4OGQB

Internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
b'ATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4ogqB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ogqB01
2QIWA 3LW5J 4RKUJ 1Q90D 2E76B 2D2CB 2O01J 4H13B 2WSCJ 3C8VA 5L8RJ 2E74B 2K9YA 2WSEJ 2YIUC 4PV1B 2QSIA 1ZRTE 2ZT9B 4I7ZB 2WSFJ 4IL6X 5KLIC 2QJYC 2WPVB 4KT0J 4H0LB 2QJPC 2FYNC 2E75B 4OGQB 5KKZC 1VF5B 4H44B 1S5LX 4Y28J 1JB0J 2QJKC
chains in the Genus database with same CATH superfamily
2CTRA 3AG7A 3BAAA 5LHIA 3H25A 2BTQA 1NTZH 4HH2A 1L4AB 1K8AQ 2B9ZA 1S3JA 4R8CA 2JGDB 3CB2A 4B7EA 2PGDA 3SYAA 1UPGA 3GHGA 3E22A 2EULA 4YXWG 1Q7YQ 5DJUB 2RDCA 1NAFA 2IFNA 4LF5B 2H88C 5LMNB 5L3FA 1KV4A 1RE4C 2BOBC 1EZVG 1GM7A 4CC6A 1IFIA 1JVMA 4UCUA 1VF5B 3QTCA 4JI1O 5HFMA 4I4TA 4UXNA 5B1BB 4OWFA 5FLXN 2QJ1A 3ZS8C 4DV6B 3S4RA 4OPAA 2YSUB 4UB6H 2I8DA 2NR5A 3PJSK 3CI9A 3OJAB 2JGUA 2ZXEB 1Q5OA 1DGSA 5A2QN 1NGMB 3SYQA 3DC5A 1UJWB 1S5JA 2XDJA 1NHLA 5L3DA 1HR0B 1VQ7P 4KUMA 1BQZA 1GTWA 3A0HH 1XL6A 1NBMG 2HJDA 4DV7B 1PPJG 2VRSA 3MIWA 4EOTA 2VQEB 1URFA 4DXWA 4U3JB 3G71V 5BMVB 3NR7A 4U3FH 2Y69B 3TSIA 2HHHB 3FB6C 4P9OA 2QIWA 3ABVC 1JFFB 4PA7A 4JYAO 1FS0G 5GTIZ 1LNQA 2OYOA 1SQBK 1NVPB 3E7KA 4RJTA 2H8PC 4LBEC 4PJ0Z 4ZNCA 2AEMA 4WBNB 1EDKA 1N32B 1LWUA 2UXBO 1LT9B 1QEXA 1SQXD 4KHPO 1GW3A 2KYVA 4PV1C 4JI5O 4OX9B 1SQPH 3WUVA 3RYFA 3M91A 1H38A 3V2PA 1QLEC 2W6AA 3JATB 1PFIA 4XDJA 1M93A 4W4KA 1QU7A 3K5BA 2YIUB 4H13B 3QO5A 1LT1A 2Y0EA 3I5CA 1NTME 3VP8A 3VTPC 2Z0AA 1S0VA 1W5CE 2Y0CA 3T4ZA 2LO1A 5A9GA 1GKFA 1RSOB 3MD0A 1VQLP 1B3QA 2HG5D 3LNNA 1BCCG 5AG2A 4WFHA 2EZOA 1SFCB 3GF7A 2Q3IA 1H89A 4NPFX 3E8HA 1M57B 1QL2A 2XAJA 1BGYG 3CCEV 4D6TE 1PL4A 1H8EG 3FX0A 2C9NY 1XTGB 2KP8A 2NPSB 5TJHA 4X64B 1Y67A 2IBZH 2JVDA 2ZVNB 4YXDC 4DV2O 1T3UA 1OCRB 4IFDK 4A5UB 4GZRB 3CMAV 1OCCC 2XZRA 3ABUA 3JCZA 4U7OA 1S76D 1L0LE 3RBZA 3VYIA 3RK3E 3CPWU 2B9BA 1AR1B 2Q67A 2ZE7A 5E1AC 3EVKA 3FD9A 3K03A 5KLIC 1BMFG 5KKZB 1PPJD 1FFXB 2UXCB 1AP5A 3UO2A 4XDLA 2RN0A 3JASA 4UVCA 1RQUA 4LF8B 4ZBMA 4N78D 1P7BA 3B2EE 1R3LC 2OYQA 4DV4O 1DH3A 3T1CA 1KILD 1N7SD 4FFBA 1M90W 4IL6E 2ZKOA 3QVNA 4EDFA 1QBZA 2N1TC 3F7VC 3SJBC 4LFBO 4NXMB 3FX7A 2V7QH 4PV1D 2HPCB 2F93B 1V54C 1NTMJ 1R5LA 3CCMV 1HBWA 1WT6A 2CAZC 2EINB 1NTKG 4ZOLA 1YJNP 3H1LG 3L37A 1RF1C 4BW9A 2DWDC 3HKEB 2ADQB 3HUSC 5LP6A 2F4VB 2EJ7A 3H9VA 1PNKA 2HR3A 3W7UA 2HVJC 4PDRA 2Q9LA 3I56P 4D6TJ 5KMGB 5JJNB 1BCCD 4D6TH 3L72G 3A7OA 2QGNA 4TSFG 1N86A 5KX5A 1Y4MA 3R65A 4AYCA 1RP3B 2QE7H 4TT3H 2Q69A 2Q5ZA 1YITP 1AR5A 4D7SA 2K1EA 3CCRV 1L0LJ 1L0LH 4JYYA 3JSLA 4R50A 2HLOA 3V2NA 4O4JA 1US6A 1OW8A 5IJ0A 3SPIA 3PN1A 4JZ2A 4I9QA 3MZWB 4CS4A 4YJ3A 2JK5C 2P4VA 2IBZI 2W90A 3W7TA 2K9JB 4MVMA 3T1YO 1MUUA 2WT7A 4NKGB 1WLEA 3S3WA 1EDIA 5JCOA 1AA0A 1YDXA 3ZHQA 3JD1A 1MFZA 1YIJP 1YJWP 3CCLV 2PP6A 1FJGO 5D5PA 2AW9A 4IL6H 3ZCCA 3X2QB 3HRNA 3BPZA 1DF4A 1PP9E 1EN6A 1RHZB 1Q2NA 2WLIB 2KB7P 2IDBA 3I5DA 2WAMA 2WSSH 1M56C 3LDCA 3TGUD 3D36A 2WLNA 1L4AC 2N1TD 2RNBA 4EEQA 2WLLB 3SYPA 1SZTA 5CBFA 3Q5SA 2QJYC 1NTKD 2G38A 5CHXA 4GX0A 5LXTB 3H1LD 5LBQA 3TCUA 3MP7B 4LF4B 4GKJB 5CCHC 1GH6A 3M9HA 2O1KA 2LW1A 3A2AA 4JBZA 4LP8A 1QGKB 1IFNA 2SPZA 1K9MQ 4AQYB 1KD1W 1XNQB 3BVHA 1CXZB 1YI2V 1VF5C 4JAUA 1R5SA 2R44A 1VMGA 5B1BC 1M1KW 3L72D 3EFFK 1SETA 5J9PC 1PNMA 4NPDA 1EZVE 3HE5B 4DR3B 2HEPA 3CMEV 2AXCA 2JS3A 3H1ID 3APOA 5IYZA 3SYOA 3K57A 3RK3B 2QKCA 4X1KA 3AEDC 1IC2A 3RYCA 3LNMB 1MZ9A 3JD3A 5LA6B 1FPOA 1LGHB 2KUBA 2GM4A 3D6ZA 1JEKA 5ITZB 1Q81W 4TV9B 1SQXK 2OYHB 2UXDB 4TUYA 1HF9A 1VQ9V 3FB5C 4C46A 2Z4EA 4B3MO 3ZBHA 2W0FC 1PPJE 1U57A 5CA1A 1R6KA 1S1CX 1JJ2U 2OTKE 2C9LY 2Q7GA 1PP9J 3CC7V 3CP1A 1ZWIC 3H1HJ 1OW6A 1PP9H 4GX2A 4N78E 4Z1MG 3H1HH 2X7RB 2KIKA 3VP9A 5B5EE 1JY2O 3HD7D 1KYOE 1URQB 4I0XB 1H2GA 1LT9C 2A06G 2C0XA 3E2EA 5IJ9A 5KHIA 4JI7O 1KILE 1ZAUA 4HKZH 3WU2H 3JD0A 2OYIA 3JCUE 1KQFB 4OPHA 3O6QA 1FD9A 3UCSC 4UVBA 4O4LB 4RWUA 4LF9B 4E2LA 1NKDA 1F23A 3RK2B 1K5QA 4LR3A 4YJ2A 1M56D 1H2MA 3LDDA 3Q2YA 3G3ZA 2QTSA 5KA6A 4DOJA 2YIUC 2B87B 4BAYA 3JC22 5EIBC 4YHHO 4L74A 1YZBA 4FLXA 1JY3N 5CCHD 4XE5B 1L1FA 1DF5A 4DR1B 3N7NA 2NN4A 2DW4A 1KP2A 4TQDA 1EZVH 3HTKB 1HNWB 5LOVA 4K3AA 1BCCE 2P7JA 2E75D 2V4HA 5EZYA 3BFRA 5KJ7D 1M4UA 1IK7A 3L74D 4LF7O 1Q81Q 4JI6O 2AHYA 3CX5D 3DSQA 3KKYA 2QTOA 2UU9B 2B88A 1FXKA 1SQVD 1F4NA 1OCRC 2W27A 4LF6O 1SA0B 3AG1B 4MT8A 2BEQD 4Z2WA 1ZOYC 3EWKA 1S5HC 4H0LB 1LTIC 1FDMA 4MVQA 3NXSA 1FKAO 2C0WA 1HTLC 1PPJH 2VQFB 5KKZC 1XMQO 2PYJA 5EK0A 4O4IB 5FPRA 4E4EA 1HNXB 1CZQA 1LTBC 5KUMA 4X88A 3K58A 5CB4B 1SQBG 3OEHG 2R9RB 1X0TA 1X79B 2GDSA 3CXHH 3G9RA 3G4SV 1KB9D 1ZL8B 1KYOH 2M5AB 3OMNB 4X1YA 3T2MA 2KKWA 2ZE5A 3O65A 2OTLP 4RUFA 2QA4P 3L75G 1HH0A 1HVVA 2DW3A 1IZ3A 2F95B 3JCUH 2UXXA 1BS3A 2XAGA 2RH0A 1EBOA 3HKCB 1AJNA 1B04A 3SFEC 3G6EP 1V9PA 1LTGC 1YTZI 2HLDG 4BRYA 1UFIA 2JWAA 1P7GA 3FWNA 2EINC 5D5QA 5TISZ 2YO3A 4PDVA 2E5LB 3LUTB 2R5DA 5IWAO 2QWRB 1CI6B 3GW6A 4LFAO 4NTXA 1GO3F 2BTQB 1B6QA 1NTKE 1T8ZA 1PGQA 1X4TA 1HUCA 3H1LE 4HYOA 3BA8A 1VQ4V 1BCCJ 1IZNB 4PI0A 1J5EO 4JI4O 2E74D 4U7JA 1BCCH 4JF7A 3ZRVA 1FE6A 4D6TD 3SYCA 1VQ5V 3GHGB 3E22B 4PELA 2N9BA 1RM1B 1BGYJ 1MG1A 2EJRA 3H1JG 4ZKUA 1BGYH 4AHCA 1YCIA 4NR1A 3IFMA 3L72E 3N2KA 4XA4A 3SWKA 4DV0B 4AILC 1WMKA 1PV3A 2H3OA 3B5ND 3CRCA 4I4TB 2D2CB 1VQ8V 1LJ2A 2E76D 5K5GB 2R70A 1KBHA 1R8EA 2ZR2A 2R5BA 2XNDH 2ZD9A 2ZT9B 2BSKA 1IBKO 5KLVK 1R3JC 1COWG 1XOUA 4YPCA 3LSSA 3MAQA 4CH3A 1GL2C 1V55C 3ABKC 4DUZB 5AVQB 2Q7HA 1PGPA 2YXYA 5CA0A 3JSNA 3J7AU 3L75D 1MFTA 3DXRA 3CXHI 4GUNA 3RT3C 2A0LA 3P3PA 1JR9A 4OVNF 3MUDC 4C7NA 3E86A 3G71P 5CCGA 3M0DC 3M99B 1LWUB 2W6IG 5BVZA 1NTKJ 5EBLC 1FJPA 2PRRA 3H1LJ 3A0BZ 5EYPA 1IO4A 2BE3A 3H1LH 4H44B 4WY4C 2W6BA 1RPRA 2FB5A 4HJGH 2M3EA 3RYFB 1HP8A 5APUA 4IHJA 2OCHA 5AW5B 1Q8IA 4MSWC 4DUYO 2AEJA 1I94O 1KORA 5K1XA 1VQKP 3K3WA 1VQOV 2K1AA 3WG7B 4Y99C 2HFED 3L72J 3M8AA 4LH6A 1SS1A 4GDOA 2KI7B 2YKPA 2KS1A 1WPBA 3T1HB 2QJPB 4W80A 3LIEA 2I1KA 2FYNB 3T97B 1K7DA 4KHXA 4K0KO 3H1JD 5FPOA 2E3CA 3CWBD 2UWJE 4GOEA 5KAIZ 3ETEA 2Q4PA 5KAFZ 2AZ2A 3L36A 2Z3YA 1NVOA 3CX5E 1Y6XA 3JD2A 2CGNA 4IIJA 3SPJA 2WQYC 2IZ1A 2CH7A 4PJ0E 2PZSA 4MTXA 2AXTZ 2FBWC 2W83C 1EQ7A 3CSXA 1W2BU 3C3SA 4L76A 2GHYA 3THOA 4X66B 3IAYA 3HE4A 5GTHH 5BU5A 1VEWA 4B3TB 3IGAC 5AW0B 4FK5C 1GL2D 1SQQD 3AE9C 3AEEC 3R2PA 4AI8A 1KB9E 5JVDA 2Y0PA 4JI3B 2P1JA 2YUAA 5BR8B 1K8AW 3JASB 2WTYA 3CMAP 2LJ2A 2WPDG 1Q6IA 2ZDIC 3F5TA 2EILB 5JJEB 1FXHA 3HKBA 3L71H 3H01A 2A06E 4QGPA 2W0XA 4EFEA 1XUQA 1I5YA 2VS0A 4FFBB 3RK2C 1N0JA 3K5LA 3CCJV 1L0NK 2CTQA 1T3JA 1E1RG 3HB3B 2EIJB 4W7ZA 4YIPA 3K04A 1P49A 3AEGC 1NKZB 1SQVK 3CCSP 4B3SB 4WY4D 1K34A 3VMZA 2VRZA 3U1CA 1S9KD 3AECC 1IX9A 1NH2B 4DV5B 4LFCO 3TXQA 4ZOLB 5APSA 1SERA 3MHVA 1WP7A 1TVKA 3ABTA 3CEIA 1GN4A 3RVYA 1J1EB 2O57A 5LP6B 1Q3EA 4Q20A 1IBLB 1OWAA 4DW0A 1OXZA 4WBAA 5H9CA 4UB8Z 1R1BA 3WB2A 4FLUA 4HAMA 4DR7B 3ETDA 1K97A 5KX5B 1SQXG 3AG1C 1ROPA 2V4DA 3B71A 1ZLLA 4DZOA 3STZC 3JALA 4JV5O 5H2FZ 2M0BA 4DR5B 1N34O 3M7MX 1T2KD 2XTAA 3ZHVA 3Q5PA 2P58A 3FFQA 2JP3A 1XMOO 2VWKA 4EKWA 1NTZK 3ICXA 4O4JB 1MSWD 2PGGA 5IJ0B 3OW2O 1P84D 1YXBA 4YJ3B 3JSVC 1AI6A 5LL6Y 1SQBE 2XAFA 3ABLB 2WT7B 3CC4P 4Z1MH 5KUKA 4X62O 2ZJSE 2IM9A 4JPZB 2VWJA 4FLTA 2WLKA 3CC2V 1HJ0A 1FU1A 2A45G 2A06H 3L75E 1NT2B 1FDOA 4JPRA 1KKDA 1IFPA 3H1KD 3KQGA 5CBHA 2KSJA 4DV1B 2ZINA 4PI2A 2RJZA 4L75A 4X20A 1YHQV 1VARA 1ZLZA 1IBMO 1N73A 3S3XA 1KC8Q 3VBBA 1AJYA 1QVGO 4BWAA 3F7YC 4J7KA 3EQ2A 3QH9A 4I6MC 1KILA 1N7SA 3GHGC 1MMMA 1A02J 4W4LA 1JMKC 1RM1C 1N4CA 1QR8A 2IW5A 2YS8A 4YY3O 1X22A 2L91A 2QVAA 5KHGA 5KHKA 1M7LA 1PM9A 3KXDA 2KG7A 2JKVA 4ZKIA 3CD6P 1BSHA 1LUWA 2XV5A 3L35A 3FXDA 3V2QA 3H1JE 3FWLA 1SP4A 3CWBE 4I55A 2D2CC 4JI1B 4GLXA 4DRXA 1DD3A 1AP6A 3CCUV 2GUZA 5IYZB 3B8NA 1BHBA 4BR6A 1YI2P 4X1KB 1SQPK 5CBGA 3RYIA 4LWSA 3RYCB 3AE4C 1W59A 2XAQA 1WRGA 2XASA 1SQBJ 2YMYA 1M1JA 2N9YB 1FXVA 1SQBH 1JCHA 1FFTB 1YJ9V 2ILMA 2MJZA 1HWYA 3OR7C 1JUNA 4TUYB 1OV9A 1MNGA 1LTJC 3FGAD 3L75J 2LP7A 3ETGA 2PFXA 3T97A 3ZMSA 5CA1B 3F5HA 1J1DB 1MV8A 3MDSA 2QSAA 4PD4D 4JYAB 3ASNC 4Z1VA 4I7ZC 3RGUA 2ZE8A 1VQ9P 4C7UA 3KHUA 4FFKA 1JX9A 1LWUC 1N33O 1DEBA 1AQTA 4F6EA 1VQMP 1KECA 5IJ9B 3F5WC 2UXBB 1LTSC 1J95A 3SJAC 3FYEB 4X89A 1YTZT 3AE7C 4KHPB 4ABMA 2YXHA 1AILA 2UXCO 3N4XA 3ETQA 4JI5B 5IE9A 4H44C 3O6QB 2OYIB 4GIFA 4JI8O 3ZHUA 1F4MA 4YJ2B 1FJKA 4KXRA 3WG7C 5APYA 2BCCG 2RN9A 1AI4A 1Y47A 2QWNB 3AK2A 1PGJA 2QJPC 3H1JJ 2FYNC 2FYUD 2B89A 1DLBA 1WB8A 2XKMA 1YTFD 2N1TA 1ZX3A 4RO0A 1RE3C 1SQQK 5LOVB 1H2KA 4PHZA 5AW8B 3M0AA 1FBMA 4O9BA 3CC7P 5EZYB 2H8PD 3AEIA 3EXAA 5KLVG 1OCZC 2M6YA 2F4VO 3TGUG 2YEVA 3HUSA 1FXKB 2XT9A 2CPSA 4IYHA 3SFDC 4DV2B 5K1PA 4QMAA 3QWOC 1GN6A 4DV3O 1NTMH 4R6ZA 1EXIA 1QLED 4D7TA 5M1BA 3L73G 3H6PA 1P84E 1Y76A 3L70G 2A9HA 1E1QG 5AVXB 2KNCA 4R4MA 2IH3C 1HNZO 1GAXA 2DYSB 5AVZB 4JZGA 3U59A 1H88A 5LGNA 1PZQA 1K5SA 4J7JA 4EYYQ 4X1YB 3OE7G 3U10A 5LHGA 1JO5A 3SWYA 4Q6GA 3H1IG 4DV4B 2H43A 5CJ0A 1K9MW 3G80A 1Z56A 1D5AA 4FLYA 2QJKB 5B1OA 4WF9V 1GRJA 3G4SP 3Q1MA 2EIJC 2EIMB 1NR7A 4J9YB 1DX7A 2DJVA 4LFBB 2ATKC 4BRYB 3N27A 4BXLA 5C39A 2WSCJ 1SQFA 2P5OA 3D6YA 1R6NA 3AEFC 3CXCU 2WSCH 3HD7A 4PA3A 4FLWA 2HODA 2BCCD 1I08A 4FVMA 1W2EA 1OJHA 1J1EC 2ZAEB 1MZFA 2NNUA 1EDJA 1AFOA 3CYOA 1CSBA 3IFXA 1XREA 5H6QA 2Y48A 5KHHA 1VDFA 3E35A 4OGQB 4HBNA 3AG2C 5C8YA 2GSMB 1RFYA 2P6JA 2WPSA 1VQ4P 3N2KB 3JAWA 4WB4A 2ZE6A 2N04A 3D70A 5KLVD 2OWOA 4NTWA 1VQ5P 2JS5A 1SQXE 5CCHA 1D5NA 3AE2C 3D3QA 1NU1K 4AQYO 1AROP 1BQ0A 2ARHA 4DR2O 1ZR4A 1KFNA 2PUSA 4QJFB 1OZ0A 5TISE 2BSKB 1EN5A 1ZUQA 3HKDA 2ZR3A 2KZJA 2CGOA 5KJ7A 4MW3A 3L73D 3ABLC 2ZXWB 3T1YB 1F51A 2LFSA 3L70D 1S5LX 5AW2B 4J10A 2JEEA 3J81N 4NPEA 4X9QA 4ZMDA 1KFMA 2Q8VA 4X65O 4O2AA 4MVZA 3CRRA 4PA9A 3AEBC 2LXBA 1VQ6V 2YMKA 4PD4E 1WN7A 3B4SA 1L0NG 4JI2O 1FJGB 1QR9A 5CA0B 1GK9A 4FPPA 5IY5B 3L74G 3KDPB 4QE7A 3DXRB 5KA5A 3O9OA 1SQVG 4W7YA 2QDOA 4DK0A 2XNXA 4C7NB 5AVYB 3D36C 1Q43A 1N36O 2CE4A 1QVFO 1U7MA 1N0NA 3AE6C 4KP4A 2P90A 4HB1A 4GKKO 1F7YA 5EYPB 2EBOA 4PA4A 1SLQA 4IHJB 2MKVA 2Y69C 3B40A 3RL0B 2JRIA 4UCTA 1VL2A 3GF3A 4LNUA 1YEWA 5JH7A 3OEEG 2PYLA 2OIGA 2Q6AA 1YF2A 3VOPA 2KS1B 2X0LA 4B86A 1GMGA 4WFFA 1MKMA 4GX5A 1SQXJ 3SSUA 1K73Q 3ZMVA 2A7WA 1CI6A 1SQXH 1KQSO 3NMDA 1NTZG 1S5LZ 1TGOA 4GKGA 3QO7A 3ML0A 1USDA 3K5OA 4IIJB 3TETA 4DR1O 3S1KA 1S72V 2ZM6O 2CH7B 1FZCA 1HWTC 1WNSA 1TUEB 3WFVA 1L4AD 1GN3A 1XNRO 3B8EB 1VQNP 2W6JG 1VF7A 2JEUA 1KUQA 4H13C 2R3SA 3A0BE 3FAVA 5AW4B 1RY3A 4YXWH 1SQGA 1Y74A 2HYNA 3B5NA 2RMZA 4B3MB 3C3TA 1BE3D 3HE4B 1SFCC 4PD4H 4MVUA 1W0JG 3OTOO 1M57C 2A45H 4B08A 4ZHQA 4DR4O 1NQTA 5JVDB 1NOHA 1USEA 1VF5D 2IX7C 2H94A 1YQ4C 4NYKA 3IR9A 1L0ND 2ZQMA 3DTUB 5IYBO 3PP5A 2YIAA 1G1IA 2FYUK 2PAJA 1FOSE 2NPSC 1VF6C 4JI7B 4UCRA 2PY5A 2O1JA 1Q82Q 3HKBB 3VN0A 5KAIE 4X1IA 2WPQA 2QRXA 2OARA 3ABMB 4GX1A 2WZ7A 2P22C 3Q4HA 4FJCC 4UV9A 3KCXA 4IFFA 3GVMA 3K06A 1UIIA 2AXTE 4U3FG 2LGWA 3P32A 4YHHB 2E5TA 2BCCE 4JF3A 1JCDA 1KMIZ 1YJNV 2Q5UA 3USSA 4O2BA 1ZTEA 3CCJP 1WA8A 5B5EH 3II6A 2R9AA 1JY3O 3OTFA 1TVKB 2DYRB 1JPXA 3I56V 1NVPD 1KN7A 5H6RA 3W7SA 2OTJV 3CCVV 2KZIA 3CJHA 2YKQA 1SQPG 3P3NA 3VQWA 3BCCG 1XBLA 2F66C 2JJ1G 2CUGA 2UUAO 2QM8A 4JI6B 4LF7B 4NB5A 2HP8A 1FXKC 4B3RO 1FZFA 4BIUA 3OD4A 4QPJA 1NTZD 5KLVE 4NXNO 1L8DA 2NRGA 1PKXA 5L3CA 4B7KA 4LF6B 2OGUA 2DMXA 2DQ0A 3TGUE 5J2TA 3O8ZA 3JALB 1S77D 2O01J 5B66Z 5L8RJ 4JQ0D 2FTKA 3WB0A 5LMUO 2IPPA 4H13D 1XMQB 5EIBD 5BU8B 3B77A 3L73E 2Q0OC 4F6RA 1QNMA 3TF5A 3L70E 1AV1A 4PDMA 3OT7A 2JWDA 1G2CA 3WU2Z 4KT0J 4R4LA 1SFCD 2FL4A 2K88A 4UVAA 4XFJA 1M57D 4JTAB 3KZIE 3CWBG 3EFGA 1AI7A 5HFLA 3JAKA 2IBZG 3DGEA 2QJKC 2P4KA 1EZVI 4JTDB 4UB8E 3H1IE 2EIMC 2YIBD 2E5YA 2NPSD 3E89A 2Q3EA 1S2EA 2YDEA 2UUCO 1R3KC 3LSUA 1GL2A 3ZN0A 2P10A 5C93A 1SVFA 2X6CA 1HDJA 3CC2P 4X20B 1JY2P 1XHXA 3W7WA 5EC1C 3BATA 1N73B 2JDIG 5IWAB 2ZYAA 1R6TA 3JAMN 4U3FD 4LFAB 3VMXA 5B1NA 3B8MA 4MW8A 1B06A 4LCUC 5JWPA 1SQQG 2FXPA 1SC5B 1J5EB 3CXHF 4JI4B 5F2VO 1KILB 5CJ4A 1N7SB 1KYOF 4EFBA 3OR6C 4OGQC 2LGQA 4TLFA 3AE5C 1NAYA 2M7WA 2L5GB 1BT8A 4WFEA 3M0DA 3X2QC 3V6IA 3C8VA 2KG7B 2B1GA 1K05A 5KLVJ 1U96A 4PV1B 1NYHA 1IJDB 1KYOI 4WY4A 2V7QG 4OH8B 3ZRWB 1SQPD 3TGUJ 4I55B 4R7CA 3BCCD 3TGUH 5IDJA 1Q86Q 4DRXB 1JMBA 3ZN1A 3AK3A 3G6BA 4DYLA 2X6AA 2FFDA 2CPBA 1AQ5A 2GUZB 1AVYA 1WPXA 2ZIOA 1ZXGA 2KXPB 4UCVA 2YNYA 3FXEA 1NTKH 3L73J 4FLZA 1IFJA 1JB0J 3L70J 1RQVA 1IBKB 3RYIB 4LWSB 1E5WA 4RO2A 2ZXWC 3D8CA 3L70H 5FNVA 2XOKG 1D2DA 1GZLA 3RYHA 1VP7A 1DIPA 4MVSA 1M1JB 3JCUZ 1A32A 3CCQV 3VMYA 3CPWO 2IJKA 2ODMA 3KZIH 3W7XA 2QE7G 2FYZA 1ZW0A 3L72H 5H5NA 2FY8A 1WJZA 4DO2A 3H1IJ 1XQ8A 3OUSA 3ZX6A 3OAAG 3H1IH 3MHHC 4BIOA 1L0NE 1ZRTD 3RK3C 2IBZD 3BABA 5GONA 1MOFA 3L74E 5GTIE 1YJ9P 1BZKA 2QG4A 4J42A 3K79A 3CRMA 3AE3C 3VQVA 1JTHA 3WUUA 1K33A 3PHLA 1HGZA 1SQVE 4RKUJ 4MN4C 5AW3B 2OCCB 2F1MA 2OYHC 2DOSA 5KLIB 2AZ0A 1I0HA 3K0GA 3N2GA 4J80A 3RL0C 2RKLA 3CCEP 4JI0O 2WLHA 4DUYB 1QL1A 1FZBA 2IJJA 1I94B 2ZDIA 1KZUB 3MHSC 3AE8C 5AW9B 3RWRD 1Y9BA 2WLJA 4IGGA 1URQC 5CBNA 5LYJA 1KQGB 4MTOA 1KQLA 1FDIA 2N1TB 1NU1G 3BASA 1GN2A 1IDSA 2YIDA 5J2UA 5APQA 3H1KG 3IC9A 3NTNA 1XTCC 1V54B 2I1JA 2UXNA 3FKSG 4DR6O 1QHTA 1NTZE 3STLC 3OMAB 2YXLA 3BRVB 1QCEA 2YEVB 4DW1A 4X8AA 3HUSB 2WVRA 3UQ8A 2AGAA 3CLQA 1JA8A 3BRCA 1PIXA 5BZBA 2GUVA 1ZMEC 1NJIQ 2UUBO 1LR1A 1XILA 3A0RA 4U7NA 3I55V 2LKMA 3AEAC 4RESB 3QNEA 5DM6V 1VQPV 1BSMA 1RH5B 5FL7G 2KOGA 3IF4A 4RAIA 3BY6A 1Y76B 4FLVA 1XHZA 4RQEA 2P2UA 1FAFA 1KC8W 1L0NJ 2KNCB 4AUWA 1IXMA 4JAVA 1K04A 3L74J 1Q6UA 1GD2E 3CCMP 3L74H 5GTIH 5LGTA 3CX5H 2XHBA 2DQ3A 1SQVJ 2OTLV 2QA4V 3GLMA 1SQVH 4JTCB 3UT5A 1IXBA 3LSQA 2GTSA 3IN6A 4PJ0H 3E1RA 3RK3D 1ZSPA 3TDKA 2ITCC 2DN9A 1M8OB 3G6EV 2ZCEA 5IT9N 4H0LC 4J11A 4L8JA 1RF0C 4LF5O 5LMNO 1SZXA 2L35A 2LR2A 1H0TA 3H32A 2N05A 1JJOA 1RE4A 2CTWA 3A8TA 3E83A 1MABG 1PL0A 4HNAA 4U3FE 3QG5A 3PTZA 4CBCA 1OCOB 1N8RQ 1KB9H 4LFCB 3H1HG 3HD7B 4H37A 4TWKA 4DV6O 2BOCC 2DYRC 3VQXA 2HODB 1EZJA 3CCRP 3RN4A 2R72A 3R4YA 5EBWC 4PA6A 3OM3B 4ICGA 4JGSA 4N23A 4CZZA 1X59A 1NKNA 1URQD 1Z2GA 1IURA 2GA1A 2GTAA 1GM9A 4I50A 1NTZJ 4KFMA 1HR0O 1M56B 2EIKB 5L3GA 1NU1D 2IU0A 1FAVA 1G4YB 1SQPE 5EBMC 5C8YB 2M3BA 3BCCE 3FYIB 3OAKA 2J59M 5EC2C 4DV7O 5GTHZ 3JAWB 2QJYB 1YBKA 3WUTA 2VQEO 4LH7A 2QKAA 3RK2D 2OQQA 5DEDA 2HG5C 4JV5B 2KLUA 2W6JH 3CCLP 1N34B 2HHHO 3U11A 1Z5VA 5IYDO 4P30A 2YXQB 1XMOB 1GMJA 2E75B 3HKDB 3HR0A 1CPYA 2Y4TA 4I5SA 1N32O 2FYUG 2CK3G 4P9PA 2QWQB 4EB6A 2H7HA 1Q90D 4X62B 3GG2A 1M9NA 1I7FA 4OX9O 1KU9A 3CX5F 4GCZA 4O2AB 3K0DA 1FC2C 3ZRWA 1E79G 2F43G 1OHHG 3AE1C 2QSIA 1ZRTE 5GW7A 2IBZE 3LDEA 4YIOA 1BL8A 4ZI7A 2IH1C 3UO3A 4RQFA 2Q7CA 3CX5I 3CRAA 1LP1A 3M06A 2ZT9C 1U7JA 4U3FJ 3ZMUA 3SJQC 4TV8A 1LTJA 3JARA 4H0LD 1N73C 3J80N 1VQ6P 4FMTA 1IBMB 4N6JA 5E79Z 1J2JB 3CMEP 2X6BA 1SESA 4MTGA 1KB9F 1KILC 1N7SC 3RGBA 1PP9D 1R3IC 1AVMA 2K9PA 4NTYA 3H1HD 2Z5IA 1Y66A 1XEQA 5DN6G 1VQKV 1XI1A 2OIEA 4YY3B 1SQQE 3R66A 2Q7EA 3L75H 4X64O 1SQPJ 1KB9I 4LNUB 5JH7B 3BCCJ 1EDLA 1EC5A 3BCCH 1ZR2A 4PDLA 2ZVOB 2Q0AA 2LFRA 3C1LA 1M5IA 2HJFC 3GMAA 3P7KA 5CBOA 3KG2A 5AVWB 5KHJA 2PTMA 3V2RA 2E74B 4LF8O 2Y0DA 1TUBA 1FZCB 2DE0X 2PI4A 1M1JC 5BXZA 1EZVD 1RE3A 1S9KE 2YKOA 1WP8A 1A02F 3V4QA 3ZEDA 3FAVB 3CWBJ 3H1JH 4UB6Z 2P67A 1Y74B 2MW2B 4QE9A 3CWBH 2AEFA 3B5NB 1S72P 1D7MA 4RUEA 2KK7A 2J5UA 4NXMO 3QO8A 3G67A 2E76B 1AJPA 4ZHQB 3AK1A 2ZNJA 4CH5A 4O4HA 1TA8A 1NO4A 2WITA 4GODA 4ASVA 2XNDG 2D2CD 2B5UA 2OCCC 3A0HZ 1N33B 2JEXA 1RF1A 1ORQC 3GB7C 3ZHSA 2YI8A 3ZRSA 3K5MA 1LUVA 4X1IB 5B1AB 1K4CC 3AG3B 3KYQA 3E8FA 4P2ZA 1S5LE 2ZT9D 4EIJA 1FZGA 2JDIH 1FYJA 5B3SB 4JI8B 3Q4HB 4CS3A 1SQQJ 1NTMK 3CXHD 1SQQH 1KYOD 1HW7A 1NR1A 3CCSV 2G3AA 3LW5J 2Q73A 2P06A 1IFDA 2MK3A 3LW5H 1IK9A 2JR8A 3A3YB 3CL3D 5AVUB 1EM1A 4O2BB 2J58A 1WA8B 2AHZA 3ZMTA 2V7QJ 2FKWB 2EILC 3JYCA 4WFBV 3CE2A 3ASOB 3EHBB 1NU1E 3IAOA 1JCCA 3CJHB 2QEXV 1GK4A 1CW5A 5JQGA 1XL4A 3H1KE 1NZ6A 2LXCB 4KL1A 3TNUA 4Y28J 1LTAC 1GTOA 2JJLA 3T4DA 1G6UA 1L0LK 4H44D 4JASA 1JOYA 2OTJP 5L3BA 5J2TB 2GV9A 3CCVP 4QIWF 4DV3B 5BY1A 1O9GA 2C2AA 3ZIAG 2EX3A 1TU3F 5LP6C 1QX8A 3ZDMA 3DC6A 4GT1A 3UM7A 3HPLC 1BGYD 4UCOA 5APVA 5AW6B 4YTPC 2Y9ZA 1HNZB 4F6RB 2QWOB 2XU6A 4WFGA 1RPOA 4GYCB 1JQ0A 1G2CB 3CC4V 1GK6A 2JJ2G 1Y8AA 1H2NA 3E8GA 2F23A 1L4AA 4G2KA 2BEZF 1T5EA 3RL0g 3UIAA 2Q68A 2R9IA 2JGDA 3JAKB 4N21A 4MTFA 1EFRG 1S5LH 4LF4O 4GKJO 3LIDA 3VQYA 3TXSA 5CN0A 1X9VA 1H8HG 1M90Q 1XNQO 2KLVA 1GL2B 1V55B 1K73W 1P84H 3ABKB 3SJCC 2WWWA 3K9SA 2WPVB 1OCOC 3HD7C 1PV0A 2N74A 3JD4A 4DR3O 1VQ7V 3OA7A 3TYYA 4KJMA 4N3YB 5B66E 1Z5WA 4JYCA 1BE3G 3U1AA 1GW4A 5JCOC 1VQ8P 3H1HE 1YSCA 3L71G 1NU1J 3AG4B 4G28B 1H2LA 2O3JA 1NU1H 3TK1A 2EIKC 3H1KJ 4J41A 1OVRA 1VPCA 3WU2E 3H1KH 3CD6V 4C7RA 2ZXXA 4BW5A 3L4FA 1ZN5A 2IYPA 3OW2U 2UXDO 4FZ0A 2WSFJ 4IL6X 2PF4E 4WY4B 2XAHA 2WSFH 3U0ZA 4JYBA 1VIBA 4U3JA 2IZ0A 3PRJA 5BMVA 3BA9A 5IYCO 2V1DA 2KSEA 2BTOA 4FIPC 1JFFA 4Y99B 3ZMZA 2IYOA 2FFDB 2E75C 4DR2B 1JY2N 1OVVA 1W2BO 1Q82W 1NH2D 2GBOA 1OX3A 4ZKPA 5KJ7C 2IJHA 4CC5A 4WBNA 5FNVB 5EFWB 1SS3A 3RYHB 1LT9A 3K5NA 2WMMA 1MZEA 5AW7B 2FYUE 4QNHB 4UFZA 4X65B 4LF9O 1VQLV 1HGVA 1O9HA 2H89C 4IFMA 4JI2B 5JJJB 1QVGU 4CPGA 1GU4A 3JATA 2GUSA 1EN4A 1VQOP 4UV8A 2YC0A 3CCQP 3VMAA 5GONB 1L2PA 3BHPA 1DTOA 1RSOA 1GM8A 1NS1A 2ZYDA 1JTHB 1YVWA 1VQMV 4K35A 2W8ZA 4I2LC 3K08A 1P84F 5TISH 1N36B 4ASUG 1SFCA 3F89A 4J7ZA 1HNWO 4M3LA 3W67A 5B66H 4GKKB 3CXHE 3N2GB 3TJTA 2PI5A 4IL6Z 1FS0E 3FB7C 1P84I 4DK1A 2YIBA 2NPSA 1J1DC 1VF6A 2FKXA 2UU9O 3SPCA 1BDCA 3GWOA 1OW7A 3VOUA 3L71D 4MS2A 1U97A 2Q1KA 3NFQA 5LYJB 4FM2A 3OGIB 1KD1Q 2ITDC 1FZEA 1PNLA 2VQFO 4GOFA 1BSNA 2OYIC 5J2UB 1PGOA 1M1KQ 1HNXO 1FFXA 4DT0A 2E74C 1ENVA 1OVUA 4TQFA 5KAFE 4XDKA 3P8MC 1FZCC 1S4XA 1KP3A 3D3IA 2ZM6B 1DEEG 1H2SB 4J9ZB 2HVKC 2XUMA 5KTBA 3SGIA 1XNRB 1AVOA 2WA3A 2FYUJ 5APXA 2FYUH 2CK3H 4CS2A 2B1IA 2A79B 3B5NC 3P8CD 1BGYE 4ASWA 1P4RA 3OTOB 2Z5UA 2E76C 4ZIBA 2K3RA 1HJBA 4OXSA 1E79H 5AVTB 2HPCA 2Y4UA 4DR4B 1JNMA 3QF7A 2Z5HA 2E5LO 1SKVA 3IC7A 1OIPA 2ITAA 3I55P 2LQTA 3HKEA 3E8BA 2M8RA 1VQPP 3AG3C 2IJIA 5B1AC 3UT5B 4L73A 3IJ4A 2LW7A 1AJQA 1YITV 2HKOA 5B3SC 5KMGA 4WWIA 3M9BA 3A0BH 1NH4A 5DECA 2O01H 1NI8A 1Q86W 1CP9A 1H0TB 3H32B 1IVSA 2DYSC 4H33A 1IFMA 4IYIA 4DV0O 1ZP0C 4HNAB 4PD4F 2ZFCA 2A06D 3PLNA 4IOIH 2ADPA 3V4WA 2FXOA 5APTA 2O01N 3E1IA 3GWKC 3ASOC 4JAAA 1OZHA 4TOIA 4PD4I 4XBFA 1YIJV 5KAIH 1YJWV 4A7PA 2A45I 3S9OA 5KAFH 4I50B 3RW0A 2K9JA 1ZV8A 2UUAB 1NWQA 4FM0A 1Q6HA 4B3RB 5AW1B 2HFEC 2QR4A 2AXTH 4NXNB 1WAZA 4QPKA 5AVRB 3ZHTA 2QWPB 3BEHA 2BCCJ 3KCYA 4DUZO 1R73A 2BCCH 1SRYA 5H2FE 3Q5RA 4FZ1A 1YTFB 1BDDA 3OFNG 5LMUB 1YYCA 3MGNA 2WLIA 4I1LA 2OT5A 3ZHRA 1DD4A 4WVZA 2Y9YA 2NLJC 3WB1A 1JM0A 1YHQP 3A2FA 4F4LA 3MUDA 2NZ2A 4NVPA 4HYTB 4EB6B 2ZYGA 3P30A 2WLLA 2E43A 4LGDE 1K4DC 5KLVH 1XDCA 5LXTA 3UKMA 4WCEV 1NTMG 1QLEB 4IT5A 2WPRA 1G1JA 2POHA 4ZI7B 2UUCB 2JIZG 2BASA 2RMKB 1SQBD 1LP1B 5B5EZ 3T1HO 5GTHE 1W0KG 3RBXA 4K8ZA 1NTKK 1PL5A 4LLHA 3L73H 4TV8B 3JARB 1LTJB 2IU3A 3HE5A 2IFMA 2E42A 1YQ3C 3ZJZA 4D6TG 2KQXA 3CCUP 2YXRB 3AG4C 2WLMA 4HZ3A 1BE3E 3ASNB 4TT3G 4I7ZB 1FOSF 2YICA 3K59A 3M9QA 5LA6A 3SPGA 2YI9A 4WFAV 5IY5C 3L71E 3D71A 4UB8H 4MVRA 4CH6A 2K37A 5ITZA 1NJIW 2Q9IA 4TV9A 2Q6QA 4CH4A 2OYHA 5CMUA 1QLNA 1TAEA 1L0LG 3RVZA 2DWEC 1OFCX 4X66O 5AVSB 3SR2C 4AQRD 2JO1A 5CCGC 1JY3P 1OCCB 4B3TO 3Q3DA 4BIZA 1KKCA 2FFDC 5H2FH 1N2DC 4UCSA 2G8YA 2L6LA 3SDLA 2WSEJ 3ZRXA 4JI3O 2WSEH 5BR8O 4LC1A 1MSDA 3OUFA 1URQA 4I0XA 2QKSA 1TUBB 1VQNV 1G1XB 4K8XA 5E79E 3CRQA 1QQCA 3V5BA 2EZPA 4MVOA 2ZNIA 3P8CE 2QM7A 4O4LA 3KPEA 3A5TA 1QVFU 4G27B 2KB1A 4OGQD 1H8AA 2RQ6A 1T2KC 3SWFA 1OCZB 1N8RW 5L3EA 4K0KB 1I5XA 2WSSG 2B87A 1GU5A 2A3QA 4B3SO 2RCVA 4O4HB 2R32A 4DV5O 4UUJC 3BRTB 1NTMD 1MA1A 3APQA 1N7LA 2Y0IA 3HTKA 5DJTB 1RF1B 2WA4A 1IBLO 1X8YA 1UIXA 4BWNA 1BE3J 1AB3A 1KTMA 1BE3H 5APWA 1JOCA 4JI0B 1KQSU 2KSDA 3RFRA 4DR7O 1K92A 3L71J 1CEZA 1AR4A 5CMZA 1Q7YW 1GDTA 2YO2A 4FM1A 1AI5A 1K3EA 1FZAA 1SA0A 1T6AA 2CDYA 2R3CA 1L0NH 3C9IA 3K9AA 1SF9A 4DCKA 4DR5O 4UB6E 1DK1A 1RF0A 3OMIB 1WB7A 2D3OW 3C90A 2P7TC 4O4IA 1L0LD 3ABMC 3CHXA 3BVOA 3ITKA 5CB4A 3MTUE 2ETNA 5CCGD 1EXJA 5JQGB 4DR6B 1ZL8A 3OGCC 3KZIZ 2M5AA 3A0HE 5AVVB 5CA3A 3TNUB 2FMLA 3W68A 1JMMA 1PD3A 3FB8C 5LHHA 5E79H 2K9YA 4I9WA 2FXMA 3HKCA 1PP9G 3RL0D 2QEXP 2UUBB 1BHAA 4L87A 3B09A 4DJGA 3AG2B 3SPHA 2ZIMA 3PH0A 1THZA 3WMM0 4DV1O 3CS5A 3L9DA 1LTTC 4EI2A 1G8MA 1OMIA 2CTPA 2QM4A 5LGUA
chains in the Genus database with same CATH topology
2G3AA 2JO1A 3H25A 3LW5J 1Q90D 1FDIA 3Q3DA 2IDBA 2WSCJ 1IK7A 4YXDC 3D6YA 3AEFC 2G8YA 3FGAD 2P10A 2WSEJ 3AE1C 2V7QJ 4H13C 3RK3E 2QSIA 1ZRTE 3Q5SA 1ZP0C 5KLIC 2BEQD 2QJYC 2H88C 1ZOYC 3EWKA 4H0LB 3IAOA 2H89C 2ZT9C 4I7ZC 1RQUA 4OGQB 3B71A 1VF5B 4H0LD 5KKZC 4H44B 2FXPA 1PIXA 1ZMEC 4Y28J 4OGQD 4OGQC 1VF5D 3AEAC 1VF5C 3S9OA 4H44D 3AE7C 3Q5PA 1YQ4C 1KORA 3AE5C 4H44C 3G9RA 2JP3A 3D70A 3C8VA 1NGMB 1K05A 1K04A 3AE2C 4GDOA 4PV1B 1NYHA 1TU3F 3T97B 4PV1D 4YTPC 3AEDC 3GLMA 4Z1MH 3IN6A 3SFEC 2QJPC 3Q5RA 2FYNC 1HJ0A 1UIXA 3D6ZA 1DD4A 1S5LX 1OW7A 1KTMA 4H0LC 3GMAA 2WQYC 1JB0J 2BEZF 1FDOA 1RQVA 2QIWA 1KMIZ 3ABVC 3RL0g 1HF9A 2NZ2A 2FBWC 3AEBC 1DIPA 2YMKA 2E74B 1U57A 1S1CX 2E74D 4U7JA 2E74C 1OW6A 4TT3H 1AJYA 2WPVB 3R4YA 4PV1C 3SFDC 3AE9C 3AEEC 1KILE 1EXIA 3AE6C 5M1BA 1KQFB 1WMKA 1PL5A 3AE3C 3O6QA 1EXJA 2J5UA 1PV3A 1OW8A 4R4MA 4RKUJ 2E76B 2D2CB 2O01J 4H13B 2MKVA 1YQ3C 5L8RJ 3Q2YA 2E76D 2K9YA 2D2CD 2E76C 4H13D 1VL2A 2D2CC 2YIUC 2OQQA 3GF3A 1R8EA 2ZT9B 3GF7A 4I7ZB 1DD3A 2WSFJ 4IL6X 3D71A 4KT0J 2ZT9D 4R4LA 3AEGC 1MKMA 4XFJA 1GMJA 2E75B 3AE8C 3Q1MA 3AE4C 3AECC 1OMIA 1Y9BA 2E75D 1KQGB 2QJKC 2E75C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIW A;  3LW5 J;  4RKU J;  1Q90 D;  2E76 B;  2D2C B;  2O01 J;  4H13 B;  2WSC J;  3C8V A;  5L8R J;  2E74 B;  2K9Y A;  2WSE J;  2YIU C;  4PV1 B;  2QSI A;  1ZRT E;  2ZT9 B;  4I7Z B;  2WSF J;  4IL6 X;  5KLI C;  2QJY C;  2WPV B;  4KT0 J;  4H0L B;  2QJP C;  2FYN C;  2E75 B;  4OGQ B;  5KKZ C;  1VF5 B;  4H44 B;  1S5L X;  4Y28 J;  1JB0 J;  2QJK C; 
#chains in the Genus database with same CATH topology
 2CTR A;  3AG7 A;  3BAA A;  5LHI A;  3H25 A;  2BTQ A;  1NTZ H;  4HH2 A;  1L4A B;  1K8A Q;  2B9Z A;  1S3J A;  4R8C A;  2JGD B;  3CB2 A;  4B7E A;  2PGD A;  3SYA A;  1UPG A;  3GHG A;  3E22 A;  2EUL A;  4YXW G;  1Q7Y Q;  5DJU B;  2RDC A;  1NAF A;  2IFN A;  4LF5 B;  2H88 C;  5LMN B;  5L3F A;  1KV4 A;  1RE4 C;  2BOB C;  1EZV G;  1GM7 A;  4CC6 A;  1IFI A;  1JVM A;  4UCU A;  1VF5 B;  3QTC A;  4JI1 O;  5HFM A;  4I4T A;  4UXN A;  5B1B B;  4OWF A;  5FLX N;  2QJ1 A;  3ZS8 C;  4DV6 B;  3S4R A;  4OPA A;  2YSU B;  4UB6 H;  2I8D A;  2NR5 A;  3PJS K;  3CI9 A;  3OJA B;  2JGU A;  2ZXE B;  1Q5O A;  1DGS A;  5A2Q N;  1NGM B;  3SYQ A;  3DC5 A;  1UJW B;  1S5J A;  2XDJ A;  1NHL A;  5L3D A;  1HR0 B;  1VQ7 P;  4KUM A;  1BQZ A;  1GTW A;  3A0H H;  1XL6 A;  1NBM G;  2HJD A;  4DV7 B;  1PPJ G;  2VRS A;  3MIW A;  4EOT A;  2VQE B;  1URF A;  4DXW A;  4U3J B;  3G71 V;  5BMV B;  3NR7 A;  4U3F H;  2Y69 B;  3TSI A;  2HHH B;  3FB6 C;  4P9O A;  2QIW A;  3ABV C;  1JFF B;  4PA7 A;  4JYA O;  1FS0 G;  5GTI Z;  1LNQ A;  2OYO A;  1SQB K;  1NVP B;  3E7K A;  4RJT A;  2H8P C;  4LBE C;  4PJ0 Z;  4ZNC A;  2AEM A;  4WBN B;  1EDK A;  1N32 B;  1LWU A;  2UXB O;  1LT9 B;  1QEX A;  1SQX D;  4KHP O;  1GW3 A;  2KYV A;  4PV1 C;  4JI5 O;  4OX9 B;  1SQP H;  3WUV A;  3RYF A;  3M91 A;  1H38 A;  3V2P A;  1QLE C;  2W6A A;  3JAT B;  1PFI A;  4XDJ A;  1M93 A;  4W4K A;  1QU7 A;  3K5B A;  2YIU B;  4H13 B;  3QO5 A;  1LT1 A;  2Y0E A;  3I5C A;  1NTM E;  3VP8 A;  3VTP C;  2Z0A A;  1S0V A;  1W5C E;  2Y0C A;  3T4Z A;  2LO1 A;  5A9G A;  1GKF A;  1RSO B;  3MD0 A;  1VQL P;  1B3Q A;  2HG5 D;  3LNN A;  1BCC G;  5AG2 A;  4WFH A;  2EZO A;  1SFC B;  3GF7 A;  2Q3I A;  1H89 A;  4NPF X;  3E8H A;  1M57 B;  1QL2 A;  2XAJ A;  1BGY G;  3CCE V;  4D6T E;  1PL4 A;  1H8E G;  3FX0 A;  2C9N Y;  1XTG B;  2KP8 A;  2NPS B;  5TJH A;  4X64 B;  1Y67 A;  2IBZ H;  2JVD A;  2ZVN B;  4YXD C;  4DV2 O;  1T3U A;  1OCR B;  4IFD K;  4A5U B;  4GZR B;  3CMA V;  1OCC C;  2XZR A;  3ABU A;  3JCZ A;  4U7O A;  1S76 D;  1L0L E;  3RBZ A;  3VYI A;  3RK3 E;  3CPW U;  2B9B A;  1AR1 B;  2Q67 A;  2ZE7 A;  5E1A C;  3EVK A;  3FD9 A;  3K03 A;  5KLI C;  1BMF G;  5KKZ B;  1PPJ D;  1FFX B;  2UXC B;  1AP5 A;  3UO2 A;  4XDL A;  2RN0 A;  3JAS A;  4UVC A;  1RQU A;  4LF8 B;  4ZBM A;  4N78 D;  1P7B A;  3B2E E;  1R3L C;  2OYQ A;  4DV4 O;  1DH3 A;  3T1C A;  1KIL D;  1N7S D;  4FFB A;  1M90 W;  4IL6 E;  2ZKO A;  3QVN A;  4EDF A;  1QBZ A;  2N1T C;  3F7V C;  3SJB C;  4LFB O;  4NXM B;  3FX7 A;  2V7Q H;  4PV1 D;  2HPC B;  2F93 B;  1V54 C;  1NTM J;  1R5L A;  3CCM V;  1HBW A;  1WT6 A;  2CAZ C;  2EIN B;  1NTK G;  4ZOL A;  1YJN P;  3H1L G;  3L37 A;  1RF1 C;  4BW9 A;  2DWD C;  3HKE B;  2ADQ B;  3HUS C;  5LP6 A;  2F4V B;  2EJ7 A;  3H9V A;  1PNK A;  2HR3 A;  3W7U A;  2HVJ C;  4PDR A;  2Q9L A;  3I56 P;  4D6T J;  5KMG B;  5JJN B;  1BCC D;  4D6T H;  3L72 G;  3A7O A;  2QGN A;  4TSF G;  1N86 A;  5KX5 A;  1Y4M A;  3R65 A;  4AYC A;  1RP3 B;  2QE7 H;  4TT3 H;  2Q69 A;  2Q5Z A;  1YIT P;  1AR5 A;  4D7S A;  2K1E A;  3CCR V;  1L0L J;  1L0L H;  4JYY A;  3JSL A;  4R50 A;  2HLO A;  3V2N A;  4O4J A;  1US6 A;  1OW8 A;  5IJ0 A;  3SPI A;  3PN1 A;  4JZ2 A;  4I9Q A;  3MZW B;  4CS4 A;  4YJ3 A;  2JK5 C;  2P4V A;  2IBZ I;  2W90 A;  3W7T A;  2K9J B;  4MVM A;  3T1Y O;  1MUU A;  2WT7 A;  4NKG B;  1WLE A;  3S3W A;  1EDI A;  5JCO A;  1AA0 A;  1YDX A;  3ZHQ A;  3JD1 A;  1MFZ A;  1YIJ P;  1YJW P;  3CCL V;  2PP6 A;  1FJG O;  5D5P A;  2AW9 A;  4IL6 H;  3ZCC A;  3X2Q B;  3HRN A;  3BPZ A;  1DF4 A;  1PP9 E;  1EN6 A;  1RHZ B;  1Q2N A;  2WLI B;  2KB7 P;  2IDB A;  3I5D A;  2WAM A;  2WSS H;  1M56 C;  3LDC A;  3TGU D;  3D36 A;  2WLN A;  1L4A C;  2N1T D;  2RNB A;  4EEQ A;  2WLL B;  3SYP A;  1SZT A;  5CBF A;  3Q5S A;  2QJY C;  1NTK D;  2G38 A;  5CHX A;  4GX0 A;  5LXT B;  3H1L D;  5LBQ A;  3TCU A;  3MP7 B;  4LF4 B;  4GKJ B;  5CCH C;  1GH6 A;  3M9H A;  2O1K A;  2LW1 A;  3A2A A;  4JBZ A;  4LP8 A;  1QGK B;  1IFN A;  2SPZ A;  1K9M Q;  4AQY B;  1KD1 W;  1XNQ B;  3BVH A;  1CXZ B;  1YI2 V;  1VF5 C;  4JAU A;  1R5S A;  2R44 A;  1VMG A;  5B1B C;  1M1K W;  3L72 D;  3EFF K;  1SET A;  5J9P C;  1PNM A;  4NPD A;  1EZV E;  3HE5 B;  4DR3 B;  2HEP A;  3CME V;  2AXC A;  2JS3 A;  3H1I D;  3APO A;  5IYZ A;  3SYO A;  3K57 A;  3RK3 B;  2QKC A;  4X1K A;  3AED C;  1IC2 A;  3RYC A;  3LNM B;  1MZ9 A;  3JD3 A;  5LA6 B;  1FPO A;  1LGH B;  2KUB A;  2GM4 A;  3D6Z A;  1JEK A;  5ITZ B;  1Q81 W;  4TV9 B;  1SQX K;  2OYH B;  2UXD B;  4TUY A;  1HF9 A;  1VQ9 V;  3FB5 C;  4C46 A;  2Z4E A;  4B3M O;  3ZBH A;  2W0F C;  1PPJ E;  1U57 A;  5CA1 A;  1R6K A;  1S1C X;  1JJ2 U;  2OTK E;  2C9L Y;  2Q7G A;  1PP9 J;  3CC7 V;  3CP1 A;  1ZWI C;  3H1H J;  1OW6 A;  1PP9 H;  4GX2 A;  4N78 E;  4Z1M G;  3H1H H;  2X7R B;  2KIK A;  3VP9 A;  5B5E E;  1JY2 O;  3HD7 D;  1KYO E;  1URQ B;  4I0X B;  1H2G A;  1LT9 C;  2A06 G;  2C0X A;  3E2E A;  5IJ9 A;  5KHI A;  4JI7 O;  1KIL E;  1ZAU A;  4HKZ H;  3WU2 H;  3JD0 A;  2OYI A;  3JCU E;  1KQF B;  4OPH A;  3O6Q A;  1FD9 A;  3UCS C;  4UVB A;  4O4L B;  4RWU A;  4LF9 B;  4E2L A;  1NKD A;  1F23 A;  3RK2 B;  1K5Q A;  4LR3 A;  4YJ2 A;  1M56 D;  1H2M A;  3LDD A;  3Q2Y A;  3G3Z A;  2QTS A;  5KA6 A;  4DOJ A;  2YIU C;  2B87 B;  4BAY A;  3JC2 2;  5EIB C;  4YHH O;  4L74 A;  1YZB A;  4FLX A;  1JY3 N;  5CCH D;  4XE5 B;  1L1F A;  1DF5 A;  4DR1 B;  3N7N A;  2NN4 A;  2DW4 A;  1KP2 A;  4TQD A;  1EZV H;  3HTK B;  1HNW B;  5LOV A;  4K3A A;  1BCC E;  2P7J A;  2E75 D;  2V4H A;  5EZY A;  3BFR A;  5KJ7 D;  1M4U A;  1IK7 A;  3L74 D;  4LF7 O;  1Q81 Q;  4JI6 O;  2AHY A;  3CX5 D;  3DSQ A;  3KKY A;  2QTO A;  2UU9 B;  2B88 A;  1FXK A;  1SQV D;  1F4N A;  1OCR C;  2W27 A;  4LF6 O;  1SA0 B;  3AG1 B;  4MT8 A;  2BEQ D;  4Z2W A;  1ZOY C;  3EWK A;  1S5H C;  4H0L B;  1LTI C;  1FDM A;  4MVQ A;  3NXS A;  1FKA O;  2C0W A;  1HTL C;  1PPJ H;  2VQF B;  5KKZ C;  1XMQ O;  2PYJ A;  5EK0 A;  4O4I B;  5FPR A;  4E4E A;  1HNX B;  1CZQ A;  1LTB C;  5KUM A;  4X88 A;  3K58 A;  5CB4 B;  1SQB G;  3OEH G;  2R9R B;  1X0T A;  1X79 B;  2GDS A;  3CXH H;  3G9R A;  3G4S V;  1KB9 D;  1ZL8 B;  1KYO H;  2M5A B;  3OMN B;  4X1Y A;  3T2M A;  2KKW A;  2ZE5 A;  3O65 A;  2OTL P;  4RUF A;  2QA4 P;  3L75 G;  1HH0 A;  1HVV A;  2DW3 A;  1IZ3 A;  2F95 B;  3JCU H;  2UXX A;  1BS3 A;  2XAG A;  2RH0 A;  1EBO A;  3HKC B;  1AJN A;  1B04 A;  3SFE C;  3G6E P;  1V9P A;  1LTG C;  1YTZ I;  2HLD G;  4BRY A;  1UFI A;  2JWA A;  1P7G A;  3FWN A;  2EIN C;  5D5Q A;  5TIS Z;  2YO3 A;  4PDV A;  2E5L B;  3LUT B;  2R5D A;  5IWA O;  2QWR B;  1CI6 B;  3GW6 A;  4LFA O;  4NTX A;  1GO3 F;  2BTQ B;  1B6Q A;  1NTK E;  1T8Z A;  1PGQ A;  1X4T A;  1HUC A;  3H1L E;  4HYO A;  3BA8 A;  1VQ4 V;  1BCC J;  1IZN B;  4PI0 A;  1J5E O;  4JI4 O;  2E74 D;  4U7J A;  1BCC H;  4JF7 A;  3ZRV A;  1FE6 A;  4D6T D;  3SYC A;  1VQ5 V;  3GHG B;  3E22 B;  4PEL A;  2N9B A;  1RM1 B;  1BGY J;  1MG1 A;  2EJR A;  3H1J G;  4ZKU A;  1BGY H;  4AHC A;  1YCI A;  4NR1 A;  3IFM A;  3L72 E;  3N2K A;  4XA4 A;  3SWK A;  4DV0 B;  4AIL C;  1WMK A;  1PV3 A;  2H3O A;  3B5N D;  3CRC A;  4I4T B;  2D2C B;  1VQ8 V;  1LJ2 A;  2E76 D;  5K5G B;  2R70 A;  1KBH A;  1R8E A;  2ZR2 A;  2R5B A;  2XND H;  2ZD9 A;  2ZT9 B;  2BSK A;  1IBK O;  5KLV K;  1R3J C;  1COW G;  1XOU A;  4YPC A;  3LSS A;  3MAQ A;  4CH3 A;  1GL2 C;  1V55 C;  3ABK C;  4DUZ B;  5AVQ B;  2Q7H A;  1PGP A;  2YXY A;  5CA0 A;  3JSN A;  3J7A U;  3L75 D;  1MFT A;  3DXR A;  3CXH I;  4GUN A;  3RT3 C;  2A0L A;  3P3P A;  1JR9 A;  4OVN F;  3MUD C;  4C7N A;  3E86 A;  3G71 P;  5CCG A;  3M0D C;  3M99 B;  1LWU B;  2W6I G;  5BVZ A;  1NTK J;  5EBL C;  1FJP A;  2PRR A;  3H1L J;  3A0B Z;  5EYP A;  1IO4 A;  2BE3 A;  3H1L H;  4H44 B;  4WY4 C;  2W6B A;  1RPR A;  2FB5 A;  4HJG H;  2M3E A;  3RYF B;  1HP8 A;  5APU A;  4IHJ A;  2OCH A;  5AW5 B;  1Q8I A;  4MSW C;  4DUY O;  2AEJ A;  1I94 O;  1KOR A;  5K1X A;  1VQK P;  3K3W A;  1VQO V;  2K1A A;  3WG7 B;  4Y99 C;  2HFE D;  3L72 J;  3M8A A;  4LH6 A;  1SS1 A;  4GDO A;  2KI7 B;  2YKP A;  2KS1 A;  1WPB A;  3T1H B;  2QJP B;  4W80 A;  3LIE A;  2I1K A;  2FYN B;  3T97 B;  1K7D A;  4KHX A;  4K0K O;  3H1J D;  5FPO A;  2E3C A;  3CWB D;  2UWJ E;  4GOE A;  5KAI Z;  3ETE A;  2Q4P A;  5KAF Z;  2AZ2 A;  3L36 A;  2Z3Y A;  1NVO A;  3CX5 E;  1Y6X A;  3JD2 A;  2CGN A;  4IIJ A;  3SPJ A;  2WQY C;  2IZ1 A;  2CH7 A;  4PJ0 E;  2PZS A;  4MTX A;  2AXT Z;  2FBW C;  2W83 C;  1EQ7 A;  3CSX A;  1W2B U;  3C3S A;  4L76 A;  2GHY A;  3THO A;  4X66 B;  3IAY A;  3HE4 A;  5GTH H;  5BU5 A;  1VEW A;  4B3T B;  3IGA C;  5AW0 B;  4FK5 C;  1GL2 D;  1SQQ D;  3AE9 C;  3AEE C;  3R2P A;  4AI8 A;  1KB9 E;  5JVD A;  2Y0P A;  4JI3 B;  2P1J A;  2YUA A;  5BR8 B;  1K8A W;  3JAS B;  2WTY A;  3CMA P;  2LJ2 A;  2WPD G;  1Q6I A;  2ZDI C;  3F5T A;  2EIL B;  5JJE B;  1FXH A;  3HKB A;  3L71 H;  3H01 A;  2A06 E;  4QGP A;  2W0X A;  4EFE A;  1XUQ A;  1I5Y A;  2VS0 A;  4FFB B;  3RK2 C;  1N0J A;  3K5L A;  3CCJ V;  1L0N K;  2CTQ A;  1T3J A;  1E1R G;  3HB3 B;  2EIJ B;  4W7Z A;  4YIP A;  3K04 A;  1P49 A;  3AEG C;  1NKZ B;  1SQV K;  3CCS P;  4B3S B;  4WY4 D;  1K34 A;  3VMZ A;  2VRZ A;  3U1C A;  1S9K D;  3AEC C;  1IX9 A;  1NH2 B;  4DV5 B;  4LFC O;  3TXQ A;  4ZOL B;  5APS A;  1SER A;  3MHV A;  1WP7 A;  1TVK A;  3ABT A;  3CEI A;  1GN4 A;  3RVY A;  1J1E B;  2O57 A;  5LP6 B;  1Q3E A;  4Q20 A;  1IBL B;  1OWA A;  4DW0 A;  1OXZ A;  4WBA A;  5H9C A;  4UB8 Z;  1R1B A;  3WB2 A;  4FLU A;  4HAM A;  4DR7 B;  3ETD A;  1K97 A;  5KX5 B;  1SQX G;  3AG1 C;  1ROP A;  2V4D A;  3B71 A;  1ZLL A;  4DZO A;  3STZ C;  3JAL A;  4JV5 O;  5H2F Z;  2M0B A;  4DR5 B;  1N34 O;  3M7M X;  1T2K D;  2XTA A;  3ZHV A;  3Q5P A;  2P58 A;  3FFQ A;  2JP3 A;  1XMO O;  2VWK A;  4EKW A;  1NTZ K;  3ICX A;  4O4J B;  1MSW D;  2PGG A;  5IJ0 B;  3OW2 O;  1P84 D;  1YXB A;  4YJ3 B;  3JSV C;  1AI6 A;  5LL6 Y;  1SQB E;  2XAF A;  3ABL B;  2WT7 B;  3CC4 P;  4Z1M H;  5KUK A;  4X62 O;  2ZJS E;  2IM9 A;  4JPZ B;  2VWJ A;  4FLT A;  2WLK A;  3CC2 V;  1HJ0 A;  1FU1 A;  2A45 G;  2A06 H;  3L75 E;  1NT2 B;  1FDO A;  4JPR A;  1KKD A;  1IFP A;  3H1K D;  3KQG A;  5CBH A;  2KSJ A;  4DV1 B;  2ZIN A;  4PI2 A;  2RJZ A;  4L75 A;  4X20 A;  1YHQ V;  1VAR A;  1ZLZ A;  1IBM O;  1N73 A;  3S3X A;  1KC8 Q;  3VBB A;  1AJY A;  1QVG O;  4BWA A;  3F7Y C;  4J7K A;  3EQ2 A;  3QH9 A;  4I6M C;  1KIL A;  1N7S A;  3GHG C;  1MMM A;  1A02 J;  4W4L A;  1JMK C;  1RM1 C;  1N4C A;  1QR8 A;  2IW5 A;  2YS8 A;  4YY3 O;  1X22 A;  2L91 A;  2QVA A;  5KHG A;  5KHK A;  1M7L A;  1PM9 A;  3KXD A;  2KG7 A;  2JKV A;  4ZKI A;  3CD6 P;  1BSH A;  1LUW A;  2XV5 A;  3L35 A;  3FXD A;  3V2Q A;  3H1J E;  3FWL A;  1SP4 A;  3CWB E;  4I55 A;  2D2C C;  4JI1 B;  4GLX A;  4DRX A;  1DD3 A;  1AP6 A;  3CCU V;  2GUZ A;  5IYZ B;  3B8N A;  1BHB A;  4BR6 A;  1YI2 P;  4X1K B;  1SQP K;  5CBG A;  3RYI A;  4LWS A;  3RYC B;  3AE4 C;  1W59 A;  2XAQ A;  1WRG A;  2XAS A;  1SQB J;  2YMY A;  1M1J A;  2N9Y B;  1FXV A;  1SQB H;  1JCH A;  1FFT B;  1YJ9 V;  2ILM A;  2MJZ A;  1HWY A;  3OR7 C;  1JUN A;  4TUY B;  1OV9 A;  1MNG A;  1LTJ C;  3FGA D;  3L75 J;  2LP7 A;  3ETG A;  2PFX A;  3T97 A;  3ZMS A;  5CA1 B;  3F5H A;  1J1D B;  1MV8 A;  3MDS A;  2QSA A;  4PD4 D;  4JYA B;  3ASN C;  4Z1V A;  4I7Z C;  3RGU A;  2ZE8 A;  1VQ9 P;  4C7U A;  3KHU A;  4FFK A;  1JX9 A;  1LWU C;  1N33 O;  1DEB A;  1AQT A;  4F6E A;  1VQM P;  1KEC A;  5IJ9 B;  3F5W C;  2UXB B;  1LTS C;  1J95 A;  3SJA C;  3FYE B;  4X89 A;  1YTZ T;  3AE7 C;  4KHP B;  4ABM A;  2YXH A;  1AIL A;  2UXC O;  3N4X A;  3ETQ A;  4JI5 B;  5IE9 A;  4H44 C;  3O6Q B;  2OYI B;  4GIF A;  4JI8 O;  3ZHU A;  1F4M A;  4YJ2 B;  1FJK A;  4KXR A;  3WG7 C;  5APY A;  2BCC G;  2RN9 A;  1AI4 A;  1Y47 A;  2QWN B;  3AK2 A;  1PGJ A;  2QJP C;  3H1J J;  2FYN C;  2FYU D;  2B89 A;  1DLB A;  1WB8 A;  2XKM A;  1YTF D;  2N1T A;  1ZX3 A;  4RO0 A;  1RE3 C;  1SQQ K;  5LOV B;  1H2K A;  4PHZ A;  5AW8 B;  3M0A A;  1FBM A;  4O9B A;  3CC7 P;  5EZY B;  2H8P D;  3AEI A;  3EXA A;  5KLV G;  1OCZ C;  2M6Y A;  2F4V O;  3TGU G;  2YEV A;  3HUS A;  1FXK B;  2XT9 A;  2CPS A;  4IYH A;  3SFD C;  4DV2 B;  5K1P A;  4QMA A;  3QWO C;  1GN6 A;  4DV3 O;  1NTM H;  4R6Z A;  1EXI A;  1QLE D;  4D7T A;  5M1B A;  3L73 G;  3H6P A;  1P84 E;  1Y76 A;  3L70 G;  2A9H A;  1E1Q G;  5AVX B;  2KNC A;  4R4M A;  2IH3 C;  1HNZ O;  1GAX A;  2DYS B;  5AVZ B;  4JZG A;  3U59 A;  1H88 A;  5LGN A;  1PZQ A;  1K5S A;  4J7J A;  4EYY Q;  4X1Y B;  3OE7 G;  3U10 A;  5LHG A;  1JO5 A;  3SWY A;  4Q6G A;  3H1I G;  4DV4 B;  2H43 A;  5CJ0 A;  1K9M W;  3G80 A;  1Z56 A;  1D5A A;  4FLY A;  2QJK B;  5B1O A;  4WF9 V;  1GRJ A;  3G4S P;  3Q1M A;  2EIJ C;  2EIM B;  1NR7 A;  4J9Y B;  1DX7 A;  2DJV A;  4LFB B;  2ATK C;  4BRY B;  3N27 A;  4BXL A;  5C39 A;  2WSC J;  1SQF A;  2P5O A;  3D6Y A;  1R6N A;  3AEF C;  3CXC U;  2WSC H;  3HD7 A;  4PA3 A;  4FLW A;  2HOD A;  2BCC D;  1I08 A;  4FVM A;  1W2E A;  1OJH A;  1J1E C;  2ZAE B;  1MZF A;  2NNU A;  1EDJ A;  1AFO A;  3CYO A;  1CSB A;  3IFX A;  1XRE A;  5H6Q A;  2Y48 A;  5KHH A;  1VDF A;  3E35 A;  4OGQ B;  4HBN A;  3AG2 C;  5C8Y A;  2GSM B;  1RFY A;  2P6J A;  2WPS A;  1VQ4 P;  3N2K B;  3JAW A;  4WB4 A;  2ZE6 A;  2N04 A;  3D70 A;  5KLV D;  2OWO A;  4NTW A;  1VQ5 P;  2JS5 A;  1SQX E;  5CCH A;  1D5N A;  3AE2 C;  3D3Q A;  1NU1 K;  4AQY O;  1ARO P;  1BQ0 A;  2ARH A;  4DR2 O;  1ZR4 A;  1KFN A;  2PUS A;  4QJF B;  1OZ0 A;  5TIS E;  2BSK B;  1EN5 A;  1ZUQ A;  3HKD A;  2ZR3 A;  2KZJ A;  2CGO A;  5KJ7 A;  4MW3 A;  3L73 D;  3ABL C;  2ZXW B;  3T1Y B;  1F51 A;  2LFS A;  3L70 D;  1S5L X;  5AW2 B;  4J10 A;  2JEE A;  3J81 N;  4NPE A;  4X9Q A;  4ZMD A;  1KFM A;  2Q8V A;  4X65 O;  4O2A A;  4MVZ A;  3CRR A;  4PA9 A;  3AEB C;  2LXB A;  1VQ6 V;  2YMK A;  4PD4 E;  1WN7 A;  3B4S A;  1L0N G;  4JI2 O;  1FJG B;  1QR9 A;  5CA0 B;  1GK9 A;  4FPP A;  5IY5 B;  3L74 G;  3KDP B;  4QE7 A;  3DXR B;  5KA5 A;  3O9O A;  1SQV G;  4W7Y A;  2QDO A;  4DK0 A;  2XNX A;  4C7N B;  5AVY B;  3D36 C;  1Q43 A;  1N36 O;  2CE4 A;  1QVF O;  1U7M A;  1N0N A;  3AE6 C;  4KP4 A;  2P90 A;  4HB1 A;  4GKK O;  1F7Y A;  5EYP B;  2EBO A;  4PA4 A;  1SLQ A;  4IHJ B;  2MKV A;  2Y69 C;  3B40 A;  3RL0 B;  2JRI A;  4UCT A;  1VL2 A;  3GF3 A;  4LNU A;  1YEW A;  5JH7 A;  3OEE G;  2PYL A;  2OIG A;  2Q6A A;  1YF2 A;  3VOP A;  2KS1 B;  2X0L A;  4B86 A;  1GMG A;  4WFF A;  1MKM A;  4GX5 A;  1SQX J;  3SSU A;  1K73 Q;  3ZMV A;  2A7W A;  1CI6 A;  1SQX H;  1KQS O;  3NMD A;  1NTZ G;  1S5L Z;  1TGO A;  4GKG A;  3QO7 A;  3ML0 A;  1USD A;  3K5O A;  4IIJ B;  3TET A;  4DR1 O;  3S1K A;  1S72 V;  2ZM6 O;  2CH7 B;  1FZC A;  1HWT C;  1WNS A;  1TUE B;  3WFV A;  1L4A D;  1GN3 A;  1XNR O;  3B8E B;  1VQN P;  2W6J G;  1VF7 A;  2JEU A;  1KUQ A;  4H13 C;  2R3S A;  3A0B E;  3FAV A;  5AW4 B;  1RY3 A;  4YXW H;  1SQG A;  1Y74 A;  2HYN A;  3B5N A;  2RMZ A;  4B3M B;  3C3T A;  1BE3 D;  3HE4 B;  1SFC C;  4PD4 H;  4MVU A;  1W0J G;  3OTO O;  1M57 C;  2A45 H;  4B08 A;  4ZHQ A;  4DR4 O;  1NQT A;  5JVD B;  1NOH A;  1USE A;  1VF5 D;  2IX7 C;  2H94 A;  1YQ4 C;  4NYK A;  3IR9 A;  1L0N D;  2ZQM A;  3DTU B;  5IYB O;  3PP5 A;  2YIA A;  1G1I A;  2FYU K;  2PAJ A;  1FOS E;  2NPS C;  1VF6 C;  4JI7 B;  4UCR A;  2PY5 A;  2O1J A;  1Q82 Q;  3HKB B;  3VN0 A;  5KAI E;  4X1I A;  2WPQ A;  2QRX A;  2OAR A;  3ABM B;  4GX1 A;  2WZ7 A;  2P22 C;  3Q4H A;  4FJC C;  4UV9 A;  3KCX A;  4IFF A;  3GVM A;  3K06 A;  1UII A;  2AXT E;  4U3F G;  2LGW A;  3P32 A;  4YHH B;  2E5T A;  2BCC E;  4JF3 A;  1JCD A;  1KMI Z;  1YJN V;  2Q5U A;  3USS A;  4O2B A;  1ZTE A;  3CCJ P;  1WA8 A;  5B5E H;  3II6 A;  2R9A A;  1JY3 O;  3OTF A;  1TVK B;  2DYR B;  1JPX A;  3I56 V;  1NVP D;  1KN7 A;  5H6R A;  3W7S A;  2OTJ V;  3CCV V;  2KZI A;  3CJH A;  2YKQ A;  1SQP G;  3P3N A;  3VQW A;  3BCC G;  1XBL A;  2F66 C;  2JJ1 G;  2CUG A;  2UUA O;  2QM8 A;  4JI6 B;  4LF7 B;  4NB5 A;  2HP8 A;  1FXK C;  4B3R O;  1FZF A;  4BIU A;  3OD4 A;  4QPJ A;  1NTZ D;  5KLV E;  4NXN O;  1L8D A;  2NRG A;  1PKX A;  5L3C A;  4B7K A;  4LF6 B;  2OGU A;  2DMX A;  2DQ0 A;  3TGU E;  5J2T A;  3O8Z A;  3JAL B;  1S77 D;  2O01 J;  5B66 Z;  5L8R J;  4JQ0 D;  2FTK A;  3WB0 A;  5LMU O;  2IPP A;  4H13 D;  1XMQ B;  5EIB D;  5BU8 B;  3B77 A;  3L73 E;  2Q0O C;  4F6R A;  1QNM A;  3TF5 A;  3L70 E;  1AV1 A;  4PDM A;  3OT7 A;  2JWD A;  1G2C A;  3WU2 Z;  4KT0 J;  4R4L A;  1SFC D;  2FL4 A;  2K88 A;  4UVA A;  4XFJ A;  1M57 D;  4JTA B;  3KZI E;  3CWB G;  3EFG A;  1AI7 A;  5HFL A;  3JAK A;  2IBZ G;  3DGE A;  2QJK C;  2P4K A;  1EZV I;  4JTD B;  4UB8 E;  3H1I E;  2EIM C;  2YIB D;  2E5Y A;  2NPS D;  3E89 A;  2Q3E A;  1S2E A;  2YDE A;  2UUC O;  1R3K C;  3LSU A;  1GL2 A;  3ZN0 A;  2P10 A;  5C93 A;  1SVF A;  2X6C A;  1HDJ A;  3CC2 P;  4X20 B;  1JY2 P;  1XHX A;  3W7W A;  5EC1 C;  3BAT A;  1N73 B;  2JDI G;  5IWA B;  2ZYA A;  1R6T A;  3JAM N;  4U3F D;  4LFA B;  3VMX A;  5B1N A;  3B8M A;  4MW8 A;  1B06 A;  4LCU C;  5JWP A;  1SQQ G;  2FXP A;  1SC5 B;  1J5E B;  3CXH F;  4JI4 B;  5F2V O;  1KIL B;  5CJ4 A;  1N7S B;  1KYO F;  4EFB A;  3OR6 C;  4OGQ C;  2LGQ A;  4TLF A;  3AE5 C;  1NAY A;  2M7W A;  2L5G B;  1BT8 A;  4WFE A;  3M0D A;  3X2Q C;  3V6I A;  3C8V A;  2KG7 B;  2B1G A;  1K05 A;  5KLV J;  1U96 A;  4PV1 B;  1NYH A;  1IJD B;  1KYO I;  4WY4 A;  2V7Q G;  4OH8 B;  3ZRW B;  1SQP D;  3TGU J;  4I55 B;  4R7C A;  3BCC D;  3TGU H;  5IDJ A;  1Q86 Q;  4DRX B;  1JMB A;  3ZN1 A;  3AK3 A;  3G6B A;  4DYL A;  2X6A A;  2FFD A;  2CPB A;  1AQ5 A;  2GUZ B;  1AVY A;  1WPX A;  2ZIO A;  1ZXG A;  2KXP B;  4UCV A;  2YNY A;  3FXE A;  1NTK H;  3L73 J;  4FLZ A;  1IFJ A;  1JB0 J;  3L70 J;  1RQV A;  1IBK B;  3RYI B;  4LWS B;  1E5W A;  4RO2 A;  2ZXW C;  3D8C A;  3L70 H;  5FNV A;  2XOK G;  1D2D A;  1GZL A;  3RYH A;  1VP7 A;  1DIP A;  4MVS A;  1M1J B;  3JCU Z;  1A32 A;  3CCQ V;  3VMY A;  3CPW O;  2IJK A;  2ODM A;  3KZI H;  3W7X A;  2QE7 G;  2FYZ A;  1ZW0 A;  3L72 H;  5H5N A;  2FY8 A;  1WJZ A;  4DO2 A;  3H1I J;  1XQ8 A;  3OUS A;  3ZX6 A;  3OAA G;  3H1I H;  3MHH C;  4BIO A;  1L0N E;  1ZRT D;  3RK3 C;  2IBZ D;  3BAB A;  5GON A;  1MOF A;  3L74 E;  5GTI E;  1YJ9 P;  1BZK A;  2QG4 A;  4J42 A;  3K79 A;  3CRM A;  3AE3 C;  3VQV A;  1JTH A;  3WUU A;  1K33 A;  3PHL A;  1HGZ A;  1SQV E;  4RKU J;  4MN4 C;  5AW3 B;  2OCC B;  2F1M A;  2OYH C;  2DOS A;  5KLI B;  2AZ0 A;  1I0H A;  3K0G A;  3N2G A;  4J80 A;  3RL0 C;  2RKL A;  3CCE P;  4JI0 O;  2WLH A;  4DUY B;  1QL1 A;  1FZB A;  2IJJ A;  1I94 B;  2ZDI A;  1KZU B;  3MHS C;  3AE8 C;  5AW9 B;  3RWR D;  1Y9B A;  2WLJ A;  4IGG A;  1URQ C;  5CBN A;  5LYJ A;  1KQG B;  4MTO A;  1KQL A;  1FDI A;  2N1T B;  1NU1 G;  3BAS A;  1GN2 A;  1IDS A;  2YID A;  5J2U A;  5APQ A;  3H1K G;  3IC9 A;  3NTN A;  1XTC C;  1V54 B;  2I1J A;  2UXN A;  3FKS G;  4DR6 O;  1QHT A;  1NTZ E;  3STL C;  3OMA B;  2YXL A;  3BRV B;  1QCE A;  2YEV B;  4DW1 A;  4X8A A;  3HUS B;  2WVR A;  3UQ8 A;  2AGA A;  3CLQ A;  1JA8 A;  3BRC A;  1PIX A;  5BZB A;  2GUV A;  1ZME C;  1NJI Q;  2UUB O;  1LR1 A;  1XIL A;  3A0R A;  4U7N A;  3I55 V;  2LKM A;  3AEA C;  4RES B;  3QNE A;  5DM6 V;  1VQP V;  1BSM A;  1RH5 B;  5FL7 G;  2KOG A;  3IF4 A;  4RAI A;  3BY6 A;  1Y76 B;  4FLV A;  1XHZ A;  4RQE A;  2P2U A;  1FAF A;  1KC8 W;  1L0N J;  2KNC B;  4AUW A;  1IXM A;  4JAV A;  1K04 A;  3L74 J;  1Q6U A;  1GD2 E;  3CCM P;  3L74 H;  5GTI H;  5LGT A;  3CX5 H;  2XHB A;  2DQ3 A;  1SQV J;  2OTL V;  2QA4 V;  3GLM A;  1SQV H;  4JTC B;  3UT5 A;  1IXB A;  3LSQ A;  2GTS A;  3IN6 A;  4PJ0 H;  3E1R A;  3RK3 D;  1ZSP A;  3TDK A;  2ITC C;  2DN9 A;  1M8O B;  3G6E V;  2ZCE A;  5IT9 N;  4H0L C;  4J11 A;  4L8J A;  1RF0 C;  4LF5 O;  5LMN O;  1SZX A;  2L35 A;  2LR2 A;  1H0T A;  3H32 A;  2N05 A;  1JJO A;  1RE4 A;  2CTW A;  3A8T A;  3E83 A;  1MAB G;  1PL0 A;  4HNA A;  4U3F E;  3QG5 A;  3PTZ A;  4CBC A;  1OCO B;  1N8R Q;  1KB9 H;  4LFC B;  3H1H G;  3HD7 B;  4H37 A;  4TWK A;  4DV6 O;  2BOC C;  2DYR C;  3VQX A;  2HOD B;  1EZJ A;  3CCR P;  3RN4 A;  2R72 A;  3R4Y A;  5EBW C;  4PA6 A;  3OM3 B;  4ICG A;  4JGS A;  4N23 A;  4CZZ A;  1X59 A;  1NKN A;  1URQ D;  1Z2G A;  1IUR A;  2GA1 A;  2GTA A;  1GM9 A;  4I50 A;  1NTZ J;  4KFM A;  1HR0 O;  1M56 B;  2EIK B;  5L3G A;  1NU1 D;  2IU0 A;  1FAV A;  1G4Y B;  1SQP E;  5EBM C;  5C8Y B;  2M3B A;  3BCC E;  3FYI B;  3OAK A;  2J59 M;  5EC2 C;  4DV7 O;  5GTH Z;  3JAW B;  2QJY B;  1YBK A;  3WUT A;  2VQE O;  4LH7 A;  2QKA A;  3RK2 D;  2OQQ A;  5DED A;  2HG5 C;  4JV5 B;  2KLU A;  2W6J H;  3CCL P;  1N34 B;  2HHH O;  3U11 A;  1Z5V A;  5IYD O;  4P30 A;  2YXQ B;  1XMO B;  1GMJ A;  2E75 B;  3HKD B;  3HR0 A;  1CPY A;  2Y4T A;  4I5S A;  1N32 O;  2FYU G;  2CK3 G;  4P9P A;  2QWQ B;  4EB6 A;  2H7H A;  1Q90 D;  4X62 B;  3GG2 A;  1M9N A;  1I7F A;  4OX9 O;  1KU9 A;  3CX5 F;  4GCZ A;  4O2A B;  3K0D A;  1FC2 C;  3ZRW A;  1E79 G;  2F43 G;  1OHH G;  3AE1 C;  2QSI A;  1ZRT E;  5GW7 A;  2IBZ E;  3LDE A;  4YIO A;  1BL8 A;  4ZI7 A;  2IH1 C;  3UO3 A;  4RQF A;  2Q7C A;  3CX5 I;  3CRA A;  1LP1 A;  3M06 A;  2ZT9 C;  1U7J A;  4U3F J;  3ZMU A;  3SJQ C;  4TV8 A;  1LTJ A;  3JAR A;  4H0L D;  1N73 C;  3J80 N;  1VQ6 P;  4FMT A;  1IBM B;  4N6J A;  5E79 Z;  1J2J B;  3CME P;  2X6B A;  1SES A;  4MTG A;  1KB9 F;  1KIL C;  1N7S C;  3RGB A;  1PP9 D;  1R3I C;  1AVM A;  2K9P A;  4NTY A;  3H1H D;  2Z5I A;  1Y66 A;  1XEQ A;  5DN6 G;  1VQK V;  1XI1 A;  2OIE A;  4YY3 B;  1SQQ E;  3R66 A;  2Q7E A;  3L75 H;  4X64 O;  1SQP J;  1KB9 I;  4LNU B;  5JH7 B;  3BCC J;  1EDL A;  1EC5 A;  3BCC H;  1ZR2 A;  4PDL A;  2ZVO B;  2Q0A A;  2LFR A;  3C1L A;  1M5I A;  2HJF C;  3GMA A;  3P7K A;  5CBO A;  3KG2 A;  5AVW B;  5KHJ A;  2PTM A;  3V2R A;  2E74 B;  4LF8 O;  2Y0D A;  1TUB A;  1FZC B;  2DE0 X;  2PI4 A;  1M1J C;  5BXZ A;  1EZV D;  1RE3 A;  1S9K E;  2YKO A;  1WP8 A;  1A02 F;  3V4Q A;  3ZED A;  3FAV B;  3CWB J;  3H1J H;  4UB6 Z;  2P67 A;  1Y74 B;  2MW2 B;  4QE9 A;  3CWB H;  2AEF A;  3B5N B;  1S72 P;  1D7M A;  4RUE A;  2KK7 A;  2J5U A;  4NXM O;  3QO8 A;  3G67 A;  2E76 B;  1AJP A;  4ZHQ B;  3AK1 A;  2ZNJ A;  4CH5 A;  4O4H A;  1TA8 A;  1NO4 A;  2WIT A;  4GOD A;  4ASV A;  2XND G;  2D2C D;  2B5U A;  2OCC C;  3A0H Z;  1N33 B;  2JEX A;  1RF1 A;  1ORQ C;  3GB7 C;  3ZHS A;  2YI8 A;  3ZRS A;  3K5M A;  1LUV A;  4X1I B;  5B1A B;  1K4C C;  3AG3 B;  3KYQ A;  3E8F A;  4P2Z A;  1S5L E;  2ZT9 D;  4EIJ A;  1FZG A;  2JDI H;  1FYJ A;  5B3S B;  4JI8 B;  3Q4H B;  4CS3 A;  1SQQ J;  1NTM K;  3CXH D;  1SQQ H;  1KYO D;  1HW7 A;  1NR1 A;  3CCS V;  2G3A A;  3LW5 J;  2Q73 A;  2P06 A;  1IFD A;  2MK3 A;  3LW5 H;  1IK9 A;  2JR8 A;  3A3Y B;  3CL3 D;  5AVU B;  1EM1 A;  4O2B B;  2J58 A;  1WA8 B;  2AHZ A;  3ZMT A;  2V7Q J;  2FKW B;  2EIL C;  3JYC A;  4WFB V;  3CE2 A;  3ASO B;  3EHB B;  1NU1 E;  3IAO A;  1JCC A;  3CJH B;  2QEX V;  1GK4 A;  1CW5 A;  5JQG A;  1XL4 A;  3H1K E;  1NZ6 A;  2LXC B;  4KL1 A;  3TNU A;  4Y28 J;  1LTA C;  1GTO A;  2JJL A;  3T4D A;  1G6U A;  1L0L K;  4H44 D;  4JAS A;  1JOY A;  2OTJ P;  5L3B A;  5J2T B;  2GV9 A;  3CCV P;  4QIW F;  4DV3 B;  5BY1 A;  1O9G A;  2C2A A;  3ZIA G;  2EX3 A;  1TU3 F;  5LP6 C;  1QX8 A;  3ZDM A;  3DC6 A;  4GT1 A;  3UM7 A;  3HPL C;  1BGY D;  4UCO A;  5APV A;  5AW6 B;  4YTP C;  2Y9Z A;  1HNZ B;  4F6R B;  2QWO B;  2XU6 A;  4WFG A;  1RPO A;  4GYC B;  1JQ0 A;  1G2C B;  3CC4 V;  1GK6 A;  2JJ2 G;  1Y8A A;  1H2N A;  3E8G A;  2F23 A;  1L4A A;  4G2K A;  2BEZ F;  1T5E A;  3RL0 g;  3UIA A;  2Q68 A;  2R9I A;  2JGD A;  3JAK B;  4N21 A;  4MTF A;  1EFR G;  1S5L H;  4LF4 O;  4GKJ O;  3LID A;  3VQY A;  3TXS A;  5CN0 A;  1X9V A;  1H8H G;  1M90 Q;  1XNQ O;  2KLV A;  1GL2 B;  1V55 B;  1K73 W;  1P84 H;  3ABK B;  3SJC C;  2WWW A;  3K9S A;  2WPV B;  1OCO C;  3HD7 C;  1PV0 A;  2N74 A;  3JD4 A;  4DR3 O;  1VQ7 V;  3OA7 A;  3TYY A;  4KJM A;  4N3Y B;  5B66 E;  1Z5W A;  4JYC A;  1BE3 G;  3U1A A;  1GW4 A;  5JCO C;  1VQ8 P;  3H1H E;  1YSC A;  3L71 G;  1NU1 J;  3AG4 B;  4G28 B;  1H2L A;  2O3J A;  1NU1 H;  3TK1 A;  2EIK C;  3H1K J;  4J41 A;  1OVR A;  1VPC A;  3WU2 E;  3H1K H;  3CD6 V;  4C7R A;  2ZXX A;  4BW5 A;  3L4F A;  1ZN5 A;  2IYP A;  3OW2 U;  2UXD O;  4FZ0 A;  2WSF J;  4IL6 X;  2PF4 E;  4WY4 B;  2XAH A;  2WSF H;  3U0Z A;  4JYB A;  1VIB A;  4U3J A;  2IZ0 A;  3PRJ A;  5BMV A;  3BA9 A;  5IYC O;  2V1D A;  2KSE A;  2BTO A;  4FIP C;  1JFF A;  4Y99 B;  3ZMZ A;  2IYO A;  2FFD B;  2E75 C;  4DR2 B;  1JY2 N;  1OVV A;  1W2B O;  1Q82 W;  1NH2 D;  2GBO A;  1OX3 A;  4ZKP A;  5KJ7 C;  2IJH A;  4CC5 A;  4WBN A;  5FNV B;  5EFW B;  1SS3 A;  3RYH B;  1LT9 A;  3K5N A;  2WMM A;  1MZE A;  5AW7 B;  2FYU E;  4QNH B;  4UFZ A;  4X65 B;  4LF9 O;  1VQL V;  1HGV A;  1O9H A;  2H89 C;  4IFM A;  4JI2 B;  5JJJ B;  1QVG U;  4CPG A;  1GU4 A;  3JAT A;  2GUS A;  1EN4 A;  1VQO P;  4UV8 A;  2YC0 A;  3CCQ P;  3VMA A;  5GON B;  1L2P A;  3BHP A;  1DTO A;  1RSO A;  1GM8 A;  1NS1 A;  2ZYD A;  1JTH B;  1YVW A;  1VQM V;  4K35 A;  2W8Z A;  4I2L C;  3K08 A;  1P84 F;  5TIS H;  1N36 B;  4ASU G;  1SFC A;  3F89 A;  4J7Z A;  1HNW O;  4M3L A;  3W67 A;  5B66 H;  4GKK B;  3CXH E;  3N2G B;  3TJT A;  2PI5 A;  4IL6 Z;  1FS0 E;  3FB7 C;  1P84 I;  4DK1 A;  2YIB A;  2NPS A;  1J1D C;  1VF6 A;  2FKX A;  2UU9 O;  3SPC A;  1BDC A;  3GWO A;  1OW7 A;  3VOU A;  3L71 D;  4MS2 A;  1U97 A;  2Q1K A;  3NFQ A;  5LYJ B;  4FM2 A;  3OGI B;  1KD1 Q;  2ITD C;  1FZE A;  1PNL A;  2VQF O;  4GOF A;  1BSN A;  2OYI C;  5J2U B;  1PGO A;  1M1K Q;  1HNX O;  1FFX A;  4DT0 A;  2E74 C;  1ENV A;  1OVU A;  4TQF A;  5KAF E;  4XDK A;  3P8M C;  1FZC C;  1S4X A;  1KP3 A;  3D3I A;  2ZM6 B;  1DEE G;  1H2S B;  4J9Z B;  2HVK C;  2XUM A;  5KTB A;  3SGI A;  1XNR B;  1AVO A;  2WA3 A;  2FYU J;  5APX A;  2FYU H;  2CK3 H;  4CS2 A;  2B1I A;  2A79 B;  3B5N C;  3P8C D;  1BGY E;  4ASW A;  1P4R A;  3OTO B;  2Z5U A;  2E76 C;  4ZIB A;  2K3R A;  1HJB A;  4OXS A;  1E79 H;  5AVT B;  2HPC A;  2Y4U A;  4DR4 B;  1JNM A;  3QF7 A;  2Z5H A;  2E5L O;  1SKV A;  3IC7 A;  1OIP A;  2ITA A;  3I55 P;  2LQT A;  3HKE A;  3E8B A;  2M8R A;  1VQP P;  3AG3 C;  2IJI A;  5B1A C;  3UT5 B;  4L73 A;  3IJ4 A;  2LW7 A;  1AJQ A;  1YIT V;  2HKO A;  5B3S C;  5KMG A;  4WWI A;  3M9B A;  3A0B H;  1NH4 A;  5DEC A;  2O01 H;  1NI8 A;  1Q86 W;  1CP9 A;  1H0T B;  3H32 B;  1IVS A;  2DYS C;  4H33 A;  1IFM A;  4IYI A;  4DV0 O;  1ZP0 C;  4HNA B;  4PD4 F;  2ZFC A;  2A06 D;  3PLN A;  4IOI H;  2ADP A;  3V4W A;  2FXO A;  5APT A;  2O01 N;  3E1I A;  3GWK C;  3ASO C;  4JAA A;  1OZH A;  4TOI A;  4PD4 I;  4XBF A;  1YIJ V;  5KAI H;  1YJW V;  4A7P A;  2A45 I;  3S9O A;  5KAF H;  4I50 B;  3RW0 A;  2K9J A;  1ZV8 A;  2UUA B;  1NWQ A;  4FM0 A;  1Q6H A;  4B3R B;  5AW1 B;  2HFE C;  2QR4 A;  2AXT H;  4NXN B;  1WAZ A;  4QPK A;  5AVR B;  3ZHT A;  2QWP B;  3BEH A;  2BCC J;  3KCY A;  4DUZ O;  1R73 A;  2BCC H;  1SRY A;  5H2F E;  3Q5R A;  4FZ1 A;  1YTF B;  1BDD A;  3OFN G;  5LMU B;  1YYC A;  3MGN A;  2WLI A;  4I1L A;  2OT5 A;  3ZHR A;  1DD4 A;  4WVZ A;  2Y9Y A;  2NLJ C;  3WB1 A;  1JM0 A;  1YHQ P;  3A2F A;  4F4L A;  3MUD A;  2NZ2 A;  4NVP A;  4HYT B;  4EB6 B;  2ZYG A;  3P30 A;  2WLL A;  2E43 A;  4LGD E;  1K4D C;  5KLV H;  1XDC A;  5LXT A;  3UKM A;  4WCE V;  1NTM G;  1QLE B;  4IT5 A;  2WPR A;  1G1J A;  2POH A;  4ZI7 B;  2UUC B;  2JIZ G;  2BAS A;  2RMK B;  1SQB D;  1LP1 B;  5B5E Z;  3T1H O;  5GTH E;  1W0K G;  3RBX A;  4K8Z A;  1NTK K;  1PL5 A;  4LLH A;  3L73 H;  4TV8 B;  3JAR B;  1LTJ B;  2IU3 A;  3HE5 A;  2IFM A;  2E42 A;  1YQ3 C;  3ZJZ A;  4D6T G;  2KQX A;  3CCU P;  2YXR B;  3AG4 C;  2WLM A;  4HZ3 A;  1BE3 E;  3ASN B;  4TT3 G;  4I7Z B;  1FOS F;  2YIC A;  3K59 A;  3M9Q A;  5LA6 A;  3SPG A;  2YI9 A;  4WFA V;  5IY5 C;  3L71 E;  3D71 A;  4UB8 H;  4MVR A;  4CH6 A;  2K37 A;  5ITZ A;  1NJI W;  2Q9I A;  4TV9 A;  2Q6Q A;  4CH4 A;  2OYH A;  5CMU A;  1QLN A;  1TAE A;  1L0L G;  3RVZ A;  2DWE C;  1OFC X;  4X66 O;  5AVS B;  3SR2 C;  4AQR D;  2JO1 A;  5CCG C;  1JY3 P;  1OCC B;  4B3T O;  3Q3D A;  4BIZ A;  1KKC A;  2FFD C;  5H2F H;  1N2D C;  4UCS A;  2G8Y A;  2L6L A;  3SDL A;  2WSE J;  3ZRX A;  4JI3 O;  2WSE H;  5BR8 O;  4LC1 A;  1MSD A;  3OUF A;  1URQ A;  4I0X A;  2QKS A;  1TUB B;  1VQN V;  1G1X B;  4K8X A;  5E79 E;  3CRQ A;  1QQC A;  3V5B A;  2EZP A;  4MVO A;  2ZNI A;  3P8C E;  2QM7 A;  4O4L A;  3KPE A;  3A5T A;  1QVF U;  4G27 B;  2KB1 A;  4OGQ D;  1H8A A;  2RQ6 A;  1T2K C;  3SWF A;  1OCZ B;  1N8R W;  5L3E A;  4K0K B;  1I5X A;  2WSS G;  2B87 A;  1GU5 A;  2A3Q A;  4B3S O;  2RCV A;  4O4H B;  2R32 A;  4DV5 O;  4UUJ C;  3BRT B;  1NTM D;  1MA1 A;  3APQ A;  1N7L A;  2Y0I A;  3HTK A;  5DJT B;  1RF1 B;  2WA4 A;  1IBL O;  1X8Y A;  1UIX A;  4BWN A;  1BE3 J;  1AB3 A;  1KTM A;  1BE3 H;  5APW A;  1JOC A;  4JI0 B;  1KQS U;  2KSD A;  3RFR A;  4DR7 O;  1K92 A;  3L71 J;  1CEZ A;  1AR4 A;  5CMZ A;  1Q7Y W;  1GDT A;  2YO2 A;  4FM1 A;  1AI5 A;  1K3E A;  1FZA A;  1SA0 A;  1T6A A;  2CDY A;  2R3C A;  1L0N H;  3C9I A;  3K9A A;  1SF9 A;  4DCK A;  4DR5 O;  4UB6 E;  1DK1 A;  1RF0 A;  3OMI B;  1WB7 A;  2D3O W;  3C90 A;  2P7T C;  4O4I A;  1L0L D;  3ABM C;  3CHX A;  3BVO A;  3ITK A;  5CB4 A;  3MTU E;  2ETN A;  5CCG D;  1EXJ A;  5JQG B;  4DR6 B;  1ZL8 A;  3OGC C;  3KZI Z;  2M5A A;  3A0H E;  5AVV B;  5CA3 A;  3TNU B;  2FML A;  3W68 A;  1JMM A;  1PD3 A;  3FB8 C;  5LHH A;  5E79 H;  2K9Y A;  4I9W A;  2FXM A;  3HKC A;  1PP9 G;  3RL0 D;  2QEX P;  2UUB B;  1BHA A;  4L87 A;  3B09 A;  4DJG A;  3AG2 B;  3SPH A;  2ZIM A;  3PH0 A;  1THZ A;  3WMM 0;  4DV1 O;  3CS5 A;  3L9D A;  1LTT C;  4EI2 A;  1G8M A;  1OMI A;  2CTP A;  2QM4 A;  5LGU A; 
#chains in the Genus database with same CATH homology
 2G3A A;  2JO1 A;  3H25 A;  3LW5 J;  1Q90 D;  1FDI A;  3Q3D A;  2IDB A;  2WSC J;  1IK7 A;  4YXD C;  3D6Y A;  3AEF C;  2G8Y A;  3FGA D;  2P10 A;  2WSE J;  3AE1 C;  2V7Q J;  4H13 C;  3RK3 E;  2QSI A;  1ZRT E;  3Q5S A;  1ZP0 C;  5KLI C;  2BEQ D;  2QJY C;  2H88 C;  1ZOY C;  3EWK A;  4H0L B;  3IAO A;  2H89 C;  2ZT9 C;  4I7Z C;  1RQU A;  4OGQ B;  3B71 A;  1VF5 B;  4H0L D;  5KKZ C;  4H44 B;  2FXP A;  1PIX A;  1ZME C;  4Y28 J;  4OGQ D;  4OGQ C;  1VF5 D;  3AEA C;  1VF5 C;  3S9O A;  4H44 D;  3AE7 C;  3Q5P A;  1YQ4 C;  1KOR A;  3AE5 C;  4H44 C;  3G9R A;  2JP3 A;  3D70 A;  3C8V A;  1NGM B;  1K05 A;  1K04 A;  3AE2 C;  4GDO A;  4PV1 B;  1NYH A;  1TU3 F;  3T97 B;  4PV1 D;  4YTP C;  3AED C;  3GLM A;  4Z1M H;  3IN6 A;  3SFE C;  2QJP C;  3Q5R A;  2FYN C;  1HJ0 A;  1UIX A;  3D6Z A;  1DD4 A;  1S5L X;  1OW7 A;  1KTM A;  4H0L C;  3GMA A;  2WQY C;  1JB0 J;  2BEZ F;  1FDO A;  1RQV A;  2QIW A;  1KMI Z;  3ABV C;  3RL0 g;  1HF9 A;  2NZ2 A;  2FBW C;  3AEB C;  1DIP A;  2YMK A;  2E74 B;  1U57 A;  1S1C X;  2E74 D;  4U7J A;  2E74 C;  1OW6 A;  4TT3 H;  1AJY A;  2WPV B;  3R4Y A;  4PV1 C;  3SFD C;  3AE9 C;  3AEE C;  1KIL E;  1EXI A;  3AE6 C;  5M1B A;  1KQF B;  1WMK A;  1PL5 A;  3AE3 C;  3O6Q A;  1EXJ A;  2J5U A;  1PV3 A;  1OW8 A;  4R4M A;  4RKU J;  2E76 B;  2D2C B;  2O01 J;  4H13 B;  2MKV A;  1YQ3 C;  5L8R J;  3Q2Y A;  2E76 D;  2K9Y A;  2D2C D;  2E76 C;  4H13 D;  1VL2 A;  2D2C C;  2YIU C;  2OQQ A;  3GF3 A;  1R8E A;  2ZT9 B;  3GF7 A;  4I7Z B;  1DD3 A;  2WSF J;  4IL6 X;  3D71 A;  4KT0 J;  2ZT9 D;  4R4L A;  3AEG C;  1MKM A;  4XFJ A;  1GMJ A;  2E75 B;  3AE8 C;  3Q1M A;  3AE4 C;  3AEC C;  1OMI A;  1Y9B A;  2E75 D;  1KQG B;  2QJK C;  2E75 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...