4OGQB

Internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
ATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome b6
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4ogqB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ogqB01
5KKZC 1JB0J 2QJYC 4H0LB 2WSFJ 2D2CB 4RKUJ 2QJKC 2O01J 4H44B 2WSCJ 2YIUC 2E76B 1S5LX 4IL6X 4Y28J 3C8VA 5KLIC 2E74B 4H13B 4I7ZB 2E75B 2ZT9B 2QJPC 1VF5B 2K9YA 5L8RJ 1ZRTE 2QIWA 2FYNC 4KT0J 2QSIA 1Q90D 2WPVB 4PV1B 2WSEJ 3LW5J 4OGQB
chains in the Genus database with same CATH superfamily
3W68A 2H8PC 5KLIB 4PA7A 5AW9B 2Q6QA 4W7ZA 1GN2A 4O4IB 3CCSP 3E1RA 2Q67A 1XUQA 5CB4B 1ZXGA 3ABVC 3P8CE 4JAAA 4UCVA 3ZN1A 1L4AB 2VRSA 3CCUP 1OXZA 1ZL8A 4LH7A 1ZR4A 4DR2B 5CCGC 1LTJB 1HBWA 4NTWA 1MA1A 2WPVB 3RYHB 2CH7B 2HKOA 2JK5C 4JASA 5L3DA 5BR8O 1MFZA 2FYUJ 2IJJA 4IHJB 3AECC 1NTKG 4CS3A 4EDFA 3WG7B 2PI4A 1U7JA 2KYVA 2ZXEB 1XEQA 1M1KQ 2P7JA 5KMGB 3KPEA 2HFED 3NR7A 2QJYB 3AG1B 5KJ7A 2EIMB 2R70A 3ZRXA 5IT9N 2W83C 4PV1D 1XHZA 4AQYB 1VQ5V 1MSDA 4ZIBA 2N04A 4B7KA 3G67A 2BTQB 4IFFA 2AXTE 4O4LA 4JI6O 2R9RB 4IIJB 2B87A 2KG7A 2FYUG 3TF5A 3QG5A 1H89A 2QKAA 1KC8Q 2RMZA 4Z1MG 5KLIC 4JI0O 1BGYD 1N32B 1NJIQ 1FJPA 1X22A 3SDLA 3ZHUA 4DR7B 2NPSA 1K8AQ 3ICXA 1ROPA 1R1BA 1GN4A 2XNDH 3CD6P 1ZX3A 2WSFH 3GW6A 3JASA 3RK3E 5JWPA 3WB2A 1EC5A 2UXCB 4IIJA 5GONB 1NJIW 4Z2WA 4LF7O 4X65O 4L8JA 5CA0A 1FFTB 4O2AA 5KJ7C 3FD9A 3M0AA 3QWOC 4ZHQA 1FDIA 1HNXB 4UV8A 4YY3B 3DXRA 1SQVJ 1SQPH 2JEEA 3CXHH 3UIAA 1XNRO 1KORA 3L4FA 3LNNA 1PP9H 3H1JH 4LWSB 5IE9A 5KA5A 1Z2GA 3OFNG 1W0JG 3OA7A 2A9HA 1KFNA 4KHXA 3N4XA 2KQXA 4QGPA 1LTAC 2ZYGA 2Q9IA 5KLVK 2V7QJ 1M56D 3L74G 3H1ID 3ZHRA 3IAYA 1YZBA 1NAYA 2O01N 1SQBH 4JI1B 4YHHB 4A5UB 4NPEA 3R66A 1NTMD 3O8ZA 5CCGA 3RK2D 2JRIA 2V7QG 2BCCD 2AXTH 3WUTA 3G6BA 5CN0A 1KYOD 5AVQB 5BXZA 3RK2B 3LNMB 1EM1A 1Q6HA 3O9OA 4MTFA 1KILA 5B1BC 1US6A 1QVFO 1WPXA 2UXBO 5KHGA 1M8OB 1HJBA 5M1BA 4DO2A 4UB6H 2QJKB 2PYJA 4N23A 4B7EA 1RF0A 3OGCC 1ZP0C 1YXBA 4W4KA 4O4IA 2A06E 2UUAB 1SC5B 2A0LA 1Q7YW 1GMJA 2IPPA 1FD9A 1S77D 1OVVA 4I1LA 4B3MO 3HE4B 2ITCC 4N78D 4Y28J 4X1YA 1A32A 1NTZD 1ZOYC 1GK6A 1GK4A 3H1LE 2W6BA 2OCCB 4JI7O 1VIBA 5KHIA 4HH2A 2Y4TA 3H1JE 5KLVG 2OYHA 2N1TD 4GKKB 1J95A 2H89C 4GKKO 5C39A 3CYOA 2K9PA 2DW3A 4MTXA 5AVVB 3RK3B 1IK7A 2P4VA 1GN6A 3OT7A 3G71P 3OW2U 1BE3J 4XE5B 3JD1A 4Q20A 4YJ3B 2YXQB 4EI2A 1T8ZA 1V54C 1H2LA 5EIBC 1L0LJ 1HW7A 2MJZA 1VQ6V 1TVKB 3T1HB 2Y48A 1GKFA 5AVYB 3HKBA 2I1JA 2RCVA 4LBEC 2POHA 3VOPA 1KU9A 4HB1A 2V4DA 3CRQA 4QE9A 3CXCU 3E8FA 3CCEP 1KN7A 4H33A 1J5EB 1FAVA 1GM7A 3CX5H 3QO5A 4CH6A 5LGTA 1GZLA 2FB5A 1J2JB 2Q5ZA 4J10A 4WCEV 1N32O 3L37A 3K5MA 3K58A 2N9BA 5KTBA 3L70G 4X66B 4I55A 2FYUK 1JJOA 2QWOB 1BSNA 1LUWA 2YXLA 2Q69A 4NPFX 1EDJA 2Q7CA 3L75G 4A7PA 5LMNO 1LTBC 1N33B 1T3UA 1NU1D 2BEZF 2K1AA 3HUSA 2XOKG 5A2QN 4HJGH 3HTKA 1OX3A 4GYCB 1R8EA 4B3SB 2VWKA 1G1XB 3A0HE 4X20B 3L71G 5KHKA 1IFJA 5AW1B 3H1JD 4QNHB 1VARA 3JD2A 4LH6A 5LL6Y 1W5CE 2QA4V 1GL2B 3KKYA 5AVXB 2L5GB 4Z1VA 4KT0J 2J59M 2NZ2A 3HKEA 1JM0A 4E4EA 3L74D 1SQBG 3CWBJ 1N7SD 1SQPE 2W6IG 5IYCO 4WF9V 4DR6B 2AEMA 3CWBD 3VQXA 1K92A 1OCCC 3L74J 1NTZK 5EYPA 3D71A 5A9GA 2DQ0A 4JI8O 1YVWA 3T2MA 2OT5A 1HNWO 2BEQD 2IFNA 2OYHC 2CPBA 3SPJA 4JZ2A 2PGDA 3CB2A 2J58A 4F6RA 1LGHB 3JATA 4K0KO 3HRNA 4DV3O 3IFXA 3AG4C 1CP9A 4GX5A 1KYOH 1AP6A 2IZ1A 2LP7A 5GTHZ 1PP9G 2KI7B 1SQQE 2M0BA 5B1AC 5GTHE 4HZ3A 1JMMA 3KYQA 3RGBA 3G6EV 3ETEA 4NXNO 1HNZO 1PNLA 1L0NK 2QG4A 2RH0A 4BIUA 2MW2B 3AG2B 3ASOB 2FXPA 1LNQA 3BHPA 1YJNP 2A79B 1Q82W 2E5LB 3AE3C 4F6RB 4DR1B 4JYYA 1M57D 4RESB 3A0HH 4GUNA 5IY5B 1CI6A 2KSEA 4LF6O 3SJAC 2R72A 3FWNA 1OW8A 1BCCG 4FM1A 1JX9A 1PV3A 5TJHA 1AJQA 2N74A 3N27A 1EDLA 2P6JA 2WSCH 1XDCA 2PY5A 2ZNJA 1SZTA 1LTGC 1AI7A 2NNUA 3AE5C 3HE5A 3HKEB 4YPCA 3ZRVA 3H1HE 3VQYA 1S0VA 2K88A 5AVSB 1AQ5A 2M6YA 1P49A 1JB0J 2WA3A 5D5PA 3ZHTA 1Z5WA 2K37A 3B5NC 4I4TA 1Q81Q 1PPJE 3GVMA 1JA8A 1MG1A 4Y99B 3C8VA 2Y0IA 3K3WA 1VDFA 1XTGB 3F5TA 2VRZA 3G4SV 1D2DA 1P7BA 2CTWA 2ZT9B 5B5EE 2WLIA 3ETGA 3F7VC 1NTZE 5KJ7D 1K04A 1OIPA 4UCUA 1E1RG 1ZSPA 4GDOA 4JTDB 2ZT9D 2P5OA 2WSEJ 2X0LA 2WT7B 1W59A 4WFAV 1BE3G 1B04A 1H2NA 4EOTA 1P84H 2KZIA 4P9OA 4JI5O 2W90A 5CA1B 1YI2V 4NXNB 4OH8B 2WLHA 4UCRA 1S76D 1WB8A 1TAEA 3AG1C 3ZHSA 1FS0E 4OGQC 4W7YA 4PDVA 2HVKC 1JCHA 5FPOA 1VQMV 3ZMUA 1NTZJ 2QJPC 2CDYA 3L70D 2EJ7A 2F23A 3K5OA 4FVMA 5D5QA 4BIZA 2Q7HA 1PD3A 4NVPA 3O6QB 4G28B 3P32A 1TUEB 2LKMA 3BRVB 4XA4A 3TK1A 1DF4A 1XQ8A 1DX7A 4FLUA 3X2QB 3OMNB 2AHYA 4RO2A 1ZLLA 2ARHA 2Q3EA 1E79H 1NU1G 2IH1C 4ZHQB 3HB3B 4NR1A 2XNDG 4LLHA 5AW3B 2QR4A 4GZRB 1IZ3A 5H6QA 4IOIH 5GW7A 2R9AA 1J1DC 1Y9BA 5DJTB 2B9ZA 4B08A 3IJ4A 1IBMO 1Y67A 2YMKA 4LGDE 1OW7A 2QDOA 2X6CA 1FXKC 2F1MA 1GH6A 4DCKA 3P8CD 3AG2C 3ASOC 5KX5B 1KQSU 4PELA 1G1JA 4PDLA 4X88A 2CAZC 1SQVH 1JTHA 1K9MW 3F5WC 5BMVA 5TISH 1PM9A 3ETQA 3NTNA 3AG3C 1RF1C 5CCGD 3H25A 1USEA 3NXSA 3AE4C 3H1KG 1KBHA 4EB6B 1NTKE 4OWFA 4DV1O 1YQ3C 3CL3D 1GTWA 3CCLP 1K34A 2UXDO 4DV2O 1Q86Q 2B88A 1Z5VA 4MW3A 1VQPV 4B3TO 1BGYE 2ZCEA 3VP9A 2ZAEB 1AILA 3M06A 3P8MC 2H8PD 4YIOA 1CW5A 4ASUG 3WG7C 4TLFA 1OFCX 3B5NA 4EYYQ 4L73A 5EIBD 1BQ0A 3V6IA 1K97A 2GDSA 1SQQK 4FFBA 2UXBB 1SQQH 4MT8A 2BCCE 1HVVA 3OTOO 3GHGC 1L0NE 3I55P 2FYUE 3CWBE 1W2BU 3SWFA 1SQFA 1I94O 3KXDA 4DR3B 1NHLA 4FIPC 3ZBHA 2HJFC 1PL4A 2N1TC 5GTHH 3V4WA 1SKVA 2JJLA 2O3JA 1LTJA 3N7NA 3PLNA 2Y4UA 1OZ0A 3CCVV 4JI2O 1LP1B 1LT1A 2CPSA 3JD4A 2UU9O 2XV5A 4AYCA 1MZFA 4X66O 4KHPB 2X6AA 2E76C 1PIXA 1SFCA 3TGUD 3I5CA 1FKAO 1QR9A 1Q6UA 1Y76B 5KLVH 3EFGA 5CA3A 1QL2A 1FXKB 1SQPK 2XTAA 1L1FA 5AVZB 1X9VA 1L8DA 3SPCA 4LWSA 2R44A 3H32B 2ZJSE 2GTAA 5C8YA 1VPCA 4U3FJ 5K1XA 1JNMA 2WTYA 1NTKH 2E75B 2GHYA 1HGVA 1BZKA 2Q73A 1DEBA 2KKWA 1HUCA 1YHQP 2RDCA 2Y0CA 3GLMA 3H1HH 4IGGA 1YITP 4X1IA 3HKCB 5APYA 3KG2A 4FPPA 2FFDC 2FYUD 1FAFA 5KUMA 1WT6A 1RSOB 3W7TA 4LF9B 1GW4A 4RUFA 1XI1A 4KJMA 5CHXA 1EZVH 1LT9A 2JP3A 1NGMB 2CGNA 4N6JA 2HG5C 5LP6A 4BIOA 1X4TA 2UXXA 4MSWC 5KHHA 2C9NY 1FDMA 3OE7G 3RYIB 1H2KA 3OR7C 3MDSA 1KB9D 1VF6A 1GO3F 3CC7P 3ZMSA 2KNCB 5L3BA 3L72D 1CSBA 1GAXA 1Q90D 3FFQA 5KA6A 5IYZB 2CTPA 2KB1A 2N9YB 4KHPO 1T5EA 2OYOA 3CWBH 4FLWA 3CXHE 4JF7A 4X9QA 1H8HG 5LMNB 2D2CB 1H0TB 1VQOV 1K5QA 1AP5A 2BTQA 3JARA 3MUDC 1KILC 3SR2C 4OGQD 1MV8A 2M8RA 1NKDA 3SPGA 5LYJA 3H1LG 1Z56A 2OTJP 4WY4D 3G4SP 4ZI7B 5DM6V 2XAFA 3AEBC 1IURA 4UUJC 4IYIA 1KYOF 5B3SC 5B1OA 4PD4I 5E1AC 2Y0PA 1FE6A 2IBZH 2K1EA 1ZTEA 5DEDA 1VF6C 1QVFU 2HJDA 2Q9LA 1LTJC 3PN1A 2JJ2G 3MAQA 2KZJA 4BRYA 1M9NA 2DQ3A 1NVPB 3AE2C 1L4AA 4DV2B 3H1KD 5FNVA 4AHCA 4DV6O 1XMQB 1BSHA 1KB9E 5CB4A 1YTFD 2P2UA 1WJZA 1IBKO 2AEJA 4TOIA 3SYAA 4CC6A 2BCCJ 2GM4A 3TYYA 2VQFB 2QJ1A 3L73H 4DRXB 1SERA 1W2EA 3D3IA 4AUWA 3FWLA 2NR5A 3L70J 1JVMA 2QVAA 2QJPB 1HWYA 4YY3O 1LJ2A 4L76A 4ZMDA 1PGQA 2ZR2A 4BXLA 3B09A 2A45G 1RPRA 3JAWA 2NRGA 3DTUB 2VQEO 2XT9A 3OEHG 4CZZA 1K4CC 1B3QA 3K57A 1SQVD 1MOFA 3EQ2A 4CH3A 1IK9A 2JVDA 3B4SA 4IL6Z 4GX2A 3ABTA 3CC4V 3CRRA 3JSNA 1S9KD 2JGUA 4UVBA 1KFMA 1BCCH 3NMDA 1YIJP 5JJEB 3B8NA 3L72H 4EFEA 1FZCC 1CPYA 3ZRSA 2FBWC 1GU4A 5B3SB 3ITKA 5LHIA 4W80A 1GL2A 1SQQJ 1VQMP 2EINC 3EVKA 2C9LY 1QLEC 3V2PA 1E1QG 3JAKA 3U59A 2YNYA 1V9PA 2AXTZ 2F95B 5J2TA 3E35A 1S5LH 2QWRB 4LR3A 1M1KW 2N1TA 2D2CC 3B8EB 2NLJC 3M91A 4JBZA 1SQBE 1JFFA 5CCHD 1BT8A 3BAAA 1IDSA 4U3JA 3B5ND 1EQ7A 2AGAA 3ABMB 5KAIH 2JS5A 3ASNB 4DZOA 3ZMTA 4B3SO 2KB7P 1DF5A 1ZLZA 2L35A 2FKXA 3J7AU 1SFCC 4L87A 2Q7GA 1HWTC 4DW0A 4RQFA 4DUYB 3TNUA 1Y66A 2P22C 3ZMVA 1I5XA 4JI3B 1EZVE 3TGUJ 1Q8IA 2P10A 1MZEA 1JFFB 3CCVP 1A02F 2BTOA 1QNMA 2N1TB 1SRYA 1JO5A 2LGQA 5E79E 1SS1A 3LW5J 1FYJA 1R6TA 3OAAG 3G71V 1AA0A 1ZW0A 1AROP 3KCXA 1VP7A 2ZQMA 1H38A 3K9AA 1K05A 3SYQA 4EEQA 3EWKA 3RYFB 4C7NA 3BCCD 4D6TD 1UJWB 5K5GB 4B3RO 3ETDA 3IF4A 2PRRA 1YF2A 2YXRB 5EC1C 1VL2A 3P7KA 3W67A 3H1LD 1AR4A 3JALA 4BW5A 1P4RA 3R65A 4WFFA 1EDIA 5CMUA 1ZWIC 1QLED 3G9RA 1MNGA 3CCEV 4ABMA 2EZPA 2Z4EA 1VQKV 2W6JG 4UB6Z 3H1HG 3DC6A 1NKZB 4JYBA 1LTSC 3GHGA 1QLEB 1SQVG 5B5EZ 3M9HA 1VEWA 4RQEA 3TSIA 3CXHI 1M90W 2JIZG 1WRGA 1KD1W 3CE2A 4LFAO 2QE7H 3OD4A 4L74A 2WLLB 1FZGA 2SPZA 5AW0B 1ENVA 1Y8AA 1NQTA 4UCOA 4FLXA 1NTZG 4X1YB 4RAIA 3TXSA 3CCMV 3A2AA 1LTIC 4GOEA 1M1JB 2KS1A 1BDCA 4LF8O 3RYCA 2JKVA 4C7UA 5AW8B 4J9YB 4H44C 1WB7A 1Y76A 4I2LC 1FOSF 2YUAA 4DV1B 3ABKB 1SQXH 2BSKA 3ABLB 5FNVB 4LF6B 1RHZB 4X64O 3SYPA 5IJ9B 4OX9B 3OAKA 3AEDC 2IJHA 2IM9A 3CI9A 1QBZA 3A2FA 2GUZB 3C90A 1D5NA 3OTFA 3TETA 1LT9C 1D7MA 3LUTB 2FFDA 1NOHA 1URQD 4NXMB 1IXBA 3QH9A 3BCCE 4D6TE 2YEVB 3OGIB 2QRXA 2DJVA 3KDPB 5CJ0A 2CTQA 5AW4B 4RJTA 1XILA 3WB0A 3RVZA 1N33O 3EHBB 2UWJE 1HJ0A 2NN4A 1AFOA 2NPSC 2M3BA 3RBXA 5LBQA 3KZIH 2ODMA 5JCOC 4OXSA 2JO1A 1VQ9V 3K08A 1RF1B 2ZE8A 5KLVJ 1SVFA 2O57A 2DYRB 2F66C 3U10A 1V54B 3GF7A 3G6EP 2LO1A 4PV1B 3HD7D 1SQBK 3L73D 5CA0B 3UO2A 3OR6C 1BHBA 1DD3A 1NVPD 1PV0A 3SWYA 3I56P 1X8YA 4WFBV 2X7RB 2FYNB 2UUBO 1H2MA 1M1JC 2WVRA 3CCRP 1NTMH 5LXTB 4I55B 4B3TB 2DWEC 3AEIA 2GV9A 4H44B 4JI3O 1YJ9V 3D6YA 2B1GA 2HLDG 4WY4A 4F6EA 4GKGA 1RM1B 2L91A 5FPRA 1VF5B 2HHHB 1JCDA 3RK3C 2M5AB 1HR0B 3BASA 2IBZD 2CE4A 4DV0O 1SQXK 2WQYC 3ZHVA 3CHXA 5HFLA 3CCRV 3MIWA 1YIJV 1L4AC 2QTSA 2YIDA 4QJFB 3FB5C 2H7HA 1HNZB 3OM3B 4FM2A 3CWBG 2K3RA 1GMGA 5TISE 3TGUE 3RL0g 2E43A 1JUNA 3PTZA 2B5UA 1MABG 3T97B 2EILC 3A0BH 4M3LA 1N36B 1GL2D 1YCIA 2HR3A 4GKJB 2NPSD 1DLBA 3N2KB 1PL5A 1OZHA 2ZE7A 4FK5C 2YKOA 4JV5O 3CRCA 1Y74B 1BGYH 4NPDA 2Y69C 4LF4O 1AJPA 1KECA 2E75C 2OYIA 1QCEA 2ZYAA 2R5DA 1VMGA 2DYRC 2E5LO 2H3OA 1KB9I 1RPOA 2HFEC 2W0FC 2H88C 3B77A 2YI9A 1IVSA 3D6ZA 3J81N 1Q86W 1W0KG 4MTOA 1ZL8B 2BCCH 2IJIA 3H1IG 3LDCA 2Q8VA 3K04A 3L73E 1ZR2A 1N0JA 4ZKUA 4NXMO 1SQBD 3V5BA 1UIIA 3B5NB 3CC2V 4NYKA 2RKLA 1N73B 4GIFA 1VQ5P 2QWNB 1TGOA 1WNSA 2KOGA 1BGYJ 2Y0EA 3SGIA 1BCCD 1NBMG 4MVSA 3BPZA 4CH4A 3HE5B 3CCSV 1NTKD 4FZ1A 2Z5UA 1QX8A 1V55C 3P3NA 1GL2C 1HGZA 1YI2P 1PP9D 2IX7C 4PDMA 1SQXE 1K7DA 4DV7O 1SQPD 3RT3C 1H8EG 2YKPA 1GM9A 2ZM6B 5LMUO 1DIPA 3FB6C 3M99B 3DSQA 1P84I 1K73W 2PP6A 2OIGA 1KQLA 5AW2B 5BZBA 2XUMA 4MTGA 4C7RA 5LP6C 4WFGA 3LDDA 3RK3D 4DK0A 2KK7A 2KLUA 1ZAUA 3D70A 3JCUZ 1KQSO 1U96A 2ADQB 2Y69B 1ZUQA 1SQXJ 2WPDG 3HUSC 1JQ0A 1BCCJ 1IXMA 3HD7B 4UB6E 3R2PA 1S5LZ 1TUBB 1NI8A 1MSWD 1SQQD 4JI6B 4HNAA 2QM7A 2JWAA 3C3SA 1R6NA 2WITA 1SZXA 1R3IC 2G3AA 4PHZA 1XL6A 2Z0AA 5IDJA 2HPCA 2AHZA 1HR0O 1BHAA 2VQFO 5H9CA 1ZV8A 4K8ZA 4N3YB 3SJQC 4D7TA 1YYCA 4UB8H 2RN0A 1JCCA 1X79B 4AI8A 4MVZA 4E2LA 5JH7A 5B66H 2FY8A 1J5EO 2EIJB 2QTOA 2P7TC 2AXCA 2XAGA 3H1HJ 3H1KH 3E8HA 2C0WA 2B87B 1DEEG 4WBNB 3LIEA 4ASVA 1T2KC 2IBZG 2Z3YA 3EFFK 2Q7EA 3SPIA 4X65B 4J7JA 1ZMEC 2QGNA 2UXNA 1KV4A 4AQRD 2HLOA 4WFEA 5LOVA 1LWUC 2LFSA 1VQ4V 3D36A 1GD2E 5GTIZ 3MP7B 1S72V 1G2CA 2LGWA 5APWA 1IC2A 1WN7A 4I4TB 1RQVA 1TU3F 1IBLB 2QEXV 1FFXB 5AVRB 2EBOA 2F43G 2FL4A 4IL6E 1GN3A 2CUGA 4ZNCA 3Q2YA 1VQ8P 3MHHC 2B9BA 2ZXWC 5LP6B 1OVUA 4K3AA 3LW5H 1SETA 1EXJA 2P4KA 3L71D 5BU8B 3BA9A 1TUBA 2A3QA 3E8BA 3L71J 4KFMA 3ZMZA 3RVYA 4H13C 4BWNA 3HKCA 2Q4PA 4ZKPA 1KTMA 2DE0X 3KZIZ 1JMKC 4TSFG 2JEXA 1VQNV 2ZD9A 4DV3B 4DV4B 5F2VO 1FZFA 2WSCJ 1ZN5A 2BSKB 1AVMA 3N2GB 3MHVA 3JSVC 4JI8B 4R8CA 2YSUB 3QTCA 3VMXA 3CJHB 3W7WA 1VF5D 3VBBA 4FLZA 1IBKB 4OVNF 1VQPP 1FZCB 1WAZA 1KQGB 2XKMA 3CJHA 1Q2NA 3IFMA 4UB8E 5AG2A 1P7GA 1N7SA 3S4RA 5EFWB 1J1DB 1KYOE 2QM4A 1N36O 3NFQA 3RL0B 5KLVD 3B40A 4H0LD 2UUBB 5IWAB 3H1HD 2YO2A 5EZYA 3C1LA 1AI5A 3GMAA 3II6A 1P84F 1S5LX 3A7OA 1VQ9P 3BEHA 1NH4A 3L74E 4CS4A 3LSSA 4TT3G 4XBFA 1L0NJ 2C0XA 3CX5I 4TV8B 1N73A 2A45H 2YIBA 3E2EA 1SQVK 3V2RA 4JI4O 1A02J 3CC7V 4BR6A 3AEAC 1Y4MA 3AG4B 3F7YC 3FB8C 5FL7G 3WFVA 5CJ4A 4U7OA 3M8AA 3CCJV 4FMTA 4JI2B 4GX0A 1N7LA 5J9PC 3L36A 3TXQA 3VMZA 1U57A 1DGSA 4WY4C 4LF7B 1NO4A 3U1AA 5KAIE 4BRYB 1S5LE 3JD0A 4DR3O 5B1NA 4EFBA 1Q3EA 1BMFG 3OMIB 1KILD 1RE3C 3AE1C 4H13B 5AW5B 3GG2A 4U3FD 1AI6A 3HR0A 2OTJV 2DYSC 3V2QA 3S3XA 2WWWA 4LNUB 1J1EC 4U3FE 3T1CA 5KAFZ 2E5TA 3B8MA 5CCHC 1MMMA 1YEWA 5B66Z 1H2SB 4LF4B 3ZN0A 1MUUA 4QPKA 3AEEC 4KP4A 1IBLO 1L0LE 3L71H 5JH7B 2Z5IA 3Q4HA 4J7ZA 3OEEG 2JWDA 1WA8A 3H1JG 1K73Q 1XNQO 4JPZB 4DUYO 1H0TA 1K5SA 1XOUA 2N05A 1F51A 4DR2O 5E79Z 1UPGA 3AE7C 2M5AA 2AZ0A 4DXWA 1XHXA 5IYZA 2JDIH 2JJ1G 1QLNA 5J2TB 1JY2N 3H1LJ 3WU2H 5BVZA 1IX9A 5GONA 2PZSA 2FMLA 2R5BA 1R6KA 2YXYA 2EINB 4KL1A 5APTA 4PD4F 1YJNV 1FC2C 3A0RA 4NTYA 4ZKIA 2B1IA 4U7NA 3TCUA 1KD1Q 1FOSE 3A8TA 1IO4A 4BW9A 2AZ2A 1VQOP 3APQA 2YS8A 1RF0C 1T6AA 1WA8B 2Q6AA 1EN6A 1SESA 2PUSA 5KLVE 4BWAA 4O4JB 2Y0DA 5APVA 3BA8A 4XFJA 3ASNC 4DUZO 4PJ0Z 1RH5B 4X1IB 5EC2C 2KSJA 3FX0A 4DR4B 1FJKA 1NU1K 2AW9A 4CH5A 3L70E 3MTUE 1YTFB 4WFHA 2R32A 4FZ0A 4JV5B 5J2UA 3CC4P 2IYPA 3FGAD 3CEIA 2EULA 3L75E 3KCYA 2QKCA 4W4LA 1S5HC 2EIMC 2L6LA 2R3SA 1JY2P 4TUYB 2QSAA 2RNBA 4PD4D 1FXKA 2AEFA 2ITAA 1O9GA 4IT5A 5LGNA 1NH2B 3HPLC 4H44D 4PA6A 3G80A 5LHHA 4G27B 4MVOA 2YC0A 1GK9A 4XDLA 1R5SA 3T1HO 3ZDMA 3L71E 1IFMA 1KQFB 3CPWO 2KP8A 4UV9A 2ZXXA 3E8GA 2E3CA 3K03A 1JOCA 4C46A 1QGKB 1YQ4C 2YIUB 3AK3A 1HDJA 1I94B 1PKXA 4LP8A 2WSFJ 5GTIH 1PZQA 2ZKOA 2PI5A 3CX5F 2IU3A 2YDEA 3GF3A 3A0HZ 4TT3H 3HKDA 1EZJA 1CI6B 1XNRB 2ZE6A 4K35A 1M93A 2KLVA 3CMEP 1HNWB 5CBGA 4MS2A 2WSEH 1NZ6A 1PPJH 3VOUA 2MK3A 1N7SB 5CBHA 4LFCO 1T2KD 1YSCA 4K8XA 4O4HA 1BE3D 4J42A 3AK1A 2Y9YA 1XMOO 3RYCB 4OPAA 1NR7A 3STLC 1PP9E 5KAIZ 1M5IA 1CZQA 1R3LC 4CBCA 3JCUE 3FXDA 4EIJA 2O01J 2ADPA 5J2UB 1FPOA 1UFIA 1TA8A 3GB7C 3QO8A 4DV5O 3L75H 1WMKA 1DK1A 3MGNA 1KZUB 2FYUH 4X62O 1SQPG 2IW5A 5KAFE 1XREA 3M0DC 4WWIA 4MVQA 2IFMA 3GHGB 1AQTA 1L0LK 2YI8A 4JZGA 5KX5A 3K59A 2K9JA 3RL0D 2JGDB 2MKVA 2R3CA 3JSLA 1K8AW 5B1BB 1HTLC 1T3JA 2W8ZA 1Q6IA 1SFCD 3RYFA 2YMYA 1P84D 1MZ9A 1GTOA 1KKDA 3H1KJ 3BVHA 3AEGC 3H01A 2QEXP 4K0KB 2QJKC 4DV0B 2IBZI 2E76B 2M3EA 3LIDA 5JQGA 1KB9F 4DYLA 4J41A 3TGUH 2GUVA 2QWPB 2F4VO 5EBWC 3RWRD 5BR8B 5LOVB 4J80A 4PDRA 1XMOB 3CCMP 4MN4C 3W7XA 1PFIA 3H1IJ 4J9ZB 4O4HB 2ZT9C 1LUVA 4LF8B 1GDTA 2P1JA 5KKZC 5IWAO 3H32A 1I0HA 2HODA 3FXEA 3PP5A 1FU1A 1R5LA 3Q4HB 1E79G 1NU1H 2BE3A 5LMUB 2OQQA 1Y47A 2Q3IA 1BCCE 1N7SC 5APUA 2YKQA 5CA1A 3U11A 4PV1C 3L72E 3LSQA 2LR2A 2XAQA 1FJGO 1N34O 4I5SA 1URFA 3L9DA 1KMIZ 1OW6A 4IYHA 2WT7A 2HPCB 3RW0A 3CP1A 3RYHA 3WU2Z 4JI0B 3ZS8C 1ZRTD 2ZIMA 1WP8A 1FS0G 1F4NA 2WPRA 4RUEA 2Y9ZA 3HD7C 4HNAB 1PPJG 2CK3G 4DV4O 3UT5A 1VQKP 2KSDA 3CXHF 1S1CX 3USSA 4R50A 2QJYC 3OMAB 3D36C 4YTPC 4ICGA 2UXCO 3DGEA 2P06A 1TVKA 1O9HA 5CBFA 1JEKA 3QNEA 1Y6XA 2PTMA 4YXWG 1OV9A 1BE3E 4NB5A 1JY3O 3CS5A 4P30A 1WLEA 4LFBB 2WSSG 2ETNA 1HP8A 1KP3A 3VYIA 1S4XA 1Q82Q 3ZRWB 4TQDA 2PFXA 1R3JC 4I0XA 3I55V 3T4DA 1Y74A 3AK2A 1FXVA 3ZRWA 4X89A 1L4AD 1NU1J 5E79H 4I9WA 4O4JA 1Q81W 3IN6A 2BOCC 3JAMN 1UIXA 3VMYA 1LR1A 3L75J 2IBZE 4BAYA 4DRXA 1NU1E 3JALB 5TISZ 1JTHB 1NS1A 3GWOA 1QR8A 4FFKA 1VQLV 3PHLA 1YDXA 2P58A 3SYCA 4JAUA 1JY3N 4GCZA 2I8DA 1SS3A 2IU0A 4PA3A 2Z5HA 4C7NB 4DOJA 1BSMA 4JYAB 3UT5B 2IYOA 4N78E 4QE7A 1YTZT 3E22A 2HVJC 4ZBMA 4YXWH 2IJKA 3UQ8A 2FYZA 5B5EH 5EYPB 1NTZH 1L2PA 3FYEB 3ZCCA 4UCSA 3OUFA 4I9QA 5LA6A 1XNQB 2E5YA 2ZYDA 3OW2O 1KC8W 3L35A 2W0XA 3OJAB 1MFTA 1VQLP 1BS3A 2UUAO 2JR8A 3WUVA 3ABLC 1F23A 1V55B 3CD6V 3H1KE 2F93B 1B6QA 2ZE5A 1K33A 1QVGU 1K3EA 2KIKA 2Q68A 1G8MA 1IFPA 3CX5D 3I56V 1PL0A 3JARB 4FLYA 3D8CA 2XU6A 3JYCA 1BGYG 2VWJA 2QKSA 5JCOA 5LYJB 1OCRB 1FZEA 1OMIA 3WUUA 4QPJA 3RGUA 3WB1A 3Q5SA 3JD3A 4LNUA 1S9KE 3ZEDA 1CEZA 3CMEV 2ZINA 3BVOA 1K4DC 5JQGB 2FKWB 5L8RJ 3S1KA 5LHGA 3PRJA 4H0LC 2BCCG 1KUQA 3H1IH 3CCUV 3RYIA 5IJ0A 1L0NG 5JJNB 1XTCC 3JCUH 3CC2P 3IAOA 1FZBA 2GA1A 1AR1B 2ATKC 2YEVA 3M9BA 4JYAO 1OCOB 3BCCH 1M56B 4D6TH 3FB7C 2YIAA 3IC9A 2OGUA 1HNXO 1GM8A 5IYDO 1NTKK 2V4HA 4UCTA 1KKCA 2HEPA 2H94A 4JI7B 2CGOA 1EXIA 4UVCA 4QMAA 3V4QA 4J11A 2FYNC 1S2EA 2ZM6O 5H2FE 2RQ6A 3HKBB 3K5LA 4R4MA 1NYHA 1YBKA 4B3MB 1W2BO 4NKGB 1IFDA 1NTMG 3F89A 3VQVA 2RMKB 3UM7A 3JCZA 5EBMC 1RP3B 1IJDB 1Q7YQ 5C8YB 2VS0A 4HAMA 4GLXA 3CCQV 3AE8C 5C93A 1DTOA 4YJ2A 4IL6X 1K9MQ 3U1CA 3ML0A 5EBLC 3VTPC 2UUCO 1WP7A 3D3QA 4MVRA 4U3FG 1YJWP 2CTRA 3L72J 1SFCB 1Q5OA 1OCRC 1CXZB 1OHHG 4FLTA 2LJ2A 4HYTB 3RN4A 1L0LG 4O9BA 2LW7A 2W27A 2Q0OC 1PNKA 1N86A 3U0ZA 2O1KA 1JY2O 2A7WA 3FAVA 4MVUA 4DT0A 3M0DA 5ITZA 3JC22 1BE3H 4TQFA 1KP2A 4MVMA 4B3RB 1QL1A 3FKSG 2ILMA 3X2QC 3C9IA 1FFXA 4WBAA 4DR5O 3PJSK 1URQC 5DJUB 1YJWV 4I50A 4U7JA 4FJCC 1N4CA 1SQXD 3A0BE 1PNMA 1USDA 2HP8A 1M56C 3QVNA 4DV6B 1XMQO 1XBLA 2ZVNB 2PAJA 2HODB 1NVOA 5IJ0B 2XZRA 3CRAA 3J80N 3VQWA 1I7FA 1JOYA 3Q1MA 3VMAA 1JMBA 3T1YO 1AB3A 2WLLA 3SJBC 4DW1A 1S3JA 3LSUA 4HYOA 4X20A 1LWUB 2GBOA 2A06D 2XDJA 2M7WA 3E7KA 4PA4A 4LCUC 5JVDA 2J5UA 5IYBO 5H2FH 5BU5A 2QE7G 4TWKA 1SQPJ 3TNUB 4TV9B 4KXRA 2QIWA 1OVRA 1PGJA 4WBNA 2WMMA 4XDKA 1FBMA 1JR9A 4DJGA 3UKMA 2O01H 2ZXWB 1FJGB 1URQA 5L3GA 1NTKJ 1VQ7V 3M9QA 1R3KC 1LT9B 2JGDA 2JS3A 3I5DA 4R4LA 1OWAA 3TDKA 4WVZA 1RSOA 2Q0AA 2XAHA 2GSMB 2WZ7A 4HKZH 2YIUC 1VQNP 1G6UA 4O2AB 3ZHQA 4IFDK 3OTOB 3O6QA 2KXPB 5CMZA 3IGAC 1NWQA 3ABKC 1F4MA 4DR7O 4Q6GA 2EJRA 3HD7A 1AJYA 5LGUA 1SA0B 1SP4A 1U7MA 1FDOA 2NPSB 1H2GA 1QU7A 1YITV 3ZX6A 4CC5A 1AI4A 5EK0A 4B86A 3BY6A 2JDIG 5LXTA 3BATA 3C3TA 2DN9A 2FTKA 1URQB 4FLVA 1EDKA 2UXDB 4L75A 4PJ0E 2VQEB 1JY3P 1ORQC 1J1EB 3V2NA 3SPHA 2YXHA 3CX5E 4LFCB 3FYIB 2WPQA 2EIKB 3JAWB 2E42A 2K9YA 5H2FZ 3K06A 5JVDB 4YHHO 3SWKA 3AG7A 4PI2A 3E89A 2QWQB 1NR1A 2UUCB 1KB9H 4X62B 3APOA 2R9IA 1EZVG 4UFZA 2G8YA 4X1KA 4JI4B 2WLNA 1SQGA 1KYOI 5IY5C 5KUKA 2C2AA 3MZWB 3CPWU 4I7ZC 2ZR3A 3HE4A 3CMAP 3MD0A 1E5WA 1LTTC 4FFBB 1M57B 2LQTA 4LF9O 4UB8Z 4IHJA 2OIEA 2LXBA 4U3FH 5K1PA 2A45I 3UO3A 2FFDB 1IFNA 3ABMC 2V7QH 1S5JA 2CH7A 3W7UA 3P30A 1L0LH 4G2KA 4FM0A 2GUZA 2LW1A 2P90A 2FXOA 5AVTB 2WAMA 1NKNA 1JPXA 2OYIB 3MHSC 2GUSA 3K5NA 4JGSA 5APSA 3SFEC 2V1DA 3CMAV 4EB6A 4LFAB 1Q43A 1SLQA 3L73J 5BY1A 3H1LH 3CXHD 3B71A 3RL0C 5B1AB 2WLKA 1I5YA 3BRCA 3T97A 5KKZB 1SQVE 4DR1O 2YICA 3DC5A 1OCOC 5HFMA 4ASWA 5CBOA 2UU9B 1M1JA 4IFMA 3T4ZA 3N2GA 1QEXA 4YJ2B 4IL6H 3AE6C 4JAVA 3CSXA 3E86A 1DH3A 3Q5RA 2YIBD 4PI0A 2E74D 3IR9A 1N2DC 1OJHA 1X0TA 1NAFA 1JJ2U 5KAFH 4OPHA 2EZOA 1AV1A 4H37A 1EN4A 4LC1A 2A06G 3DXRB 2JEUA 2OCCC 3ZIAG 3BABA 3B2EE 2OARA 2DWDC 3JATB 2E75D 3G3ZA 4YIPA 4LF5O 3M7MX 1M4UA 1N73C 3L72G 1IZNB 1GRJA 1EN5A 4O2BB 4OX9O 2BOBC 2LFRA 4I7ZB 3P3PA 3BRTB 4QIWF 5L3EA 5H6RA 4F4LA 3IC7A 1GU5A 3ZJZA 1KILE 4RO0A 4DR6O 3AEFC 1RY3A 2OTLP 1NTMK 4TV9A 4PD4E 5APXA 4XDJA 1G2CB 3GWKC 5L3FA 5H5NA 4KUMA 3L75D 2DYSB 1PPJD 2D2CD 2EIKC 3SYOA 4DR5B 5DECA 1DD4A 4P9PA 1RF1A 1NTMJ 1M90Q 2E76D 1OCZC 3K5BA 3R4YA 3S9OA 5GTIE 3RBZA 1PGPA 5AW6B 2OYIC 1YTZI 2ZDIA 4R7CA 1FXHA 2OTKE 1EZVI 1PP9J 3Q5PA 1QVGO 5APQA 1GW3A 4X8AA 3HTKB 4RWUA 4AQYO 1SF9A 4I50B 4PA9A 3CRMA 3HUSB 2P67A 2PGGA 2ZNIA 3KQGA 4GT1A 1EFRG 3H6PA 4J7KA 4I6MC 1N8RQ 5AW7B 4JF3A 1P84E 3CCQP 2DOSA 4O2BA 5ITZB 3FAVB 3BCCG 3HKDB 2IZ0A 4TV8A 1SQBJ 4D6TG 1EBOA 3TJTA 1H8AA 5IJ9A 4JQ0D 1HH0A 1EZVD 5LA6B 1NT2B 2PF4E 3KHUA 2DW4A 4DK1A 2WLJA 1IFIA 5AVUB 3BCCJ 3WMM0 4D6TJ 1BQZA 4GKJO 2EX3A 2OYQA 3PH0A 4Y99C 5EZYB 2ITDC 4PJ0H 2EIJC 2HG5D 5B66E 3QF7A 4YJ3A 1M7LA 2QM8A 3FX7A 4P2ZA 3MUDA 4MW8A 4JI1O 3H1JJ 1COWG 4PD4H 4D7SA 4JTCB 3F5HA 1NH2D 2XHBA 4DV7B 3Q3DA 2A06H 2ZIOA 1FZCA 4TUYA 2KS1B 2WPSA 3S3WA 2FXMA 1RE3A 3AG3B 1OCZB 2XNXA 5DN6G 1F7YA 5CBNA 1LP1A 4GOFA 4N21A 3QO7A 4I0XB 2WSSH 3SFDC 2OYHB 3RK2C 3LDEA 5CCHA 4GODA 3EXAA 2KUBA 4H0LB 2WLMA 2O1JA 4Z1MH 1VF5C 3T1YB 5FLXN 4CPGA 3H9VA 4UVAA 2X6BA 1RE4C 1MKMA 3CCLV 1VF7A 1RFYA 2OWOA 1AVOA 1IBMB 2E74B 3ABUA 1RQUA 1U97A 1AR5A 2W6JH 1N0NA 2HYNA 4CS2A 2CK3H 2ZVOB 1HF9A 2F4VB 1KILB 1R73A 1AVYA 1SQQG 4H13D 3TGUG 3THOA 3E1IA 2XAJA 4X1KB 1VQ7P 1VQ4P 2XASA 2EILB 3OUSA 1L0ND 4WB4A 3SJCC 3KZIE 1D5AA 4DUZB 1L0LD 2WA4A 4LFBO 3L70H 4RKUJ 2Q5UA 2DMXA 2W6AA 2B89A 4R6ZA 4ZOLA 5JJJB 3CLQA 3K0DA 1VQ8V 3SSUA 1BDDA 3N2KA 3AE9C 3W7SA 1YJ9P 1QQCA 2G38A 1G1IA 1VQ6P 4HBNA 1L0NH 3RFRA 1RE4A 1ZRTE 3VP8A 3A3YB 4ZI7A 5BMVB 3L74H 4U3JB 4LF5B 1SQXG 1NTME 3O65A 3A5TA 4DV5B 3STZC 3H1IE 1SA0A 3L73G 1G4YB 2RJZA 4NTXA 4X64B 2HHHO 4ZOLB 5KHJA 4JTAB 4GX1A 1N34B 2RN9A 3E22B 1QHTA 1I08A 2WLIB 1N8RW 2H43A 2KNCA 1OCCB 3K79A 1H88A 1PGOA 1XL4A 5AVWB 4WY4B 3JAKB 3K0GA 3JASB 2PYLA 1M57C 4UXNA 5L3CA 2E74C 1S72P 1FZAA 2LXCB 1B06A 2GTSA 4OGQB 4AILC 1AJNA 2KG7B 3VN0A 3UCSC 2K9JB 3A0BZ 3WU2E 3E83A 4O4LB 4JYCA 1X59A 4EKWA 2D3OW 1WPBA 2Q1KA 4DR4O 1BL8A 2BASA 2I1KA 2OCHA 1LWUA 3K9SA 4JI5B 2YO3A 4YXDC 2QA4P 3BFRA 1YHQV 2IH3C 1THZA 5KMGA 2QSIA 2ZDIC 2ZFCA 2IDBA 2OTLV 1RM1C 3CCJP 4JPRA
chains in the Genus database with same CATH topology
2QJYC 1R8EA 4H0LB 2WSFJ 4R4LA 4YTPC 4Z1MH 1U57A 1VF5C 3GF3A 4TT3H 3RL0g 2E75D 1MKMA 2YIUC 3T97B 4OGQC 3ABVC 3AE1C 2E74B 4H13B 4I7ZB 2E75B 1RQUA 2QJPC 3O6QA 1EXIA 3GLMA 1PL5A 1ZMEC 1HF9A 2FYNC 1KILE 5M1BA 4KT0J 1AJYA 3AEFC 2NZ2A 4H13D 1FDOA 2WPVB 4R4MA 1NYHA 4H44C 3AEEC 2E75C 1ZP0C 2D2CD 4RKUJ 1GMJA 3AECC 1RQVA 2H88C 1TU3F 2JP3A 1DD4A 2O01J 3D71A 1NGMB 2FBWC 1Y9BA 2E76D 2BEQD 3Q2YA 3AE8C 3AEDC 3IN6A 4IL6X 4Y28J 3D6ZA 1UIXA 3R4YA 3AE9C 2YMKA 3S9OA 1ZOYC 1OW7A 1WMKA 3AE7C 1EXJA 2K9YA 1ZRTE 3Q5PA 2D2CC 1Q90D 4PV1D 2H89C 2MKVA 4H13C 2G8YA 1KTMA 2D2CB 1IK7A 3H25A 1HJ0A 2FXPA 4I7ZC 3AE4C 3AEGC 2QJKC 3AE3C 2WSCJ 1YQ3C 2E76B 4OGQD 2JO1A 5KLIC 4XFJA 1VF5D 3AEBC 1DIPA 2P10A 4U7JA 1KQGB 1OW8A 1PV3A 3GF7A 4PV1B 2E74C 3LW5J 1DD3A 3AE5C 3SFEC 2ZT9C 4OGQB 3RK3E 5KKZC 1JB0J 3FGAD 4H0LD 3Q1MA 3D70A 1K05A 3EWKA 3GMAA 2OQQA 1FDIA 3AE2C 1OMIA 3B71A 4H44B 3D6YA 1S5LX 3Q3DA 3Q5SA 1KORA 2J5UA 4H44D 4PV1C 3C8VA 2ZT9B 1VF5B 1KMIZ 1VL2A 5L8RJ 1OW6A 1K04A 2QIWA 3AE6C 4H0LC 4YXDC 1KQFB 4GDOA 2QSIA 2BEZF 3G9RA 2ZT9D 3Q5RA 2WSEJ 2E74D 2IDBA 2G3AA 1YQ4C 2E76C 3AEAC 2WQYC 1PIXA 3IAOA 3SFDC 1S1CX 2V7QJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KKZ C;  1JB0 J;  2QJY C;  4H0L B;  2WSF J;  2D2C B;  4RKU J;  2QJK C;  2O01 J;  4H44 B;  2WSC J;  2YIU C;  2E76 B;  1S5L X;  4IL6 X;  4Y28 J;  3C8V A;  5KLI C;  2E74 B;  4H13 B;  4I7Z B;  2E75 B;  2ZT9 B;  2QJP C;  1VF5 B;  2K9Y A;  5L8R J;  1ZRT E;  2QIW A;  2FYN C;  4KT0 J;  2QSI A;  1Q90 D;  2WPV B;  4PV1 B;  2WSE J;  3LW5 J;  4OGQ B; 
#chains in the Genus database with same CATH topology
 3W68 A;  2H8P C;  5KLI B;  4PA7 A;  5AW9 B;  2Q6Q A;  4W7Z A;  1GN2 A;  4O4I B;  3CCS P;  3E1R A;  2Q67 A;  1XUQ A;  5CB4 B;  1ZXG A;  3ABV C;  3P8C E;  4JAA A;  4UCV A;  3ZN1 A;  1L4A B;  2VRS A;  3CCU P;  1OXZ A;  1ZL8 A;  4LH7 A;  1ZR4 A;  4DR2 B;  5CCG C;  1LTJ B;  1HBW A;  4NTW A;  1MA1 A;  2WPV B;  3RYH B;  2CH7 B;  2HKO A;  2JK5 C;  4JAS A;  5L3D A;  5BR8 O;  1MFZ A;  2FYU J;  2IJJ A;  4IHJ B;  3AEC C;  1NTK G;  4CS3 A;  4EDF A;  3WG7 B;  2PI4 A;  1U7J A;  2KYV A;  2ZXE B;  1XEQ A;  1M1K Q;  2P7J A;  5KMG B;  3KPE A;  2HFE D;  3NR7 A;  2QJY B;  3AG1 B;  5KJ7 A;  2EIM B;  2R70 A;  3ZRX A;  5IT9 N;  2W83 C;  4PV1 D;  1XHZ A;  4AQY B;  1VQ5 V;  1MSD A;  4ZIB A;  2N04 A;  4B7K A;  3G67 A;  2BTQ B;  4IFF A;  2AXT E;  4O4L A;  4JI6 O;  2R9R B;  4IIJ B;  2B87 A;  2KG7 A;  2FYU G;  3TF5 A;  3QG5 A;  1H89 A;  2QKA A;  1KC8 Q;  2RMZ A;  4Z1M G;  5KLI C;  4JI0 O;  1BGY D;  1N32 B;  1NJI Q;  1FJP A;  1X22 A;  3SDL A;  3ZHU A;  4DR7 B;  2NPS A;  1K8A Q;  3ICX A;  1ROP A;  1R1B A;  1GN4 A;  2XND H;  3CD6 P;  1ZX3 A;  2WSF H;  3GW6 A;  3JAS A;  3RK3 E;  5JWP A;  3WB2 A;  1EC5 A;  2UXC B;  4IIJ A;  5GON B;  1NJI W;  4Z2W A;  4LF7 O;  4X65 O;  4L8J A;  5CA0 A;  1FFT B;  4O2A A;  5KJ7 C;  3FD9 A;  3M0A A;  3QWO C;  4ZHQ A;  1FDI A;  1HNX B;  4UV8 A;  4YY3 B;  3DXR A;  1SQV J;  1SQP H;  2JEE A;  3CXH H;  3UIA A;  1XNR O;  1KOR A;  3L4F A;  3LNN A;  1PP9 H;  3H1J H;  4LWS B;  5IE9 A;  5KA5 A;  1Z2G A;  3OFN G;  1W0J G;  3OA7 A;  2A9H A;  1KFN A;  4KHX A;  3N4X A;  2KQX A;  4QGP A;  1LTA C;  2ZYG A;  2Q9I A;  5KLV K;  2V7Q J;  1M56 D;  3L74 G;  3H1I D;  3ZHR A;  3IAY A;  1YZB A;  1NAY A;  2O01 N;  1SQB H;  4JI1 B;  4YHH B;  4A5U B;  4NPE A;  3R66 A;  1NTM D;  3O8Z A;  5CCG A;  3RK2 D;  2JRI A;  2V7Q G;  2BCC D;  2AXT H;  3WUT A;  3G6B A;  5CN0 A;  1KYO D;  5AVQ B;  5BXZ A;  3RK2 B;  3LNM B;  1EM1 A;  1Q6H A;  3O9O A;  4MTF A;  1KIL A;  5B1B C;  1US6 A;  1QVF O;  1WPX A;  2UXB O;  5KHG A;  1M8O B;  1HJB A;  5M1B A;  4DO2 A;  4UB6 H;  2QJK B;  2PYJ A;  4N23 A;  4B7E A;  1RF0 A;  3OGC C;  1ZP0 C;  1YXB A;  4W4K A;  4O4I A;  2A06 E;  2UUA B;  1SC5 B;  2A0L A;  1Q7Y W;  1GMJ A;  2IPP A;  1FD9 A;  1S77 D;  1OVV A;  4I1L A;  4B3M O;  3HE4 B;  2ITC C;  4N78 D;  4Y28 J;  4X1Y A;  1A32 A;  1NTZ D;  1ZOY C;  1GK6 A;  1GK4 A;  3H1L E;  2W6B A;  2OCC B;  4JI7 O;  1VIB A;  5KHI A;  4HH2 A;  2Y4T A;  3H1J E;  5KLV G;  2OYH A;  2N1T D;  4GKK B;  1J95 A;  2H89 C;  4GKK O;  5C39 A;  3CYO A;  2K9P A;  2DW3 A;  4MTX A;  5AVV B;  3RK3 B;  1IK7 A;  2P4V A;  1GN6 A;  3OT7 A;  3G71 P;  3OW2 U;  1BE3 J;  4XE5 B;  3JD1 A;  4Q20 A;  4YJ3 B;  2YXQ B;  4EI2 A;  1T8Z A;  1V54 C;  1H2L A;  5EIB C;  1L0L J;  1HW7 A;  2MJZ A;  1VQ6 V;  1TVK B;  3T1H B;  2Y48 A;  1GKF A;  5AVY B;  3HKB A;  2I1J A;  2RCV A;  4LBE C;  2POH A;  3VOP A;  1KU9 A;  4HB1 A;  2V4D A;  3CRQ A;  4QE9 A;  3CXC U;  3E8F A;  3CCE P;  1KN7 A;  4H33 A;  1J5E B;  1FAV A;  1GM7 A;  3CX5 H;  3QO5 A;  4CH6 A;  5LGT A;  1GZL A;  2FB5 A;  1J2J B;  2Q5Z A;  4J10 A;  4WCE V;  1N32 O;  3L37 A;  3K5M A;  3K58 A;  2N9B A;  5KTB A;  3L70 G;  4X66 B;  4I55 A;  2FYU K;  1JJO A;  2QWO B;  1BSN A;  1LUW A;  2YXL A;  2Q69 A;  4NPF X;  1EDJ A;  2Q7C A;  3L75 G;  4A7P A;  5LMN O;  1LTB C;  1N33 B;  1T3U A;  1NU1 D;  2BEZ F;  2K1A A;  3HUS A;  2XOK G;  5A2Q N;  4HJG H;  3HTK A;  1OX3 A;  4GYC B;  1R8E A;  4B3S B;  2VWK A;  1G1X B;  3A0H E;  4X20 B;  3L71 G;  5KHK A;  1IFJ A;  5AW1 B;  3H1J D;  4QNH B;  1VAR A;  3JD2 A;  4LH6 A;  5LL6 Y;  1W5C E;  2QA4 V;  1GL2 B;  3KKY A;  5AVX B;  2L5G B;  4Z1V A;  4KT0 J;  2J59 M;  2NZ2 A;  3HKE A;  1JM0 A;  4E4E A;  3L74 D;  1SQB G;  3CWB J;  1N7S D;  1SQP E;  2W6I G;  5IYC O;  4WF9 V;  4DR6 B;  2AEM A;  3CWB D;  3VQX A;  1K92 A;  1OCC C;  3L74 J;  1NTZ K;  5EYP A;  3D71 A;  5A9G A;  2DQ0 A;  4JI8 O;  1YVW A;  3T2M A;  2OT5 A;  1HNW O;  2BEQ D;  2IFN A;  2OYH C;  2CPB A;  3SPJ A;  4JZ2 A;  2PGD A;  3CB2 A;  2J58 A;  4F6R A;  1LGH B;  3JAT A;  4K0K O;  3HRN A;  4DV3 O;  3IFX A;  3AG4 C;  1CP9 A;  4GX5 A;  1KYO H;  1AP6 A;  2IZ1 A;  2LP7 A;  5GTH Z;  1PP9 G;  2KI7 B;  1SQQ E;  2M0B A;  5B1A C;  5GTH E;  4HZ3 A;  1JMM A;  3KYQ A;  3RGB A;  3G6E V;  3ETE A;  4NXN O;  1HNZ O;  1PNL A;  1L0N K;  2QG4 A;  2RH0 A;  4BIU A;  2MW2 B;  3AG2 B;  3ASO B;  2FXP A;  1LNQ A;  3BHP A;  1YJN P;  2A79 B;  1Q82 W;  2E5L B;  3AE3 C;  4F6R B;  4DR1 B;  4JYY A;  1M57 D;  4RES B;  3A0H H;  4GUN A;  5IY5 B;  1CI6 A;  2KSE A;  4LF6 O;  3SJA C;  2R72 A;  3FWN A;  1OW8 A;  1BCC G;  4FM1 A;  1JX9 A;  1PV3 A;  5TJH A;  1AJQ A;  2N74 A;  3N27 A;  1EDL A;  2P6J A;  2WSC H;  1XDC A;  2PY5 A;  2ZNJ A;  1SZT A;  1LTG C;  1AI7 A;  2NNU A;  3AE5 C;  3HE5 A;  3HKE B;  4YPC A;  3ZRV A;  3H1H E;  3VQY A;  1S0V A;  2K88 A;  5AVS B;  1AQ5 A;  2M6Y A;  1P49 A;  1JB0 J;  2WA3 A;  5D5P A;  3ZHT A;  1Z5W A;  2K37 A;  3B5N C;  4I4T A;  1Q81 Q;  1PPJ E;  3GVM A;  1JA8 A;  1MG1 A;  4Y99 B;  3C8V A;  2Y0I A;  3K3W A;  1VDF A;  1XTG B;  3F5T A;  2VRZ A;  3G4S V;  1D2D A;  1P7B A;  2CTW A;  2ZT9 B;  5B5E E;  2WLI A;  3ETG A;  3F7V C;  1NTZ E;  5KJ7 D;  1K04 A;  1OIP A;  4UCU A;  1E1R G;  1ZSP A;  4GDO A;  4JTD B;  2ZT9 D;  2P5O A;  2WSE J;  2X0L A;  2WT7 B;  1W59 A;  4WFA V;  1BE3 G;  1B04 A;  1H2N A;  4EOT A;  1P84 H;  2KZI A;  4P9O A;  4JI5 O;  2W90 A;  5CA1 B;  1YI2 V;  4NXN B;  4OH8 B;  2WLH A;  4UCR A;  1S76 D;  1WB8 A;  1TAE A;  3AG1 C;  3ZHS A;  1FS0 E;  4OGQ C;  4W7Y A;  4PDV A;  2HVK C;  1JCH A;  5FPO A;  1VQM V;  3ZMU A;  1NTZ J;  2QJP C;  2CDY A;  3L70 D;  2EJ7 A;  2F23 A;  3K5O A;  4FVM A;  5D5Q A;  4BIZ A;  2Q7H A;  1PD3 A;  4NVP A;  3O6Q B;  4G28 B;  3P32 A;  1TUE B;  2LKM A;  3BRV B;  4XA4 A;  3TK1 A;  1DF4 A;  1XQ8 A;  1DX7 A;  4FLU A;  3X2Q B;  3OMN B;  2AHY A;  4RO2 A;  1ZLL A;  2ARH A;  2Q3E A;  1E79 H;  1NU1 G;  2IH1 C;  4ZHQ B;  3HB3 B;  4NR1 A;  2XND G;  4LLH A;  5AW3 B;  2QR4 A;  4GZR B;  1IZ3 A;  5H6Q A;  4IOI H;  5GW7 A;  2R9A A;  1J1D C;  1Y9B A;  5DJT B;  2B9Z A;  4B08 A;  3IJ4 A;  1IBM O;  1Y67 A;  2YMK A;  4LGD E;  1OW7 A;  2QDO A;  2X6C A;  1FXK C;  2F1M A;  1GH6 A;  4DCK A;  3P8C D;  3AG2 C;  3ASO C;  5KX5 B;  1KQS U;  4PEL A;  1G1J A;  4PDL A;  4X88 A;  2CAZ C;  1SQV H;  1JTH A;  1K9M W;  3F5W C;  5BMV A;  5TIS H;  1PM9 A;  3ETQ A;  3NTN A;  3AG3 C;  1RF1 C;  5CCG D;  3H25 A;  1USE A;  3NXS A;  3AE4 C;  3H1K G;  1KBH A;  4EB6 B;  1NTK E;  4OWF A;  4DV1 O;  1YQ3 C;  3CL3 D;  1GTW A;  3CCL P;  1K34 A;  2UXD O;  4DV2 O;  1Q86 Q;  2B88 A;  1Z5V A;  4MW3 A;  1VQP V;  4B3T O;  1BGY E;  2ZCE A;  3VP9 A;  2ZAE B;  1AIL A;  3M06 A;  3P8M C;  2H8P D;  4YIO A;  1CW5 A;  4ASU G;  3WG7 C;  4TLF A;  1OFC X;  3B5N A;  4EYY Q;  4L73 A;  5EIB D;  1BQ0 A;  3V6I A;  1K97 A;  2GDS A;  1SQQ K;  4FFB A;  2UXB B;  1SQQ H;  4MT8 A;  2BCC E;  1HVV A;  3OTO O;  3GHG C;  1L0N E;  3I55 P;  2FYU E;  3CWB E;  1W2B U;  3SWF A;  1SQF A;  1I94 O;  3KXD A;  4DR3 B;  1NHL A;  4FIP C;  3ZBH A;  2HJF C;  1PL4 A;  2N1T C;  5GTH H;  3V4W A;  1SKV A;  2JJL A;  2O3J A;  1LTJ A;  3N7N A;  3PLN A;  2Y4U A;  1OZ0 A;  3CCV V;  4JI2 O;  1LP1 B;  1LT1 A;  2CPS A;  3JD4 A;  2UU9 O;  2XV5 A;  4AYC A;  1MZF A;  4X66 O;  4KHP B;  2X6A A;  2E76 C;  1PIX A;  1SFC A;  3TGU D;  3I5C A;  1FKA O;  1QR9 A;  1Q6U A;  1Y76 B;  5KLV H;  3EFG A;  5CA3 A;  1QL2 A;  1FXK B;  1SQP K;  2XTA A;  1L1F A;  5AVZ B;  1X9V A;  1L8D A;  3SPC A;  4LWS A;  2R44 A;  3H32 B;  2ZJS E;  2GTA A;  5C8Y A;  1VPC A;  4U3F J;  5K1X A;  1JNM A;  2WTY A;  1NTK H;  2E75 B;  2GHY A;  1HGV A;  1BZK A;  2Q73 A;  1DEB A;  2KKW A;  1HUC A;  1YHQ P;  2RDC A;  2Y0C A;  3GLM A;  3H1H H;  4IGG A;  1YIT P;  4X1I A;  3HKC B;  5APY A;  3KG2 A;  4FPP A;  2FFD C;  2FYU D;  1FAF A;  5KUM A;  1WT6 A;  1RSO B;  3W7T A;  4LF9 B;  1GW4 A;  4RUF A;  1XI1 A;  4KJM A;  5CHX A;  1EZV H;  1LT9 A;  2JP3 A;  1NGM B;  2CGN A;  4N6J A;  2HG5 C;  5LP6 A;  4BIO A;  1X4T A;  2UXX A;  4MSW C;  5KHH A;  2C9N Y;  1FDM A;  3OE7 G;  3RYI B;  1H2K A;  3OR7 C;  3MDS A;  1KB9 D;  1VF6 A;  1GO3 F;  3CC7 P;  3ZMS A;  2KNC B;  5L3B A;  3L72 D;  1CSB A;  1GAX A;  1Q90 D;  3FFQ A;  5KA6 A;  5IYZ B;  2CTP A;  2KB1 A;  2N9Y B;  4KHP O;  1T5E A;  2OYO A;  3CWB H;  4FLW A;  3CXH E;  4JF7 A;  4X9Q A;  1H8H G;  5LMN B;  2D2C B;  1H0T B;  1VQO V;  1K5Q A;  1AP5 A;  2BTQ A;  3JAR A;  3MUD C;  1KIL C;  3SR2 C;  4OGQ D;  1MV8 A;  2M8R A;  1NKD A;  3SPG A;  5LYJ A;  3H1L G;  1Z56 A;  2OTJ P;  4WY4 D;  3G4S P;  4ZI7 B;  5DM6 V;  2XAF A;  3AEB C;  1IUR A;  4UUJ C;  4IYI A;  1KYO F;  5B3S C;  5B1O A;  4PD4 I;  5E1A C;  2Y0P A;  1FE6 A;  2IBZ H;  2K1E A;  1ZTE A;  5DED A;  1VF6 C;  1QVF U;  2HJD A;  2Q9L A;  1LTJ C;  3PN1 A;  2JJ2 G;  3MAQ A;  2KZJ A;  4BRY A;  1M9N A;  2DQ3 A;  1NVP B;  3AE2 C;  1L4A A;  4DV2 B;  3H1K D;  5FNV A;  4AHC A;  4DV6 O;  1XMQ B;  1BSH A;  1KB9 E;  5CB4 A;  1YTF D;  2P2U A;  1WJZ A;  1IBK O;  2AEJ A;  4TOI A;  3SYA A;  4CC6 A;  2BCC J;  2GM4 A;  3TYY A;  2VQF B;  2QJ1 A;  3L73 H;  4DRX B;  1SER A;  1W2E A;  3D3I A;  4AUW A;  3FWL A;  2NR5 A;  3L70 J;  1JVM A;  2QVA A;  2QJP B;  1HWY A;  4YY3 O;  1LJ2 A;  4L76 A;  4ZMD A;  1PGQ A;  2ZR2 A;  4BXL A;  3B09 A;  2A45 G;  1RPR A;  3JAW A;  2NRG A;  3DTU B;  2VQE O;  2XT9 A;  3OEH G;  4CZZ A;  1K4C C;  1B3Q A;  3K57 A;  1SQV D;  1MOF A;  3EQ2 A;  4CH3 A;  1IK9 A;  2JVD A;  3B4S A;  4IL6 Z;  4GX2 A;  3ABT A;  3CC4 V;  3CRR A;  3JSN A;  1S9K D;  2JGU A;  4UVB A;  1KFM A;  1BCC H;  3NMD A;  1YIJ P;  5JJE B;  3B8N A;  3L72 H;  4EFE A;  1FZC C;  1CPY A;  3ZRS A;  2FBW C;  1GU4 A;  5B3S B;  3ITK A;  5LHI A;  4W80 A;  1GL2 A;  1SQQ J;  1VQM P;  2EIN C;  3EVK A;  2C9L Y;  1QLE C;  3V2P A;  1E1Q G;  3JAK A;  3U59 A;  2YNY A;  1V9P A;  2AXT Z;  2F95 B;  5J2T A;  3E35 A;  1S5L H;  2QWR B;  4LR3 A;  1M1K W;  2N1T A;  2D2C C;  3B8E B;  2NLJ C;  3M91 A;  4JBZ A;  1SQB E;  1JFF A;  5CCH D;  1BT8 A;  3BAA A;  1IDS A;  4U3J A;  3B5N D;  1EQ7 A;  2AGA A;  3ABM B;  5KAI H;  2JS5 A;  3ASN B;  4DZO A;  3ZMT A;  4B3S O;  2KB7 P;  1DF5 A;  1ZLZ A;  2L35 A;  2FKX A;  3J7A U;  1SFC C;  4L87 A;  2Q7G A;  1HWT C;  4DW0 A;  4RQF A;  4DUY B;  3TNU A;  1Y66 A;  2P22 C;  3ZMV A;  1I5X A;  4JI3 B;  1EZV E;  3TGU J;  1Q8I A;  2P10 A;  1MZE A;  1JFF B;  3CCV P;  1A02 F;  2BTO A;  1QNM A;  2N1T B;  1SRY A;  1JO5 A;  2LGQ A;  5E79 E;  1SS1 A;  3LW5 J;  1FYJ A;  1R6T A;  3OAA G;  3G71 V;  1AA0 A;  1ZW0 A;  1ARO P;  3KCX A;  1VP7 A;  2ZQM A;  1H38 A;  3K9A A;  1K05 A;  3SYQ A;  4EEQ A;  3EWK A;  3RYF B;  4C7N A;  3BCC D;  4D6T D;  1UJW B;  5K5G B;  4B3R O;  3ETD A;  3IF4 A;  2PRR A;  1YF2 A;  2YXR B;  5EC1 C;  1VL2 A;  3P7K A;  3W67 A;  3H1L D;  1AR4 A;  3JAL A;  4BW5 A;  1P4R A;  3R65 A;  4WFF A;  1EDI A;  5CMU A;  1ZWI C;  1QLE D;  3G9R A;  1MNG A;  3CCE V;  4ABM A;  2EZP A;  2Z4E A;  1VQK V;  2W6J G;  4UB6 Z;  3H1H G;  3DC6 A;  1NKZ B;  4JYB A;  1LTS C;  3GHG A;  1QLE B;  1SQV G;  5B5E Z;  3M9H A;  1VEW A;  4RQE A;  3TSI A;  3CXH I;  1M90 W;  2JIZ G;  1WRG A;  1KD1 W;  3CE2 A;  4LFA O;  2QE7 H;  3OD4 A;  4L74 A;  2WLL B;  1FZG A;  2SPZ A;  5AW0 B;  1ENV A;  1Y8A A;  1NQT A;  4UCO A;  4FLX A;  1NTZ G;  4X1Y B;  4RAI A;  3TXS A;  3CCM V;  3A2A A;  1LTI C;  4GOE A;  1M1J B;  2KS1 A;  1BDC A;  4LF8 O;  3RYC A;  2JKV A;  4C7U A;  5AW8 B;  4J9Y B;  4H44 C;  1WB7 A;  1Y76 A;  4I2L C;  1FOS F;  2YUA A;  4DV1 B;  3ABK B;  1SQX H;  2BSK A;  3ABL B;  5FNV B;  4LF6 B;  1RHZ B;  4X64 O;  3SYP A;  5IJ9 B;  4OX9 B;  3OAK A;  3AED C;  2IJH A;  2IM9 A;  3CI9 A;  1QBZ A;  3A2F A;  2GUZ B;  3C90 A;  1D5N A;  3OTF A;  3TET A;  1LT9 C;  1D7M A;  3LUT B;  2FFD A;  1NOH A;  1URQ D;  4NXM B;  1IXB A;  3QH9 A;  3BCC E;  4D6T E;  2YEV B;  3OGI B;  2QRX A;  2DJV A;  3KDP B;  5CJ0 A;  2CTQ A;  5AW4 B;  4RJT A;  1XIL A;  3WB0 A;  3RVZ A;  1N33 O;  3EHB B;  2UWJ E;  1HJ0 A;  2NN4 A;  1AFO A;  2NPS C;  2M3B A;  3RBX A;  5LBQ A;  3KZI H;  2ODM A;  5JCO C;  4OXS A;  2JO1 A;  1VQ9 V;  3K08 A;  1RF1 B;  2ZE8 A;  5KLV J;  1SVF A;  2O57 A;  2DYR B;  2F66 C;  3U10 A;  1V54 B;  3GF7 A;  3G6E P;  2LO1 A;  4PV1 B;  3HD7 D;  1SQB K;  3L73 D;  5CA0 B;  3UO2 A;  3OR6 C;  1BHB A;  1DD3 A;  1NVP D;  1PV0 A;  3SWY A;  3I56 P;  1X8Y A;  4WFB V;  2X7R B;  2FYN B;  2UUB O;  1H2M A;  1M1J C;  2WVR A;  3CCR P;  1NTM H;  5LXT B;  4I55 B;  4B3T B;  2DWE C;  3AEI A;  2GV9 A;  4H44 B;  4JI3 O;  1YJ9 V;  3D6Y A;  2B1G A;  2HLD G;  4WY4 A;  4F6E A;  4GKG A;  1RM1 B;  2L91 A;  5FPR A;  1VF5 B;  2HHH B;  1JCD A;  3RK3 C;  2M5A B;  1HR0 B;  3BAS A;  2IBZ D;  2CE4 A;  4DV0 O;  1SQX K;  2WQY C;  3ZHV A;  3CHX A;  5HFL A;  3CCR V;  3MIW A;  1YIJ V;  1L4A C;  2QTS A;  2YID A;  4QJF B;  3FB5 C;  2H7H A;  1HNZ B;  3OM3 B;  4FM2 A;  3CWB G;  2K3R A;  1GMG A;  5TIS E;  3TGU E;  3RL0 g;  2E43 A;  1JUN A;  3PTZ A;  2B5U A;  1MAB G;  3T97 B;  2EIL C;  3A0B H;  4M3L A;  1N36 B;  1GL2 D;  1YCI A;  2HR3 A;  4GKJ B;  2NPS D;  1DLB A;  3N2K B;  1PL5 A;  1OZH A;  2ZE7 A;  4FK5 C;  2YKO A;  4JV5 O;  3CRC A;  1Y74 B;  1BGY H;  4NPD A;  2Y69 C;  4LF4 O;  1AJP A;  1KEC A;  2E75 C;  2OYI A;  1QCE A;  2ZYA A;  2R5D A;  1VMG A;  2DYR C;  2E5L O;  2H3O A;  1KB9 I;  1RPO A;  2HFE C;  2W0F C;  2H88 C;  3B77 A;  2YI9 A;  1IVS A;  3D6Z A;  3J81 N;  1Q86 W;  1W0K G;  4MTO A;  1ZL8 B;  2BCC H;  2IJI A;  3H1I G;  3LDC A;  2Q8V A;  3K04 A;  3L73 E;  1ZR2 A;  1N0J A;  4ZKU A;  4NXM O;  1SQB D;  3V5B A;  1UII A;  3B5N B;  3CC2 V;  4NYK A;  2RKL A;  1N73 B;  4GIF A;  1VQ5 P;  2QWN B;  1TGO A;  1WNS A;  2KOG A;  1BGY J;  2Y0E A;  3SGI A;  1BCC D;  1NBM G;  4MVS A;  3BPZ A;  4CH4 A;  3HE5 B;  3CCS V;  1NTK D;  4FZ1 A;  2Z5U A;  1QX8 A;  1V55 C;  3P3N A;  1GL2 C;  1HGZ A;  1YI2 P;  1PP9 D;  2IX7 C;  4PDM A;  1SQX E;  1K7D A;  4DV7 O;  1SQP D;  3RT3 C;  1H8E G;  2YKP A;  1GM9 A;  2ZM6 B;  5LMU O;  1DIP A;  3FB6 C;  3M99 B;  3DSQ A;  1P84 I;  1K73 W;  2PP6 A;  2OIG A;  1KQL A;  5AW2 B;  5BZB A;  2XUM A;  4MTG A;  4C7R A;  5LP6 C;  4WFG A;  3LDD A;  3RK3 D;  4DK0 A;  2KK7 A;  2KLU A;  1ZAU A;  3D70 A;  3JCU Z;  1KQS O;  1U96 A;  2ADQ B;  2Y69 B;  1ZUQ A;  1SQX J;  2WPD G;  3HUS C;  1JQ0 A;  1BCC J;  1IXM A;  3HD7 B;  4UB6 E;  3R2P A;  1S5L Z;  1TUB B;  1NI8 A;  1MSW D;  1SQQ D;  4JI6 B;  4HNA A;  2QM7 A;  2JWA A;  3C3S A;  1R6N A;  2WIT A;  1SZX A;  1R3I C;  2G3A A;  4PHZ A;  1XL6 A;  2Z0A A;  5IDJ A;  2HPC A;  2AHZ A;  1HR0 O;  1BHA A;  2VQF O;  5H9C A;  1ZV8 A;  4K8Z A;  4N3Y B;  3SJQ C;  4D7T A;  1YYC A;  4UB8 H;  2RN0 A;  1JCC A;  1X79 B;  4AI8 A;  4MVZ A;  4E2L A;  5JH7 A;  5B66 H;  2FY8 A;  1J5E O;  2EIJ B;  2QTO A;  2P7T C;  2AXC A;  2XAG A;  3H1H J;  3H1K H;  3E8H A;  2C0W A;  2B87 B;  1DEE G;  4WBN B;  3LIE A;  4ASV A;  1T2K C;  2IBZ G;  2Z3Y A;  3EFF K;  2Q7E A;  3SPI A;  4X65 B;  4J7J A;  1ZME C;  2QGN A;  2UXN A;  1KV4 A;  4AQR D;  2HLO A;  4WFE A;  5LOV A;  1LWU C;  2LFS A;  1VQ4 V;  3D36 A;  1GD2 E;  5GTI Z;  3MP7 B;  1S72 V;  1G2C A;  2LGW A;  5APW A;  1IC2 A;  1WN7 A;  4I4T B;  1RQV A;  1TU3 F;  1IBL B;  2QEX V;  1FFX B;  5AVR B;  2EBO A;  2F43 G;  2FL4 A;  4IL6 E;  1GN3 A;  2CUG A;  4ZNC A;  3Q2Y A;  1VQ8 P;  3MHH C;  2B9B A;  2ZXW C;  5LP6 B;  1OVU A;  4K3A A;  3LW5 H;  1SET A;  1EXJ A;  2P4K A;  3L71 D;  5BU8 B;  3BA9 A;  1TUB A;  2A3Q A;  3E8B A;  3L71 J;  4KFM A;  3ZMZ A;  3RVY A;  4H13 C;  4BWN A;  3HKC A;  2Q4P A;  4ZKP A;  1KTM A;  2DE0 X;  3KZI Z;  1JMK C;  4TSF G;  2JEX A;  1VQN V;  2ZD9 A;  4DV3 B;  4DV4 B;  5F2V O;  1FZF A;  2WSC J;  1ZN5 A;  2BSK B;  1AVM A;  3N2G B;  3MHV A;  3JSV C;  4JI8 B;  4R8C A;  2YSU B;  3QTC A;  3VMX A;  3CJH B;  3W7W A;  1VF5 D;  3VBB A;  4FLZ A;  1IBK B;  4OVN F;  1VQP P;  1FZC B;  1WAZ A;  1KQG B;  2XKM A;  3CJH A;  1Q2N A;  3IFM A;  4UB8 E;  5AG2 A;  1P7G A;  1N7S A;  3S4R A;  5EFW B;  1J1D B;  1KYO E;  2QM4 A;  1N36 O;  3NFQ A;  3RL0 B;  5KLV D;  3B40 A;  4H0L D;  2UUB B;  5IWA B;  3H1H D;  2YO2 A;  5EZY A;  3C1L A;  1AI5 A;  3GMA A;  3II6 A;  1P84 F;  1S5L X;  3A7O A;  1VQ9 P;  3BEH A;  1NH4 A;  3L74 E;  4CS4 A;  3LSS A;  4TT3 G;  4XBF A;  1L0N J;  2C0X A;  3CX5 I;  4TV8 B;  1N73 A;  2A45 H;  2YIB A;  3E2E A;  1SQV K;  3V2R A;  4JI4 O;  1A02 J;  3CC7 V;  4BR6 A;  3AEA C;  1Y4M A;  3AG4 B;  3F7Y C;  3FB8 C;  5FL7 G;  3WFV A;  5CJ4 A;  4U7O A;  3M8A A;  3CCJ V;  4FMT A;  4JI2 B;  4GX0 A;  1N7L A;  5J9P C;  3L36 A;  3TXQ A;  3VMZ A;  1U57 A;  1DGS A;  4WY4 C;  4LF7 B;  1NO4 A;  3U1A A;  5KAI E;  4BRY B;  1S5L E;  3JD0 A;  4DR3 O;  5B1N A;  4EFB A;  1Q3E A;  1BMF G;  3OMI B;  1KIL D;  1RE3 C;  3AE1 C;  4H13 B;  5AW5 B;  3GG2 A;  4U3F D;  1AI6 A;  3HR0 A;  2OTJ V;  2DYS C;  3V2Q A;  3S3X A;  2WWW A;  4LNU B;  1J1E C;  4U3F E;  3T1C A;  5KAF Z;  2E5T A;  3B8M A;  5CCH C;  1MMM A;  1YEW A;  5B66 Z;  1H2S B;  4LF4 B;  3ZN0 A;  1MUU A;  4QPK A;  3AEE C;  4KP4 A;  1IBL O;  1L0L E;  3L71 H;  5JH7 B;  2Z5I A;  3Q4H A;  4J7Z A;  3OEE G;  2JWD A;  1WA8 A;  3H1J G;  1K73 Q;  1XNQ O;  4JPZ B;  4DUY O;  1H0T A;  1K5S A;  1XOU A;  2N05 A;  1F51 A;  4DR2 O;  5E79 Z;  1UPG A;  3AE7 C;  2M5A A;  2AZ0 A;  4DXW A;  1XHX A;  5IYZ A;  2JDI H;  2JJ1 G;  1QLN A;  5J2T B;  1JY2 N;  3H1L J;  3WU2 H;  5BVZ A;  1IX9 A;  5GON A;  2PZS A;  2FML A;  2R5B A;  1R6K A;  2YXY A;  2EIN B;  4KL1 A;  5APT A;  4PD4 F;  1YJN V;  1FC2 C;  3A0R A;  4NTY A;  4ZKI A;  2B1I A;  4U7N A;  3TCU A;  1KD1 Q;  1FOS E;  3A8T A;  1IO4 A;  4BW9 A;  2AZ2 A;  1VQO P;  3APQ A;  2YS8 A;  1RF0 C;  1T6A A;  1WA8 B;  2Q6A A;  1EN6 A;  1SES A;  2PUS A;  5KLV E;  4BWA A;  4O4J B;  2Y0D A;  5APV A;  3BA8 A;  4XFJ A;  3ASN C;  4DUZ O;  4PJ0 Z;  1RH5 B;  4X1I B;  5EC2 C;  2KSJ A;  3FX0 A;  4DR4 B;  1FJK A;  1NU1 K;  2AW9 A;  4CH5 A;  3L70 E;  3MTU E;  1YTF B;  4WFH A;  2R32 A;  4FZ0 A;  4JV5 B;  5J2U A;  3CC4 P;  2IYP A;  3FGA D;  3CEI A;  2EUL A;  3L75 E;  3KCY A;  2QKC A;  4W4L A;  1S5H C;  2EIM C;  2L6L A;  2R3S A;  1JY2 P;  4TUY B;  2QSA A;  2RNB A;  4PD4 D;  1FXK A;  2AEF A;  2ITA A;  1O9G A;  4IT5 A;  5LGN A;  1NH2 B;  3HPL C;  4H44 D;  4PA6 A;  3G80 A;  5LHH A;  4G27 B;  4MVO A;  2YC0 A;  1GK9 A;  4XDL A;  1R5S A;  3T1H O;  3ZDM A;  3L71 E;  1IFM A;  1KQF B;  3CPW O;  2KP8 A;  4UV9 A;  2ZXX A;  3E8G A;  2E3C A;  3K03 A;  1JOC A;  4C46 A;  1QGK B;  1YQ4 C;  2YIU B;  3AK3 A;  1HDJ A;  1I94 B;  1PKX A;  4LP8 A;  2WSF J;  5GTI H;  1PZQ A;  2ZKO A;  2PI5 A;  3CX5 F;  2IU3 A;  2YDE A;  3GF3 A;  3A0H Z;  4TT3 H;  3HKD A;  1EZJ A;  1CI6 B;  1XNR B;  2ZE6 A;  4K35 A;  1M93 A;  2KLV A;  3CME P;  1HNW B;  5CBG A;  4MS2 A;  2WSE H;  1NZ6 A;  1PPJ H;  3VOU A;  2MK3 A;  1N7S B;  5CBH A;  4LFC O;  1T2K D;  1YSC A;  4K8X A;  4O4H A;  1BE3 D;  4J42 A;  3AK1 A;  2Y9Y A;  1XMO O;  3RYC B;  4OPA A;  1NR7 A;  3STL C;  1PP9 E;  5KAI Z;  1M5I A;  1CZQ A;  1R3L C;  4CBC A;  3JCU E;  3FXD A;  4EIJ A;  2O01 J;  2ADP A;  5J2U B;  1FPO A;  1UFI A;  1TA8 A;  3GB7 C;  3QO8 A;  4DV5 O;  3L75 H;  1WMK A;  1DK1 A;  3MGN A;  1KZU B;  2FYU H;  4X62 O;  1SQP G;  2IW5 A;  5KAF E;  1XRE A;  3M0D C;  4WWI A;  4MVQ A;  2IFM A;  3GHG B;  1AQT A;  1L0L K;  2YI8 A;  4JZG A;  5KX5 A;  3K59 A;  2K9J A;  3RL0 D;  2JGD B;  2MKV A;  2R3C A;  3JSL A;  1K8A W;  5B1B B;  1HTL C;  1T3J A;  2W8Z A;  1Q6I A;  1SFC D;  3RYF A;  2YMY A;  1P84 D;  1MZ9 A;  1GTO A;  1KKD A;  3H1K J;  3BVH A;  3AEG C;  3H01 A;  2QEX P;  4K0K B;  2QJK C;  4DV0 B;  2IBZ I;  2E76 B;  2M3E A;  3LID A;  5JQG A;  1KB9 F;  4DYL A;  4J41 A;  3TGU H;  2GUV A;  2QWP B;  2F4V O;  5EBW C;  3RWR D;  5BR8 B;  5LOV B;  4J80 A;  4PDR A;  1XMO B;  3CCM P;  4MN4 C;  3W7X A;  1PFI A;  3H1I J;  4J9Z B;  4O4H B;  2ZT9 C;  1LUV A;  4LF8 B;  1GDT A;  2P1J A;  5KKZ C;  5IWA O;  3H32 A;  1I0H A;  2HOD A;  3FXE A;  3PP5 A;  1FU1 A;  1R5L A;  3Q4H B;  1E79 G;  1NU1 H;  2BE3 A;  5LMU B;  2OQQ A;  1Y47 A;  2Q3I A;  1BCC E;  1N7S C;  5APU A;  2YKQ A;  5CA1 A;  3U11 A;  4PV1 C;  3L72 E;  3LSQ A;  2LR2 A;  2XAQ A;  1FJG O;  1N34 O;  4I5S A;  1URF A;  3L9D A;  1KMI Z;  1OW6 A;  4IYH A;  2WT7 A;  2HPC B;  3RW0 A;  3CP1 A;  3RYH A;  3WU2 Z;  4JI0 B;  3ZS8 C;  1ZRT D;  2ZIM A;  1WP8 A;  1FS0 G;  1F4N A;  2WPR A;  4RUE A;  2Y9Z A;  3HD7 C;  4HNA B;  1PPJ G;  2CK3 G;  4DV4 O;  3UT5 A;  1VQK P;  2KSD A;  3CXH F;  1S1C X;  3USS A;  4R50 A;  2QJY C;  3OMA B;  3D36 C;  4YTP C;  4ICG A;  2UXC O;  3DGE A;  2P06 A;  1TVK A;  1O9H A;  5CBF A;  1JEK A;  3QNE A;  1Y6X A;  2PTM A;  4YXW G;  1OV9 A;  1BE3 E;  4NB5 A;  1JY3 O;  3CS5 A;  4P30 A;  1WLE A;  4LFB B;  2WSS G;  2ETN A;  1HP8 A;  1KP3 A;  3VYI A;  1S4X A;  1Q82 Q;  3ZRW B;  4TQD A;  2PFX A;  1R3J C;  4I0X A;  3I55 V;  3T4D A;  1Y74 A;  3AK2 A;  1FXV A;  3ZRW A;  4X89 A;  1L4A D;  1NU1 J;  5E79 H;  4I9W A;  4O4J A;  1Q81 W;  3IN6 A;  2BOC C;  3JAM N;  1UIX A;  3VMY A;  1LR1 A;  3L75 J;  2IBZ E;  4BAY A;  4DRX A;  1NU1 E;  3JAL B;  5TIS Z;  1JTH B;  1NS1 A;  3GWO A;  1QR8 A;  4FFK A;  1VQL V;  3PHL A;  1YDX A;  2P58 A;  3SYC A;  4JAU A;  1JY3 N;  4GCZ A;  2I8D A;  1SS3 A;  2IU0 A;  4PA3 A;  2Z5H A;  4C7N B;  4DOJ A;  1BSM A;  4JYA B;  3UT5 B;  2IYO A;  4N78 E;  4QE7 A;  1YTZ T;  3E22 A;  2HVJ C;  4ZBM A;  4YXW H;  2IJK A;  3UQ8 A;  2FYZ A;  5B5E H;  5EYP B;  1NTZ H;  1L2P A;  3FYE B;  3ZCC A;  4UCS A;  3OUF A;  4I9Q A;  5LA6 A;  1XNQ B;  2E5Y A;  2ZYD A;  3OW2 O;  1KC8 W;  3L35 A;  2W0X A;  3OJA B;  1MFT A;  1VQL P;  1BS3 A;  2UUA O;  2JR8 A;  3WUV A;  3ABL C;  1F23 A;  1V55 B;  3CD6 V;  3H1K E;  2F93 B;  1B6Q A;  2ZE5 A;  1K33 A;  1QVG U;  1K3E A;  2KIK A;  2Q68 A;  1G8M A;  1IFP A;  3CX5 D;  3I56 V;  1PL0 A;  3JAR B;  4FLY A;  3D8C A;  2XU6 A;  3JYC A;  1BGY G;  2VWJ A;  2QKS A;  5JCO A;  5LYJ B;  1OCR B;  1FZE A;  1OMI A;  3WUU A;  4QPJ A;  3RGU A;  3WB1 A;  3Q5S A;  3JD3 A;  4LNU A;  1S9K E;  3ZED A;  1CEZ A;  3CME V;  2ZIN A;  3BVO A;  1K4D C;  5JQG B;  2FKW B;  5L8R J;  3S1K A;  5LHG A;  3PRJ A;  4H0L C;  2BCC G;  1KUQ A;  3H1I H;  3CCU V;  3RYI A;  5IJ0 A;  1L0N G;  5JJN B;  1XTC C;  3JCU H;  3CC2 P;  3IAO A;  1FZB A;  2GA1 A;  1AR1 B;  2ATK C;  2YEV A;  3M9B A;  4JYA O;  1OCO B;  3BCC H;  1M56 B;  4D6T H;  3FB7 C;  2YIA A;  3IC9 A;  2OGU A;  1HNX O;  1GM8 A;  5IYD O;  1NTK K;  2V4H A;  4UCT A;  1KKC A;  2HEP A;  2H94 A;  4JI7 B;  2CGO A;  1EXI A;  4UVC A;  4QMA A;  3V4Q A;  4J11 A;  2FYN C;  1S2E A;  2ZM6 O;  5H2F E;  2RQ6 A;  3HKB B;  3K5L A;  4R4M A;  1NYH A;  1YBK A;  4B3M B;  1W2B O;  4NKG B;  1IFD A;  1NTM G;  3F89 A;  3VQV A;  2RMK B;  3UM7 A;  3JCZ A;  5EBM C;  1RP3 B;  1IJD B;  1Q7Y Q;  5C8Y B;  2VS0 A;  4HAM A;  4GLX A;  3CCQ V;  3AE8 C;  5C93 A;  1DTO A;  4YJ2 A;  4IL6 X;  1K9M Q;  3U1C A;  3ML0 A;  5EBL C;  3VTP C;  2UUC O;  1WP7 A;  3D3Q A;  4MVR A;  4U3F G;  1YJW P;  2CTR A;  3L72 J;  1SFC B;  1Q5O A;  1OCR C;  1CXZ B;  1OHH G;  4FLT A;  2LJ2 A;  4HYT B;  3RN4 A;  1L0L G;  4O9B A;  2LW7 A;  2W27 A;  2Q0O C;  1PNK A;  1N86 A;  3U0Z A;  2O1K A;  1JY2 O;  2A7W A;  3FAV A;  4MVU A;  4DT0 A;  3M0D A;  5ITZ A;  3JC2 2;  1BE3 H;  4TQF A;  1KP2 A;  4MVM A;  4B3R B;  1QL1 A;  3FKS G;  2ILM A;  3X2Q C;  3C9I A;  1FFX A;  4WBA A;  4DR5 O;  3PJS K;  1URQ C;  5DJU B;  1YJW V;  4I50 A;  4U7J A;  4FJC C;  1N4C A;  1SQX D;  3A0B E;  1PNM A;  1USD A;  2HP8 A;  1M56 C;  3QVN A;  4DV6 B;  1XMQ O;  1XBL A;  2ZVN B;  2PAJ A;  2HOD B;  1NVO A;  5IJ0 B;  2XZR A;  3CRA A;  3J80 N;  3VQW A;  1I7F A;  1JOY A;  3Q1M A;  3VMA A;  1JMB A;  3T1Y O;  1AB3 A;  2WLL A;  3SJB C;  4DW1 A;  1S3J A;  3LSU A;  4HYO A;  4X20 A;  1LWU B;  2GBO A;  2A06 D;  2XDJ A;  2M7W A;  3E7K A;  4PA4 A;  4LCU C;  5JVD A;  2J5U A;  5IYB O;  5H2F H;  5BU5 A;  2QE7 G;  4TWK A;  1SQP J;  3TNU B;  4TV9 B;  4KXR A;  2QIW A;  1OVR A;  1PGJ A;  4WBN A;  2WMM A;  4XDK A;  1FBM A;  1JR9 A;  4DJG A;  3UKM A;  2O01 H;  2ZXW B;  1FJG B;  1URQ A;  5L3G A;  1NTK J;  1VQ7 V;  3M9Q A;  1R3K C;  1LT9 B;  2JGD A;  2JS3 A;  3I5D A;  4R4L A;  1OWA A;  3TDK A;  4WVZ A;  1RSO A;  2Q0A A;  2XAH A;  2GSM B;  2WZ7 A;  4HKZ H;  2YIU C;  1VQN P;  1G6U A;  4O2A B;  3ZHQ A;  4IFD K;  3OTO B;  3O6Q A;  2KXP B;  5CMZ A;  3IGA C;  1NWQ A;  3ABK C;  1F4M A;  4DR7 O;  4Q6G A;  2EJR A;  3HD7 A;  1AJY A;  5LGU A;  1SA0 B;  1SP4 A;  1U7M A;  1FDO A;  2NPS B;  1H2G A;  1QU7 A;  1YIT V;  3ZX6 A;  4CC5 A;  1AI4 A;  5EK0 A;  4B86 A;  3BY6 A;  2JDI G;  5LXT A;  3BAT A;  3C3T A;  2DN9 A;  2FTK A;  1URQ B;  4FLV A;  1EDK A;  2UXD B;  4L75 A;  4PJ0 E;  2VQE B;  1JY3 P;  1ORQ C;  1J1E B;  3V2N A;  3SPH A;  2YXH A;  3CX5 E;  4LFC B;  3FYI B;  2WPQ A;  2EIK B;  3JAW B;  2E42 A;  2K9Y A;  5H2F Z;  3K06 A;  5JVD B;  4YHH O;  3SWK A;  3AG7 A;  4PI2 A;  3E89 A;  2QWQ B;  1NR1 A;  2UUC B;  1KB9 H;  4X62 B;  3APO A;  2R9I A;  1EZV G;  4UFZ A;  2G8Y A;  4X1K A;  4JI4 B;  2WLN A;  1SQG A;  1KYO I;  5IY5 C;  5KUK A;  2C2A A;  3MZW B;  3CPW U;  4I7Z C;  2ZR3 A;  3HE4 A;  3CMA P;  3MD0 A;  1E5W A;  1LTT C;  4FFB B;  1M57 B;  2LQT A;  4LF9 O;  4UB8 Z;  4IHJ A;  2OIE A;  2LXB A;  4U3F H;  5K1P A;  2A45 I;  3UO3 A;  2FFD B;  1IFN A;  3ABM C;  2V7Q H;  1S5J A;  2CH7 A;  3W7U A;  3P30 A;  1L0L H;  4G2K A;  4FM0 A;  2GUZ A;  2LW1 A;  2P90 A;  2FXO A;  5AVT B;  2WAM A;  1NKN A;  1JPX A;  2OYI B;  3MHS C;  2GUS A;  3K5N A;  4JGS A;  5APS A;  3SFE C;  2V1D A;  3CMA V;  4EB6 A;  4LFA B;  1Q43 A;  1SLQ A;  3L73 J;  5BY1 A;  3H1L H;  3CXH D;  3B71 A;  3RL0 C;  5B1A B;  2WLK A;  1I5Y A;  3BRC A;  3T97 A;  5KKZ B;  1SQV E;  4DR1 O;  2YIC A;  3DC5 A;  1OCO C;  5HFM A;  4ASW A;  5CBO A;  2UU9 B;  1M1J A;  4IFM A;  3T4Z A;  3N2G A;  1QEX A;  4YJ2 B;  4IL6 H;  3AE6 C;  4JAV A;  3CSX A;  3E86 A;  1DH3 A;  3Q5R A;  2YIB D;  4PI0 A;  2E74 D;  3IR9 A;  1N2D C;  1OJH A;  1X0T A;  1NAF A;  1JJ2 U;  5KAF H;  4OPH A;  2EZO A;  1AV1 A;  4H37 A;  1EN4 A;  4LC1 A;  2A06 G;  3DXR B;  2JEU A;  2OCC C;  3ZIA G;  3BAB A;  3B2E E;  2OAR A;  2DWD C;  3JAT B;  2E75 D;  3G3Z A;  4YIP A;  4LF5 O;  3M7M X;  1M4U A;  1N73 C;  3L72 G;  1IZN B;  1GRJ A;  1EN5 A;  4O2B B;  4OX9 O;  2BOB C;  2LFR A;  4I7Z B;  3P3P A;  3BRT B;  4QIW F;  5L3E A;  5H6R A;  4F4L A;  3IC7 A;  1GU5 A;  3ZJZ A;  1KIL E;  4RO0 A;  4DR6 O;  3AEF C;  1RY3 A;  2OTL P;  1NTM K;  4TV9 A;  4PD4 E;  5APX A;  4XDJ A;  1G2C B;  3GWK C;  5L3F A;  5H5N A;  4KUM A;  3L75 D;  2DYS B;  1PPJ D;  2D2C D;  2EIK C;  3SYO A;  4DR5 B;  5DEC A;  1DD4 A;  4P9P A;  1RF1 A;  1NTM J;  1M90 Q;  2E76 D;  1OCZ C;  3K5B A;  3R4Y A;  3S9O A;  5GTI E;  3RBZ A;  1PGP A;  5AW6 B;  2OYI C;  1YTZ I;  2ZDI A;  4R7C A;  1FXH A;  2OTK E;  1EZV I;  1PP9 J;  3Q5P A;  1QVG O;  5APQ A;  1GW3 A;  4X8A A;  3HTK B;  4RWU A;  4AQY O;  1SF9 A;  4I50 B;  4PA9 A;  3CRM A;  3HUS B;  2P67 A;  2PGG A;  2ZNI A;  3KQG A;  4GT1 A;  1EFR G;  3H6P A;  4J7K A;  4I6M C;  1N8R Q;  5AW7 B;  4JF3 A;  1P84 E;  3CCQ P;  2DOS A;  4O2B A;  5ITZ B;  3FAV B;  3BCC G;  3HKD B;  2IZ0 A;  4TV8 A;  1SQB J;  4D6T G;  1EBO A;  3TJT A;  1H8A A;  5IJ9 A;  4JQ0 D;  1HH0 A;  1EZV D;  5LA6 B;  1NT2 B;  2PF4 E;  3KHU A;  2DW4 A;  4DK1 A;  2WLJ A;  1IFI A;  5AVU B;  3BCC J;  3WMM 0;  4D6T J;  1BQZ A;  4GKJ O;  2EX3 A;  2OYQ A;  3PH0 A;  4Y99 C;  5EZY B;  2ITD C;  4PJ0 H;  2EIJ C;  2HG5 D;  5B66 E;  3QF7 A;  4YJ3 A;  1M7L A;  2QM8 A;  3FX7 A;  4P2Z A;  3MUD A;  4MW8 A;  4JI1 O;  3H1J J;  1COW G;  4PD4 H;  4D7S A;  4JTC B;  3F5H A;  1NH2 D;  2XHB A;  4DV7 B;  3Q3D A;  2A06 H;  2ZIO A;  1FZC A;  4TUY A;  2KS1 B;  2WPS A;  3S3W A;  2FXM A;  1RE3 A;  3AG3 B;  1OCZ B;  2XNX A;  5DN6 G;  1F7Y A;  5CBN A;  1LP1 A;  4GOF A;  4N21 A;  3QO7 A;  4I0X B;  2WSS H;  3SFD C;  2OYH B;  3RK2 C;  3LDE A;  5CCH A;  4GOD A;  3EXA A;  2KUB A;  4H0L B;  2WLM A;  2O1J A;  4Z1M H;  1VF5 C;  3T1Y B;  5FLX N;  4CPG A;  3H9V A;  4UVA A;  2X6B A;  1RE4 C;  1MKM A;  3CCL V;  1VF7 A;  1RFY A;  2OWO A;  1AVO A;  1IBM B;  2E74 B;  3ABU A;  1RQU A;  1U97 A;  1AR5 A;  2W6J H;  1N0N A;  2HYN A;  4CS2 A;  2CK3 H;  2ZVO B;  1HF9 A;  2F4V B;  1KIL B;  1R73 A;  1AVY A;  1SQQ G;  4H13 D;  3TGU G;  3THO A;  3E1I A;  2XAJ A;  4X1K B;  1VQ7 P;  1VQ4 P;  2XAS A;  2EIL B;  3OUS A;  1L0N D;  4WB4 A;  3SJC C;  3KZI E;  1D5A A;  4DUZ B;  1L0L D;  2WA4 A;  4LFB O;  3L70 H;  4RKU J;  2Q5U A;  2DMX A;  2W6A A;  2B89 A;  4R6Z A;  4ZOL A;  5JJJ B;  3CLQ A;  3K0D A;  1VQ8 V;  3SSU A;  1BDD A;  3N2K A;  3AE9 C;  3W7S A;  1YJ9 P;  1QQC A;  2G38 A;  1G1I A;  1VQ6 P;  4HBN A;  1L0N H;  3RFR A;  1RE4 A;  1ZRT E;  3VP8 A;  3A3Y B;  4ZI7 A;  5BMV B;  3L74 H;  4U3J B;  4LF5 B;  1SQX G;  1NTM E;  3O65 A;  3A5T A;  4DV5 B;  3STZ C;  3H1I E;  1SA0 A;  3L73 G;  1G4Y B;  2RJZ A;  4NTX A;  4X64 B;  2HHH O;  4ZOL B;  5KHJ A;  4JTA B;  4GX1 A;  1N34 B;  2RN9 A;  3E22 B;  1QHT A;  1I08 A;  2WLI B;  1N8R W;  2H43 A;  2KNC A;  1OCC B;  3K79 A;  1H88 A;  1PGO A;  1XL4 A;  5AVW B;  4WY4 B;  3JAK B;  3K0G A;  3JAS B;  2PYL A;  1M57 C;  4UXN A;  5L3C A;  2E74 C;  1S72 P;  1FZA A;  2LXC B;  1B06 A;  2GTS A;  4OGQ B;  4AIL C;  1AJN A;  2KG7 B;  3VN0 A;  3UCS C;  2K9J B;  3A0B Z;  3WU2 E;  3E83 A;  4O4L B;  4JYC A;  1X59 A;  4EKW A;  2D3O W;  1WPB A;  2Q1K A;  4DR4 O;  1BL8 A;  2BAS A;  2I1K A;  2OCH A;  1LWU A;  3K9S A;  4JI5 B;  2YO3 A;  4YXD C;  2QA4 P;  3BFR A;  1YHQ V;  2IH3 C;  1THZ A;  5KMG A;  2QSI A;  2ZDI C;  2ZFC A;  2IDB A;  2OTL V;  1RM1 C;  3CCJ P;  4JPR A; 
#chains in the Genus database with same CATH homology
 2QJY C;  1R8E A;  4H0L B;  2WSF J;  4R4L A;  4YTP C;  4Z1M H;  1U57 A;  1VF5 C;  3GF3 A;  4TT3 H;  3RL0 g;  2E75 D;  1MKM A;  2YIU C;  3T97 B;  4OGQ C;  3ABV C;  3AE1 C;  2E74 B;  4H13 B;  4I7Z B;  2E75 B;  1RQU A;  2QJP C;  3O6Q A;  1EXI A;  3GLM A;  1PL5 A;  1ZME C;  1HF9 A;  2FYN C;  1KIL E;  5M1B A;  4KT0 J;  1AJY A;  3AEF C;  2NZ2 A;  4H13 D;  1FDO A;  2WPV B;  4R4M A;  1NYH A;  4H44 C;  3AEE C;  2E75 C;  1ZP0 C;  2D2C D;  4RKU J;  1GMJ A;  3AEC C;  1RQV A;  2H88 C;  1TU3 F;  2JP3 A;  1DD4 A;  2O01 J;  3D71 A;  1NGM B;  2FBW C;  1Y9B A;  2E76 D;  2BEQ D;  3Q2Y A;  3AE8 C;  3AED C;  3IN6 A;  4IL6 X;  4Y28 J;  3D6Z A;  1UIX A;  3R4Y A;  3AE9 C;  2YMK A;  3S9O A;  1ZOY C;  1OW7 A;  1WMK A;  3AE7 C;  1EXJ A;  2K9Y A;  1ZRT E;  3Q5P A;  2D2C C;  1Q90 D;  4PV1 D;  2H89 C;  2MKV A;  4H13 C;  2G8Y A;  1KTM A;  2D2C B;  1IK7 A;  3H25 A;  1HJ0 A;  2FXP A;  4I7Z C;  3AE4 C;  3AEG C;  2QJK C;  3AE3 C;  2WSC J;  1YQ3 C;  2E76 B;  4OGQ D;  2JO1 A;  5KLI C;  4XFJ A;  1VF5 D;  3AEB C;  1DIP A;  2P10 A;  4U7J A;  1KQG B;  1OW8 A;  1PV3 A;  3GF7 A;  4PV1 B;  2E74 C;  3LW5 J;  1DD3 A;  3AE5 C;  3SFE C;  2ZT9 C;  4OGQ B;  3RK3 E;  5KKZ C;  1JB0 J;  3FGA D;  4H0L D;  3Q1M A;  3D70 A;  1K05 A;  3EWK A;  3GMA A;  2OQQ A;  1FDI A;  3AE2 C;  1OMI A;  3B71 A;  4H44 B;  3D6Y A;  1S5L X;  3Q3D A;  3Q5S A;  1KOR A;  2J5U A;  4H44 D;  4PV1 C;  3C8V A;  2ZT9 B;  1VF5 B;  1KMI Z;  1VL2 A;  5L8R J;  1OW6 A;  1K04 A;  2QIW A;  3AE6 C;  4H0L C;  4YXD C;  1KQF B;  4GDO A;  2QSI A;  2BEZ F;  3G9R A;  2ZT9 D;  3Q5R A;  2WSE J;  2E74 D;  2IDB A;  2G3A A;  1YQ4 C;  2E76 C;  3AEA C;  2WQY C;  1PIX A;  3IAO A;  3SFD C;  1S1C X;  2V7Q J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...