5CZVH 2HLFC 3T3PE 1NKOA 5GSRA 4ELMB 4OZHA 5CSBA 4PJ8A 4Q7DA 5IFJA 3O8XC 4NHCH 3VFVA 1GAFL 5F6HJ 4TSAH 3MJ8A 3GMOB 3GHBL 1JGLL 4D2NA 2JB6B 2XN9E 4LBEB 5CP7A 4P46A 1JVKA 1OTUC 4Z8FL 1F4WH 4P59L 2OMBA 5T33L 3CK0L 3DX8B 4HWZA 2PETA 3C87A 3VXRD 3UROR 3PWJB 1DQJB 4G6KL 2OBGA 3O3EA 4U6VH 4RAUB 2VDQL 3O4LA 3X3GH 2GT9A 3ECBA 3S36X 1DUZA 3KLHC 3JXAA 2OJZL 5MP6H 1D7FA 5FA4B 5E6ID 5C0IB 4HG4K 4AIOA 5B22A 2H3NB 4HEPG 4AEHH 4OLYH 1CFSA 2HN7B 1R3HB 3CDFA 3UTTD 3LKQA 3NIDE 3I3DA 3L1OH 3OAUL 3K4ZA 4KKBC 3SE9L 3CXHJ 2JCCF 2AABH 2V2TA 5IMMA 3FONB 4WEMB 5IROC 4U1MB 3ABZA 1LP9A 3X3FH 2ZCHH 4S1QH 3UBXA 1B0RA 1DBMH 3VWKB 4FG6D 1EEQA 4XTRD 4RMSA 3TIDB 2VDMH 1WZ1H 4TPRL 2IGFH 4JN2A 3SPVA 2ESVB 2DM4A 2HTLC 5DF0A 4D0BB 5BVPH 1JPSH 5DJ8B 4OCRL 1NSNH 4XPHH 1FLTX 5IB2B 5CSZA 1Q72L 4LFHD 3WSQH 1FN4B 5D7LE 4MWFA 3AU1A 4J3UA 1XF5B 4LHUG 3MBEA 5F7HA 1PZ5B 4UV4H 3JTTB 2FJFA 1AO7E 2XZCH 5GIRB 3BQUB 3VWJC 5A2JH 2AEQH 3L3JB 1B9ZA 5CJOH 2VQTA 1I85C 5CEZE 1KTDA 4LLWA 1BECA 1JZ6A 1KIQB 3NZHH 3TIEB 5DFVD 1EJOH 1L9MA 3FN0L 3PL6B 2UZIL 1T22B 4UTAH 4OM1L 5K9KA 2GJJA 3V6ZB 2Z92A 4M9OA 5DC0A 3KYMA 4UNTA 3U7YH 2HT3C 5IMKB 2YPVL 1CVRA 5J1SC 2IMNA 3MUZ1 4XNMA 5I19H 4WEBL 4S2SB 3WJJC 4LCWA 5GS0C 2ARWA 3BAEL 3QZWG 4QNPE 3BZEB 4CMMB 2IAMC 1NANH 2BJML 4ZSOB 3RBGA 5KVEL 4MDJA 2COQA 3BSZL 5FUOL 4OFKA 1QQDA 4PGBB 5IEKB 5LXGH 5FKPA 5DD1L 3HPLA 3DRQA 2IPKB 1YMMD 3UCRA 2XOTA 5GGUB 1S7UA 5HYJE 3OG6B 4DN4L 2JJSA 1TZGL 3F65A 2FYYA 2A38A 1FZKB 1H5BC 5L6YH 4H20H 4UOJA 4OZGA 1UVQA 3S3SA 4U6YA 4UT7H 4YFDB 2BMKA 4MNGA 4OUUA 1M7DA 4IRSC 3R8BB 3TO4A 2YSSA 2NW2A 4L3AA 4PRHB 4LVOC 1Z2KA 5FF6B 2FRGP 2GITB 2OR8A 2XNAA 4FA8A 5F3HB 3WXWL 3VFWA 5F9JA 2J3SA 2FIRT 3MRJA 3PWNB 3VRIB 4FFWD 1IL1A 5JXEA 3V6FA 4HUXA 1FZJB 1OAUL 1ZS8A 4TUOB 3SKUD 5BS0A 3U4BH 3QIWB 5JW3L 4EI5B 5HGAA 4NHUA 4ZD3H 4YDVB 3VD5A 1VFAA 1ZK9A 4PJ7A 4PJXB 1U58B 2X1QA 4EOWL 4RX4A 1T4KB 3QXVA 5BO1L 5JQ6L 4N8CH 1WBZA 4M1CC 4WFGE 3VFMB 2F54A 1C5DB 4R4BB 3KPTA 4KDVA 3IDYB 4YHOH 1F4YH 3WCYA 3U7WH 4MD4B 4P4KC 1P53A 1ZHNA 5IW6A 2FHFA 2D0HA 5FYJH 4Z0BL 3C60A 4DCQA 2HFTA 2MTPA 4OJFL 2H2SC 5C0BB 5SX5H 5FO7B 1ZLSL 3VXTB 2ZSVA 1N5AA 4K7PY 1GCFA 2Q3AA 4E41E 2ZUWA 3O6KH 3UPAA 5C09A 5LGHH 1UWXH 2IQAA 2XXCB 4GKSA 1I3VA 4LCCB 2FD6L 2Y06L 3MA9H 1Q9WA 1N6QL 4X4MA 4JN1L 1NMBL 2DMKA 1V3LA 4EQ2A 5FYJU 1U8IB 3UTPE 5KSBE 3LIZH 2X1XR 3CLEL 1YEHH 2J88L 5MERA 3G5ZA 4PBWD 3EFDL 4JM4L 1FL5A 1UB6B 3OHXB 4P2RA 4M4PA 4ZTPL 1XF2B 5AWNL 3WHE1 1G6VK 1L7TH 1FSKB 2UUDH 4UT6H 5J9PB 2HJLA 4Z7VE 5IHZB 3CDGA 3G5YB 3LKSA 4YH6A 5FM5M 5IBTH 3GJEA 5J6GA 5DZOA 3SN6N 5T1LB 4R9HA 2AV7A 2UY6A 5CBAA 3FCTB 3TZVB 2VISA 4ZO8A 4UDTA 2AV1A 2PXYB 5EBMB 4HLZH 3WKNA 1QSEB 4HS8H 3EYVB 2HWZH 5MEQB 5ITFA 5EOQL 2ZUQC 3QB7C 5A2KH 1NGPL 2DDQH 4U1SA 3D0VB 5F9OL 1UZ8A 5B39B 4YDLB 2HLAA 3P4MA 5I17A 4M7KH 1IC5H 1EZVY 1SJHA 2OL3A 4P3WA 5FDYA 3EDFA 4Y8AA 3CZFA 4M7LH 2ZUSA 3OXRB 1NCCH 3EJYC 2A9MH 1R5VA 3QRFM 2K1MA 5IK3B 2DBLL 1M7IB 2GUOA 4GXUM 3RTQA 3H8NA 2C4FT 3HC0B 1Q0XL 4YXKL 3CVHL 1TJHL 1OB1A 2YMXH 3NCJH 5DHVA 1X5FA 3PUCA 2FL5B 3MLUL 1FHGA 4QCIA 5HY9A 1GPOH 3D69B 3B43A 2H2PD 3LKPB 2V17H 2BSRB 3ARPA 1YEFH 5BW7A 5A40E 1WICA 4KUCF 1MI5E 1T1YB 4F7CB 4HSQA 1FFRA 4M43L 4XCFH 4UBDC 5F9WB 3HPJB 3QRGL 4BFBD 3P0VL 3WIHL 4YR6A 4FHBD 4DOHB 1E4KC 3QFJA 3BISA 3BH9B 3O3DB 5IW1A 1BM3H 3IU4H 3PP4H 5SV3A 2BZDA 3ZTJG 4PGCA 1F90H 1I7TA 3F7QA 1QD0A 5AZ2L 1KUMA 2BVYA 4S1DD 4BH7A 3RRQA 5B38B 3FFDB 4YDIH 3ARED 2B1AL 4JZNB 4NT6B 4Y4HB 4WI5A 4XC3H 2V6HA 2WMPA 2ADIB 4ZNEA 5C8JA 1Q38A 1T7ZA 4XP6H 4WI7A 4M7ZC 2P8LA 3BZDA 4PRPB 2VXUL 3LVEA 5DQJA 4MNQE 2XTJB 3SGDI 4KRNA 5GGTL 4K71C 2VDNL 5DD3H 3VXQB 4JANB 1DBJH 3BKCL 1MRDH 1G7QB 4DJMA 1JYVA 5IJKC 4YE4L 5IBLC 5TE7L 5E24E 3VXMA 4HWBL 1GXEA 4LRNH 4JGMA 3GJFK 3H9ZA 5D8JL 4X0KB 4JREC 3VD4A 4M3KB 4LARH 3SEPA 1WBXA 4RZCA 1J18A 1T5WB 5HHVH 4JGJA 3U36B 4ZYKA 5GGQH 5IF0A 2BXYA 3W0WE 1JPFB 3TFKD 4IHOB 1S9XA 4K94C 4HV8B 4ZFOL 3MNZB 4P2YA 4GG6F 1T20A 4GW5B 5FGSA 3KXFD 4XBPA 1T66D 1NC4D 3ZHDA 4I0PB 2EDHA 2BSSB 3ZDXF 3KGRA 5IV2A 3PGCA 3V0WH 3QDMD 1ZA3A 1SYVB 1OP9A 4DKEL 3FRUB 3D87B 3E1F1 4Z18A 2V7HB 3GSQB 3WHXB 3VFGL 4U0QB 5CMAA 4KVCL 5FYKD 2W0FB 4Y7MA 4KDTA 3SO5A 3QIBD 5EU6D 1LMKA 3C5ZD 3EOBB 3RKDD 3U0WH 1JRHL 1NLDL 4IMLA 2IBGA 4RGNE 3DV6A 1D5IL 1S9WA 3KYKH 1XGYH 4KKCC 3STBA 3QYCA 1INDH 5ETUA 1U8OA 5B8CC 1RUMH 4JHAL 1Y0LA 3O6FB 4G8GB 2D9QB 3HC4H 3DROA 2XY2A 2VWEE 4NO3A 1UCTA 3HB3C 3OXSB 3SDDB 3RUGE 4GG6E 2H8PA 3UJTH 4F7EB 5IWLA 3PNWA 5DO2D 4X6DF 1SVZA 1YDPA 3NACL 1ZANH 2HG5A 2X4PA 1BJ1J 1ZHKB 2WWKT 5DK0B 1OSPH 1CL7H 3V5KA 3WD5H 3ZDXE 4P9MH 2Z35A 1JI2A 1P9MC 3LEVH 5CZKA 2P5EB 3FZUD 4NDMA 1C16A 4KGLA 1KPVB 4YIQA 3P40A 1UCBL 4PRNA 1FV1A 3TH4T 3R4DA 8FABB 2EDJA 3KPQA 2YK1H 4B7IA 4WW1B 3V0VB 1GHFL 2OM5A 4NO0A 5H94B 3MV9E 4NQEA 5TQ2H 1RULL 4Y4KB 3MR9A 4R4FL 2R23B 2VXVH 4PJAB 1IAMA 4N0UA 1A6UL 2X09A 3DUSB 1MUJB 3ZHKA 5EUOB 3HI5H 3T0EA 4L4VE 3OJVC 5DGQA 4PD4K 3X12B 1LK2A 4XHJD 3MO1B 5I30H 5IGXL 1ZT7B 5KVGL 4HJJL 3HZMA 1MCPL 1UM6L 1LD9B 2DBJA 1BZ9A 1CFVH 1KB5B 3QUXD 2EDWA 3QEHA 1J0HA 4C55A 5AYUH 4TVPL 4HIIB 1KJVB 2YN5A 3GMNB 2IANA 1ADQA 2C3WA 2FX7L 2JK5A 4NZTH 4OIIL 4ODWB 3HUJA 1NCBL 5GGRA 4HFWB 2HT4C 4JRXA 5DRXB 2I60L 1RAMA 3ALWA 4RWHA 1KCKA 4NNXB 3VCLA 1LEIA 3HZVB 3BRFA 1NFIA 4PUBL 4OGYL 1CFTA 4FQCH 1ZT4B 3VGAC 4V1DB 4GOSA 2MOVA 1JNLL 1MEXH 3OR7B 3P2TA 4F7MB 2OR9L 3NCEB 3LKNB 1YMHB 1X5AA 4PJHF 5IB3A 4L8SB 3LRSB 2D03L 3ULVF 3O2VH 1YQVL 3GSWB 4NBXB 1G7HB 2QL1A 3FB8A 4H1LG 2NZIA 1XCTA 3IJSA 4XT1C 5DR5L 4EQ3A 1B6UA 4NYLB 1RK1B 1NCWL 3RIAF 4FZ8L 1X5IA 3DVFA 3C5JB 2ZUXA 4DFIA 1KLUB 4XPFH 3ARUA 2CK2A 4CNIA 2PTTB 5GISH 2HFGL 5KAQF 1AIFA 1MSPA 3D2UA 4C57C 5DUPH 4J3OC 1QFHA 5FYLH 1NUDA 3QFDB 5C0DA 1I4FB 3S88L 4I8DA 1YQ2A 4U7SA 4O58H 3VI3E 2FR4B 1JNHB 2ZNWA 3ARFA 2Q86B 2PYEB 2E6PA 1IGYB 1QO3B 2AAVA 4QRUB 1HYSD 4XNUH 3VWKD 3SQOH 2CGRH 3MLXL 4Z95L 1HN1A 5H37H 3EOAB 3MRGA 2R2HB 1DN2A 5T1KB 4IIQC 4MJ5B 2P5WD 4ZOAA 4YHNB 4OF3A 2ESVD 4KTDH 3Q48A 4W4OC 1H3UA 2DYPB 3KPOB 1YN6B 3L7FB 1I1AC 3WS6A 32C2A 1FVEA 2G5BA 5ENWB 4M6NL 5JR1H 4N9GB 4WJ5B 3MRCB 4M1GH 1J8HA 3LQZB 3ULUH 3W5NA 2Z8RA 3SDYH 1J8KA 5GGVY 2NW3A 5IVXF 1ZMYA 3BQUD 3MXVH 3LHPH 1RY7B 3QCVH 3LPWA 1YPZF 1CLZL 5C0CE 5I1GL 1PEWA 1BX2B 1BBDL 2GJ6A 2FEDD 3FO2A 5D4QA 5DMKB 2BFVL 2B5IB 2PNDA 1TENA 3HFMH 3MOQA 3UJJH 1EFQA 1CN4A 1ADQH 3QPQD 5FM8A 3ARBA 5E0QA 3PL6D 5ICYA 1FVDB 3V8OA 4OAWA 1F2QA 2FGWL 1YC7A 5C70A 1E27A 4Z7UB 3ULSA 4U1KB 5F72S 3PG2A 3IDXH 4DQOH 3HRZB 2C7UA 5I1AB 4QHNA 1CGTA 4HWUA 2RQ8A 3I2CL 4MNGE 1G9ML 1MF2H 1MPAL 1A9EA 3O8XB 4LSSL 1BFSA 1G7LA 5GXBB 1I7ZA 2XZQL 1A4KB 5JXAL 43CAA 4K94L 1G6RB 3JVGA 3KAAA 3L3DA 3S35X 1YY9D 3QPXH 5IVXE 4N8VG 3NAAH 1LO0H 4DZBB 4LLDA 1YPZE 3MRHA 4HH9A 1N7ML 2GCYB 5L88L 2X41A 1OF2B 3NBNA 3AB0C 1IAKB 2ICWB 5TF1L 4JQVA 1ZGLA 5CUSL 2E7MA 1S3KH 5DJ6B 1D5ZA 3NCYS 5GSVA 3WHE0 4IMKA 4F37F 1CFBA 2Y23A 3CC5B 1ZT1B 4F9LC 5J13C 3OKNB 3FB5A 2A6JB 5DHXB 3F7VB 4PRHD 3DMMA 4XCYA 5KN5A 2HVJA 4HGKC 3CPLB 3LH2L 3RY6C 1P4BL 1SYSB 3I9GH 2X70A 4JHWH 2I5YL 1Z5LB 4JY5L 1JPTH 1BQLL 1MY5A 3TP4A 1RZ7L 1CR9H 1H3VA 4RMTA 2P43B 4OD1H 1I8LA 3DV4A 1RVFH 2V9RA 5E7FA 1S7TA 1JF1A 3QIWD 3MLTA 4M02A 1HHJB 3QP3A 4EI5D 1KCUL 5C6TL 3REWA 2ICEB 4LIQL 2Y7QA 4YBLC 1OAXH 4KK6C 1G7PB 1U3HA 1BQHG 5CZXC 5DD6A 3MA7A 5F44A 1T21A 3AXLA 4X4ME 2L7UA 1AQDA 2YRPA 2DI8A 5C08E 3WLWC 1WZLA 5IHBA 3T1WA 4NM8H 3MTRA 1S78D 2J6EL 2N1KA 3IDIB 2IALB 4HKZB 4HT1H 5GRJL 3VWJB 1OWWA 1FZOB 1L7IL 2GYSA 2RFXA 1I75A 2W0KA 3HCVA 1S5HB 4BQCA 1TZIB 1T2JA 4J23A 2O5ZL 2LFGA 4OM0L 3TM6A 3CIQA 5C0BD 1ODAA 1HH9A 2J12B 4Q6IB 3FQTB 3BKYH 4P5TC 3TYFB 1M6OA 3ZKSD 1T1WA 1F97A 1I3GL 4J4PC 2DAVA 4LLVA 4JFPA 3IVKA 5C0EA 5TQ0H 3VFPB 1RHHB 1WEJL 3GMRB 4KRLB 5F88B 5FK9A 5DWUH 3MRRA 1LNUB 2IAMB 2R9HC 4UILL 1U8QA 4LEXH 1JF5A 4U6HA 3VH8B 4LCYA 5EOCL 2C3GA 1R3JA 1N3NB 1XF4A 2YHGA 2X7LA 1RUAL 3T0WA 1A0QL 3RY4A 4XP1L 4XVJH 4CVXA 5GJTH 1A1NA 4ZS6C 4YXHL 4M61B 5J8OA 1FYHB 1MJ8L 4NCC1 4XMKL 1MLCA 1AXTH 3OX8A 4MS8D 4U0RC 3V95A 2GKIA 2DLFH 3EO9H 25C8H 5J1AB 5T1LD 3PHOB 1FAIH 3L95B 3ZT5A 3TZVD 1QLFB 1FDLL 3QQ3B 1F4AA 5EO0B 3O0RL 1HINL 1XR9B 2PXYD 4PJEF 3C2AL 1VGEL 1QSED 3TT3L 4IRSB 5K9QI 4RNRA 4BSJA 3FB6A 1OM3L 5DZNA 1PJ9A 4KKLD 3GIZL 1IKNA 4MA3B 4WFFD 2FJGB 5BMFL 4I2XB 4QHKJ 4GBXC 4Y4FA 4MNHB 2FH6A 3JUZA 4PLJD 2VZVA 4HHAA 3E6FA 2BVTA 4D94A 5EOCJ 1U3JA 3DX7A 4QRRE 3O2DA 3CNKA 1KPUB 4XWOD 2HMID 2LE9A 3KPRA 4DGVH 1J9CT 5FHAL 2UZXB 4L9LA 4RMRA 5DEGA 3T0AA 1T89C 2WLYA 3BPOB 1QSFA 3IAGC 2J8UA 3RWIA 1B88A 2X6MA 1E4XH 3FHQA 5D71L 4W70A 2PYFA 2R2BA 4OI9A 1OCWL 4PJEE 1I1YB 5GZNC 1PLGH 1IGFL 3D3VB 3ME0A 1FFOB 2A77H 3VMOA 5IOPB 4PRBA 4Z5RA 4LPWA 1NCUA 4XCEA 3VXRE 5CP3A 4NPYA 5C0RH 3GZKA 2CD0A 2BK8A 2VJXA 1PW3A 4LOUD 1IC7H 5DTFB 1QVOA 1OLZA 2Q87A 3RWFB 1FL3A 4Y4HD 5I1JH 1IGCH 1HCVA 5DEFB 3HR6A 3TCLB 3D39B 1N0XL 2ZSWB 1T6WA 3LQAH 4PJIE 3RI5F 3UTTE 3IXAA 4D3CH 3ZE2F 3V4VH 5A43C 4PRPD 1A14H 1RJYB 2ITDA