4OGQB

Internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
ATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4ogqB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ogqB01
2YIUC 2E76B 1ZRTE 4I7ZB 2FYNC 2WPVB 2QJYC 3C8VA 4H0LB 1JB0J 4IL6X 1VF5B 2QJKC 2QSIA 3LW5J 4RKUJ 4Y28J 4PV1B 2WSCJ 5L8RJ 1Q90D 2WSEJ 2QJPC 5KLIC 2ZT9B 4H13B 2E75B 4KT0J 2WSFJ 2K9YA 2D2CB 4OGQB 4H44B 2O01J 2E74B 5KKZC 1S5LX 2QIWA
chains in the Genus database with same CATH superfamily
4FPPA 1CEZA 4D6TG 1KN7A 4LFAO 2GA1A 2R32A 2IDBA 4AHCA 1I08A 4YY3O 1L4AA 2NPSC 2DWDC 3SJBC 3E22A 2EINB 1PL4A 1YJ9P 3R2PA 1VQ6P 4RQFA 3BEHA 3ZCCA 2E75B 3CCVV 2A06G 2RCVA 4PELA 3HD7D 3DXRB 4Z1VA 1CZQA 2YXRB 3KCYA 5M1BA 1JJ2U 5J9PC 2YEVB 2K9JA 1AI7A 3CPWU 3G9RA 4D7TA 4X89A 3PJSK 1Q7YQ 4FM2A 2Y9YA 3DSQA 2PYLA 5LXTB 5CN0A 1PP9J 5BMVB 2R5BA 3RK3B 3AK3A 3BHPA 3B8EB 4ZIBA 2ZE8A 1N32B 3TGUD 1BCCD 1K5QA 3RL0B 4NYKA 1T3JA 3VOUA 3W7SA 1LT9A 2CAZC 5GTIZ 3P8CD 3GWOA 1N36O 4B3SO 1WT6A 2Y0DA 2ZXWC 1MABG 1LR1A 1WA8B 1RE3C 1SFCD 4U3FD 1I5XA 1GMGA 4OPHA 1R73A 1U97A 4ZI7B 2OWOA 4B3RB 4FM0A 1PP9E 3MHHC 4JI6O 1SP4A 4X66O 3K5NA 2G8YA 2QWNB 4CH5A 1X0TA 4GIFA 3RYHA 5AW5B 4YXWG 4OX9B 1XILA 2NPSA 4OH8B 1JVMA 2GTSA 5EYPA 4MVQA 4W4LA 5C8YB 3CXHE 1G6UA 2G38A 3BRCA 1YZBA 2AEFA 2J58A 2Y0IA 4DV5B 4YXDC 1NAFA 5LHHA 3CC7V 1XL6A 1W2BU 1QHTA 2YUAA 4K0KO 3B5ND 2D2CB 1M8OB 1EZVE 4WVZA 5EK0A 1EDJA 5KHJA 1JMMA 2ADPA 1GK4A 3CL3D 2ZR2A 4RJTA 4J7KA 2A45I 1PGPA 1HF9A 1XHXA 1VQMV 4LF6B 3L75J 4Z1MH 4IL6E 4JPRA 4BIZA 1KD1W 4JI3O 2IBZE 1P84I 1RF1A 4JTCB 1NZ6A 4EIJA 3H1KJ 1KB9E 1LWUC 2FYNB 1PD3A 3FB5C 3JD4A 5CBGA 5BVZA 1NO4A 4I2LC 2IYPA 1KYOI 1FXHA 4KUMA 2BCCD 1RE3A 3Q1MA 1KKCA 4JZGA 4H44B 3Q3DA 1BT8A 3CX5I 4PDRA 1AQ5A 5C39A 2OYHB 3SJCC 4JI4B 3L75E 1JY2N 3Q2YA 3JSLA 4PI2A 3CRQA 2O01N 2EX3A 3ABMB 2XAGA 2UU9O 2QJYC 1V55C 3AEFC 4QNHB 3N7NA 4PD4I 3HE5A 3H1KE 4Y99B 4NXNB 5KKZB 3AG1C 1B3QA 3TCUA 3OUSA 3OA7A 1I7FA 3ASOC 5L3GA 2M8RA 3RK3E 4AQRD 2YXHA 5IYDO 1IXBA 4YJ2A 2JGDB 2KYVA 2WPDG 4IFFA 4F6RA 5H5NA 1WB8A 2ZIOA 1YTZT 3ETQA 3E89A 3ZRVA 2EULA 3ABLB 1IBMB 1N7SC 4HB1A 3D3IA 4GZRB 4R4LA 4DK0A 5KJ7A 2HPCA 4H37A 3T1YO 4JZ2A 3USSA 3RYFA 3N4XA 1N33B 5CB4B 4MN4C 2QTSA 3QH9A 1VQ8V 4HZ3A 1T5EA 5KLVJ 3T4DA 1LWUA 1JY3N 2CE4A 4MVOA 2OIGA 5KUKA 1GK6A 2A0LA 3OEHG 5L3FA 2LXBA 2QWRB 1LTJA 3CS5A 1MA1A 2W0FC 1Y9BA 1Q6IA 2I8DA 1NH2D 2E3CA 3A0BH 3FYEB 1VQKV 2JWDA 4WFEA 4I7ZB 3A0HH 5KLVE 5APSA 3C9IA 3CPWO 1YJNP 3C90A 3GW6A 1QLEB 2DMXA 1JY2P 4DV7O 1S5LZ 2NLJC 4YJ3A 2MKVA 2LXCB 3KHUA 5AW4B 4C7UA 1GM8A 1NU1J 4AUWA 3M06A 2Z5HA 2FMLA 4I9WA 2KZJA 1PPJD 4PDVA 1VQ4V 3GF7A 1LTAC 2GBOA 2QG4A 3TXSA 3GG2A 2JGUA 2NR5A 2PI5A 3UKMA 4LF7B 3C3TA 2I1JA 1N7SA 5JCOC 3W67A 2ZINA 4X65B 2QM8A 3V4QA 1SQXG 1TGOA 4NTXA 5CA0B 3I5DA 2XAQA 3CSXA 4OGQC 5CCHC 1BE3H 3AEAC 1NU1E 4GX1A 3B71A 5IY5C 1FXKC 1G4YB 5K1XA 1IZNB 1U7JA 4BW5A 5LA6B 4WFBV 1CI6A 2DYRC 5JJNB 4JAUA 1JJOA 2L35A 3ZHSA 1NTZD 2Y0CA 2VQEB 2Q3IA 4ZKIA 2VQFB 1JY3P 3GF3A 5TISZ 3CCLV 1Q81W 1ZV8A 4MSWC 3N2GB 1NR7A 2CDYA 2CGOA 2FFDC 2QTOA 2ZJSE 5LP6B 1AI6A 3S1KA 1M57C 1M1KW 3BA8A 3HUSC 5B66E 2N9YB 3LDEA 3T1HB 4EOTA 3APOA 3FWLA 1K05A 1R6NA 1W0KG 4K35A 5D5QA 5DN6G 1J5EB 4H0LC 3O6QA 1E1RG 1BMFG 1OW7A 5JCOA 5B3SB 2Y4UA 1HGZA 3OTOO 3AG3C 4XFJA 3KDPB 5C8YA 2K3RA 1DIPA 1WJZA 5APQA 2FYUD 3H1JJ 3GMAA 1QR8A 3CC2P 2XTAA 1DEBA 3JSNA 5KAIH 1BGYJ 1VP7A 1SQXK 3RK2B 1DTOA 3E2EA 4JTAB 3CB2A 3L71D 3N27A 1DF5A 5CBFA 3A5TA 3TF5A 2F66C 4HYOA 3WUVA 3G3ZA 2SPZA 5K1PA 4DT0A 3LNNA 1VQLP 3R65A 3U1CA 1JR9A 3FB6C 3H1JE 4KL1A 5EIBD 3U0ZA 2HEPA 2QKAA 2BTQB 1OCRC 1BGYE 2YI9A 2QKCA 1MSWD 4ZNCA 1DH3A 4UB8Z 1OZHA 1AR4A 2FYUH 2JRIA 2P22C 2YIUB 4DK1A 2F4VB 2OYHA 3LUTB 2QRXA 3C3SA 3X2QB 3O65A 2N74A 4JPZB 3RVZA 2JWAA 2NN4A 4JYAO 4CZZA 4AYCA 3AEDC 1DF4A 3U59A 2H88C 3P32A 4MTOA 5GTHH 1XNRB 3HR0A 4B7EA 1LTSC 4TT3H 5LBQA 1U7MA 3RFRA 2EILC 1LUWA 1QX8A 5APXA 1YI2P 1A32A 4MTGA 5AW0B 2F1MA 2JGDA 1R3IC 4WBNB 1LUVA 2QSIA 4LF4B 2Z0AA 1FD9A 1RPOA 4DV0O 5H2FZ 1GTOA 3CJHA 4RAIA 2EBOA 1P84D 3L73D 2E5LO 3EFGA 1SQPG 1XNQB 3RYIB 2XNDH 1H8AA 1IFMA 4TQFA 3U10A 3VQWA 2EZPA 2IJJA 1LGHB 2OGUA 4MW8A 3HKDA 1KYOD 1S2EA 3E1IA 3SR2C 3L70H 3CX5D 2EZOA 1KECA 1GL2C 1KQLA 4JV5B 4GX0A 5AVTB 1FAFA 3TGUJ 1BCCJ 1DD3A 4JI1B 1VQ9V 2IZ0A 3G6EV 4UVCA 1AR5A 3UT5B 4PD4D 2ZE7A 2R72A 2WSEH 3IF4A 1FJPA 5AW8B 3A3YB 1VF7A 3AE1C 2K9YA 4H33A 1OJHA 1TAEA 1WP8A 3L73H 3RVYA 3AG2C 1RQUA 3L74J 1FZCC 1MOFA 2JEUA 3JYCA 5KA6A 3RYCB 4LFBO 5IDJA 3MGNA 2CTQA 1FZFA 1FYJA 1HDJA 1I94B 3TGUE 4X20A 2W6JH 1BCCE 1KYOH 4XDJA 1CPYA 3GWKC 1Y76A 4LNUA 2N1TD 2ILMA 5LHIA 2WMMA 1QL1A 1UPGA 1PP9H 3MHSC 5IYBO 3JD2A 3P8CE 3OAAG 1OCOC 1S72P 3UO3A 1QLNA 1H88A 3L74E 1XL4A 4DR6O 1D2DA 4LF5O 2YNYA 5CA0A 4I55B 2HHHB 3JSVC 2W6JG 3JCUH 1OV9A 3ICXA 3HD7C 4UCUA 1OCZC 1SQPK 4OVNF 5GTIE 2A7WA 2KOGA 5J2UB 3K9AA 4J11A 1S3JA 1PP9G 1IZ3A 2R70A 2FL4A 1EZVH 1GDTA 5B1AB 4J9YB 3S3WA 4J80A 1T6AA 2BOCC 1RM1B 4BXLA 2ZM6B 3A7OA 3CCEV 2FXMA 2CK3H 2KQXA 2ZAEB 4ZKUA 3BVOA 3M0AA 2EJ7A 2IBZH 1VQOV 4B3MB 3LIDA 4QGPA 1JMBA 3CD6P 2B5UA 1BQZA 1L4AB 1AV1A 1N2DC 3E22B 1FZCA 1IURA 1EZVG 1KB9H 2O01J 4JI7O 5CJ4A 1F4MA 3CWBD 2IH1C 4N78D 1SFCC 1SKVA 4JASA 4UV9A 1K97A 2CK3G 1OCCC 3W7UA 1WMKA 1JOCA 3MD0A 2IBZG 1HH0A 4J7ZA 2VS0A 3L4FA 4ASVA 4LWSB 1NTMD 3FX7A 3G4SP 3TK1A 3MIWA 2M6YA 2L5GB 3H1LJ 3ABUA 4U7OA 1SQFA 1GTWA 3LNMB 2QJKB 2XKMA 4L87A 1M7LA 3WB1A 1X59A 2ITAA 1PFIA 5IYZB 2WSSH 1TUBB 3B5NC 4RUEA 3L75G 2QA4V 5KHGA 2BOBC 2IZ1A 1LT9B 1R1BA 3KXDA 1YITP 3CMAP 3CWBH 3VQYA 3K5LA 2OYQA 3AE7C 5L3BA 2FXPA 2Z3YA 1YQ3C 3STLC 4PJ0Z 5IYCO 2WPSA 1PNKA 3B4SA 3H1KG 3H1LE 2Y4TA 3D36C 1N0JA 2UXDO 1KILD 2ZDIC 2ZVNB 3I5CA 3CCMV 1NTMH 1YJWV 1L0LJ 3RYHB 3BASA 1SQBD 2NPSB 1SLQA 4LBEC 5EYPB 4DW0A 4TOIA 1OIPA 2KI7B 2P7JA 2J59M 4JF7A 5AVYB 4B86A 1SS1A 2HJFC 5APVA 1FDIA 1PIXA 2DYSC 1L0LE 3IFXA 2PI4A 1FOSE 1HTLC 2IFMA 2C0WA 1IX9A 1S4XA 2KP8A 2LQTA 1ENVA 1JNMA 1B6QA 4N21A 3FKSG 4X88A 3EHBB 1FDOA 1EN5A 3K59A 1X9VA 1HWTC 4DV3O 1SQBH 3V2QA 2OIEA 2Z5UA 4GUNA 4JI2O 2LKMA 2JEXA 4DV4O 2ZXWB 4JQ0D 4YIPA 4EI2A 2GV9A 3ZRSA 5KLVG 3P8MC 1FJGB 1VF6C 3WB0A 1OFCX 3O9OA 5AVWB 1E5WA 3A2AA 1DEEG 3L37A 1XREA 1GH6A 2XV5A 2EIKB 4YPCA 3HKBB 1FKAO 3SFEC 3JASB 5KUMA 1NTZJ 4X1KA 1FXVA 1ZWIC 4JF3A 4JI0O 2OT5A 4DR1B 4JI8O 4AQYB 3FXDA 4ZOLB 1K8AW 2R3SA 2IX7C 4YJ2B 3D3QA 2FY8A 2QEXP 4D6TD 4F6RB 2LP7A 2RH0A 1YYCA 2RMKB 3STZC 3SWFA 1B06A 3OFNG 1SZXA 4LFAB 3K5MA 1L0ND 1NU1G 2OTLP 2B1GA 4ASUG 4RO0A 1EDKA 3WG7C 1NTZE 2HPCB 4R50A 2EIJC 3CRAA 4F4LA 2JR8A 4YY3B 3Q4HA 4FLUA 5KTBA 1BSHA 5AVSB 3I55V 4JAAA 1N8RW 2A06D 1J1DC 4CH4A 1EDLA 2GUZA 1LWUB 2KB7P 4FZ1A 2IFNA 1H2KA 2CH7B 4B08A 1W2EA 4DR5O 4O4LA 4FLYA 3U11A 2NNUA 2UXBB 3CXHF 3CI9A 5AVRB 1VF6A 4X1YA 3ABVC 4LF8O 3CC4P 2YIBA 5TISE 2KSEA 2QJYB 1V55B 2ARHA 5KLVK 5J2UA 4QIWF 3AG1B 1RSOA 3ABTA 2YS8A 4LFCO 3ASOB 4HYTB 1Y67A 4YJ3B 2CTRA 1IBKO 3BCCJ 2A06H 1N36B 4B3SB 2ZYAA 3F89A 3OAKA 1MSDA 1SQQJ 3AK2A 4WBAA 3W7TA 4A5UB 4YHHO 1KB9F 2VWKA 1N7SB 4QE9A 4CS2A 1FBMA 4UCSA 4JI6B 2P4VA 1PZQA 1BGYH 4X66B 5JVDB 5CA3A 3QVNA 2Q6QA 5DJTB 2OQQA 1NVPD 1VQ5P 1NU1K 1EZJA 1W59A 3BCCE 1YTFD 3JD0A 2WSFH 1SQQE 2Y69C 2WLKA 4LWSA 2J5UA 3S3XA 1XOUA 4K0KB 3H1JG 2PZSA 1K8AQ 1CI6B 2BEQD 1JMKC 1BGYG 4ABMA 3CCUV 2H43A 2IYOA 3MUDC 2V4HA 1K04A 1M56D 1XTGB 2KKWA 2X6BA 5IYZA 1SRYA 2AXTE 1TUBA 2PYJA 3ML0A 3JCZA 4JI3B 4UB8E 3U1AA 1QNMA 5E79Z 4YXWH 2NRGA 1KQGB 1M1JC 4DR4O 3E7KA 1EXIA 1J95A 3WFVA 2OTJV 1N8RQ 1IVSA 5KAFH 2Q0OC 3JD1A 3CLQA 4LH7A 4NXMO 3L72J 4UCRA 3IN6A 3O6QB 1ZP0C 2P4KA 5EIBC 1P84E 1SQVJ 1RF0C 2GDSA 2KS1B 3GHGC 1Y74A 3CMEP 2UU9B 1WN7A 1H0TA 4GOEA 3B2EE 1HNZO 3DGEA 3VMAA 2HP8A 1TVKA 3K0DA 1S5HC 1PGJA 5H2FE 2ZT9D 3CX5E 2HG5D 2ITDC 3L72E 5IY5B 1FXKB 4B3TO 1U57A 3OMNB 4JYYA 3LSUA 2JS3A 2DQ0A 1SQVE 2DYRB 4U3JB 3R4YA 2BSKA 4DUYO 3MUDA 1MFZA 2XT9A 2N05A 2E76D 1P7GA 4XDKA 4LF9O 4GKGA 2HYNA 2LGWA 3GB7C 2FXOA 4O4IA 4I50B 3T1YB 3WU2E 4DXWA 1M1JA 3TDKA 2FFDB 4XE5B 1GM9A 1M57B 3HUSB 1DD4A 3L74H 5K5GB 1XDCA 1KV4A 3FD9A 5LMNO 4MW3A 2Q73A 1BCCG 4H0LB 5H6QA 3K04A 2C2AA 3ZBHA 3A0BZ 3HKBA 1RF0A 4ZMDA 3GHGA 3JASA 1TU3F 3CXHI 5B5EH 2WA4A 3A0HZ 1IO4A 3CRMA 3W7WA 4W7ZA 2KSDA 3AG3B 3OUFA 2A9HA 5CMZA 5DEDA 3F7YC 3K57A 1JX9A 4DO2A 4GCZA 3PN1A 3L74G 4ZOLA 3HRNA 1EZVI 5BXZA 2AW9A 1X79B 4PV1D 3H1HJ 3QTCA 4DV7B 2B1IA 4EFEA 4PA9A 4DR7O 3CJHB 2EJRA 1KC8Q 1XEQA 3K79A 3L9DA 2MW2B 1FC2C 1LTTC 2IBZI 4FK5C 2C0XA 1SQXD 5CBNA 3OR6C 3HKDB 3LW5J 5DM6V 1KB9I 1MZ9A 2N1TC 3D70A 3RBZA 2LW1A 1OCRB 3H1HE 5L3EA 4L73A 1D5NA 2CH7A 4LF6O 2ZNJA 3L36A 1EN6A 2B9BA 2XNXA 3OTFA 3PTZA 4WY4D 1V9PA 2YKPA 3ZMTA 2KLUA 1FS0E 2RDCA 2X6CA 1OX3A 3UM7A 4FFBA 1HR0O 3CCSP 2K1EA 4M3LA 3OEEG 3HKCA 5A9GA 1S9KD 3M9QA 4KHXA 1BE3D 1VQ7V 4J42A 4RUFA 1OW6A 1SQXH 3CE2A 3CCJV 2EILB 1K7DA 1NR1A 3QO5A 4X20B 5FPOA 5JH7B 2Q6AA 1S77D 2WZ7A 1Y76B 2LGQA 4LNUB 4NPFX 3H1LH 2WLIA 1KUQA 5JWPA 3MTUE 4EB6B 5APYA 2WWWA 1S0VA 1AJNA 2UXXA 2P90A 4I4TA 3QF7A 5JVDA 3CP1A 1YJ9V 1VQ6V 1WAZA 2WLJA 3ZS8C 2G3AA 2BEZF 5AW7B 1NKZB 3H1LG 1OWAA 4IYIA 3OTOB 2N1TA 5KLIC 3ETGA 2YMYA 1WB7A 2P1JA 2WLMA 2V1DA 5JQGA 2WSCH 4PJ0E 4LGDE 1GL2B 3L35A 1KQFB 1FFXB 3TETA 2F95B 3MDSA 1T3UA 1SETA 3BABA 4N3YB 2M3EA 4HBNA 4X8AA 1LNQA 2YIDA 1GD2E 1MG1A 3AG2B 2E42A 1H2LA 1FZCB 4LLHA 2D3OW 3JC22 1GK9A 2ZNIA 2NZ2A 2YDEA 2KB1A 1L0LG 1S5JA 1IFJA 4PA6A 2ZFCA 1UJWB 4HKZH 2WT7B 3FWNA 3MP7B 5B1NA 2OCCC 3SYQA 1Q3EA 3VP8A 4G27B 1KILC 1G8MA 5JJEB 1OCOB 4P9OA 1GO3F 4FLZA 4H13D 4TSFG 2KS1A 1H2SB 4R4MA 1ZSPA 3T2MA 1S5LH 4X64O 5LMUO 2R9IA 2JO1A 1QL2A 2P58A 3HD7B 1GM7A 5CCHA 2W27A 1L0NJ 1GN6A 3AE4C 3F5TA 2YKOA 4JYBA 4MTXA 1FXKA 4OWFA 1IBLO 3AE9C 5GW7A 4L74A 1OMIA 5IT9N 4DV0B 4U3JA 1SQPD 1B04A 5EBWC 4TUYA 2FYZA 3CCQP 1CP9A 1YQ4C 2E5LB 3EQ2A 3OJAB 2KG7A 5ITZB 5BR8O 2XAHA 1SESA 4I50A 1F4NA 1L0NE 2AXTZ 3JATA 4MVUA 2FFDA 4N6JA 2YI8A 3AE2C 3H1IJ 1SFCB 1URQD 4L75A 3HUSA 1H38A 1ZW0A 2OCHA 4ICGA 1OCCB 4FJCC 1NTZG 5AW9B 3PP5A 1Q5OA 2H8PD 1S76D 1NAYA 2OTKE 5CCGD 5LL6Y 1L0LK 5TISH 2XUMA 1AJPA 4BWNA 3G71P 1NTKJ 2UXCO 1SQPH 3L70D 2ZR3A 1OXZA 1ZRTE 4X62O 4HH2A 3ZMZA 3H1IE 4DR2O 2Q3EA 2ETNA 3W68A 4CH3A 4LFBB 3KZIH 3CYOA 4E4EA 3UCSC 3CCRP 1J5EO 2XHBA 2KSJA 1W0JG 1HNXO 2MK3A 1W5CE 1OVRA 2YSUB 1ZMEC 1NTKE 1PM9A 4KHPO 2WTYA 2Q68A 2FKXA 1IDSA 1E79G 3E8HA 2RQ6A 4JI5O 5KJ7D 4PA7A 1FJKA 2HLDG 4DR6B 3E1RA 4MTFA 1T8ZA 1HBWA 3JCUZ 4LF5B 3BCCH 3AK1A 3FXEA 1PL5A 1PP9D 2HKOA 1SQQH 4X1KB 3THOA 1U96A 3B77A 2E74D 3JAWB 1Z56A 4MVSA 4IL6X 1XBLA 5FLXN 2WPRA 3WU2Z 2O57A 2EIMC 1FU1A 4DZOA 1RP3B 2WPQA 5APWA 2IJKA 2N9BA 3CHXA 4DUZB 2Q7EA 1LTBC 2H7HA 4C7NA 1CSBA 1FZBA 4TLFA 1SS3A 5EC1C 4L76A 1VF5D 3CXHD 3V6IA 3KG2A 4U3FJ 1GMJA 2DYSB 3BCCG 2QWPB 1NTZK 1BHBA 1SQQG 2UXNA 4JYCA 1L1FA 1EZVD 2LR2A 3VBBA 3AG4C 2F4VO 4TV8A 3Q4HB 1YJNV 3K08A 4JBZA 3TSIA 1P49A 1CXZB 5JH7A 2HFED 4JI7B 1SF9A 3OGCC 2GUZB 5BZBA 3P7KA 3V2NA 1R6KA 2IBZD 2Q69A 2PGGA 3E83A 2R9RB 4EB6A 4U3FE 4FLVA 4CC5A 5B1OA 4KFMA 2B89A 1YEWA 4O4LB 3T4ZA 1KB9D 3RWRD 3IAYA 1JTHA 3S4RA 4NR1A 4X1YB 4FLXA 1SVFA 2YXYA 3CXHH 4UB6Z 1AVYA 2KZIA 1YIJP 2W83C 5E79E 2E75D 1E1QG 1ZXGA 3ABKC 5GONA 1XTCC 1RSOB 1GL2A 4O9BA 5J2TA 3MZWB 1FOSF 1IFIA 1FFXA 4EEQA 3ITKA 1GN2A 4AILC 1VQNP 4IL6H 4IT5A 1K92A 1NH2B 2AZ2A 3RK3D 1M56C 4YTPC 3TNUA 4TWKA 3IFMA 2PGDA 4L8JA 2BCCJ 1US6A 1EBOA 2DJVA 2Q9IA 3RL0D 1QQCA 1XI1A 2UXDB 1G1IA 1LP1A 4UV8A 2QWOB 3L72G 2EIJB 5APTA 3SPJA 1SERA 5CBOA 2ZKOA 2K37A 4JGSA 3I56P 4CS4A 1Q43A 1SQVG 2WT7A 1SQQK 1J1DB 3FAVA 4X1IB 3L75H 1MNGA 4NKGB 1HJBA 1ZR2A 2YKQA 1OHHG 3SDLA 2BCCE 2HODA 2Q0AA 2JIZG 3FFQA 3H1KH 5C93A 2ZXEB 2A79B 3SYAA 1XMOO 3CCVP 3BVHA 1Y6XA 3VYIA 3HD7A 2DN9A 1JCHA 3CC2V 4RWUA 5CMUA 2D2CD 2ZT9C 2HG5C 1FZEA 1VARA 1F23A 1J2JB 4UCTA 4DV3B 1SQGA 1RFYA 2KXPB 4JI2B 2PFXA 5AVZB 1G1JA 1Z2GA 4DV4B 1VEWA 5JJJB 2RJZA 1DX7A 1JOYA 3A0BE 2IJHA 5ITZA 1VQLV 2E76C 2VRSA 3ZHVA 2JEEA 3A0HE 4W4KA 4CH6A 2RN9A 5IWAO 3H1HH 1Y74B 4CBCA 2ZCEA 1WP7A 2Q67A 1SFCA 1H0TB 3M91A 3E8FA 1QVGU 4H44D 1TVKB 4B3MO 1LTIC 1WRGA 2AEJA 1BE3J 4JI0B 4JI8B 1HNWO 4I0XA 1N34O 2Y69B 3CEIA 1IJDB 4G28B 1GU5A 1R6TA 4WFGA 3FB8C 3DC5A 1SQVK 1THZA 1QGKB 5LHGA 1O9GA 3WUUA 4TV9A 1NS1A 3H1HG 4I5SA 2QJ1A 5KLVH 1PKXA 5FNVB 2BSKB 4BIOA 4J7JA 3V2PA 1NKDA 1YBKA 4R6ZA 1ZN5A 3M8AA 4DV1O 1YI2V 3AE3C 3ZN0A 2X6AA 3CC7P 4O4IB 3B5NA 4WFAV 1YXBA 3K9SA 1N73C 1BE3E 4PV1C 1GZLA 2IU0A 4WF9V 2IH3C 4WFFA 1M1JB 3SYCA 2P10A 1JB0J 1RY3A 3RN4A 3D71A 2K1AA 4N23A 1VQMP 3BA9A 1AFOA 5EZYA 1FZAA 2QJPC 3D36A 4UFZA 4DR3O 1PPJE 4DR5B 2ZDIA 4GKKO 5AVXB 3QWOC 4BRYA 4ZKPA 2W90A 3FGAD 2DW3A 1TUEB 4LF8B 2B87A 1NU1H 1XMQO 3GHGB 1GU4A 1H2MA 4DV2O 3P3PA 3JAWA 4PJ0H 2XDJA 1WPXA 4O2BA 4WY4C 3IC9A 1AJYA 4Z2WA 4LFCB 3K58A 2Z5IA 1L2PA 3QNEA 2GUVA 3AECC 1IBKB 1J1EC 2UUBO 3RGBA 2KUBA 4GOFA 3CRRA 2ATKC 1ROPA 1D7MA 3AEBC 1OW8A 1NI8A 2WLHA 4C7RA 1JQ0A 1KU9A 1A02J 2XAFA 2Y9ZA 2W0XA 4U7NA 5DJUB 3D6ZA 2QR4A 2PF4E 4PHZA 1T2KD 3GVMA 3J80N 3VQVA 4DV6O 1QLED 5B66H 3BY6A 1JA8A 4PA3A 3OW2U 5KMGB 4IHJA 3T97B 3ASNC 4XDLA 5B1BC 5AW3B 3H25A 3OE7G 1Y66A 1SC5B 1NBMG 4OXSA 1GRJA 2HVKC 1S72V 2R3CA 1P84F 1BSNA 2FYUJ 3H1JD 1JCDA 2WQYC 5LYJA 2W6IG 3E86A 1BGYD 1K9MQ 4FFBB 4GKJO 3A2FA 2ZD9A 4LC1A 1USDA 1GKFA 2OYOA 2M5AA 5BY1A 3L71J 4UCVA 3HKCB 1YVWA 1WNSA 1VQ8P 4MVZA 3CX5F 1AQTA 3ZDMA 1JM0A 3C1LA 3B8NA 2MJZA 2W6BA 4DRXA 2QM7A 1RPRA 1Y47A 2YMKA 1BDCA 1QBZA 3ZMUA 2FYUE 2LO1A 3TJTA 3APQA 1KORA 3H6PA 3SWYA 4UUJC 4DR4B 3FB7C 3KPEA 2H89C 2WLIB 1LT1A 5E1AC 3CXCU 1KP3A 1P4RA 4LCUC 5KAFZ 1R8EA 1H8HG 1K73Q 1VQKP 2FKWB 4Q20A 3L71E 2AEMA 2XOKG 3ZN1A 3CD6V 3H1JH 4I4TB 3M0DC 4NXMB 5GTHE 1XHZA 2KIKA 1VQPP 1G1XB 2IJIA 3K03A 5EFWB 4F6EA 3EVKA 1ZR4A 3VMYA 1IC2A 2N1TB 3BFRA 4X1IA 5EBLC 1FPOA 2UUAO 3L70J 5JQGB 1R5SA 3KYQA 1HNZB 1AI4A 1VQ4P 3G4SV 3F5HA 4H13C 2QGNA 1Q8IA 1IK7A 2UUCO 1L0NG 1ORQC 4B3TB 2GSMB 2YXLA 5F2VO 3IJ4A 2AGAA 4NPDA 2WSEJ 3H1IH 1QVGO 4HAMA 1ZX3A 1RH5B 3L73J 2W8ZA 4MVRA 4DUYB 1X4TA 3SJAC 1N86A 1IFNA 2WAMA 3L70E 1YITV 3RK2D 3P3NA 3CMAV 4LF9B 3OM3B 3Q5RA 2CTPA 4FLTA 2UXBO 4B7KA 1KC8W 2WITA 2XU6A 4NVPA 4XBFA 1NTKH 2Q7CA 4HJGH 1NOHA 2HVJC 4KP4A 3H1IG 3NTNA 3PLNA 2QDOA 1RF1C 4K8ZA 1GN4A 3KQGA 3D8CA 5IJ0A 3L73E 3CCLP 4O4HA 1Q90D 5LMNB 3M0DA 3K5OA 2P6JA 5AVQB 1ZTEA 2KNCA 2Q9LA 3LIEA 2X7RB 1Q82Q 1URQC 5B5EZ 2YO3A 1HUCA 1NTKG 4PDMA 4OGQB 4I9QA 1KYOE 1PGQA 1MZFA 3L74D 1K4DC 3HE4B 3GLMA 5KLIB 1UIXA 2H8PC 1NHLA 1H8EG 1Y4MA 1N7LA 2V7QJ 5CCGC 3K5BA 2A3QA 2QM4A 2VRZA 5KHHA 1EDIA 1RQVA 3V4WA 3VOPA 4UXNA 4A7PA 3JARA 2EIKC 1GAXA 2R44A 2Q1KA 4DR7B 1I0HA 4TUYB 5FNVA 1VL2A 4PD4E 1F7YA 1HVVA 1NYHA 3JCUE 2KG7B 3TGUH 1BCCH 1L0NK 3WUTA 1RE4C 4IIJB 3OD4A 1ZL8A 3JATB 5A2QN 3HPLC 3K0GA 1Z5WA 3CRCA 3OR7C 2Z4EA 3WB2A 4GLXA 2I1KA 2QVAA 1L8DA 4U3FH 4ZBMA 3ETDA 4QPJA 1PGOA 2WLNA 5IE9A 1N32O 1M90Q 3H32B 2OCCB 5KJ7C 2O3JA 3HTKA 3ETEA 2PY5A 1KILB 1S1CX 3OW2O 3TGUG 1V54C 5CJ0A 3J7AU 1USEA 5E79H 1Z5VA 5GTIH 3N2KA 1HR0B 2E74C 5CA1A 3ZIAG 2X0LA 2JJLA 4U3FG 4BW9A 4B3RO 1URQA 4X9QA 5AW6B 2F93B 2PRRA 2K9PA 2RNBA 2OYIC 4Z1MG 4ASWA 5D5PA 2W6AA 1LTJC 4HNAA 2QEXV 1VF5C 3CWBJ 5CCGA 4OX9O 1YTZI 1NTKK 1ZLLA 2M7WA 1NVOA 3LDCA 5AG2A 3VMZA 4NB5A 4DV5O 2OTLV 4UB6E 3PRJA 3NXSA 1NTMJ 2JS5A 2HFEC 1EN4A 5KMGA 1Q2NA 1X22A 3H1LD 3T97A 1RE4A 2CPBA 3UIAA 2IM9A 4RESB 3R66A 4QPKA 2P7TC 3CWBE 1KQSU 4N78E 3RT3C 3VQXA 4CS3A 2LW7A 2BCCH 1BL8A 4GYCB 4FVMA 2WLLA 2EINC 4C7NB 2O01H 5IJ9A 2H94A 2P67A 1Q6UA 2C9LY 3T1CA 3CC4V 1NTME 2YIBD 3AE6C 1JCCA 4PI0A 2E75C 3VN0A 2WA3A 1VDFA 1QCEA 3QO8A 3ZMSA 4TV8B 3W7XA 4JI4O 4O2AA 2BCCG 1YF2A 1QVFU 3O8ZA 4MT8A 1L0LD 2LFSA 1VQ9P 3G6EP 2OYIA 2JKVA 1SQBJ 3II6A 4IYHA 3RK3C 2BE3A 1S5LX 5LOVA 4NXNO 3UO2A 1O9HA 3RL0C 3ZMVA 1L4AD 3MAQA 1FZGA 3ZHQA 1JTHB 2QWQB 5HFMA 4O4JA 4PDLA 1KD1Q 2YC0A 1VQPV 3ZRWA 2PUSA 3RW0A 3ZJZA 1KILE 1NQTA 1VQ5V 3S9OA 3QG5A 4X64B 1SQBE 1IBMO 5GONB 5LMUB 2GM4A 2H3OA 5KAIZ 1NGMB 4QMAA 4LR3A 4QE7A 5J2TB 2EIMB 1N0NA 3KCXA 1L0LH 5FPRA 1QEXA 2WVRA 4QJFB 1N33O 2KK7A 4C46A 1M93A 2Y0PA 1IBLB 1KBHA 1H2NA 3ZX6A 3B09A 4FM1A 1X8YA 3TNUB 2PTMA 1AILA 1R5LA 3V5BA 5BU8B 3DXRA 4IFDK 1LP1B 2D2CC 1QR9A 4CC6A 4J10A 5L8RJ 2GHYA 5BR8B 2DQ3A 3AG4B 1D5AA 4DOJA 2YEVA 2YICA 4MS2A 1R3KC 1FE6A 1AROP 4FFKA 3CCEP 3FAVB 3VTPC 5LXTA 2P06A 3NFQA 5BMVA 1DGSA 4MVMA 1VQOP 4R7CA 1PPJH 2ITCC 3JALB 3OMAB 4ZHQB 1YDXA 2HODB 1W2BO 3J81N 4OPAA 2P2UA 1BE3G 1CW5A 3EFFK 2NPSD 2FYNC 4JYAB 4D6TJ 2QSAA 4EYYQ 1KKDA 5GTHZ 5KX5B 3CMEV 3SWKA 5EC2C 5H9CA 3SPHA 2UXCB 1VMGA 1WA8A 1NVPB 1PNMA 4H44C 2E5YA 1F51A 1OCZB 4ZI7A 3HE4A 3ZRXA 1YTFB 2OYHC 4X62B 4UCOA 4LF7O 2DE0X 4DR2B 3KZIZ 3ABKB 1MUUA 1PPJG 1UIIA 1AR1B 3ABMC 3TYYA 4X65O 1YSCA 1UFIA 2YIAA 1HNXB 4Y99C 1JUNA 5KKZC 3RBXA 1NTZH 2O1JA 4D6TE 4GT1A 4KXRA 4D7SA 1M56B 2QKSA 3IGAC 4KHPB 2LFRA 2Q5UA 3UQ8A 1G2CB 4IIJA 4JI5B 2QA4P 3V2RA 2JJ1G 2AHZA 1KTMA 3JAMN 1NT2B 1PL0A 3KKYA 1FDMA 3ABLC 2VQEO 1KP2A 2A06E 1NJIW 2VQFO 2AHYA 3BRTB 3H32A 4I0XB 2E5TA 2WSFJ 3BATA 3OT7A 1KILA 2POHA 4I6MC 1SA0B 3CCMP 1WPBA 4WCEV 3K3WA 1YJWP 3BCCD 4R8CA 4TV9B 1R3LC 3AG7A 1SQQD 1E79H 4JAVA 1KQSO 3C8VA 1ZOYC 4LP8A 3T1HO 2ADQB 3NMDA 3AEEC 2L91A 3SYPA 2O1KA 2Y48A 3B5NB 3PH0A 1IK9A 2XZRA 5LGTA 2ZT9B 1AP6A 2FBWC 3L71H 5TJHA 2ZYGA 4I7ZC 2ZIMA 2IW5A 3Q5SA 2Y0EA 5EZYB 2DWEC 1JEKA 2PAJA 1QVFO 1T2KC 1QLEC 4TQDA 4J41A 2FYUG 2E76B 5L3DA 4BRYB 4DCKA 5LGNA 1Q81Q 2BTOA 2B87B 2F23A 4W80A 2N04A 2IU3A 4J9ZB 3FX0A 1URFA 3L71G 4RKUJ 3IC7A 4O2BB 1M1KQ 3ZHTA 1MFTA 5KA5A 3JAKB 2IPPA 5KAFE 1I5YA 4TT3G 1K33A 1N4CA 4WFHA 1JPXA 4IL6Z 3CCSV 2AXCA 4NTYA 5CB4A 4UVBA 2AXTH 1K4CC 2RMZA 3BPZA 4UB8H 1AB3A 3ZEDA 1EC5A 4P30A 3L72D 1SZTA 2F43G 3SYOA 1K3EA 3JD3A 2CTWA 5EBMC 1SQVD 4IHJB 1HJ0A 3LSQA 3A8TA 1N73B 2XNDG 4PV1B 4BIUA 2A45H 3PHLA 1H2GA 1M5IA 4IFMA 2M3BA 4FIPC 1XNRO 3WMM0 5LYJB 3SJQC 1XUQA 2Q4PA 1P84H 2UWJE 1N7SD 3IAOA 1NJIQ 4DJGA 2XAJA 3L70G 2QJPB 4Q6GA 3E8GA 1KFNA 5LP6C 2M5AB 4LF4O 3I55P 3RL0g 4KJMA 4U7JA 3L75D 2A45G 3RGUA 5H2FH 2C9NY 1XMOB 3BRVB 3CX5H 4DRXB 5L3CA 1VIBA 3L72H 1XNQO 2FYUK 2B9ZA 4P2ZA 1YHQP 1COWG 1ZLZA 2KLVA 3L73G 3G6BA 4WY4B 1P7BA 3IR9A 2K88A 1SQVH 2ZXXA 3H1KD 5DECA 3SSUA 5B3SC 3H9VA 1VPCA 1K5SA 3HKEB 1HWYA 4PD4H 3E8BA 1J1EB 1NKNA 2YO2A 2Q5ZA 4JV5O 3DTUB 1NWQA 5B5EE 1JFFB 1K34A 3WG7B 1JY2O 3RK2C 3WU2H 1BS3A 4JI1O 4EKWA 4GX2A 2CUGA 4DW1A 4DUZO 2V7QH 1Q86W 3M9HA 5IWAB 5LA6A 3H01A 4FMTA 3ASNB 3K06A 1AP5A 5B1BB 1QU7A 1AI5A 2AZ0A 3A0RA 1EQ7A 3JALA 4ZHQA 1FFTB 2DOSA 1HNWB 2Q7GA 1N34B 2RN0A 1AJQA 1I94O 3N2GA 3H1HD 4XA4A 2V7QG 5CBHA 3VMXA 5KX5A 5H6RA 4IOIH 4UVAA 5LP6A 4I1LA 1KZUB 2YIUC 3BAAA 2CGNA 4IGGA 4OGQD 3EWKA 5CCHD 1GW4A 3X2QC 4DV1B 1NH4A 1SQXJ 2FB5A 4YIOA 2K9JB 1MMMA 4BWAA 2HHHO 2JP3A 3SPCA 1BQ0A 5KLVD 3CCUP 1M9NA 4UB6H 1BDDA 1JY3O 1WLEA 1AA0A 3CCQV 4K8XA 3MHVA 2VWJA 4PA4A 4WWIA 1IXMA 4FZ0A 3AE5C 1G2CA 5IJ0B 1HW7A 4LH6A 4O4HB 1LTGC 3G67A 4DYLA 4DR3B 1Y8AA 4GKKB 3TXQA 2KNCB 2ZM6O 2QIWA 4EFBA 1SQXE 2OTJP 4K3AA 5FL7G 2WPVB 1XMQB 1M57D 5AW1B 5KHIA 4DV2B 1EFRG 1A02F 5AW2B 1H89A 1AVMA 2GTAA 3M7MX 1K9MW 5AVVB 4Y28J 2WSCJ 4BR6A 1SA0A 3F7VC 3M99B 4H13B 2WSSG 1HP8A 3LW5H 4H0LD 3SPIA 3AEIA 3G71V 3JARB 3DC6A 1NU1D 1FAVA 4KT0J 4AI8A 2BTQA 2UUBB 1KFMA 2GUSA 3CWBG 2ZYDA 1DK1A 2R5DA 2ZE5A 4NTWA 1JO5A 1GN3A 1Q6HA 1FS0G 1S9KE 1ZL8B 3EXAA 5B66Z 3CCRV 1BHAA 2ZVOB 4DV6B 2OARA 2ZE6A 5KHKA 4RQEA 1K73W 1NTMG 1Q86Q 1RHZB 3SPGA 3SFDC 3D6YA 1YCIA 3AEGC 1OZ0A 1PV0A 1EM1A 3HTKB 3G80A 3B40A 3AE8C 1RF1B 1KMIZ 1EXJA 2HLOA 4NPEA 1PV3A 4GKJB 3N2KB 5CHXA 4WBNA 5CA1B 2L6LA 1AVOA 3LDDA 1HGVA 1MV8A 1IFPA 2QE7H 3Q5PA 3B8MA 1URQB 2E43A 2JVDA 1LJ2A 2Q7HA 2M0BA 2LJ2A 3JAKA 1OVVA 4W7YA 4HNAB 3RYIA 5HFLA 1MKMA 4GDOA 5APUA 2P5OA 2JJ2G 2Q8VA 1SQBG 3SGIA 1GW3A 3HE5B 2QE7G 4EDFA 1IFDA 3VP9A 2ODMA 1S5LE 4YHHB 4P9PA 5B1AC 1DLBA 3NR7A 4CPGA 4JTDB 2B88A 2XASA 1RM1C 1Q7YW 4GX5A 5AVUB 5KAIE 2JDIH 5BU5A 1N73A 1OVUA 2YXQB 2HR3A 3UT5A 4RO2A 3P30A 4G2KA 2CPSA 2UUAB 1L4AC 3M9BA 2RKLA 5LGUA 1ZAUA 2JK5C 2WLLB 1BSMA 3RYCA 1ZUQA 3LSSA 5IJ9B 3OGIB 1Q82W 2ZQMA 4GODA 1NTMK 2UUCB 1KYOF 2HJDA 3RYFB 1YIJV 1V54B 2JDIG 1SQPJ 2FTKA 1M4UA 2E74B 2DW4A 4O2AB 1GL2D 1R3JC 1FJGO 4WB4A 1YHQV 4WY4A 2PP6A 2OYIB 3FYIB 4PD4F 1VQNV 1LTJB 4E2LA 3HKEA 4D6TH 1BZKA 1ZRTD 1VF5B 2QJKC 1PNLA 4I55A 3H1ID 5LOVB 4FLWA 3OMIB 3HB3B 4DR1O 3E35A 1L0NH 1SQPE 1JFFA 4AQYO 1LT9C 3F5WC 4O4JB 4BAYA 1VQ7P 2R9AA 3ZHUA 3ZRWB 3CCJP 2BASA 1XQ8A 3ZHRA 3I56V 1NTKD 1TA8A 3KZIE 1SQBK 1M90W 2V4DA 3QO7A 1MZEA
chains in the Genus database with same CATH topology
3RL0g 3GF3A 1ZRTE 3AE7C 4U7JA 2FXPA 2QJYC 1AJYA 1YQ3C 2IDBA 3AEFC 3R4YA 3AE6C 2E75C 3AECC 2G3AA 3SFDC 2BEZF 3D6YA 1DD3A 3AEGC 3ABVC 2E76D 1Q90D 3RK3E 5KLIC 3AEBC 1KTMA 1OW8A 3AE8C 1ZMEC 2E75B 1KMIZ 3D6ZA 3AE1C 1KQFB 2WSFJ 1EXJA 2K9YA 1K05A 4OGQB 1PV3A 4H0LC 3O6QA 1RQUA 5M1BA 3GLMA 1OW7A 1UIXA 3T97B 1S5LX 1DD4A 3H25A 3G9RA 2V7QJ 3Q5PA 1DIPA 4XFJA 2ZT9C 2D2CD 4R4LA 1RQVA 1ZOYC 3C8VA 4H0LB 1PL5A 2WQYC 3GMAA 2E74D 4IL6X 1FDIA 1KILE 1VL2A 1PIXA 3AEEC 1MKMA 1TU3F 4GDOA 1NYHA 2NZ2A 3S9OA 2ZT9B 2FBWC 2E76C 1VF5D 1NGMB 2OQQA 4I7ZC 1FDOA 4PV1D 1GMJA 3Q5SA 4H13D 1Y9BA 2YMKA 2YIUC 2J5UA 1KORA 4R4MA 2E76B 4OGQD 3EWKA 4I7ZB 2H89C 4H44D 1S1CX 2G8YA 2BEQD 1R8EA 2JO1A 2D2CC 3LW5J 4RKUJ 2JP3A 1K04A 5L8RJ 3AE4C 2MKVA 3D70A 2E74C 4YXDC 3SFEC 3AE9C 1KQGB 1OMIA 2D2CB 1EXIA 3AEDC 3GF7A 3AE5C 2O01J 2H88C 3AE3C 2E74B 1VF5C 2QIWA 1YQ4C 4PV1C 2E75D 4TT3H 1HF9A 4Z1MH 4H13C 1IK7A 2FYNC 2WPVB 2P10A 1JB0J 1WMKA 3IN6A 3D71A 1ZP0C 4OGQC 1VF5B 2QJKC 1HJ0A 2QSIA 3AE2C 4H44C 4Y28J 3AEAC 4PV1B 2WSCJ 1OW6A 2WSEJ 2QJPC 4H13B 3B71A 4H0LD 4YTPC 3FGAD 4KT0J 3Q1MA 3IAOA 4H44B 3Q5RA 3Q3DA 3Q2YA 2ZT9D 5KKZC 1U57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIU C;  2E76 B;  1ZRT E;  4I7Z B;  2FYN C;  2WPV B;  2QJY C;  3C8V A;  4H0L B;  1JB0 J;  4IL6 X;  1VF5 B;  2QJK C;  2QSI A;  3LW5 J;  4RKU J;  4Y28 J;  4PV1 B;  2WSC J;  5L8R J;  1Q90 D;  2WSE J;  2QJP C;  5KLI C;  2ZT9 B;  4H13 B;  2E75 B;  4KT0 J;  2WSF J;  2K9Y A;  2D2C B;  4OGQ B;  4H44 B;  2O01 J;  2E74 B;  5KKZ C;  1S5L X;  2QIW A; 
#chains in the Genus database with same CATH topology
 4FPP A;  1CEZ A;  4D6T G;  1KN7 A;  4LFA O;  2GA1 A;  2R32 A;  2IDB A;  4AHC A;  1I08 A;  4YY3 O;  1L4A A;  2NPS C;  2DWD C;  3SJB C;  3E22 A;  2EIN B;  1PL4 A;  1YJ9 P;  3R2P A;  1VQ6 P;  4RQF A;  3BEH A;  3ZCC A;  2E75 B;  3CCV V;  2A06 G;  2RCV A;  4PEL A;  3HD7 D;  3DXR B;  4Z1V A;  1CZQ A;  2YXR B;  3KCY A;  5M1B A;  1JJ2 U;  5J9P C;  2YEV B;  2K9J A;  1AI7 A;  3CPW U;  3G9R A;  4D7T A;  4X89 A;  3PJS K;  1Q7Y Q;  4FM2 A;  2Y9Y A;  3DSQ A;  2PYL A;  5LXT B;  5CN0 A;  1PP9 J;  5BMV B;  2R5B A;  3RK3 B;  3AK3 A;  3BHP A;  3B8E B;  4ZIB A;  2ZE8 A;  1N32 B;  3TGU D;  1BCC D;  1K5Q A;  3RL0 B;  4NYK A;  1T3J A;  3VOU A;  3W7S A;  1LT9 A;  2CAZ C;  5GTI Z;  3P8C D;  3GWO A;  1N36 O;  4B3S O;  1WT6 A;  2Y0D A;  2ZXW C;  1MAB G;  1LR1 A;  1WA8 B;  1RE3 C;  1SFC D;  4U3F D;  1I5X A;  1GMG A;  4OPH A;  1R73 A;  1U97 A;  4ZI7 B;  2OWO A;  4B3R B;  4FM0 A;  1PP9 E;  3MHH C;  4JI6 O;  1SP4 A;  4X66 O;  3K5N A;  2G8Y A;  2QWN B;  4CH5 A;  1X0T A;  4GIF A;  3RYH A;  5AW5 B;  4YXW G;  4OX9 B;  1XIL A;  2NPS A;  4OH8 B;  1JVM A;  2GTS A;  5EYP A;  4MVQ A;  4W4L A;  5C8Y B;  3CXH E;  1G6U A;  2G38 A;  3BRC A;  1YZB A;  2AEF A;  2J58 A;  2Y0I A;  4DV5 B;  4YXD C;  1NAF A;  5LHH A;  3CC7 V;  1XL6 A;  1W2B U;  1QHT A;  2YUA A;  4K0K O;  3B5N D;  2D2C B;  1M8O B;  1EZV E;  4WVZ A;  5EK0 A;  1EDJ A;  5KHJ A;  1JMM A;  2ADP A;  1GK4 A;  3CL3 D;  2ZR2 A;  4RJT A;  4J7K A;  2A45 I;  1PGP A;  1HF9 A;  1XHX A;  1VQM V;  4LF6 B;  3L75 J;  4Z1M H;  4IL6 E;  4JPR A;  4BIZ A;  1KD1 W;  4JI3 O;  2IBZ E;  1P84 I;  1RF1 A;  4JTC B;  1NZ6 A;  4EIJ A;  3H1K J;  1KB9 E;  1LWU C;  2FYN B;  1PD3 A;  3FB5 C;  3JD4 A;  5CBG A;  5BVZ A;  1NO4 A;  4I2L C;  2IYP A;  1KYO I;  1FXH A;  4KUM A;  2BCC D;  1RE3 A;  3Q1M A;  1KKC A;  4JZG A;  4H44 B;  3Q3D A;  1BT8 A;  3CX5 I;  4PDR A;  1AQ5 A;  5C39 A;  2OYH B;  3SJC C;  4JI4 B;  3L75 E;  1JY2 N;  3Q2Y A;  3JSL A;  4PI2 A;  3CRQ A;  2O01 N;  2EX3 A;  3ABM B;  2XAG A;  2UU9 O;  2QJY C;  1V55 C;  3AEF C;  4QNH B;  3N7N A;  4PD4 I;  3HE5 A;  3H1K E;  4Y99 B;  4NXN B;  5KKZ B;  3AG1 C;  1B3Q A;  3TCU A;  3OUS A;  3OA7 A;  1I7F A;  3ASO C;  5L3G A;  2M8R A;  3RK3 E;  4AQR D;  2YXH A;  5IYD O;  1IXB A;  4YJ2 A;  2JGD B;  2KYV A;  2WPD G;  4IFF A;  4F6R A;  5H5N A;  1WB8 A;  2ZIO A;  1YTZ T;  3ETQ A;  3E89 A;  3ZRV A;  2EUL A;  3ABL B;  1IBM B;  1N7S C;  4HB1 A;  3D3I A;  4GZR B;  4R4L A;  4DK0 A;  5KJ7 A;  2HPC A;  4H37 A;  3T1Y O;  4JZ2 A;  3USS A;  3RYF A;  3N4X A;  1N33 B;  5CB4 B;  4MN4 C;  2QTS A;  3QH9 A;  1VQ8 V;  4HZ3 A;  1T5E A;  5KLV J;  3T4D A;  1LWU A;  1JY3 N;  2CE4 A;  4MVO A;  2OIG A;  5KUK A;  1GK6 A;  2A0L A;  3OEH G;  5L3F A;  2LXB A;  2QWR B;  1LTJ A;  3CS5 A;  1MA1 A;  2W0F C;  1Y9B A;  1Q6I A;  2I8D A;  1NH2 D;  2E3C A;  3A0B H;  3FYE B;  1VQK V;  2JWD A;  4WFE A;  4I7Z B;  3A0H H;  5KLV E;  5APS A;  3C9I A;  3CPW O;  1YJN P;  3C90 A;  3GW6 A;  1QLE B;  2DMX A;  1JY2 P;  4DV7 O;  1S5L Z;  2NLJ C;  4YJ3 A;  2MKV A;  2LXC B;  3KHU A;  5AW4 B;  4C7U A;  1GM8 A;  1NU1 J;  4AUW A;  3M06 A;  2Z5H A;  2FML A;  4I9W A;  2KZJ A;  1PPJ D;  4PDV A;  1VQ4 V;  3GF7 A;  1LTA C;  2GBO A;  2QG4 A;  3TXS A;  3GG2 A;  2JGU A;  2NR5 A;  2PI5 A;  3UKM A;  4LF7 B;  3C3T A;  2I1J A;  1N7S A;  5JCO C;  3W67 A;  2ZIN A;  4X65 B;  2QM8 A;  3V4Q A;  1SQX G;  1TGO A;  4NTX A;  5CA0 B;  3I5D A;  2XAQ A;  3CSX A;  4OGQ C;  5CCH C;  1BE3 H;  3AEA C;  1NU1 E;  4GX1 A;  3B71 A;  5IY5 C;  1FXK C;  1G4Y B;  5K1X A;  1IZN B;  1U7J A;  4BW5 A;  5LA6 B;  4WFB V;  1CI6 A;  2DYR C;  5JJN B;  4JAU A;  1JJO A;  2L35 A;  3ZHS A;  1NTZ D;  2Y0C A;  2VQE B;  2Q3I A;  4ZKI A;  2VQF B;  1JY3 P;  3GF3 A;  5TIS Z;  3CCL V;  1Q81 W;  1ZV8 A;  4MSW C;  3N2G B;  1NR7 A;  2CDY A;  2CGO A;  2FFD C;  2QTO A;  2ZJS E;  5LP6 B;  1AI6 A;  3S1K A;  1M57 C;  1M1K W;  3BA8 A;  3HUS C;  5B66 E;  2N9Y B;  3LDE A;  3T1H B;  4EOT A;  3APO A;  3FWL A;  1K05 A;  1R6N A;  1W0K G;  4K35 A;  5D5Q A;  5DN6 G;  1J5E B;  4H0L C;  3O6Q A;  1E1R G;  1BMF G;  1OW7 A;  5JCO A;  5B3S B;  2Y4U A;  1HGZ A;  3OTO O;  3AG3 C;  4XFJ A;  3KDP B;  5C8Y A;  2K3R A;  1DIP A;  1WJZ A;  5APQ A;  2FYU D;  3H1J J;  3GMA A;  1QR8 A;  3CC2 P;  2XTA A;  1DEB A;  3JSN A;  5KAI H;  1BGY J;  1VP7 A;  1SQX K;  3RK2 B;  1DTO A;  3E2E A;  4JTA B;  3CB2 A;  3L71 D;  3N27 A;  1DF5 A;  5CBF A;  3A5T A;  3TF5 A;  2F66 C;  4HYO A;  3WUV A;  3G3Z A;  2SPZ A;  5K1P A;  4DT0 A;  3LNN A;  1VQL P;  3R65 A;  3U1C A;  1JR9 A;  3FB6 C;  3H1J E;  4KL1 A;  5EIB D;  3U0Z A;  2HEP A;  2QKA A;  2BTQ B;  1OCR C;  1BGY E;  2YI9 A;  2QKC A;  1MSW D;  4ZNC A;  1DH3 A;  4UB8 Z;  1OZH A;  1AR4 A;  2FYU H;  2JRI A;  2P22 C;  2YIU B;  4DK1 A;  2F4V B;  2OYH A;  3LUT B;  2QRX A;  3C3S A;  3X2Q B;  3O65 A;  2N74 A;  4JPZ B;  3RVZ A;  2JWA A;  2NN4 A;  4JYA O;  4CZZ A;  4AYC A;  3AED C;  1DF4 A;  3U59 A;  2H88 C;  3P32 A;  4MTO A;  5GTH H;  1XNR B;  3HR0 A;  4B7E A;  1LTS C;  4TT3 H;  5LBQ A;  1U7M A;  3RFR A;  2EIL C;  1LUW A;  1QX8 A;  5APX A;  1YI2 P;  1A32 A;  4MTG A;  5AW0 B;  2F1M A;  2JGD A;  1R3I C;  4WBN B;  1LUV A;  2QSI A;  4LF4 B;  2Z0A A;  1FD9 A;  1RPO A;  4DV0 O;  5H2F Z;  1GTO A;  3CJH A;  4RAI A;  2EBO A;  1P84 D;  3L73 D;  2E5L O;  3EFG A;  1SQP G;  1XNQ B;  3RYI B;  2XND H;  1H8A A;  1IFM A;  4TQF A;  3U10 A;  3VQW A;  2EZP A;  2IJJ A;  1LGH B;  2OGU A;  4MW8 A;  3HKD A;  1KYO D;  1S2E A;  3E1I A;  3SR2 C;  3L70 H;  3CX5 D;  2EZO A;  1KEC A;  1GL2 C;  1KQL A;  4JV5 B;  4GX0 A;  5AVT B;  1FAF A;  3TGU J;  1BCC J;  1DD3 A;  4JI1 B;  1VQ9 V;  2IZ0 A;  3G6E V;  4UVC A;  1AR5 A;  3UT5 B;  4PD4 D;  2ZE7 A;  2R72 A;  2WSE H;  3IF4 A;  1FJP A;  5AW8 B;  3A3Y B;  1VF7 A;  3AE1 C;  2K9Y A;  4H33 A;  1OJH A;  1TAE A;  1WP8 A;  3L73 H;  3RVY A;  3AG2 C;  1RQU A;  3L74 J;  1FZC C;  1MOF A;  2JEU A;  3JYC A;  5KA6 A;  3RYC B;  4LFB O;  5IDJ A;  3MGN A;  2CTQ A;  1FZF A;  1FYJ A;  1HDJ A;  1I94 B;  3TGU E;  4X20 A;  2W6J H;  1BCC E;  1KYO H;  4XDJ A;  1CPY A;  3GWK C;  1Y76 A;  4LNU A;  2N1T D;  2ILM A;  5LHI A;  2WMM A;  1QL1 A;  1UPG A;  1PP9 H;  3MHS C;  5IYB O;  3JD2 A;  3P8C E;  3OAA G;  1OCO C;  1S72 P;  3UO3 A;  1QLN A;  1H88 A;  3L74 E;  1XL4 A;  4DR6 O;  1D2D A;  4LF5 O;  2YNY A;  5CA0 A;  4I55 B;  2HHH B;  3JSV C;  2W6J G;  3JCU H;  1OV9 A;  3ICX A;  3HD7 C;  4UCU A;  1OCZ C;  1SQP K;  4OVN F;  5GTI E;  2A7W A;  2KOG A;  5J2U B;  3K9A A;  4J11 A;  1S3J A;  1PP9 G;  1IZ3 A;  2R70 A;  2FL4 A;  1EZV H;  1GDT A;  5B1A B;  4J9Y B;  3S3W A;  4J80 A;  1T6A A;  2BOC C;  1RM1 B;  4BXL A;  2ZM6 B;  3A7O A;  3CCE V;  2FXM A;  2CK3 H;  2KQX A;  2ZAE B;  4ZKU A;  3BVO A;  3M0A A;  2EJ7 A;  2IBZ H;  1VQO V;  4B3M B;  3LID A;  4QGP A;  1JMB A;  3CD6 P;  2B5U A;  1BQZ A;  1L4A B;  1AV1 A;  1N2D C;  3E22 B;  1FZC A;  1IUR A;  1EZV G;  1KB9 H;  2O01 J;  4JI7 O;  5CJ4 A;  1F4M A;  3CWB D;  2IH1 C;  4N78 D;  1SFC C;  1SKV A;  4JAS A;  4UV9 A;  1K97 A;  2CK3 G;  1OCC C;  3W7U A;  1WMK A;  1JOC A;  3MD0 A;  2IBZ G;  1HH0 A;  4J7Z A;  2VS0 A;  3L4F A;  4ASV A;  4LWS B;  1NTM D;  3FX7 A;  3G4S P;  3TK1 A;  3MIW A;  2M6Y A;  2L5G B;  3H1L J;  3ABU A;  4U7O A;  1SQF A;  1GTW A;  3LNM B;  2QJK B;  2XKM A;  4L87 A;  1M7L A;  3WB1 A;  1X59 A;  2ITA A;  1PFI A;  5IYZ B;  2WSS H;  1TUB B;  3B5N C;  4RUE A;  3L75 G;  2QA4 V;  5KHG A;  2BOB C;  2IZ1 A;  1LT9 B;  1R1B A;  3KXD A;  1YIT P;  3CMA P;  3CWB H;  3VQY A;  3K5L A;  2OYQ A;  3AE7 C;  5L3B A;  2FXP A;  2Z3Y A;  1YQ3 C;  3STL C;  4PJ0 Z;  5IYC O;  2WPS A;  1PNK A;  3B4S A;  3H1K G;  3H1L E;  2Y4T A;  3D36 C;  1N0J A;  2UXD O;  1KIL D;  2ZDI C;  2ZVN B;  3I5C A;  3CCM V;  1NTM H;  1YJW V;  1L0L J;  3RYH B;  3BAS A;  1SQB D;  2NPS B;  1SLQ A;  4LBE C;  5EYP B;  4DW0 A;  4TOI A;  1OIP A;  2KI7 B;  2P7J A;  2J59 M;  4JF7 A;  5AVY B;  4B86 A;  1SS1 A;  2HJF C;  5APV A;  1FDI A;  1PIX A;  2DYS C;  1L0L E;  3IFX A;  2PI4 A;  1FOS E;  1HTL C;  2IFM A;  2C0W A;  1IX9 A;  1S4X A;  2KP8 A;  2LQT A;  1ENV A;  1JNM A;  1B6Q A;  4N21 A;  3FKS G;  4X88 A;  3EHB B;  1FDO A;  1EN5 A;  3K59 A;  1X9V A;  1HWT C;  4DV3 O;  1SQB H;  3V2Q A;  2OIE A;  2Z5U A;  4GUN A;  4JI2 O;  2LKM A;  2JEX A;  4DV4 O;  2ZXW B;  4JQ0 D;  4YIP A;  4EI2 A;  2GV9 A;  3ZRS A;  5KLV G;  3P8M C;  1FJG B;  1VF6 C;  3WB0 A;  1OFC X;  3O9O A;  5AVW B;  1E5W A;  3A2A A;  1DEE G;  3L37 A;  1XRE A;  1GH6 A;  2XV5 A;  2EIK B;  4YPC A;  3HKB B;  1FKA O;  3SFE C;  3JAS B;  5KUM A;  1NTZ J;  4X1K A;  1FXV A;  1ZWI C;  4JF3 A;  4JI0 O;  2OT5 A;  4DR1 B;  4JI8 O;  4AQY B;  3FXD A;  4ZOL B;  1K8A W;  2R3S A;  2IX7 C;  4YJ2 B;  3D3Q A;  2FY8 A;  2QEX P;  4D6T D;  4F6R B;  2LP7 A;  2RH0 A;  1YYC A;  2RMK B;  3STZ C;  3SWF A;  1B06 A;  3OFN G;  1SZX A;  4LFA B;  3K5M A;  1L0N D;  1NU1 G;  2OTL P;  2B1G A;  4ASU G;  4RO0 A;  1EDK A;  3WG7 C;  1NTZ E;  2HPC B;  4R50 A;  2EIJ C;  3CRA A;  4F4L A;  2JR8 A;  4YY3 B;  3Q4H A;  4FLU A;  5KTB A;  1BSH A;  5AVS B;  3I55 V;  4JAA A;  1N8R W;  2A06 D;  1J1D C;  4CH4 A;  1EDL A;  2GUZ A;  1LWU B;  2KB7 P;  4FZ1 A;  2IFN A;  1H2K A;  2CH7 B;  4B08 A;  1W2E A;  4DR5 O;  4O4L A;  4FLY A;  3U11 A;  2NNU A;  2UXB B;  3CXH F;  3CI9 A;  5AVR B;  1VF6 A;  4X1Y A;  3ABV C;  4LF8 O;  3CC4 P;  2YIB A;  5TIS E;  2KSE A;  2QJY B;  1V55 B;  2ARH A;  5KLV K;  5J2U A;  4QIW F;  3AG1 B;  1RSO A;  3ABT A;  2YS8 A;  4LFC O;  3ASO B;  4HYT B;  1Y67 A;  4YJ3 B;  2CTR A;  1IBK O;  3BCC J;  2A06 H;  1N36 B;  4B3S B;  2ZYA A;  3F89 A;  3OAK A;  1MSD A;  1SQQ J;  3AK2 A;  4WBA A;  3W7T A;  4A5U B;  4YHH O;  1KB9 F;  2VWK A;  1N7S B;  4QE9 A;  4CS2 A;  1FBM A;  4UCS A;  4JI6 B;  2P4V A;  1PZQ A;  1BGY H;  4X66 B;  5JVD B;  5CA3 A;  3QVN A;  2Q6Q A;  5DJT B;  2OQQ A;  1NVP D;  1VQ5 P;  1NU1 K;  1EZJ A;  1W59 A;  3BCC E;  1YTF D;  3JD0 A;  2WSF H;  1SQQ E;  2Y69 C;  2WLK A;  4LWS A;  2J5U A;  3S3X A;  1XOU A;  4K0K B;  3H1J G;  2PZS A;  1K8A Q;  1CI6 B;  2BEQ D;  1JMK C;  1BGY G;  4ABM A;  3CCU V;  2H43 A;  2IYO A;  3MUD C;  2V4H A;  1K04 A;  1M56 D;  1XTG B;  2KKW A;  2X6B A;  5IYZ A;  1SRY A;  2AXT E;  1TUB A;  2PYJ A;  3ML0 A;  3JCZ A;  4JI3 B;  4UB8 E;  3U1A A;  1QNM A;  5E79 Z;  4YXW H;  2NRG A;  1KQG B;  1M1J C;  4DR4 O;  3E7K A;  1EXI A;  1J95 A;  3WFV A;  2OTJ V;  1N8R Q;  1IVS A;  5KAF H;  2Q0O C;  3JD1 A;  3CLQ A;  4LH7 A;  4NXM O;  3L72 J;  4UCR A;  3IN6 A;  3O6Q B;  1ZP0 C;  2P4K A;  5EIB C;  1P84 E;  1SQV J;  1RF0 C;  2GDS A;  2KS1 B;  3GHG C;  1Y74 A;  3CME P;  2UU9 B;  1WN7 A;  1H0T A;  4GOE A;  3B2E E;  1HNZ O;  3DGE A;  3VMA A;  2HP8 A;  1TVK A;  3K0D A;  1S5H C;  1PGJ A;  5H2F E;  2ZT9 D;  3CX5 E;  2HG5 D;  2ITD C;  3L72 E;  5IY5 B;  1FXK B;  4B3T O;  1U57 A;  3OMN B;  4JYY A;  3LSU A;  2JS3 A;  2DQ0 A;  1SQV E;  2DYR B;  4U3J B;  3R4Y A;  2BSK A;  4DUY O;  3MUD A;  1MFZ A;  2XT9 A;  2N05 A;  2E76 D;  1P7G A;  4XDK A;  4LF9 O;  4GKG A;  2HYN A;  2LGW A;  3GB7 C;  2FXO A;  4O4I A;  4I50 B;  3T1Y B;  3WU2 E;  4DXW A;  1M1J A;  3TDK A;  2FFD B;  4XE5 B;  1GM9 A;  1M57 B;  3HUS B;  1DD4 A;  3L74 H;  5K5G B;  1XDC A;  1KV4 A;  3FD9 A;  5LMN O;  4MW3 A;  2Q73 A;  1BCC G;  4H0L B;  5H6Q A;  3K04 A;  2C2A A;  3ZBH A;  3A0B Z;  3HKB A;  1RF0 A;  4ZMD A;  3GHG A;  3JAS A;  1TU3 F;  3CXH I;  5B5E H;  2WA4 A;  3A0H Z;  1IO4 A;  3CRM A;  3W7W A;  4W7Z A;  2KSD A;  3AG3 B;  3OUF A;  2A9H A;  5CMZ A;  5DED A;  3F7Y C;  3K57 A;  1JX9 A;  4DO2 A;  4GCZ A;  3PN1 A;  3L74 G;  4ZOL A;  3HRN A;  1EZV I;  5BXZ A;  2AW9 A;  1X79 B;  4PV1 D;  3H1H J;  3QTC A;  4DV7 B;  2B1I A;  4EFE A;  4PA9 A;  4DR7 O;  3CJH B;  2EJR A;  1KC8 Q;  1XEQ A;  3K79 A;  3L9D A;  2MW2 B;  1FC2 C;  1LTT C;  2IBZ I;  4FK5 C;  2C0X A;  1SQX D;  5CBN A;  3OR6 C;  3HKD B;  3LW5 J;  5DM6 V;  1KB9 I;  1MZ9 A;  2N1T C;  3D70 A;  3RBZ A;  2LW1 A;  1OCR B;  3H1H E;  5L3E A;  4L73 A;  1D5N A;  2CH7 A;  4LF6 O;  2ZNJ A;  3L36 A;  1EN6 A;  2B9B A;  2XNX A;  3OTF A;  3PTZ A;  4WY4 D;  1V9P A;  2YKP A;  3ZMT A;  2KLU A;  1FS0 E;  2RDC A;  2X6C A;  1OX3 A;  3UM7 A;  4FFB A;  1HR0 O;  3CCS P;  2K1E A;  4M3L A;  3OEE G;  3HKC A;  5A9G A;  1S9K D;  3M9Q A;  4KHX A;  1BE3 D;  1VQ7 V;  4J42 A;  4RUF A;  1OW6 A;  1SQX H;  3CE2 A;  3CCJ V;  2EIL B;  1K7D A;  1NR1 A;  3QO5 A;  4X20 B;  5FPO A;  5JH7 B;  2Q6A A;  1S77 D;  2WZ7 A;  1Y76 B;  2LGQ A;  4LNU B;  4NPF X;  3H1L H;  2WLI A;  1KUQ A;  5JWP A;  3MTU E;  4EB6 B;  5APY A;  2WWW A;  1S0V A;  1AJN A;  2UXX A;  2P90 A;  4I4T A;  3QF7 A;  5JVD A;  3CP1 A;  1YJ9 V;  1VQ6 V;  1WAZ A;  2WLJ A;  3ZS8 C;  2G3A A;  2BEZ F;  5AW7 B;  1NKZ B;  3H1L G;  1OWA A;  4IYI A;  3OTO B;  2N1T A;  5KLI C;  3ETG A;  2YMY A;  1WB7 A;  2P1J A;  2WLM A;  2V1D A;  5JQG A;  2WSC H;  4PJ0 E;  4LGD E;  1GL2 B;  3L35 A;  1KQF B;  1FFX B;  3TET A;  2F95 B;  3MDS A;  1T3U A;  1SET A;  3BAB A;  4N3Y B;  2M3E A;  4HBN A;  4X8A A;  1LNQ A;  2YID A;  1GD2 E;  1MG1 A;  3AG2 B;  2E42 A;  1H2L A;  1FZC B;  4LLH A;  2D3O W;  3JC2 2;  1GK9 A;  2ZNI A;  2NZ2 A;  2YDE A;  2KB1 A;  1L0L G;  1S5J A;  1IFJ A;  4PA6 A;  2ZFC A;  1UJW B;  4HKZ H;  2WT7 B;  3FWN A;  3MP7 B;  5B1N A;  2OCC C;  3SYQ A;  1Q3E A;  3VP8 A;  4G27 B;  1KIL C;  1G8M A;  5JJE B;  1OCO B;  4P9O A;  1GO3 F;  4FLZ A;  4H13 D;  4TSF G;  2KS1 A;  1H2S B;  4R4M A;  1ZSP A;  3T2M A;  1S5L H;  4X64 O;  5LMU O;  2R9I A;  2JO1 A;  1QL2 A;  2P58 A;  3HD7 B;  1GM7 A;  5CCH A;  2W27 A;  1L0N J;  1GN6 A;  3AE4 C;  3F5T A;  2YKO A;  4JYB A;  4MTX A;  1FXK A;  4OWF A;  1IBL O;  3AE9 C;  5GW7 A;  4L74 A;  1OMI A;  5IT9 N;  4DV0 B;  4U3J A;  1SQP D;  1B04 A;  5EBW C;  4TUY A;  2FYZ A;  3CCQ P;  1CP9 A;  1YQ4 C;  2E5L B;  3EQ2 A;  3OJA B;  2KG7 A;  5ITZ B;  5BR8 O;  2XAH A;  1SES A;  4I50 A;  1F4N A;  1L0N E;  2AXT Z;  3JAT A;  4MVU A;  2FFD A;  4N6J A;  2YI8 A;  3AE2 C;  3H1I J;  1SFC B;  1URQ D;  4L75 A;  3HUS A;  1H38 A;  1ZW0 A;  2OCH A;  4ICG A;  1OCC B;  4FJC C;  1NTZ G;  5AW9 B;  3PP5 A;  1Q5O A;  2H8P D;  1S76 D;  1NAY A;  2OTK E;  5CCG D;  5LL6 Y;  1L0L K;  5TIS H;  2XUM A;  1AJP A;  4BWN A;  3G71 P;  1NTK J;  2UXC O;  1SQP H;  3L70 D;  2ZR3 A;  1OXZ A;  1ZRT E;  4X62 O;  4HH2 A;  3ZMZ A;  3H1I E;  4DR2 O;  2Q3E A;  2ETN A;  3W68 A;  4CH3 A;  4LFB B;  3KZI H;  3CYO A;  4E4E A;  3UCS C;  3CCR P;  1J5E O;  2XHB A;  2KSJ A;  1W0J G;  1HNX O;  2MK3 A;  1W5C E;  1OVR A;  2YSU B;  1ZME C;  1NTK E;  1PM9 A;  4KHP O;  2WTY A;  2Q68 A;  2FKX A;  1IDS A;  1E79 G;  3E8H A;  2RQ6 A;  4JI5 O;  5KJ7 D;  4PA7 A;  1FJK A;  2HLD G;  4DR6 B;  3E1R A;  4MTF A;  1T8Z A;  1HBW A;  3JCU Z;  4LF5 B;  3BCC H;  3AK1 A;  3FXE A;  1PL5 A;  1PP9 D;  2HKO A;  1SQQ H;  4X1K B;  3THO A;  1U96 A;  3B77 A;  2E74 D;  3JAW B;  1Z56 A;  4MVS A;  4IL6 X;  1XBL A;  5FLX N;  2WPR A;  3WU2 Z;  2O57 A;  2EIM C;  1FU1 A;  4DZO A;  1RP3 B;  2WPQ A;  5APW A;  2IJK A;  2N9B A;  3CHX A;  4DUZ B;  2Q7E A;  1LTB C;  2H7H A;  4C7N A;  1CSB A;  1FZB A;  4TLF A;  1SS3 A;  5EC1 C;  4L76 A;  1VF5 D;  3CXH D;  3V6I A;  3KG2 A;  4U3F J;  1GMJ A;  2DYS B;  3BCC G;  2QWP B;  1NTZ K;  1BHB A;  1SQQ G;  2UXN A;  4JYC A;  1L1F A;  1EZV D;  2LR2 A;  3VBB A;  3AG4 C;  2F4V O;  4TV8 A;  3Q4H B;  1YJN V;  3K08 A;  4JBZ A;  3TSI A;  1P49 A;  1CXZ B;  5JH7 A;  2HFE D;  4JI7 B;  1SF9 A;  3OGC C;  2GUZ B;  5BZB A;  3P7K A;  3V2N A;  1R6K A;  2IBZ D;  2Q69 A;  2PGG A;  3E83 A;  2R9R B;  4EB6 A;  4U3F E;  4FLV A;  4CC5 A;  5B1O A;  4KFM A;  2B89 A;  1YEW A;  4O4L B;  3T4Z A;  1KB9 D;  3RWR D;  3IAY A;  1JTH A;  3S4R A;  4NR1 A;  4X1Y B;  4FLX A;  1SVF A;  2YXY A;  3CXH H;  4UB6 Z;  1AVY A;  2KZI A;  1YIJ P;  2W83 C;  5E79 E;  2E75 D;  1E1Q G;  1ZXG A;  3ABK C;  5GON A;  1XTC C;  1RSO B;  1GL2 A;  4O9B A;  5J2T A;  3MZW B;  1FOS F;  1IFI A;  1FFX A;  4EEQ A;  3ITK A;  1GN2 A;  4AIL C;  1VQN P;  4IL6 H;  4IT5 A;  1K92 A;  1NH2 B;  2AZ2 A;  3RK3 D;  1M56 C;  4YTP C;  3TNU A;  4TWK A;  3IFM A;  2PGD A;  4L8J A;  2BCC J;  1US6 A;  1EBO A;  2DJV A;  2Q9I A;  3RL0 D;  1QQC A;  1XI1 A;  2UXD B;  1G1I A;  1LP1 A;  4UV8 A;  2QWO B;  3L72 G;  2EIJ B;  5APT A;  3SPJ A;  1SER A;  5CBO A;  2ZKO A;  2K37 A;  4JGS A;  3I56 P;  4CS4 A;  1Q43 A;  1SQV G;  2WT7 A;  1SQQ K;  1J1D B;  3FAV A;  4X1I B;  3L75 H;  1MNG A;  4NKG B;  1HJB A;  1ZR2 A;  2YKQ A;  1OHH G;  3SDL A;  2BCC E;  2HOD A;  2Q0A A;  2JIZ G;  3FFQ A;  3H1K H;  5C93 A;  2ZXE B;  2A79 B;  3SYA A;  1XMO O;  3CCV P;  3BVH A;  1Y6X A;  3VYI A;  3HD7 A;  2DN9 A;  1JCH A;  3CC2 V;  4RWU A;  5CMU A;  2D2C D;  2ZT9 C;  2HG5 C;  1FZE A;  1VAR A;  1F23 A;  1J2J B;  4UCT A;  4DV3 B;  1SQG A;  1RFY A;  2KXP B;  4JI2 B;  2PFX A;  5AVZ B;  1G1J A;  1Z2G A;  4DV4 B;  1VEW A;  5JJJ B;  2RJZ A;  1DX7 A;  1JOY A;  3A0B E;  2IJH A;  5ITZ A;  1VQL V;  2E76 C;  2VRS A;  3ZHV A;  2JEE A;  3A0H E;  4W4K A;  4CH6 A;  2RN9 A;  5IWA O;  3H1H H;  1Y74 B;  4CBC A;  2ZCE A;  1WP7 A;  2Q67 A;  1SFC A;  1H0T B;  3M91 A;  3E8F A;  1QVG U;  4H44 D;  1TVK B;  4B3M O;  1LTI C;  1WRG A;  2AEJ A;  1BE3 J;  4JI0 B;  4JI8 B;  1HNW O;  4I0X A;  1N34 O;  2Y69 B;  3CEI A;  1IJD B;  4G28 B;  1GU5 A;  1R6T A;  4WFG A;  3FB8 C;  3DC5 A;  1SQV K;  1THZ A;  1QGK B;  5LHG A;  1O9G A;  3WUU A;  4TV9 A;  1NS1 A;  3H1H G;  4I5S A;  2QJ1 A;  5KLV H;  1PKX A;  5FNV B;  2BSK B;  4BIO A;  4J7J A;  3V2P A;  1NKD A;  1YBK A;  4R6Z A;  1ZN5 A;  3M8A A;  4DV1 O;  1YI2 V;  3AE3 C;  3ZN0 A;  2X6A A;  3CC7 P;  4O4I B;  3B5N A;  4WFA V;  1YXB A;  3K9S A;  1N73 C;  1BE3 E;  4PV1 C;  1GZL A;  2IU0 A;  4WF9 V;  2IH3 C;  4WFF A;  1M1J B;  3SYC A;  2P10 A;  1JB0 J;  1RY3 A;  3RN4 A;  3D71 A;  2K1A A;  4N23 A;  1VQM P;  3BA9 A;  1AFO A;  5EZY A;  1FZA A;  2QJP C;  3D36 A;  4UFZ A;  4DR3 O;  1PPJ E;  4DR5 B;  2ZDI A;  4GKK O;  5AVX B;  3QWO C;  4BRY A;  4ZKP A;  2W90 A;  3FGA D;  2DW3 A;  1TUE B;  4LF8 B;  2B87 A;  1NU1 H;  1XMQ O;  3GHG B;  1GU4 A;  1H2M A;  4DV2 O;  3P3P A;  3JAW A;  4PJ0 H;  2XDJ A;  1WPX A;  4O2B A;  4WY4 C;  3IC9 A;  1AJY A;  4Z2W A;  4LFC B;  3K58 A;  2Z5I A;  1L2P A;  3QNE A;  2GUV A;  3AEC C;  1IBK B;  1J1E C;  2UUB O;  3RGB A;  2KUB A;  4GOF A;  3CRR A;  2ATK C;  1ROP A;  1D7M A;  3AEB C;  1OW8 A;  1NI8 A;  2WLH A;  4C7R A;  1JQ0 A;  1KU9 A;  1A02 J;  2XAF A;  2Y9Z A;  2W0X A;  4U7N A;  5DJU B;  3D6Z A;  2QR4 A;  2PF4 E;  4PHZ A;  1T2K D;  3GVM A;  3J80 N;  3VQV A;  4DV6 O;  1QLE D;  5B66 H;  3BY6 A;  1JA8 A;  4PA3 A;  3OW2 U;  5KMG B;  4IHJ A;  3T97 B;  3ASN C;  4XDL A;  5B1B C;  5AW3 B;  3H25 A;  3OE7 G;  1Y66 A;  1SC5 B;  1NBM G;  4OXS A;  1GRJ A;  2HVK C;  1S72 V;  2R3C A;  1P84 F;  1BSN A;  2FYU J;  3H1J D;  1JCD A;  2WQY C;  5LYJ A;  2W6I G;  3E86 A;  1BGY D;  1K9M Q;  4FFB B;  4GKJ O;  3A2F A;  2ZD9 A;  4LC1 A;  1USD A;  1GKF A;  2OYO A;  2M5A A;  5BY1 A;  3L71 J;  4UCV A;  3HKC B;  1YVW A;  1WNS A;  1VQ8 P;  4MVZ A;  3CX5 F;  1AQT A;  3ZDM A;  1JM0 A;  3C1L A;  3B8N A;  2MJZ A;  2W6B A;  4DRX A;  2QM7 A;  1RPR A;  1Y47 A;  2YMK A;  1BDC A;  1QBZ A;  3ZMU A;  2FYU E;  2LO1 A;  3TJT A;  3APQ A;  1KOR A;  3H6P A;  3SWY A;  4UUJ C;  4DR4 B;  3FB7 C;  3KPE A;  2H89 C;  2WLI B;  1LT1 A;  5E1A C;  3CXC U;  1KP3 A;  1P4R A;  4LCU C;  5KAF Z;  1R8E A;  1H8H G;  1K73 Q;  1VQK P;  2FKW B;  4Q20 A;  3L71 E;  2AEM A;  2XOK G;  3ZN1 A;  3CD6 V;  3H1J H;  4I4T B;  3M0D C;  4NXM B;  5GTH E;  1XHZ A;  2KIK A;  1VQP P;  1G1X B;  2IJI A;  3K03 A;  5EFW B;  4F6E A;  3EVK A;  1ZR4 A;  3VMY A;  1IC2 A;  2N1T B;  3BFR A;  4X1I A;  5EBL C;  1FPO A;  2UUA O;  3L70 J;  5JQG B;  1R5S A;  3KYQ A;  1HNZ B;  1AI4 A;  1VQ4 P;  3G4S V;  3F5H A;  4H13 C;  2QGN A;  1Q8I A;  1IK7 A;  2UUC O;  1L0N G;  1ORQ C;  4B3T B;  2GSM B;  2YXL A;  5F2V O;  3IJ4 A;  2AGA A;  4NPD A;  2WSE J;  3H1I H;  1QVG O;  4HAM A;  1ZX3 A;  1RH5 B;  3L73 J;  2W8Z A;  4MVR A;  4DUY B;  1X4T A;  3SJA C;  1N86 A;  1IFN A;  2WAM A;  3L70 E;  1YIT V;  3RK2 D;  3P3N A;  3CMA V;  4LF9 B;  3OM3 B;  3Q5R A;  2CTP A;  4FLT A;  2UXB O;  4B7K A;  1KC8 W;  2WIT A;  2XU6 A;  4NVP A;  4XBF A;  1NTK H;  2Q7C A;  4HJG H;  1NOH A;  2HVJ C;  4KP4 A;  3H1I G;  3NTN A;  3PLN A;  2QDO A;  1RF1 C;  4K8Z A;  1GN4 A;  3KQG A;  3D8C A;  5IJ0 A;  3L73 E;  3CCL P;  4O4H A;  1Q90 D;  5LMN B;  3M0D A;  3K5O A;  2P6J A;  5AVQ B;  1ZTE A;  2KNC A;  2Q9L A;  3LIE A;  2X7R B;  1Q82 Q;  1URQ C;  5B5E Z;  2YO3 A;  1HUC A;  1NTK G;  4PDM A;  4OGQ B;  4I9Q A;  1KYO E;  1PGQ A;  1MZF A;  3L74 D;  1K4D C;  3HE4 B;  3GLM A;  5KLI B;  1UIX A;  2H8P C;  1NHL A;  1H8E G;  1Y4M A;  1N7L A;  2V7Q J;  5CCG C;  3K5B A;  2A3Q A;  2QM4 A;  2VRZ A;  5KHH A;  1EDI A;  1RQV A;  3V4W A;  3VOP A;  4UXN A;  4A7P A;  3JAR A;  2EIK C;  1GAX A;  2R44 A;  2Q1K A;  4DR7 B;  1I0H A;  4TUY B;  5FNV A;  1VL2 A;  4PD4 E;  1F7Y A;  1HVV A;  1NYH A;  3JCU E;  2KG7 B;  3TGU H;  1BCC H;  1L0N K;  3WUT A;  1RE4 C;  4IIJ B;  3OD4 A;  1ZL8 A;  3JAT B;  5A2Q N;  3HPL C;  3K0G A;  1Z5W A;  3CRC A;  3OR7 C;  2Z4E A;  3WB2 A;  4GLX A;  2I1K A;  2QVA A;  1L8D A;  4U3F H;  4ZBM A;  3ETD A;  4QPJ A;  1PGO A;  2WLN A;  5IE9 A;  1N32 O;  1M90 Q;  3H32 B;  2OCC B;  5KJ7 C;  2O3J A;  3HTK A;  3ETE A;  2PY5 A;  1KIL B;  1S1C X;  3OW2 O;  3TGU G;  1V54 C;  5CJ0 A;  3J7A U;  1USE A;  5E79 H;  1Z5V A;  5GTI H;  3N2K A;  1HR0 B;  2E74 C;  5CA1 A;  3ZIA G;  2X0L A;  2JJL A;  4U3F G;  4BW9 A;  4B3R O;  1URQ A;  4X9Q A;  5AW6 B;  2F93 B;  2PRR A;  2K9P A;  2RNB A;  2OYI C;  4Z1M G;  4ASW A;  5D5P A;  2W6A A;  1LTJ C;  4HNA A;  2QEX V;  1VF5 C;  3CWB J;  5CCG A;  4OX9 O;  1YTZ I;  1NTK K;  1ZLL A;  2M7W A;  1NVO A;  3LDC A;  5AG2 A;  3VMZ A;  4NB5 A;  4DV5 O;  2OTL V;  4UB6 E;  3PRJ A;  3NXS A;  1NTM J;  2JS5 A;  2HFE C;  1EN4 A;  5KMG A;  1Q2N A;  1X22 A;  3H1L D;  3T97 A;  1RE4 A;  2CPB A;  3UIA A;  2IM9 A;  4RES B;  3R66 A;  4QPK A;  2P7T C;  3CWB E;  1KQS U;  4N78 E;  3RT3 C;  3VQX A;  4CS3 A;  2LW7 A;  2BCC H;  1BL8 A;  4GYC B;  4FVM A;  2WLL A;  2EIN C;  4C7N B;  2O01 H;  5IJ9 A;  2H94 A;  2P67 A;  1Q6U A;  2C9L Y;  3T1C A;  3CC4 V;  1NTM E;  2YIB D;  3AE6 C;  1JCC A;  4PI0 A;  2E75 C;  3VN0 A;  2WA3 A;  1VDF A;  1QCE A;  3QO8 A;  3ZMS A;  4TV8 B;  3W7X A;  4JI4 O;  4O2A A;  2BCC G;  1YF2 A;  1QVF U;  3O8Z A;  4MT8 A;  1L0L D;  2LFS A;  1VQ9 P;  3G6E P;  2OYI A;  2JKV A;  1SQB J;  3II6 A;  4IYH A;  3RK3 C;  2BE3 A;  1S5L X;  5LOV A;  4NXN O;  3UO2 A;  1O9H A;  3RL0 C;  3ZMV A;  1L4A D;  3MAQ A;  1FZG A;  3ZHQ A;  1JTH B;  2QWQ B;  5HFM A;  4O4J A;  4PDL A;  1KD1 Q;  2YC0 A;  1VQP V;  3ZRW A;  2PUS A;  3RW0 A;  3ZJZ A;  1KIL E;  1NQT A;  1VQ5 V;  3S9O A;  3QG5 A;  4X64 B;  1SQB E;  1IBM O;  5GON B;  5LMU B;  2GM4 A;  2H3O A;  5KAI Z;  1NGM B;  4QMA A;  4LR3 A;  4QE7 A;  5J2T B;  2EIM B;  1N0N A;  3KCX A;  1L0L H;  5FPR A;  1QEX A;  2WVR A;  4QJF B;  1N33 O;  2KK7 A;  4C46 A;  1M93 A;  2Y0P A;  1IBL B;  1KBH A;  1H2N A;  3ZX6 A;  3B09 A;  4FM1 A;  1X8Y A;  3TNU B;  2PTM A;  1AIL A;  1R5L A;  3V5B A;  5BU8 B;  3DXR A;  4IFD K;  1LP1 B;  2D2C C;  1QR9 A;  4CC6 A;  4J10 A;  5L8R J;  2GHY A;  5BR8 B;  2DQ3 A;  3AG4 B;  1D5A A;  4DOJ A;  2YEV A;  2YIC A;  4MS2 A;  1R3K C;  1FE6 A;  1ARO P;  4FFK A;  3CCE P;  3FAV B;  3VTP C;  5LXT A;  2P06 A;  3NFQ A;  5BMV A;  1DGS A;  4MVM A;  1VQO P;  4R7C A;  1PPJ H;  2ITC C;  3JAL B;  3OMA B;  4ZHQ B;  1YDX A;  2HOD B;  1W2B O;  3J81 N;  4OPA A;  2P2U A;  1BE3 G;  1CW5 A;  3EFF K;  2NPS D;  2FYN C;  4JYA B;  4D6T J;  2QSA A;  4EYY Q;  1KKD A;  5GTH Z;  5KX5 B;  3CME V;  3SWK A;  5EC2 C;  5H9C A;  3SPH A;  2UXC B;  1VMG A;  1WA8 A;  1NVP B;  1PNM A;  4H44 C;  2E5Y A;  1F51 A;  1OCZ B;  4ZI7 A;  3HE4 A;  3ZRX A;  1YTF B;  2OYH C;  4X62 B;  4UCO A;  4LF7 O;  2DE0 X;  4DR2 B;  3KZI Z;  3ABK B;  1MUU A;  1PPJ G;  1UII A;  1AR1 B;  3ABM C;  3TYY A;  4X65 O;  1YSC A;  1UFI A;  2YIA A;  1HNX B;  4Y99 C;  1JUN A;  5KKZ C;  3RBX A;  1NTZ H;  2O1J A;  4D6T E;  4GT1 A;  4KXR A;  4D7S A;  1M56 B;  2QKS A;  3IGA C;  4KHP B;  2LFR A;  2Q5U A;  3UQ8 A;  1G2C B;  4IIJ A;  4JI5 B;  2QA4 P;  3V2R A;  2JJ1 G;  2AHZ A;  1KTM A;  3JAM N;  1NT2 B;  1PL0 A;  3KKY A;  1FDM A;  3ABL C;  2VQE O;  1KP2 A;  2A06 E;  1NJI W;  2VQF O;  2AHY A;  3BRT B;  3H32 A;  4I0X B;  2E5T A;  2WSF J;  3BAT A;  3OT7 A;  1KIL A;  2POH A;  4I6M C;  1SA0 B;  3CCM P;  1WPB A;  4WCE V;  3K3W A;  1YJW P;  3BCC D;  4R8C A;  4TV9 B;  1R3L C;  3AG7 A;  1SQQ D;  1E79 H;  4JAV A;  1KQS O;  3C8V A;  1ZOY C;  4LP8 A;  3T1H O;  2ADQ B;  3NMD A;  3AEE C;  2L91 A;  3SYP A;  2O1K A;  2Y48 A;  3B5N B;  3PH0 A;  1IK9 A;  2XZR A;  5LGT A;  2ZT9 B;  1AP6 A;  2FBW C;  3L71 H;  5TJH A;  2ZYG A;  4I7Z C;  2ZIM A;  2IW5 A;  3Q5S A;  2Y0E A;  5EZY B;  2DWE C;  1JEK A;  2PAJ A;  1QVF O;  1T2K C;  1QLE C;  4TQD A;  4J41 A;  2FYU G;  2E76 B;  5L3D A;  4BRY B;  4DCK A;  5LGN A;  1Q81 Q;  2BTO A;  2B87 B;  2F23 A;  4W80 A;  2N04 A;  2IU3 A;  4J9Z B;  3FX0 A;  1URF A;  3L71 G;  4RKU J;  3IC7 A;  4O2B B;  1M1K Q;  3ZHT A;  1MFT A;  5KA5 A;  3JAK B;  2IPP A;  5KAF E;  1I5Y A;  4TT3 G;  1K33 A;  1N4C A;  4WFH A;  1JPX A;  4IL6 Z;  3CCS V;  2AXC A;  4NTY A;  5CB4 A;  4UVB A;  2AXT H;  1K4C C;  2RMZ A;  3BPZ A;  4UB8 H;  1AB3 A;  3ZED A;  1EC5 A;  4P30 A;  3L72 D;  1SZT A;  2F43 G;  3SYO A;  1K3E A;  3JD3 A;  2CTW A;  5EBM C;  1SQV D;  4IHJ B;  1HJ0 A;  3LSQ A;  3A8T A;  1N73 B;  2XND G;  4PV1 B;  4BIU A;  2A45 H;  3PHL A;  1H2G A;  1M5I A;  4IFM A;  2M3B A;  4FIP C;  1XNR O;  3WMM 0;  5LYJ B;  3SJQ C;  1XUQ A;  2Q4P A;  1P84 H;  2UWJ E;  1N7S D;  3IAO A;  1NJI Q;  4DJG A;  2XAJ A;  3L70 G;  2QJP B;  4Q6G A;  3E8G A;  1KFN A;  5LP6 C;  2M5A B;  4LF4 O;  3I55 P;  3RL0 g;  4KJM A;  4U7J A;  3L75 D;  2A45 G;  3RGU A;  5H2F H;  2C9N Y;  1XMO B;  3BRV B;  3CX5 H;  4DRX B;  5L3C A;  1VIB A;  3L72 H;  1XNQ O;  2FYU K;  2B9Z A;  4P2Z A;  1YHQ P;  1COW G;  1ZLZ A;  2KLV A;  3L73 G;  3G6B A;  4WY4 B;  1P7B A;  3IR9 A;  2K88 A;  1SQV H;  2ZXX A;  3H1K D;  5DEC A;  3SSU A;  5B3S C;  3H9V A;  1VPC A;  1K5S A;  3HKE B;  1HWY A;  4PD4 H;  3E8B A;  1J1E B;  1NKN A;  2YO2 A;  2Q5Z A;  4JV5 O;  3DTU B;  1NWQ A;  5B5E E;  1JFF B;  1K34 A;  3WG7 B;  1JY2 O;  3RK2 C;  3WU2 H;  1BS3 A;  4JI1 O;  4EKW A;  4GX2 A;  2CUG A;  4DW1 A;  4DUZ O;  2V7Q H;  1Q86 W;  3M9H A;  5IWA B;  5LA6 A;  3H01 A;  4FMT A;  3ASN B;  3K06 A;  1AP5 A;  5B1B B;  1QU7 A;  1AI5 A;  2AZ0 A;  3A0R A;  1EQ7 A;  3JAL A;  4ZHQ A;  1FFT B;  2DOS A;  1HNW B;  2Q7G A;  1N34 B;  2RN0 A;  1AJQ A;  1I94 O;  3N2G A;  3H1H D;  4XA4 A;  2V7Q G;  5CBH A;  3VMX A;  5KX5 A;  5H6R A;  4IOI H;  4UVA A;  5LP6 A;  4I1L A;  1KZU B;  2YIU C;  3BAA A;  2CGN A;  4IGG A;  4OGQ D;  3EWK A;  5CCH D;  1GW4 A;  3X2Q C;  4DV1 B;  1NH4 A;  1SQX J;  2FB5 A;  4YIO A;  2K9J B;  1MMM A;  4BWA A;  2HHH O;  2JP3 A;  3SPC A;  1BQ0 A;  5KLV D;  3CCU P;  1M9N A;  4UB6 H;  1BDD A;  1JY3 O;  1WLE A;  1AA0 A;  3CCQ V;  4K8X A;  3MHV A;  2VWJ A;  4PA4 A;  4WWI A;  1IXM A;  4FZ0 A;  3AE5 C;  1G2C A;  5IJ0 B;  1HW7 A;  4LH6 A;  4O4H B;  1LTG C;  3G67 A;  4DYL A;  4DR3 B;  1Y8A A;  4GKK B;  3TXQ A;  2KNC B;  2ZM6 O;  2QIW A;  4EFB A;  1SQX E;  2OTJ P;  4K3A A;  5FL7 G;  2WPV B;  1XMQ B;  1M57 D;  5AW1 B;  5KHI A;  4DV2 B;  1EFR G;  1A02 F;  5AW2 B;  1H89 A;  1AVM A;  2GTA A;  3M7M X;  1K9M W;  5AVV B;  4Y28 J;  2WSC J;  4BR6 A;  1SA0 A;  3F7V C;  3M99 B;  4H13 B;  2WSS G;  1HP8 A;  3LW5 H;  4H0L D;  3SPI A;  3AEI A;  3G71 V;  3JAR B;  3DC6 A;  1NU1 D;  1FAV A;  4KT0 J;  4AI8 A;  2BTQ A;  2UUB B;  1KFM A;  2GUS A;  3CWB G;  2ZYD A;  1DK1 A;  2R5D A;  2ZE5 A;  4NTW A;  1JO5 A;  1GN3 A;  1Q6H A;  1FS0 G;  1S9K E;  1ZL8 B;  3EXA A;  5B66 Z;  3CCR V;  1BHA A;  2ZVO B;  4DV6 B;  2OAR A;  2ZE6 A;  5KHK A;  4RQE A;  1K73 W;  1NTM G;  1Q86 Q;  1RHZ B;  3SPG A;  3SFD C;  3D6Y A;  1YCI A;  3AEG C;  1OZ0 A;  1PV0 A;  1EM1 A;  3HTK B;  3G80 A;  3B40 A;  3AE8 C;  1RF1 B;  1KMI Z;  1EXJ A;  2HLO A;  4NPE A;  1PV3 A;  4GKJ B;  3N2K B;  5CHX A;  4WBN A;  5CA1 B;  2L6L A;  1AVO A;  3LDD A;  1HGV A;  1MV8 A;  1IFP A;  2QE7 H;  3Q5P A;  3B8M A;  1URQ B;  2E43 A;  2JVD A;  1LJ2 A;  2Q7H A;  2M0B A;  2LJ2 A;  3JAK A;  1OVV A;  4W7Y A;  4HNA B;  3RYI A;  5HFL A;  1MKM A;  4GDO A;  5APU A;  2P5O A;  2JJ2 G;  2Q8V A;  1SQB G;  3SGI A;  1GW3 A;  3HE5 B;  2QE7 G;  4EDF A;  1IFD A;  3VP9 A;  2ODM A;  1S5L E;  4YHH B;  4P9P A;  5B1A C;  1DLB A;  3NR7 A;  4CPG A;  4JTD B;  2B88 A;  2XAS A;  1RM1 C;  1Q7Y W;  4GX5 A;  5AVU B;  5KAI E;  2JDI H;  5BU5 A;  1N73 A;  1OVU A;  2YXQ B;  2HR3 A;  3UT5 A;  4RO2 A;  3P30 A;  4G2K A;  2CPS A;  2UUA B;  1L4A C;  3M9B A;  2RKL A;  5LGU A;  1ZAU A;  2JK5 C;  2WLL B;  1BSM A;  3RYC A;  1ZUQ A;  3LSS A;  5IJ9 B;  3OGI B;  1Q82 W;  2ZQM A;  4GOD A;  1NTM K;  2UUC B;  1KYO F;  2HJD A;  3RYF B;  1YIJ V;  1V54 B;  2JDI G;  1SQP J;  2FTK A;  1M4U A;  2E74 B;  2DW4 A;  4O2A B;  1GL2 D;  1R3J C;  1FJG O;  4WB4 A;  1YHQ V;  4WY4 A;  2PP6 A;  2OYI B;  3FYI B;  4PD4 F;  1VQN V;  1LTJ B;  4E2L A;  3HKE A;  4D6T H;  1BZK A;  1ZRT D;  1VF5 B;  2QJK C;  1PNL A;  4I55 A;  3H1I D;  5LOV B;  4FLW A;  3OMI B;  3HB3 B;  4DR1 O;  3E35 A;  1L0N H;  1SQP E;  1JFF A;  4AQY O;  1LT9 C;  3F5W C;  4O4J B;  4BAY A;  1VQ7 P;  2R9A A;  3ZHU A;  3ZRW B;  3CCJ P;  2BAS A;  1XQ8 A;  3ZHR A;  3I56 V;  1NTK D;  1TA8 A;  3KZI E;  1SQB K;  1M90 W;  2V4D A;  3QO7 A;  1MZE A; 
#chains in the Genus database with same CATH homology
 3RL0 g;  3GF3 A;  1ZRT E;  3AE7 C;  4U7J A;  2FXP A;  2QJY C;  1AJY A;  1YQ3 C;  2IDB A;  3AEF C;  3R4Y A;  3AE6 C;  2E75 C;  3AEC C;  2G3A A;  3SFD C;  2BEZ F;  3D6Y A;  1DD3 A;  3AEG C;  3ABV C;  2E76 D;  1Q90 D;  3RK3 E;  5KLI C;  3AEB C;  1KTM A;  1OW8 A;  3AE8 C;  1ZME C;  2E75 B;  1KMI Z;  3D6Z A;  3AE1 C;  1KQF B;  2WSF J;  1EXJ A;  2K9Y A;  1K05 A;  4OGQ B;  1PV3 A;  4H0L C;  3O6Q A;  1RQU A;  5M1B A;  3GLM A;  1OW7 A;  1UIX A;  3T97 B;  1S5L X;  1DD4 A;  3H25 A;  3G9R A;  2V7Q J;  3Q5P A;  1DIP A;  4XFJ A;  2ZT9 C;  2D2C D;  4R4L A;  1RQV A;  1ZOY C;  3C8V A;  4H0L B;  1PL5 A;  2WQY C;  3GMA A;  2E74 D;  4IL6 X;  1FDI A;  1KIL E;  1VL2 A;  1PIX A;  3AEE C;  1MKM A;  1TU3 F;  4GDO A;  1NYH A;  2NZ2 A;  3S9O A;  2ZT9 B;  2FBW C;  2E76 C;  1VF5 D;  1NGM B;  2OQQ A;  4I7Z C;  1FDO A;  4PV1 D;  1GMJ A;  3Q5S A;  4H13 D;  1Y9B A;  2YMK A;  2YIU C;  2J5U A;  1KOR A;  4R4M A;  2E76 B;  4OGQ D;  3EWK A;  4I7Z B;  2H89 C;  4H44 D;  1S1C X;  2G8Y A;  2BEQ D;  1R8E A;  2JO1 A;  2D2C C;  3LW5 J;  4RKU J;  2JP3 A;  1K04 A;  5L8R J;  3AE4 C;  2MKV A;  3D70 A;  2E74 C;  4YXD C;  3SFE C;  3AE9 C;  1KQG B;  1OMI A;  2D2C B;  1EXI A;  3AED C;  3GF7 A;  3AE5 C;  2O01 J;  2H88 C;  3AE3 C;  2E74 B;  1VF5 C;  2QIW A;  1YQ4 C;  4PV1 C;  2E75 D;  4TT3 H;  1HF9 A;  4Z1M H;  4H13 C;  1IK7 A;  2FYN C;  2WPV B;  2P10 A;  1JB0 J;  1WMK A;  3IN6 A;  3D71 A;  1ZP0 C;  4OGQ C;  1VF5 B;  2QJK C;  1HJ0 A;  2QSI A;  3AE2 C;  4H44 C;  4Y28 J;  3AEA C;  4PV1 B;  2WSC J;  1OW6 A;  2WSE J;  2QJP C;  4H13 B;  3B71 A;  4H0L D;  4YTP C;  3FGA D;  4KT0 J;  3Q1M A;  3IAO A;  4H44 B;  3Q5R A;  3Q3D A;  3Q2Y A;  2ZT9 D;  5KKZ C;  1U57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...