4OGYH

Crystal structure of fab dx-2930 in complex with human plasma kallikrein at 2.1 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
219
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibody
molecule keywords Plasma kallikrein
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 219
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogyH01
5HHME 1QRNE 1F2QA 4WU5B 3RX8A 5D7JA 1HK6A 3I3EA 4NBXB 3QFJB 4QO1A 1CLZH 3OR7A 1GOGA 4WV1B 4JKKA 4PJEF 1MAJA 5EBMA 1CE6B 1T0MA 1AGDB 1PSKL 4ZFZB 2YKLL 4Z77B 1WBZB 1XF2A 1ES0B 2HT4C 3ZTJH 4XCNA 1I8IA 3LKOB 5DFTA 4N8CL 4AEIH 2R9HD 4EVNB 4HIXL 2AI0L 5JPMB 1BAFH 2EDLA 3KPOB 1KGCD 2V5RA 1A3LL 4GBXC 3GSQA 5IB4A 3B2UC 2XN9E 4LPVA 3WIHH 3H7BA 1UZ8A 5I30H 1DQQA 1RY7B 2YUVA 4HUWB 4PJGB 1MREH 5F7HA 1G9MH 2OJEA 4HGWA 1QHOA 2OSLB 3G5XA 3NA9L 5TQ2H 3P73A 1LEKA 1S78C 3I6GA 5GS0L 3ES6B 1A47A 2VLKD 1UYWL 4MB3A 5FYJE 5JW5B 5DI8B 3CH1A 1Z5LA 3G6JA 1IEAA 2R0WL 2Q8AH 2DBJA 4FXGA 4APQC 4YHOL 2EDJA 5EOQH 5IVXF 2UYLB 5F3BA 1FG2A 1OGTB 3BIBX 3QCTH 5DHVA 3AC0A 3NCBB 4N0YH 2GAZB 3FRUA 1ZTXL 1G6RH 3C08L 4DW2L 3AB0C 2V2XA 4GAJH 5GS1C 2YWYA 4YNYB 3PWNA 5GRYA 3QFDB 3RTQA 1TXKA 1NFDA 5BRZD 4C57C 4I48B 4HSQA 1A7QH 3S8WA 1GHFL 1KFAL 2VNCA 4YJZL 1EJ6A 1D9KA 1CXKA 3RWFA 2Q6WB 4I77L 1ORSB 4GW5A 2VLJA 5F1IA 3FO2B 4HK3J 2Y25A 3CXHJ 3BQUA 1FNAA 2Q7YA 5E94A 3SDDD 3L5WA 5TE6H 1FVEA 2G2RB 4PRDB 1HHGA 1IBGH 3MRJA 5EUOB 2YK1H 5JA8B 1J7VR 1MJ8H 4V1DA 2YPLA 3U7AA 2HMID 4O02L 3LIZL 3BDYL 5F89B 2A73B 3QWOB 4J3TA 2A83A 5EULV 5C0CD 1PG7H 2FDBP 3GSXA 5IR1A 3UC0L 3R0MA 2HFGL 3O6LH 4OI8A 3BXNA 4WY7L 1BF8A 4Y4FC 5HVHC 1KCSL 5ESAA 4HAFA 4FQJL 2RR3A 2FGZA 1BIHA 3S88H 4KGJA 4YDLC 5DO2D 3HC4H 2VXQH 3Q6FB 2JCCE 1RK0A 4OAWA 5T3XL 1FNFA 1BVLA 1XH3B 3ARFA 1R5IA 1KJ2H 2GTZA 2AEIT 3HC3H 2NNAB 5CS7A 4H1LB 5J6HA 5EZOL 4H8WH 4YR6B 5ALCH 4PBXA 8FABA 4N0UE 4X7FC 4HJ0D 3ZE1E 3QRGL 4HIEB 1F4YH 4BFBD 1DTUA 3SDXB 5IROC 4OJFL 5I1GL 5ENWA 1J11A 3UTSB 3V0VB 4PJCE 1N0XL 3DX6B 3UPRB 1N59A 3R4DA 1EAPB 2HRLA 4HKZA 5DF0A 4DGIL 5IOPB 5EO1A 1NC2B 1QFUH 4R4BB 4H0GA 3ULUL 1S7WB 2BK8A 4IM8A 3VH8G 1XR8A 2PO6A 2QL1A 2IGFH 5D5ME 3DIFA 3QDJB 4PG9A 2VWEC 1BIIA 4HWUA 4MDJA 3B2VH 4ODXB 1IL1B 4FQXA 4KUCD 3RIFK 3GJFK 3OXRB 3PIQB 2PCPA 3TVMC 1WVZA 3CFCH 1TFHA 1ZGLA 3DTXB 1BQHB 1QSEE 3T77A 1EXUB 3PE9A 1J8HA 2DQTH 4YFDB 4ZAKB 4XMPH 3GMLA 1KIRB 5HHOD 4D94A 1BFVL 1LP9B 2VDKH 2ZOKB 1BQLH 1IGFL 4NFBA 4YHKH 1IKNC 2DKMA 3JV4B 1BJ1J 3P2TA 5FCUH 4LMQE 1MCBA 4IDJL 1DQML 2JJTC 3TBVB 3RWCB 4PJ8A 4QTIH 3RU8L 4D9LH 5EBWB 1C5BH 1MVFA 1MAKA 2EZ0C 4MAUL 3PQYB 5D71H 2ESVD 3I6LD 3TPUB 4NO0D 3PGFL 5DURD 4CNIB 1L7IL 2HTKD 3AAZA 1MCWW 4M6NH 2GSGB 3RVWD 1XGPA 4BH7A 4LHJB 3ULSB 2IANB 5FHAL 3ARDC 3MLYL 4BFEA 1T5WB 4M8VA 1KN2H 4XAWH 2Z8WC 1JRHL 2RFXB 3EOBA 5GS2D 4TVPE 3TIDB 2XTJC 3NAAL 1KELH 2ICWB 2VE6B 2EDHA 3QUYD 3SGJC 1CGVA 4UQ2A 4OD3L 5FM5M 4RDQG 3FT2B 1M7IA 4GT7A 3QDME 5C9KA 4ZO8A 3NABL 3QXTA 4ODHL 3ARBA 4X6CB 3S96B 4L3EE 1XGYH 4XCYA 3TGXA 3PWJB 2EDTA 3DV4B 3C8HA 1FAIH 1G0XA 4JKLA 1A7NL 1A6AB 2BC4B 3EO1B 1X7QA 4JO2L 3BGAA 3IDMA 5CEZD 4XNMB 3GSUB 1MWAL 1F3JB 5IFJB 3VFOA 1G7QB 3OPZH 4OV5B 4ZSOA 1TZIA 3MRBB 3TNNB 5E99H 4QHNA 1T1WA 2ORBL 3IDJA 1LD9B 3I02A 2BNUA 5C07B 4Z8FL 4HH9B 3MYJB 4NUJB 4OLZL 4FQQB 3C60B 4F3FB 1FVDA 1AE6L 3X14A 5MEOA 2DQJH 3QO1A 3QG7L 4M6AA 3BKCL 3ZZ1A 4KVNH 1K2DA 4Y16B 5ID1B 4XPHH 5DQ9B 4HGMA 5FM5O 1B4RA 3VCLB 4AZ8A 2DQUL 3VXSA 2XN9B 5IG7B 1A9EA 1A1NA 3TH3T 2VZSA 2D31B 3MV7D 1B6UA 4LASL 1X6LA 4P3CH 4NSKB 4LHQB 4G43B 5FA3B 2XQBH 5FYKU 4R7NB 2E6QA 2VABA 4B7IA 1MAML 1NC4B 4NQXA 3FT3A 3S37H 4Y4KA 5JA9A 1RZIB 3Q3GA 1JNNL 4U0RB 1NCCH 3BI9X 1EA9C 3VFGL 4XP9H 2HKFH 3CC5B 2F53B 4UI2A 2A1WH 1A2YA 4YIQA 3VWJD 2GK0A 4DKFH 2H1PL 4J23A 3GJEB 1MRDL 1RJYA 4F7MB 5J12B 3QA3A 4YHIA 2R15A 3S3SA 4IOFC 1S9XB 1HHJB 3CUPB 2PTTB 4XBPB 1RUPL 3O3DB 3RJDA 3HCVA 2ADGA 4C58B 2MMXA 1A6WH 2Q86A 3MRDB 5D7KE 3AXLB 4LGPB 1QUNA 3CLEL 1KTLA 2V7HA 1JF5A 1WTLA 4QRRD 4FNLH 4L3AA 1ZVSA 2ILLA 4JDVA 4LLWB 1JV5B 4XWOD 4U1GC 3OJDA 3DRTB 4OBRA 2QJDA 4QRSB 2GSIA 3UPAA 3SOBL 3VFTA 4PGDA 3QUZC 3WIFB 2OK0H 1SYVB 1Q9KA 5BO1L 5IHZB 2P8MB 1KULA 2DDQL 2QQNH 2QQLL 4XVTL 1H9VA 1JYWA 4HQQL 5DJ0A 1MHEA 4QXGL 5KSUA 3SDCD 3SE3A 4RFEB 2EH8L 4P2OB 4TSBL 3GRWH 1YPZF 4PLJD 3MCKB 5EIIA 3BJ91 1OWRM 2W9DL 1GGYA 5AZ2H 4FFYH 4YAQA 1CF8H 5B39G 2F19L 1ORQA 5C09E 3OX8B 4KJPC 4HW6A 3UO1H 2R4SL 4EUPA 4OZGF 4JPKL 4OCNC 4NQDE 4P9HH 5TH2B 4FP8L 4LCYB 2PYED 3FFCD 4LSPH 1B0WA 1T22B 2DLFL 1S7TA 4QRTB 1D9KC 3RPIA 1TDQA 1NGWB 5DSCA 3MR9B 3DV6A 3S37X 1AIFB 4FQLH 3MLRH 5I1DA 2O5ZH 3TT3H 3EYOA 1HQRA 5DMGD 2VLLA 2GCYA 4J1UB 1RVFH 1J1PL 2AJUL 5I18H 3OKNA 4UUJB 3BKMH 4XTRD 4GMTH 3WLBB 3QAZC 5KSVB 3B9EA 3BKYH 4H20H 1MFDL 5FYLH 4M5YL 4PV8B 3WFEH 1K85A 4M48L 4N0RA 2BNRE 4CADA 4N8VB 1HOCB 3CK0H 3GM8A 1IC7H 3WNLA 4IMLA 3L95B 2WANA 4ZQKA 3VRIA 3DGGA 2QADC 5EU5A 4PS4L 3H9SA 2IQAA 4K8RH 5I8OH 4NFCA 2X7LB 4L8CB 3RY4A 3CDGB 3WXVL 1UJ3A 2H32B 4K3EH 3T4YB 2YSSA 2DQHL 3MRRB 1ZLUK 1CFQA 4M7LL 3H3PL 4KPHH 5TF0A 1TQCB 3IVKB 2AXFB 4I3RH 4P5MB 4J12A 2WNGA 2UV3A 5EZIL 3KPQA 1HHKB 3O3EA 5I0ZA 4W68A 1MIEL 5FB8B 5HPMB 2QTEA 3PABB 3DUSA 3SKOA 3RKPA 3SKJL 1YNTA 2N7AA 2C7UB 3MUY1 3LZFH 1CDJA 4PJIF 3VFMA 1WZ1L 4L8DA 4GKZA 2QKIB 1IVLA 3VXRD 5C0GA 5E9DE 5SWZA 2AJYL 3X12B 1RZJC 3HA0A 3QHFL 5KVDL 5J4MA 3OZ9H 4LCWD 1PY9A 5AYQA 3MRFA 1U91B 3PWPA 2DMKA 2E6JA 2YPVL 1FNSH 5EO9A 2WIMA 5HVFB 1BM3L 4RGNC 2IF7A 4TPRL 2NLJA 3KLHD 3MO1A 3FB8B 2OZ4H 1NUDA 4R4NC 4D0CA 5FYJU 2EC9U 3IDGB 1ZKAA 5B4MD 1CVSC 5MEPB 4GAGH 3TBSB 4N90E 1AGEA 4FTVA 2A6DB 3HC0A 1BHGA 5HI5C 5FDWB 3S36X 5J56B 3ZYIA 3A6OA 4NRZA 5BV7L 1ZHBB 4E0RA 3QUKA 1IGCH 3MRMA 3EDFA 2YHGA 4HS3B 3DHMA 4ODVH 3GSOA 2ZPKL 3IXTB 1S7UB 4NIKB 1K6QH 4R90H 4NQVA 1A6ZB 2OR8A 4OZHE 3KLDA 3RVTC 4L3EB 4OT1L 3C5ZA 5FO8B 4O51A 1TMCB 1KXVC 2X89A 2VSCA 1H3PL 2H41A 3PG2A 4RAUA 3ESVF 3BPOB 3ELAT 4YO0A 3E0GA 3GB7B 5J1AB 3NFPB 1BD2E 4QT5B 2BFVH 4GUPB 4Q6IB 5IF0A 5FUOL 4J3SA 1C5DA 5HYSB 3RFZC 1B0RB 1Y18B 4NO2A 5TDNB 1CCZA 2VXVH 4OD1H 3DRQB 4XAKD 3LB6C 1G9NC 1YJDL 4LKXA 3STLB 4QHKJ 5F7EH 1LO0L 4HUMB 1CGXA 3GSVB 3OGCA 1OP9A 4XI5C 3F6LA 2L7JA 2J8UA 1AC6A 1HQ4B 1JWMA 4UDUB 4WRLA 4BZ2L 2R56L 3ARBC 4PGCB 3LAFA 2W0KA 4MAYB 3L3IB 5DJ6B 4G8EA 3DURB 5T1DL 3OBAA 4OD2A 1N2RA 3QXDB 1QOKA 3A0OA 3HUJE 3U0PA 4PJBB 3V6OA 3IJYA 4KQ3L 3LKSB 5MEND 4HCRH 5TPWL 3LEYL 1Y0LA 3NACL 4NZRL 1CG9A 1UM6H 2AJ3B 4LGSB 4E41D 3OAUH 4O58L 4C56E 3K2MC 5DRZB 1DVFB 2P47B 5LVEA 4KI1A 5DJDA 1II4E 1T0MB 4JAMA 4U1HA 1ZLWH 2YKLH 4JKMA 5GRVL 3LQMA 5I71C 5ICZB 3E8UH 4ZUWB 3U0TA 4XCNB 1I8IB 1AO7B 5CD3A 2W91A 3M8OL 4KKAC 5CSGA 3JTTB 1KLFA 4MD0A 2VQ1A 4N8CH 2OP4L 2AI0H 4H5SA 3RL2A 1A3LH 3VMOA 3B8YA 4GG6A 5IB4B 3U83A 5BOZG 3L3JB 1TNMA 3H7BB 1UZ8B 4Z9KB 3MA7A 4UAOB 4MVBC 2FLRT 2CSPA 1JPTH 3TA3D 3QUXD 2OJEB 2CDEB 1AD0A 1U36A 4Y4KC 1DLHB 1Z3GH 1LEKB 4RWHA 3RUGF 5EIQA 1NMAL 3I6GB 3MV01 4FFVC 3UAJD 5GS0H 1V7NL 2PXYA 4IBLT 4QY8A 1UYWH 3CH1B 4EOWH 1G9EA 1Z0NA 3G6JB 1IEAB 4K55A 2E7HA 5ECJE 3T3ME 1T6WA 1UA6L 4YHOH 1FG2B 5DHVB 4UV7H 1H8SA 3S4SG 3V4UL 1QFWM 2H2PC 3F7YB 4MHHG 3U9UB 1NGYA 1PX4A 1CK0L 1EHLH 1ZTXH 1PZUB 3H8NA 3C08H 4DW2H 3G9AB 3PWNB 1Q72H 1GZQA 1MFAL 2HLFC 3MUJA 1SEQL 5SWSA 3RTQB 3GEWB 1NUFA 2NR6D 4LRNL 1FQ9C 5DA0B 1GHFH 3CX2A 2EDQA 4RX4D 5IBTL 1KFAH 4XNZC 1HWHB 1RZ8A 1IAMA 1VESA 3TYFB 1NLDH 1OTUD 4GW5B 1HDMA 2VLJB 4I77H 3BDBA 2XZCL 3BQUB 3KR3L 1H3GA 1J0ZA 4PY7A 2WW8A 3L5WB 5E00B 2DICA 4JZNA 2H2SD 1HHGB 3MRJB 3FRPA 1I8MA 4EI5B 2NXYB 2YPLB 3HG1D 1GC1L 2EO9A 4O02H 5K9KA 3LIZH 3BDYH 1ONQA 4M4PA 4IRSA 1JNLH 1NEZG 1W72L 1KCUH 3GSXB 5EU7C 5IR1B 1URLA 3BPLC 4HV8B 3BEWA 3VE0A 3TN0C 4P46C 3UC0H 3UJJL 4WY7H 2WUCH 5ESAB 4JY5L 1H3WM 1KCSH 2SEBA 4Z95H 4GRWE 5J89A 1S5HA 1E4KA 1RK0B 3LVEA 5T3XH 5JOPE 1BVLB 3ARFB 5E8DH 2YD4A 1R5IB 3BWAB 2GTZB 3U46A 2HFTA 3U7WL 3FJTA 5J6HB 1KJVA 2H26A 1T03L 2VIRA 4NZJA 3VGDA 5EZOH 1BQSA 8FABB 3RVVC 4EIGB 2ZP0T 5T1LD 3ZDXE 1SQ2N 4OJFH 5D1ZD 2H9GB 4QRUA 2CKBB 5KSAD 4O4YL 2F5BL 1N59B 2WSKA 1ZXQA 4NKMA 4XPTH 3SJVD 1BLNA 4DGIH 2DWEB 5EO1B 1NKOA 4ZFOB 5FF6B 2C4FU 1UH2A 4HBCL 5F7YC 3BN9D 5HSFA 3MUGB 3K2UL 3VXTB 4C59B 1XR8B 3V5DA 5FM8A 3DIFB 4ONFL 3D0LA 4JEGB 3BAEL 4PG9B 4UMGA 1KTKE 1BIIB 2IAMD 3FN9A 3FQRB 3QHZH 4MDJB 4WI4A 4LNVA 1FVCA 4D0BA 1U2HA 4BSVB 5B3JE 1ZGLB 4QHMA 3T77B 1WWWX 4QRRA 1D5ZA 3MMEB 3CVHH 4UIMA 5CJ8A 4OF5A 4LSTL 2WBJB 5FYLD 2NYYC 1MCCA 4K3DL 4YDVA 4IDJH 3MOQA 3FONA 5FUZH 3P9LA 2HT2C 2IBZY 3JWOL 4PJ8B 2HG5A 5JOFA 1UM4L 5KVEH 4XHJD 3B83A 4I0PC 3CGTA 4MAUH 3G08B 3KPNA 3PGFH 4BUHA 5BCAA 2OXHA 4NO3A 1XGPB 3B3IA 4FQIH 4LPXA 1N8ZB 3NIGF 4GQ9L 4KRNA 1AQDA 3W2DL 3CFJB 3GK8L 4I2XE 5FHAH 3MLYH 1JUFB 5JXAL 3MGAA 5IVNA 5BRZE 1JRHH 2GJ6D 4KV5E 4OLXH 4CAGA 2PKDA 4PBVC 5F9WC 4FFWC 5E03A 4GOSA 4CW1A 4Z78B 1X5HA 3R8BB 5DJZB 3UP1A 3TO4C 1R3HB 4B5EA 4WUUD 1HHHA 1R3LA 4JVWA 2EXYC 4PBWD 5ACMA 4X6DF 2VUOA 2YC1A 3WHXB 4OD3H 4C4KT 1M7IB 4GW4A 1KXTB 4Q74A 4KKNA 3JWDH 3SDAB 1I7ZA 4WWKD 5E2UL 4HLJA 4ODHH 5DEZA 3GO1H 4K7FA 4AYFA 1P5UA 5K9JL 3C9NB 3C5ZC 2HRPL 1T2QL 1R5WB 4PFEA 1NFKA 3D39E 1A7NH 1F3DH 4IRJD 5F3HA 5C0CE 1CD8A 5AD0A 5C0EB 3BRGC 4JO2H 1HWGB 1U8OA 3IAPA 5I19L 2LTQC 1QFWI 5CJ5A 4WO4B 3QIWC 1MWAH 4C56B 4OF8A 2NY4B 3OSKA 4K3JL 1JK8B 2MQ0A 1IGMH 4YHZL 3BUYA 5TDOB 4QHNB 1T1WB 2FJFA 2P8LA 3ULVD 2ORBH 1XGQA 3ARXA 2BNUB 3EOAA 4K94L 4NKDA 4ALAL 4Z8FH 4OLZH 1QSEA 5M7QA 3X14B 2ARWA 1AE6H 5JDSA 2UWEF 5D2LF 1E6JL 2YPKA 3QO1B 5GZOC 4YHYC 2WK2A 3BKCH 1H5BA 2VB5A 1K2DB 5HHQB 5J13C 3O2WL 5BVPL 2DQUH 1A9EB 1A1NB 3RNQA 7FABL 1CGUA 3CIQA 5GRUH 2VABB 2B4CC 4HULB 1WIUA 4NQXB 3FT3B 1MAMH 3AM8C 1NANI 1P9MC 3OB8A 3Q3GB 3VXRA 2R0ZH 2ATPA 4XXCC 5E8OB 4JFHE 3EZJB 3VFGH 2WV3A 1FGVL 3FTGB 4O2FB 1A2YB 4NNYA 3RWJA 4X6FA 3KG5A 3X13B 5CP7A 5K9OB 2GK0B 1NCUA 2GY7B 3TWCL 3KYKL 2H1PH 3BW9A 3ARGD 2IH3A 3QA3B 4YHIB 4KK6C 4YXKH 4KJYA 3G5VA 2VLMD 2XPGB 4ZXBD 3HCVB 3NGBB 3VMPA 4HX1A 1G7MA 3LH2H 4P2RD 2B1AL 1SJEA 3K8KA 1FO0L 1KTLB 2V7HB 3D85B 4LPTA 1ZVSB 3MRIA 5EU4A 3KJ4C 4X5LA 3O4OB 1FYTA 2K3TA 4NGHH 2NY7L 1S7XB 4M61A 2ZCHL 2GSIB 1KIPA 3VFTB 4PGDB 3SOBH 4EBQH 4G6JL 2VQUA 5BO1H 4UNTA 5D2NC 2A6JA 2E9JA 1M7XA 2QQLH 2F58L 4PJAF 4TTDD 5TDPA 4YHLL 5DJ0B 5KSUB 3IDNA 5LWYL 3KNBB 1A7RL 2EH8H 4TSBH 5EIIB 5C0IB 1OSZA 5IB1A 4FS0A 1KB5A 5IKCA 1CL7H 4IJ3C 5I74C 4YAQB 5FKAA 4JY4A 2YA1A 2CJUL 1ORQB 2EDFA 2F19H 3NMEA 3Q48A 2J8OA 1X5JA 5C0BD 1C16A 4H88H 3N1FC 3ARVA 3AU1B 2R4SH 1FJ1B 5GGVL 2VISB 2I60L 1QBMH 4FP8H 3QXAA 4GRWB 2DLFH 1VFAB 3HPLA 3RPIB 4YH6A 3W11C 4X7TA 5I1DB 2HH0H 4UT6L 3BZEB 3ZHKA 3EYOB 1HQRB 3I50L 2VLLB 4HPOH 1NAML 3CFEA 4OIBA 4Y0GA 1MELA 3GSWA 2X4QA 2R2HA 3EHBD 3U4AA 3OKNB 2W65A 5SWQA 1J1PH 2AJUH 5DRWA 3RNKA 2XI9A 4ZNEE 4MNQB 4MDIA 1I8KA 4EI6B 5GS0D 5HXMA 4J7RA 5MENA 1MFDH 1QBBA 3OKMB 1ZANL 5L6YL 2XACC 3MROA 2G5BB 4E41A 4M48H 3GMQB 1F11A 4JQVA 5JQ6L 1IGJA 4HFWA 1KCRL 1XIWA 2BY3A 1RIHL 3FMGH 1CFSB 3H42L 4ZQKB 3VRIB 4HMDA 1WBYB 4NPYA 5EU5B 3EUUA 4PS4H 4MD4B 5F1KC 3SPVA 1T7ZA 1A8JH 3DSFH 1E4KC 4PJGF 4Y16C 1YEHL 2IQ9H 3V8CA 1A1MA 3WXVH 3P0GB 2XZAL 4JRYE 5I0DA 3SKMA 2ZJSH 1UJTA 4BFIB 4W4OC 2FZ3B 2VDPL 2YSSB 3NIFE 2NY5C 1IAOB 2DQHH 1CFQB 4Y1AD 4M7LH 4LVOC 1EZVX 4OFYD 1IFHL 4JHZA 1D6VL 3MV7E 4U0RC 1IC4L 4WEBL 2Z0BA 4CKVX 1X4ZA 3O3EB 2GIYA 1OAQL 2XKNB 1PKQE 3QUXA 5E5MA 2EKSB 3DUSB 2BVOA 3LKQB 4HJJL 3SKJH 2VLKB 1U3HA 5E2VL 4JN2A 4S1DD 3P0VL 4GKZB 3NA4A 1WZ1H 1UKQA 5J12C 4YHNA 5C0GB 5MP6L 2HN7A 5H35A 1H3TA 2CKNA 2AJYH 3RI5K 4DGVL 1O0VA 5KVDH 5HDLA 5C08D 4NCC2 1L4IA 3MRFB 3WN5A 15C8L 1MHPH 2G5RA 5IEHA 2AJXL 5D1QC 3ZE2F 3T0EA 2NLJB 1BEYL 5T3XD 1BZ9B 3RY6C 1ED3B 3O45A 5BRZB 2DAVA 2BOCA 4BZYA 5EUOF 3FT4B 3HC0B 3T3PE 4RX4A 4NJAH 4LHUA 5ACZB 4ZUUB 4NRZB 5LBSH 2YZ8A 4LOUD 1J86A 3QUKB 3O41A 1YY9C 3MRMB 4JJ5A 1BBDL 4F57L 3C09B 4HHAA 3TH4T 1IEBA 5I1KL 4JLRA 4OUUA 5E5UB 1EK3A 1LDPH 2ZPKH 1QFOA 4NQVB 3SDDB 4S10A 1Z9MA 4D8PA 1IM9D 4EKXA 4OT1H 3ZTNL 4O51B 1M6OB 1MLCA 3OKDB 3VGEA 5LJYH 4PJ9D 3WFDL 2P5EE 4MQTB 5IB3B 3MX0A 1OP3H 2VLRD 3ULUD 3T2QA 5L2KE 1PW3A 5IF0B 3CSPA 4NM8L 2PYEE 3FFCE 4Q2ZA 5FUOH 1G7LA 1C5DB 4MNGA 2D0HA 5T1MA 4NO2B 4RFNB 3MODL 1I3RB 2MPAH 5F6IC 4ZYKB 2DTSA 4LKXB 3F8UB 1YJDH 2FHBA 3KXFD 1LO0H 2DWDA 4E42A 5D93B 2PR4H 2J8UB 3P4OA 3CFIC 2C5DC 3MZTA 2R56H 3LN9A 5KN5B 3T1WA 1N26A 1OWWA 4G8EB 2XY2A 3UJTL 1I75A 3CVIL 1N2RB 3MJ9H 4OD2B 3U0PB 2WBWB 3BKJL 1FFRA 5F7WC 3IJYB 5D1ZA 2JJSA 4KQ3H 1S9YB 3TNMA 1Y0LB 3ZYOA 2PW1A 2G9HA 3LEYH 3ZT7A 4F15C 3NACH 4NZRH 4EZMA 3ORJA 3WEXA 4O58H 3F65A 4P23D 1LMKA 5DEGA 1T6VN 1IT9L 1CTOA 1P7QA 5I1JH 2O93L 1LP9F 1UB5B 2NXZD 3ZDZF 3RWIA 4Q9QL 1INDL 2HT3C 3BEVA 2UUDK 3U0TB 3KPRA 3WO4C 3M8OH 4FZ8L 2VQ1B 4HUVA 3C6SB 4H5SB 3RL2B 4FQCL 5L0QB 1YEEL 4GG6B 3JV6A 2FIKB 5CLTA 1RUAL 1HCVA 1U92A 1I9IL 1I8LA 5HHOB 4UV4L 4KROC 5GJSL 4TSAL 5EU3A 4KC3B 3D2UD 5F44A 4E5XA 2V5YA 4M3KB 5DUBB 3MNZB 3TEUA 1AD0B 5IP4A 4ZO9A 1P7HL 5D7SL 5FO9A 5JW4N 4P4KA 4PJHB 1V7NH 4POUB 4QY8B 1X5KA 2DBLL 4G80B 4GMSL 4IEFB 5FO7A 2ESVB 2VXUL 1K3ZA 4NO0B 2ICWJ 5DURB 1UA6H 3ZHDA 4PLKD 3V4UH 3JBG7 4X9FA 4OM1L 1Q1JL 4HG4K 4X6BA 1RK1A 3NCYS 5H2BA 3QUMA 1N64L 4X6CF 4MQ7A 2GJ6A 4UBDD 4OSUL 1MFAH 1BVZA 2XA3A 4LCUA 5SWSB 5JXED 3FN3A 4WUUA 4LRNH 3QUYB 5B3NA 5IQ7L 3L5XL 4OLVH 4PRHE 5DQJA 5B21A 3V4VL 4LEXL 1T21A 1JP5A 5D9SA 5F9JA 2OTWA 3RAJL 1JTPA 3OF6D 1XF1A 3BPOC 3ETBF 2XOTA 3GSNA 2XZCH 4GH7B 3WL9A 3ZE0E 3KR3H 4JO1L 4FQ1H 2KBGA 4PY7B 5ETUA 3SE8L 3JVGC 5CEXB 4NN5B 2ITCA 5F93C 3EYUH 5IW6A 1U8PA 1I8MB 1CFBA 2ZKHH 4LRIA 4EXPX 3O2DA 2VR4A 1ONQB 3DXAD 12E8H 5CJBA 3O6ML 5AG8A 3EOYG 4CMHB 1HNGA 2EDEA 4KHTH 3BEWB 3MLWL 5GSVA 3RWEB 3LV3B 5F1SA 3UJJH 4XAKE 2H6PB 4H1LH 4MAYC 4JY5H 3MLSL 1F97A 5B39A 4KK9C 1HILB 4XNUL 3HNTL 1MCOL 1JZ7A 4WJ5A 4PJFE 5E24E 4MA1C 2NZ9D 4Z7OE 4RAHA 3V7AE 3O9WD 1G7JA 1FPTL 4RA0C 2M26A 1KJVB 2CPCA 2H26B 3U7WH 5C6TH 1RZKC 2Z4QB 5I76A 3QIBD 1DVFC 4OLWL 1XEDA 4M1CD 1JNJA 5HYJD 4WTZG 4QRUB 4M5ZL 1RIUH 4X8JA 4ZS7L 4UTBL 5DJYA 5IVXE 4FMFA 1V3MA 5JHDD 2F5BH 1BLNB 3SBWA 3TBWA 3UYOD 2WWMD 1U8MA 1FV1A 4MXQC 5IGXL 3VWJB 4HBCH 2NY3C 2CUMA 4AEFA 3ARGA 1MH5A 1QLRB 2DN7A 3BAEH 4WI3A 4Q0XL 3DI3B 3BPCA 4D0BB 1FDLL 1FN4B 1YEKH 4QHMB 4DK3A 1SYSA 4QRRB 3UTZB 1D5ZB 5D96B 5E8PA 3VXUD 4UIMB 2VZ1A 1YZZA 2GT9A 4LSTH 1KNOA 4KJWD 3BDXA 4U1MB 2Z31D 4P48A 1A7PL 4L4TE 3KPSA 4GKSA 1JPSL 2HG5B 5JOFB 3MNVA 1UM4H 5HGAA 5AUMA 3SDCB 2XWBA 3MRKA 1DBAH 2AABL 4F7TA 3KPNB 4JFPA 3VXQA 4HXBL 3LS5H 1FNEB 1MHHB 4JCMA 4NO3B 2Y1VA 4G7VL 1G6VK 2A0LD 1AQDB 5F1OB 4BQ8A 4UOW1 5JXAH 2C9AA 5BS0D 1EO8L 5SX5K 3UXFA 4CW1B 5AAMA 2OMNA 3REVA 1UENA 1HHHB 5DJ2A 2Q3ZA 2YUWA 3MXWH 4PJCF 3BSZH 5MEQA 2YC1B 4N0FB 3OQ3B 1S7SA 3MACL 4GW4B 4JFFE 1IQWH 1I7TB 1Z2KA 2CH8A 1OP5K 1CR9L 5FGRA 4K7FB 5E2UH 2E7LA 4HPYL 3IRZA 1OTSD 2D4DA 4XPFL 1CT8A 3HG1E 3T0XA 5I1LA 3ROLA 5D5MF 1YEJL 1FFNA 2HKHL 4HK3N 4LARL 4GRLD 4W6YB 5F3HB 5AD0B 1WEJL 3U79A 4IMKA 2BOBA 3H2WA 4OCMC 4NNPL 3L7FA 2P7TA 5I19H 4LGRB 4B53A 4NRXA 1G6RB 3DUUB 3GJFH 3EJYD 1WCBB 2DLGA 4PRPA 2PW2A 4XVUD 1LGVA 1F6AB 4K2UL 2BJML 4K3JH 4QHLA 1QSVA 3BUYB 2FJFB 1A6VL 4P49A 4ODBD 2JELH 3N50A 3IAGC 3EOAB 4NKDB 3O6FA 4MJ2A 3LDBB 4K94H 2HYMA 3W5NA 4X4ME 5KSBA 2R4RL 3CPLB 4NZUL 5HD8C 1MQ8A 5JDSB 1DCLA 3MBED 4MA8L 3TZVA 3CH8A 2YPKB 3CAFA 2PYFA 4GKNB 3C5JB 1RZ7H 5ADOL 3W39A 2YEZA 4Y19D 4KKBC 3X3GL 1JPGB 1MCKA 2ZUSA 3O2WH 4PJDE 4DZ8B 7FABH 4DTGH 2IALA 1DN2A 3GBNH 2ZNWA 3S98A 1EFQA 3SJVE 4XT1C 3VXRB 2ATPB 3SQOL 4ZOBA 4IHOA 3EYFB 3PUCA 4I2XA 4KY1L 4LCWB 1KSRA 3DROA 1FGVH 4ONHA 4L4VE 4CRPA 4NNYB 2F8XC 3RWJB 4X6FB 3BGFC 5CP7B 2XV6B 1C1EL 5GIRA 1EEZA 3TWCH 2IH3B 5F72S 5I1AA 1FIEA 3STZA 2E5EA 2IFFL 2OM5A 1ZSDB 3G5VB 3DECA 3BJLA 1J1XH 1O7VA 3HZYA 2HVJB 2DQDL 1KJ2B 5L2JA 5DD5L 4HX1B 1G7MB 1OW0C 4ZG1A 3NFNB 4UT7L 2DIJA 1DQTA 3BP4B 1SJEB 5DGQA 2B1AH 3WFBL 1FNGB 3FO9A 3MUHL 4JCLA 5BXFA 3OHXA 1FO0H 1MJ7H 5FYLE 2VN4A 5EU4B 2WINA 1MCLA 1PG7W 5IVZA 4UNVA 2I5YL 3O8XD 1FYTB 3HAEA 1IM9A 2NY7H 4M61B 4ELMA 5HDOA 5KG9A 1KIPB 5DD0L 2ZCHH 3MOAH 4G6FD 4R3SB 4UZGA 5IHUH 4HZAA 3VFVA 5ITFA 2F5AL 1BWWA 1TPXB 4LF3A 1I7RA 5T3ZL 2XNAA 1TVHA 2F58H 3K4DA 4YHLH 2VLRA 3VGAB 5LWYH 3KS0J 1A7RH 1KG0A 4NNXA 5C0ND 3WJLA 1OGAD 1KB5B 1X5ZA 3QDGA 5IKCB 3RHWK 4JN1L 3RZCD 2WBKA 5FKAB 4JY4B 4HKBB 4WI5A 4GKOA 2JIXD 1REIA 2CJUH 4Z7VE 3ZO0A 2GKIA 2EH7L 3S4SA 3SDAC 1P2CA 4PJBF 4FXKB 5BW7C 1AD9A 2I60H 3QXAB 2LFGA 4MZ3A 3HPLB 4X7TB 2BXZA 5ICXB 1RURL 4UT6H 3AY4C 3I50H 3GSWB 5C0AD 2X4QB 1CYGA 4M9OA 4PR5B 4WO4C 5F6HI 3RNKB 2Q3AA 1J12A 1UH3A 3SCMC 3CD4A 2NY4C 3KPLA 3O4LD 5MENB 3KHOA 3D3VA 1J1OH 1RZFL 1EUUA 1ZANH 2W1NA 5L6YH 4MX7A 2AEQL 2XXCB 4E41B 5FFLA 1R3JA 1F11B 5CEYA 4JM2A 1ZT4B 1KBGH 5JQ6H 4LNRA 2H32H 3DO7A 1I85C 1NUGA 1XIWB 2MJWA 2Y4SA 4P23A 2F74A 3H42H 2GUOB 4WGWB 4NPYB 4YUEL 5JMRA 4XBEL 25C8L 3SGEH 3IF1B 2R69L 3FQXA 4OGAD 5LAXB 2KQMA 2V17L 3FKUS 2IG2L 3C87A 5GXBB 1YEHH 1DFBL 1OM3H 2LVEA 4N9GA 3TBYB 3SKMB 3K46A 2XZAH 4TOYH 3GGWA 2VDPH 1IZJA 5DMKA 1AHWC 4LAQL 3RDTC 3BD5A 3G6JF 4GS7B 1X5IA 4JRXD 1DQJA 1IFHH 4D9RD 1D6VH 1IC4H 1JWSA 4U1JA 2RBLA 3D2UA 3IJHA 4XP4L 1PX3A 4R8WL 3TA3B 3QUXB 5E5MB 1IC5L 4H26B 2BVOB 2G60L 4YGVA 2UZIL 4HJJH 1DZBA 2AKRA 1JPST 2IPUK 2MHAB 5J06A 1IM3A 1A7OH 1GGIL 5E2VH 3P0VH 5FV2A 3VFPB 5T5NF 5H35B 5MP6H 4QHUA 4N1CA 3VG9B 3LMJL 1IKFL 4OQTA 1DBBL 4K71B 4UU9A 3BISA 4DGVH 4XNXH 1XZ0A 4HAGA 5FGCB 15C8H 3PDOA 4OZGE 1HZHL 3TFKD 4MSWA 1YEIL 2AJXH 2VLME 4YHPB 3AS0A 1OD9A 3T0EB 4KK5D 1BEYH 3KLAA 3NPZB 3O45B 3VWKA 3UTPD 3KHQA 3VH8B 4UIKL 2X4UA 4W70A 5F88A 3HFMH 1R3KB 2AV7B 4K23L 4MJIE 5DHYA 3CX5K 1JRHI 3H9YA 3MNWA 1N5YL 1MCHA 4Y8DC 3O41B 4JJ5B 3OF6A 2E9WA 4F57H 1BBDH 4WU7B 4WFHE 5I1KH 4I0KA 5ABDE 3TM6A 4OCWL 1MRFL 3ZTNH 2DD8L 3PP4L 2NY6B 3QRFM 3BMVA 3I75B 1KN4H 2E9BA 3WFDH 1OSPL 2AP2A 5F7DA 1KIQA 1JMZA 5JPNB 1ZLUH 1U8LA 4ODWA 5C0BE 4EN3C 3QEUB 4X9GA 4ZAKD 1UZ6F 2NPLX 5DFVC 3BGMB 1RULL 4NM8H 1TZGL 4Q2ZB 3VFNB 4MNGB 1YQVH 3TIEB 3BP5A 5T1MB 1AGCA 5FCSH 3ZLQC 3PL6C 3LQZA 1NEUA 3IJSA 3MODH 1OD7A 4OCSH 1MJUL 3U6RA 2AEWA 4HIHB 2DWDB 2NY1C 4E42B 2YR3A 3O9WA 4DKDC 4LEOB 5F7FA 3ILQC 4QXUL 3VD4A 4XPGL 3RZWA 2QR0B 5T1LB 4FZEL 3OMZA 4PJIE 3BKJH 1YY8B 1AGFA 5D1ZB 4LKCA 4PJDB 4NDMA 5GGSY 3TNMB 5KSAB 4UOJA 5I75C 2PW1B 2ERJB 2G9HB 3SJVB 5IESL 4TUKL 3WEXB 2DQIH 1WITA 2O61B 3V7MA 5GZND 4LIQH 3ME0A 5DEGB 1TCMA 3H0TA 4P2QA 3O6FC 5BVJA 5JOEA 1F4WL 2BNQE 5IUSA 3D25A 4Q9QH 1INDH 3KPRB 4IOIA 3K8LA 5EA0L 1ZE3C 4Y1AE 3UROR 4I4WB 2VH5L 3C2AL 1HXYA 2Z9TA 4FZ8H 4NOBA 4WW2A 3TZVC 4HUVB 2X1XR 2FSEB 5EPMB 1CU4L 2HFEA 3LKPA 2VXTL 2AJVL 1BOGA 3MV9A 3QYCA 1QR1B 2VZVA 5CILL 1U92B 3HTLX 3ARPA 1RUAH 1NBVL 2P48B 5IM7A 2FWOB 4HMEA 5HPOA 4UV4H 3MJ6A 4ETQA 4HKJB 4CL7A 3DWTA 5GJSH 3SO5A 4E5XB 3VXMA 4HJGB 1KJ3L 5DHVH 4XNYL 1WT5A 2Z31A 3G6DL 1AXSB 5FO9B 5HVGB 3O3UN 5D7SH 5J11C 1GVIA 1FC2D 3WD5L 2NW2B 2RHEA 3WNKA 3C60D 2DBLH 4GMSH 3EDJA 5FO7B 2FLBT 5M95B 1YQ2A 2VXUH 4FHBD 4FQHA 2EYSA 2ZUXA 5EBLA 2YD8A 5C0FA 1GXEA 2B2XL 2BSTA 2DTML 4P5TA 1EBAA 4GBXD 4M1DH 4QYOA 5JORA 5JW4Q 3TCLB 4BH8B 43CAB 4OM1H 1Q1JH 1EEYA 2GJ6B 2XICA 1N64H 4AH2A 1RJLA 4PJ7E 4Z7VB 4P4RA 1AH1A 4JFED 1F2XK 4LCUB 3SDDC 5KS9E 3ARRA 3WKMH 4WUUB 4JREC 3GMMA 4JM4L 4B50A 1X9QA 3T2NL 5DQJB 1S78D 3L5XH 3V4VH 2O26U 1MI5A 4HIIB 1T21B 4JRWA 5CHNB 5D9SB 5F9JB 3RAJH 2VZ3A 4WWKB 1VEMA 2LU4A 3X11B 3GSNB 1F00I 5ERWA 4XMKL 2CK0L 3MRLA 1MRCL 4JO1H 5ETUB 1VFBA 4X6EA 2X4TA 3SE8H 5EU6E 5C8JA 5IW6B 1U8PB 4IRJB 5IWLC 1ZHKA 2WAHA 3UTQA 5DO2C 1TJGL 4C4KO 4P57A 4URTB 1EHAA 4R0LB 1NDGB 3O6MH 4NWUL 4NRYB 1T83A 1EJOH 3MJ8B 4PRID 4CDGC 3W0WD 5GSVB 2XZZA 4Z7NE 1YC8A 2BVPA 5LQBL 1NH6A 4X9IA 4HJ0C 5EO0A 4R97C 1LQSR 1VADB 3HZMA 3MLSH 5E6IA 1MY7A 3MBEA 2YOCA 5B39B 1V8HA 2EEAA 3CMOL 4XNUH 3O0RL 1MCOH 4WJ5B 4WUKL 2X4OA 2DL9A 1XF4A 4H25B 1CD9B 4OKDA 1CFTA 5AEAA 2AJZA 2HWZH 1FPTH 5LGJB 5BZDA 1NCWL 3HI5L 1S9VB 3KPMA 1P84K 4G8GE 5I76B 5GRXG 3JXAA 3UTTA 4HLZG 4OLWH 3O81A 4NQCD 4MXWL 1EZVY 5JR1L 2WLYA 4U1SA 3DMMD 4JM2C 4Y4FD 4X8JB 5E0QA 4ZS7H 4BQCA 3D18A 1F6FB 1QLFA 1UWEH 1A4JA 1U8MB 1FV1B 4M7JL 5I15L 4ZMAT 1VEOA 4TUOA 2EIDA 3AMKA 5IGXH 5L0QC 4NQUA 2GITB 3S35H 1P4LB 3ARGB 5T1KD 2DOCA 1MH5B 4OLUL 1S3KH 3QULA 3KGRA 3ZKSD 4WW1A 1YC7A 2X4RA 4Q0XH 4ZXBB 3QISA 3VXOB 4C54A 4MCZA 4QRPE 2FH8A 2G75A 5E5RB 4P2RB 3X3FL 2JJUA 5D1XC 1FDLH 1MCFA 4KKLD 4U6XB 3Q1SL 1SYSB 3BN3B 3HE6D 5KVMC 5E8PB 3FOMA 3O8XA 5EOTA 4X83A 2VDOL 5DGRA 3RVWC 4F7CA 5FGSA 5HGDA 3LEVH 1LEGA 1RZGA 5E08L 5CKAA 4PJEA 4EDXA 1SVCP 5DDHA 3KPSB 4GKSB 1SJVA 3O11A 5DQDH 3LEXB 4GRWF 5AUMB 5HGAB 2VJXA 3O2VL 3MRKB 3P77B 5EZJA 4XH2B 2D3VA 1RUQL 4F7TB 4F80A 2AABH 1MCJA 3WFCH 1OF2B 4DEPC 3RZCA 4HXBH 3TVMD 4U1KA 4G7VH 2JIXA 4F37K 5E7BA 1E28A 5C0BB 5HYQB 2N4IA 4M7KL 4L9LA 4ZPTB 1D7FA 2GQHA 4TYUA 1UM5H 3SGDI 1VA9A 4PGBB 4JQXA 5GRWA 3IT8D 4Z5RA 3REVB 1U8NA 3ZDXF 3L3HA 3FB6A 4PG2A 4YDKL 3BFOA 1RUKL 1I3VA 5MEQB 1G0YR 1A14L 3L7EB 4YHML 3G5ZA 4EUPG 3T4AA 3MACH 1S7QB 2EDYA 2EZ0D 2CLZA 2EYRA 3O4LA 1QSFE 3TF7C 4HPYH 3QEQD 2OX5A 2BSRB 4U6HB 3S35X 1CT8B 4XPFH 5I1LB 1WIPA 3UYPA 4Y5XB 3ARDD 1FFNB 1YEJH 3DXAE 4JY6A 1MCEA 2HKHH 3N1PC 2FX7L 2VDLL 1KT2B 2BOBB 4LARH 4NBZB 1WEJH 3L7FB 4NNPH 4XBGA 3NZ8A 4M62L 4NRXB 3QJHA 4HLZH 1A0QL 3IU4H 1LO3H 1UCTA 4PRPB 2PW2B 1YYLL 2V2WA 4PD4K 4PJ5E 4K2UH 1JHLL 2BJMH 4QHLB 1IAIL 5B3JF 1NQBA 1E4JA 3MGOA 1A6VH 2E6PA 2QSQA 3WJJA 2OCFD 4JANA 3Q0HA 5KSBB 4BUGA 4BJLA 5HI3D 2R4RH 1MJJA 4NZUH 1P69B 4R96A 4MA8H 1KPUA 2PYFB 3HMWL 1CIDA 3QIUA 4P2CG 3W39B 5ADOH 1X6NA 4O2CA 3X3GH 1UWGL 4L4TA 1JNHA 1LWRA 2VC2H 3V0WL 3VWJC 4I9WD 2IALB 2VTFA 1M7DA 3VXPA 3HE7A 1HXMA 1G7PA 4YEEA 2XKUA 4TVPL 5JHDE 3BZFB 1MFBL 1PAMA 4OM0L 5FXCH 2DJ4A 4JFDD 2D9CA 5IV2A 3IDXL 4U1IA 3SQOH 5IJVA 1HKLL 1KTRL 1W72A 5H37G 1HCFX 5C08B 4YFEA 2YN3A 3NIGE 1OAYL 4LAJH 3BPNC 4UINL 2APVA 2L7UA 5GIRB 5TQ0L 3PXHA 5E1AB 3ROOA 1C1EH 3U82B 1TVDA 1FSKB 5D96C 3L1OL 3DJ9A 2EDXA 4DVBB 4RMSA 4EDWL 3HZYB 2DQDH 4PJ7B 5DD5H 4X6DE 4JFFA 3B9KA 3VXUE 3WE6A 4UT7H 2QSCL 3V4PL 5INDA 5D7JD 1LHZA 3FO9B 4WEMB 4XZUA 5BXFB 3OHXB 3SDCC 4FRWA 4PLJC 4M8QA 1CLOL 3S34L 1AGBB 1OT2A 1IM9B 1DQDH 1S8DA 1FGNL 4ELMB 1S5IL 4AG4L 1F58L 3MFFA 4QOKA 3ILPA 4X98B 1JL8A 3VFVB 1VKXA 5ITFB 5DD0H 3Q6GL 1HKFA 1ADQA 2F5AH 1I7RB 2XNAB 4Y2DA 4M43L 5T3ZH 4PJ9B 4EUPH 1CFNA 1AR2A 2NTFA 4EEEA 4P5TC 2VLRB 3PWUB 2V7NA 2Y23A 4TNVF 4NNXB 4KDTA 5T33L 3QDGB 1HEZB 2P1YA 2J8UF 2AGJL 5DMGC 4TN9A 2OJZL 4ZOAA 5J9PA 3IFOB 3DVNA 1RU9L 1G9MC 4N1EA 1JPFA 4XTRC 5INCA 3S4SB 1P2CB 1LNUB 2UWEE 2JB5L 2VDRL 3BHBA 4L4JA 5F8RC 4F9PC 4RRPA 1RZKL 1BZ7B 3KXFB 2CIIB 3QUZD 4LL9A 4W6WB 1NLBL 1MCDA 4UQ3A 4MS8C 3D9AH 3L3KA 4J8RA 5JDJA 3V6FA 1WGOA 5D7LE 1A1OA 3OKLA 1DE4A 4WDIA 1RZFH 2K9UA 3M45A 3MV8D 4KUCF 4MX7B 4IS6B 4LQ1A 1CGSH 4KJPD 5EG6C 1CICA 5I2IA 5F70A 3MJGX 3RTQD 4LNRB 4Z0BL 4GG6F 5IEKA 4P23B 1OAUL 1CN4A 1IJ9A 4IRZL 4LVHC 4ORZC 3R8QA 3S5LA 3VXNA 5CIPA 1D9KD 4YUEH 4DFIA 3GDBA 3FQXB 25C8H 4XBEH 2NXZB 2R69H 3RVUC 4MGXA 2V17H 2WWKO 5DLML 1MLBA 5E6IC 2IG2H 4GFTB 1LE9B 1DFBH 5CZKA 2XYCA 1T04A 1WK0A 5FGBC 1NEZB 2RGSA 3GGWB 4J3XA 5H37H 3T0DA 4Y19E 5KVFL 4PJHF 4XCCL 1CE1L 4LAQH 1GGCH 3HZVB 4V1DD 4XNQA 2YPLD 1DQJB 1NPUA 4OLYL 4QTHA 5IW3A 3STBA 5KZCD 1I9JL 4JZJB 3ZKXB 1JWSB 1V5JA 4ZDHA 3D2UB 3IJHB 2X05A 1RPQA 1GH7A 4R8WH 5C0DA 3SE9H 3CU1A 3P9WB 3VFRB 4L8SC 1RIVL 1IC5H 2CLVB 1YEGL 4HS8L 5F7LB 3FQWA 2E8ZA 4PJAE 2DM7A 1TTUA 1IM3B 4BQ6A 4AEHL 1IGIL 1Q8MA 3KLHC 1GGIH 4BELD 1MWAB 1OOAA 2F54D 3CZJA 4Q9RH 3LMJH 4DUWA 1SBSL 5I1HL 4UU9B 1BWMA 1DBBH 3DYMA 4LLYA 1HE7A 4WTZA 4GBXA 1UEMA 4H8WC 1XZ0B 4LK4A 4MSWB 1HZHH 4I3GA 1YEIH 2A6IA 2R2BA 4HK0B 3FB5A 4P3DB 3C5SA 1A5FL 4HC1A 3DVGB 2X4UB 5F88B 1EPFA 4K23H 2V5TA 1I1AC 4DN4L 1N5YH 5ESQB 1TPXC 4ESKA 1HI6A 3MRPA 5JO5B 4APQA 4CVWA 5IHBA 1CI5A 3SO3B 4XC3L 2DI9A 2YN5A 1FZJB 5E6ZA 4P0DA 1PZ5A 3N1GC 2PO6D 1S9KC 1KPRA 1LEIB 1NCBL 2H8PA 1B90A 1MRFH 4Z7WE 5GS1A 4X99B 4FQXD 1IQDA 1OGAE 1U8JA 1G0DA 4RGND 4GXVH 3I2CH 3LSOA 1KCKA 3FO1B 5F7DB 3VI3F 1KIQB 1D5BB 1OSPH 1U8LB 4MZ2A 4ODWB 2YRPA 2XFXA 3F7QA 4PJGE 1FFPA 1J8HD 4P59L 1H8OA 3RKDD 1RULH 3FRPG 1TZGH 1J8KA 2CUIA 1ND0A 3MRCA 1T0PB 1GYAA 4GW1A 3GBLA 2FBJL 2ED8A 5GSRA 3C8KA 1YMHB 5C0AE 1MJUH 4YWGL 4PJ8D 4LLVB 1KJMA 1LK3H 5CAYB 1M1SA 3O9WB 1KTDA 1A3QA 4WFED 1FL6A 1GOFA 2IPKA 2EO1A 1E0OB 3QIBB 5EBGA 5HHNA 1KEGH 1B2WL 4XPGH 4OLEA 2OL3L 4MCYA 4KRPC 4WFGE 1YPZA 4LKCB 4NDMB 4HWEL 5HYJB 4S0TD 4Y4FA 2EDKA 4ODTL 1MPAH 5JHDB 3W9EA 4ODSH 4F9LC 5EUKA 4TUKH 1A64A 4OCRL 1I1FA 4NC1E 3LB6D 3T3PF 1U8HB 4GS7C 1OHQA 2EIBA 3ZE2E 4CGTA 3OAYK 5CGTA 5BVJB 5DS8A 4XI5D 1F4WH 4PJXA 1T1XA 3ARBD 3EZ8A 1UQSA 5EUOE 3VW3L 4O9HL 4WW2B 2VH5H 3BP6B 2IC2A 4JRXE 3MLVL 5IROA 4LSVH 2HLAB 1QRKA 1NAMA 3UAJC 1CU4H 3LKPB 5CSBA 1BOGB 3MV9B 2VXTH 2AJVH 3RBGA 5CILH 2WUBL 4JO3L 3VXUB 1NBVH 4I5BA 1LO5A 4ETQB 4M93B 2FJHA 3VXMB 2FO4B 2Z31B 2Q87A 5CSZB 4XNYH 2ADFL 1KCVL 3ZKMC 3GMNB 1BBJA 1YEFL 3GIZL 1JGVL 5FYKE 3QUML 5FK9A 3WD5H 1OP3K 1ACYL 5ISZA 4KKAD 5A3ID 1EMTH 4F8TA 2NR6C 1C08B 4J6RL 2C4FT 4WNQA 1SEBA 3TVMA 1RHFA 4PTUA 2B2XH 2VO5A 2DTMH 3T0WA 4QYOB 1IGYA 1T0NA 4A6YL 3SDXE 3BE1H 3VXSD 4I18C 3AREA 4CBPA 3UTSE 5BS0B 4R2GD 4GSDL 4V2CB 1IKNA 5E4EB 4L8BA 4JFXA 1JBJA 2Q1EA 5DC0A 2OI9C 3F7VA 4WFFE 3LKRA 3QT2A 2JJTA 2W0FA 3GMMB 2VSDA 4XWGH 3P0YL 4Y4KD 5ANMA 5EFIA 1CQYA 3DX9A 4PYGA 1B4JL 3IXAB 3SGKC 4JFQA 1AXIB 3O2DL 3U4EA 3QDJE 3RVXC 5E2WH 4XMKH 5IB5A 2H2PD 1VFBB 2J3SA 4LSUL 2BHUA 1GGUA 5C8JB 5DJ8B 4G9FD 3EGSA 1FG9C 5JMOC 4GRLB 2UUDH 1LE5A 4X8XA 1ZHKB 3VRJB 3UTQB 3MYZA 3SY0B 4DK6A 4P57B 5B22A 4G42A 1TJGH 3GI9L 2HLFD 1Q9WA 2BNQA 3QQ3B 5MI0B 1LP9E 5AZEL 5MERA 2IBZX 4NWUH 3ZDZE 5GRVK 1KYOK 2FIRT 3SGJA 4JPVL 3FN0L 3QQ4B 1JWUB 1J0IA 2X70A 1TQBB 1RI8A 3O3BB 5EO0B 3PGDB 4BKLB 2OR9H 5DD6A 2RIKA 1QLEH 3MBEB 5BV7B 3CFDA 3PQYE 4HZLA 2J5LB 5C0RL 3CMOH 4JG0L 1K9TA 2X4OB 1BVKA 43C9B 1OQOA 1WFNA 1XF4B 4HS6A 2O5YL 4PB0L 5DHXB 3F5WB 2ERJC 3BYYA 2AJZB 2DMCA 3CSGA 1FFQA 4GG8A 5BZDB 1N4XL 3KPMB 2IANE 1NCWH 2JTDA 3HI5H 1T1YB 3UTTB 1H3XA 2B0SH 3BN9C 2X4SA 2APXA 2J88L 2BMKB 4MXWH 5IMLA 4JO4L 5E4IA 4U1SB 5JR1H 3ARUA 4J3WA 4P9HC 5T3ZD 4XX1E 2IAMC 2WQRA 3V5HB 2A6KA 5DMYA 3MRNB 4ZFFA 3WO3B 2DKUA 2EIEA 2HFFA 5A1AA 1DEEA 1DUYA 4ZD3H 4M7JH 3F6IA 1XGUB 2YXMA 5IMKA 1IGTB 4GQPH 4X6CE 4NT6A 1Q94B 4KMQA 4KU1A 5GGUB 1AJ7L 4G6KL 4OLUH 4WW1B 5IMOA 2X4RB 3RVVD 4Y4HA 1QFWH 4HUUB 4MCZB 1ZHNA 1DQLH 2NY0B 1FZOA 5KOVC 3CZFA 3D6GA 3C6LA 2M2DA 1UT9A 4HWBL 2Z8RA 4JFYA 4NP4L 5EORL 3FOMB 4JFOA 3O8XB 4K8RC 3CSBA 5I8EA 3MRGB 5EOTB 4I3SL 3CFKA 3H9SD 3V6BR 5HGDB 5C07E 2AK4A 3GHBL 1RZGB 4G6FB 4ZPVB 5E08H 1T5XA 5DDHB 3K1KC 4UILH 4ZUVA 5GGRY 5IJKC 4MA3B 3KJ6L 3W9DA 4Z7WB 3ARWA 3O2VH 5IBLC 1RUQH 1OGAB 1C5CL 3RZCB 1FZKA 5JZ7C 2X4PB 2JIXB 2IH1A 4PJFF 5HY9B 4Z7OF 4LDEB 1NANH 4L9LB 1GZPA 3W81A 1T89C 4M7KH 3ZHLA 3WLWC 4B41A 1U2CA 2OMBA 2MQCA 5A2LH 2R29H 1A02N 4NO5A 4Z5RB 2ZUQC 1U8NB 3IFNL 2NYYD 5E8EA 3BVNB 3L3HB 3FB6B 1QPPA 4G8GA 1ZGLM 3QUZA 4YDKH 5IIEA 4ZTPL 1A6TB 3J8F7 2HT2D 4YX2L 4K9EC 3RUGA 1RUKH 2F53E 4IRJC 4KH2A 5C0AB 5SWZD 3V95A 1A14H 1WF5A 3T4AB 4I0PD 3BZ4B 1IARB 2ZCKL 3MOBL 5EOCJ 2CLZB 3E6HA 4MWFA 2EYRB 1FIGL 2FYYA 3O4LB 1U58A 1ODAA 2V6HA 3PWPD 3PWVB 1IEHA 1ETZB 2CDFA 3WFHB 3MV8A 2ARJA 4DKEL 4F33B 4MJ5A 4JY6B 5IK3B 1CDIA 1UKTA 1WUNT 3O6KH 2FX7H 2VDLH 5CJOL 3EJZD 4FTVD 1L7TH 3NZ8B 4Q9BA 4PRIE 4N0CC 4M62H 1ULVA 3GNML 2V2WB 1HSAA 5CWSA 3SKNA 3TO4D 1YYLH 5DR5L 4ZFGL 2EDNA 3VJ6A 3QB7C 5DK2B 1IAIH 3BIKB 5DWUL 3MGOB 3L3DB 4QRPA 4Y5VB 1DBJL 4OGXH 4YK4B 3QJFB 3LS4L 1NSNL 3V79C 1Q0XL 3BMWA 5ID0A 2B39A 1KPUB 4QEGA 3C5ZD 5CMAA 4JRXB 3QIUB 2X89D 3HMWH 3KWWB 2IFGA 3BZDA 1J5OL 5C3LD 1RAMA 1NDMA 4NQCE 2FH6A 4O2CB 4XPAH 4R6UA 1RSFA 5KW9L 2AQ3A 3RHWF 1EX0A 1NCNA 3IDYC 1UWGH 3QH3B 3QP3A 3A6BL 1VERA 3UZEA 4KKCD 1M7DB 1FCCA 1G7PB 2NY2C 2E7MA 3DETC 5T5FH 4JZOB 3CFBB 2F54A 2H45A 1MFBH 1PFCA 1PLGH 2Y06H 5C0JB 1FL5A 5IV2B 4ZXBC 1CQKA 5JIHA 4U1IB 5IJVB 5SX5H 1W72B 1D5XA 4PTTB 1XF5A 2IPTH 4NJ9L 1OAYH 1UB6A 4NWTL 3IGAA 3QXVA 5TQ0H 3TC9A 2R8SH 1CWVA 1WTGT 3L1OH 5TJWK 3SDYL 3KDMA 2P43B 2ZZUT 4PRAA 1R24A 1CBVL 1OP5H 3L6FB 4K7PH 2KDGA 2OXGA 4EDWH 2FR4A 1A21A 4QRQB 3ESUF 1A9BB 3B9KB 2EECA 3WE6B 3QG6B 1KEMH 2QSCH 4X5XA 5EDXA 2H3NA 5I16B 5DTFA 1UADC 1OVZA 2D2OA 2QLVB 4M8QB 5D7IA 1CLOH 3ET9F 1QO3A 1S8DB 1FGNH 4QOKB 1KB5H 5DD1L 3E2HB 5BJTB 1GCFA 4AG4H 1F58H 5LG1A 4CVZA 4LHUG 2KPNA 3Q6GH 4KI5F 4Y2DB 1O7SA 2ZSWA 1LO2L 3EYVA 1CFNB 4PJ5A 1J05A 4KK6D 2NTFB 2D7TL 2VXSL 3P4MA 3B6SA 4Q58C 1AKJA 5DA4A 2V7NB 2K1MA 5T33H 1CGWA 2AGJH 3AREC 4IIQC 5J9PB 2A74B 5IQ9A 2OJZH 1YECH 3DVNB 3FOLB 4PUBL 3OB0K 3EHBC 1RU9H 1PG7X 4F7PB 3HR6A 3EW3B 3BRDA 1DDHA 1INEL 2D7NA 1U9KA 4RDQF 4PJDF 1D6EA 4NQED 1U3ZA 2JB5H 4G8FB 4KZEL 4FG6D 4QGTA 1NGQH 1T2XA 2NX5D 3KVQA 2PXYD 1QTYT 1ZWIA 5E8NB 1NGPL 3T0VA 4OF3A 1INQA 2PTUA 4I13B 2J6EA 1G7HA 4UQ3B 3QEQE 4J8RB 4NYLB 1S9WA 3QI9C 4KJQC 3V6FB 1P1ZA 4D0DB 5JQHC 4PV9B 5AYUL 5B8CB 1A1OB 5EOCH 3IFLL 3OKLB 4Z7UE 4CDHA 4PREB 2ADJB 4WDIB 3ZT5A 5D6CA 1ITCA 4NKIL 3H9HB 3G6AA 5I2IB 3FL7A 3GI8H 1FZMA 5D6DC 4J4PC 5SWSD 1T4KA 5EB9A 2VDQL 2YZ1A 5IEKB 5C70A 1EEUA 4IRZH 5E2JA 1UWXK 1M71B 1ZT1A 2IPUG 4WIQA 1J88A 1HH6A 3MCLL 5DLMH 4WCYH 4OZFG 4ISVA 4PLNC 3GIVB 1NBYA 4KQ4L 5TE7L 5HHMD 4ORGA 1QRND 1WBXA 5B38A 3R06A 1SJHA 4YE4L 2JB6A 4OZIA 4S1DC 4XCCH 3FFDA 3TO2B 1CE1H 4KUZH 4XNQB 3KYMB 2EDDA 3RQ3A 1NCDL 4QTHB 2EC8A 4OLYH 4I9WE 4OBSA 1I9JH 5DD3L 1JHTA 4ZDHB 2Q76A 4IRSD 4RGMB 2V9RA 3P11L 4OQTL 5C0DB 4KTEL 5A16A 3B9VA 4P2YA 1OCWH 1RIVH 5DEFA 4HS8H 3QR2A 5GISL 3R1GL 2I24N 3T1FA 3DBXB 3QPQD 4HF5L 4Z7VF 1DSFH 2O5XL 3LRSA 1IGIH 3GJFB 3QNYB 3TBTB 1OT1A 2ITDA 4YXLL 3V5KB 3VFUB 4DVRL 1SBSH 2BDNH 2ED9A 5I1HH 3KPPA 1LDSA 4LLYB 4LLUA 4GBXB 2UWEA 5D2LA 2EYTA 1CDCA 5HGGS 5C71A 1F90L 4PJBE 2DLEA 2W92A 4L29B 2VDML 4UB0H 1K3IA 4Y4HC 3T04D 4TULL 2DS4A 2D4FA 4JFEB 3C5SB 9CGTA 1A5FH 1EGJA 4G7YL 1N3NB 4EJ1C 4BQ9A 1QQDA 3WNPA 3C6LC 5C9JA 3A67L 4DN4H 2DIBA 4M00A 1HI6B 3MRPB 5CZVL 4PJ9C 4LPWA 1NFIA 4X4XB 5HHPB 3VA6A 4TNWK 4LDOB 1K4DA 4XC3H 1AO7E 1QSZA 3ULVF 1KPRB 3HI1A 4G9FA 1QEWA 3BUTA 4LIQE 1EFXA 3IU3A 1NCBH 2P24A 5D1QD 4JHAL 4OKVA 3VDCA 2P49B 5GS1B 3LQAL 3LSOB 4HGKC 3BH9B 1BJMA 4AENA 1RFDL 3QEHB 4R7DB 1AI1L 1IAKA 4PRIB 3W0WB 3DX8A 5KOMC 2DQCL 3INUL 3RGHA 1VGKA 1YY9D 3IDUA 1RHHA 3MRCB 4OTXH 1NGZA 2QEJA 3TYGL 2B5IC 1TNNA 3DUHA 3OWEA 2UY6A 4O2EB 3G6JE 5FA4B 5GSRB 3UTOA 1HHIA 2FBJH 3UDWC 4EXKA 1NCTA 3TPKA 2ZCLL 1FO0B 1CDUA 3VFWA 5DT1L 4S1SL 3UZQA 2XIDA 1FL6B 1FNHA 2V5MA 2IPKB 4PB9L 3DYPA 5HHNB 3PWLA 3QO0A 4MCYB 1MUJA 4PJAA 4NQCB 1B2WH 4PRNA 3MXVL 1SJXA 3NOIA 2FD6L 1YPZB 2NXZC 3DMMB 3TN0A 3CDCA 4P46A 4HWEH 1NFDE 4Y4FB 1XF3B 2JLLA 2DYPD 2FGWL 4ODTH 3W9EB 1P7KB 1WLHA 1GGBL 1KPVA 3GHEL 2VLJE 1I1FB 3NN8A 4OCRH 3OG6B 5HGHA 1T3FA 1OB1B 4GRMB 3JWDC 5CBEB 4XC1L 5T1KB 5DS8B 2IBBA 5FHBH 4PJXB 1T1XB 2GEEA 3QFJA 1UQSB 5A2FA 5JUEL 4YDIH 2J4WH 5EC2B 4D9QD 2ZOLA 3VW3H 4O9HH 3TJHD 3BT2L 4V1DE 4P3WA 2YPLE 5GPRA 1CE6A 1JZ3A 1NAMB 1H15B 3MLVH 4GXUM 4DN3L 4FXLA 4Z77A 5I8CA 5JNYB 3I3BA 1ES0A 3HE6B 2Q20A 2WUBH 1B0GA 4I5BB 4JO3H 1LO5B 3G04B 5J1TC 1BAFL 5JPMA 3QQ9D 4PLKC 4RGOH 1GOHA 5TGBB 4ZODA 1CDHA 1AP2B 3IKKA 1DBML 5IFAH 2ADFH 1KCVH 1YEFH 5GGRB 1WAAA 4UBDC 3DLQR 3GKWH 3QUMH 5ISZB 3B8SA 1QSED 1D5MA 1ACYH 4N5ED 5JXEC 5TQ2L 4J6RH 1SEBB 1O5DT 2RQ8A 3TVMB 1UZ6E 4KZDL 3F12A 1IGYB 1RD6A 5JW5A 1QYGL 2BP3A 3HI6L 4G5ZL 4L8BB 3GSNH 2YD1A 2GAZA 3F7VB 2W0FB 1I1YB 1YN6B 2W07A 4LCCC 5EFIB 3TP4A 1BREA 3DX9B 4N1HB 4PP2B 1B4JH 2VR9A 4I0PA 5I8KL 2R1YB 1D5IL 4JFQB 3U4EB 3QFDA 3O2DH 4I48A 3LOWA 3QEQB 4Y8AA 4TVPD 5A2JH 2HJKA 5FUCE 3ARDB 2WZPD 5HJ3B 3EGSB 2C26A 4Z7UB 1ORSA 4Y5YC 3QCVH 3ULVH 1LE5B 5KSBF 5EZLA 32C2A 5J0BA 4G42B 2CD0A 2XTJB 1Q9WB 2EDRA 3GI9H 1TCRA 2CMRL 3TO4A 1AQKH 1IBGL 2G2RA 5AZEH 1WC7B 3QXUA 2YK1L 1T7XA 1MJ8L 4ZTOL 4M7ZC 4JPVH 1T66D 1I1CA 2W9LA 3FN0H 5F97E 1I3GL 2X70B 3QIBC 1FYTD 5F89A 2A73A 2VAAA 2GFBB 2XY1A 4M1CC 5IT2H 3GMRA 3AUVA 3CFDB 5EN2A 5C0RH 4JG0H 1WWBX 4LVNC 4HS6B 4ONGL 2O5YH 3NH7L 1FH5L 4PB0H 3S88L 2WWMC 2VXQL 3QIWA 4YZFF 1TZHA 2X4SB 4F2MB 4YDJA 1XH3A 2CIKA 3HN3A 5IMLB 2J88H 3FB7B 3MGTA 4JO4H 5DRNA 3M17A 4N8PA 2NNAA 4H8WL 5ALCL 4JFDB 4PJ7F 5C6PB 5F6HJ 2PF6A 4U1NA 2LAGB 2BY1A 4HIEA 4KHXL 5KS9F 35C8L 4KK9D 5CD5C 5IMKB 3V0VA 5CCKH 1YMMA 5I1EH 1XFPA 4NT6B 4PPTA 4WI8A 1EAPA 4Z7QE 5MHSE 1NC2A 4HDIA 4C83B 4ELMF 1AJ7H 5IMOB 3U30C 2Z8VC 3KYNB 2MCPL 2ZUWA 5EWIH 1N0LA 1ZHNB 3AM8A 3SE4C 2IBGA 5D7JB 1P9MA 3CZFB 3MTRA 3E3QE 1JYXA 4ZSOE 3ULUF 1NMCC 4BFGA 3OR7B 1XIWD 1IL1A 2R0LL 4XXCA 4NP4H 5F7KC 5EORH 5I8EB 5EBMB 1H0DA 2HA1A 1V3JA 3CFKB 4I3SH 4PD4J 2AK1L 1PSKH 2EICA 2A0LC 3GHBH 2P5WA 1XF2B 2NY3D 1HH9A 3DTXA 1BQHA 5A40E 4WI9A 4Z7NF 4U2ZA 1EUTA 2ZOKA 2W60A 4HIXH 1KLUA 3W9DB 4NQTA 5FCUL 3JV4A 3MV11 3GSQB 3HAEG 2CK2A 1A6UL 1FZKB 1C5CH 4XPBL 4MQXD 3F58L 4QTIL 2IH1B 4D9LL 1DQQB 4YLQT 4BQBA 1XT5A 1GZPB 5FV1L 3PQYA 1PD6A 3ZT6A 3QDHA 4HGWB 4XP5L 1MEXL 3G5XB 4U1GB 4NQEA 1OTSC 3P73B 4CNIA 3NA9H 4NO5B 2GSGA 2NX5A 5E8EB 1U3HD 2X44D 3DX7A 3IFNH 1FFOA 2YMXL 4MLSA 1Z5LB 1KN2L 3QUZB 4XAWL 1UGNA 4IDLA 3PV7A 4ZTPH 4FXGB 4GRLC 3VG0L 2R0WH 4JB9L 4YX2H 2RFXA 5D2NA 5F3BB 2EE3A 3EJYC 2ICWA 3FRUB 2VE6A 3LY6A 3MOBH 2FYYB 3BH8A 2V2XB 4MJ4A 2CDFB 4ZS6C 4U7SA 3MV8B 2X1PA 3DHJA 3T0ED 3BD4A 4MJ5B 3FT2A 5M94B 1NFDB 3RGVC 2MCG1 5CJOH 3PWJA 5C2BL 1D9KB 4LHUD 1WV7T 2J5LC 2NMSA 3FHAA 3GNMH 1U93A 1HSAB 5CWSB 3RWFB 3SKNB 1A6AA 3VJ6B 5F1IB 5DR5H 1Q0YL 3EO1A 3QCUL 4G3YL 1N5AA 2C3WA 5F9OL 5DWUH 4LQFL 3EKCA 4HUXA 3VD5A 5E94B 2Q7YB 1F3JA 1QRNA 4KK8C 1MFNA 3OPZL 1FVEB 1NSNH 2OYPA 1Q0XH 4OV5A 1F3DJ 3GSRA 3MRBA 2Y72A 3TNNA 5CMAB 4V1DB 1Y6KR 2NY6D 5IHLB 5KZCB 3W5MA 1U8KA 4BZ1L 2ZUTA 1LD9A 3LD8C 5IFHL 3OR6A 1J5OH 3MYJA 4NUJA 1RQ5A 2A83B 1WIOA 4FQQA 4F3FA 5KW9H 2DQJL 3U4BL 4OIAA 3A6BH 3PDGA 3BXNB 2HFGH 4DGYL 4FQJH 7CGTA 4Y16A 5ID1A 2F54B 3VCLA 4KI5D 2XN9A 4OAWB 5IG7A 1FL5B 1YJDC 3T2PA 4NSKA 4W4OA 4G43A 1EIBA 4R7NA 2PUQT 1XF5B 3S37L 1NC4A 1UB6B 5ITBL 4YBLB 1RZIA 4MNQE 3IGAB 2VL5A 4WV1C 5C6WH 1EBPA 4KKBD 2D7MA 1ZGLP 3QRGH 4OIIL 4PRAB 1R24B 3LKNA 2OQJA 5E9DD 1CBVH 5ENWB 2FR4B 2HJLA 5I1GH 3HAEH 1N0XH 2B8OT 2XQYK 2D0FA 1IAIM 2RAMA 3VD3A 3GJEA 4HKZB 4X5XB 1ADQL 3WHE1 2H3NB 4F7MA 5DTFB 2HTLC 5GJTL 3ZKND 3CUPA 3GKZA 3WCYA 4XBPA 4ZUSA 5D7IB 1P7QD 1LILA 3ULUH 1A6WL 2JE8A 4XGZA 2PO6B 4YFLI 3MRDA 1G1YA 1ZK9A 4NC0B 5DD1H 4CVZB 5C2UB 4N90D 1KGCE 3AXLA 4FNLL 3KPRD 5D1QA 1MVUA 2GI7A 4FQXB 4RGNB 4WI2A 3OXSA 2F8OA 4X0KA 2PCPB 3RY6A 3B6SB 3DRTA 1T7YA 3I3DA 4QRSA 4HXAL 2OK0L 1J8HB 3WIFA 3ARQA 3GMLB 2PN5A 5IHZA 5IQ9B 4UOW0 5L7XL 1BFVH 4PUBH 1IGFH 5CUSL 2VLKE 1B88A 4P2OA 1RMFL 1W0VA 1INEH 1DQMH 1D6EB 3IS1X 5LCVL 4FFYL 1CXFA 5SWZE 4KZEH 4QWWC 5DUPL 2D03L 4P4KD 3RU8H 3UO1L 3HMXA 1ZWIB 3ALXA 3OX8A 3AMLA 4CN4A 1BD2D 3CJJA 4P9HL 4LSPL 1KCLA 3AAZB 1L7IH 1S9WB 4QRTA 4BH7B 2EE6A 1P1ZB 1NGWA 3MR9A 1AIFA 4OGAC 2JCCA 2VMFA 3IFLH 4NC1C 4X80L 2DYPA 3EOBB 5JTWA 4FTVE 1RVFL 4CMMA 4J1UA 5I18L 5JIPA 4WW2F 3DVIA 3G6AB 1WZLA 3TLRA 3ZDYF 4GAYA 4UUJA 4Y5VC 1G1CA 4YK4C 3NAAH 3QPXL 3BKYL 4H20L 1QPXA 3F7RA 1TJHL 2VDQH 4N0UA 5FECA 4UQ2B 5F71A 4CJ1A 3WFEL 3S36L 4PV8A 1DUZA 4Q6YA 3EDDA 2IADA 2VN7A 2Y5EA 4PJCA 3NABH 3K80A 3NCYP 3ARBB 1IC7L 3MCLH 4ISVB 4XCYB 1HIML 1NBYB 3L95A 2HP4A 4ORGB 4KQ4H 4ENED 1WBXB 3TJEL 3R06B 5CJQL 4K8RL 1SJHB 1DLFL 2JB6B 5I8OL 3TCXA 3U48A 4OZIB 4YE4H 1X7QB 2X7LA 3CDGA 3IDMB 3B9DA 1NCDH 2Q8BL 5D5MA 1QBAA 4K3EL 3VFOB 1R3IL 2AXJA 1PY4A 4ZSOB 1TZIB 3MRRA 3UCRA 3FAXA 2DQFA 4OQTH 1X44A 1FORL 3IDJB 3TFKC 3AGVA 1JF1A 3I02B 4P5MA 5GISH 3R1GH 2ZG3A 1FVDB 1HHKA 3G5YA 5MEOB 4WI6A 1QD0A 2J8UE 5FB8A 3T65A 3PABA 4HC1L 4FQ2L 3I9GL 4CVUA 3QG7H 4DVRH 3KPPB 4JFZL 4LLUB 5TF1L 3IDIA 3V8OA 2QKIA 5ALBL 3VXSB 3ZTJG 1TLKA 1A3RL 3V6OE 1SY6A 4R2GB 4LASH 4K9EL 2VDMH 4TULH 1J18A 3RRQA 2BSSA 2BRQA 5I73B 4Y4KB 4G7YH 2YS4A 2Z93A 3VRLE 1JNNH 4CVXA 3A67H 5CZVH 4WHDA 3IDGA 3HB3D 4M9PA 3D0VA 4YIQB 3TBSA 1K4DB 2A6DA 3UZVB 4YEFA 4ZAKC 1RJYB 4LFHG 4G9FB 1NCAL 1IGCL 1MRDH 5JIIA 5LKNA 3B4NA 1QKZL 4ODVL 2P24B 4HS3A 4OKVB 4GG6E 1EAJA 4JHAH 3RWHA 1RUPH 3V52L 3IXTA 2ADGB 1S7UA 2C3VA 3GBML 2R23A 3LQAH 3QDMA 1YNKL 4M02A 2Q86B 5DYOA 3CCHA 5HHOE 1A6ZA 2IEPA 4L3EA 1BOYA 1RFDH 2DB8A 3CLEH 1IAKB 1G84A 1AI1H 4XNZB 1JZ5A 4JDVB 2DQCH 2ADIA 2DM3A 3INUH 3ISWA 5ESVA 3OJDB 1VGKB 1ZAGA 1UCBL 4PJHE 4GXUN 3GB7A 1T7VA 1IAII 5J1AA 2BFVL 1HHIB 1Q9KB 3JVGA 2ESVE 2I9LA 3NFPA 3I6LE 4LMQI 4Q6IA 3KPSD 4G9DA 2DDQH 5D70L 4XVTH 4XB7A 5CKGA 8CGTA 1MHEB 1B0RA 4HQQH 3AVEA 4QXGH 1Y18A 4RQQA 3PWLB 4OCXL 1ROWA 3DRQA 1MUJB 4NCC1 2XG5A 1HN1A 4PRNB 2W9DH 4U49A 3MXVH 3STLA 3WV0A 1HYSC 2FD6H 3EYQD 4EN3D 3BPLB 4EUPB 5SWSE 3TN0B 4P46B 5JOPD 1HQ4A 5DFVD 4JPKH 4KRMB 2FGWH 2GTWA 3L3IA 4MAYA 1S7TB 5DSCB 5J6GA 3DV6B 3QXDA 3PL6D 1KPVB 1GGBH 3GHEH 4KTDL 3LKSA 1T3FB 2GCYB 2XG4A 2NY1D 2ZNXA 3MLUL 3CDFA 2AJ3A 5KAQG 1PYWA 1VSCA 1MCRA 3ILQD 4RGMC 2I26N 4ACPA 5DRZA 1DVFA 4DJMA 5FIEA 5JUEH 2ZOLB 1WQVT 3CLFL 5CEZE 4M5YH 3BT2H 3ZYZA 3FZUC 4CADB 1OL0A 2HVKA 4DN3H 5I8CB 4KVCL 1PQZA 5ICZA 2VZOA 3E8UL 1EEQA 3C60C 4ZUWA 4Z7WF 1AO7A 1B0GB 2P8PA 4IMLB 3TESA 3JTTA 4S11A 3WS6C 3DGGB 3EIFA 3H9SB 4RMWA 2IQAB 4PRPD 4TRPL 1KYOJ 1MCNA 4K94C 3L3JA 1DBMH 1UJ3B 3BP7A 1KB9K 3O6FD 1JGEA 1F4HA 1ZLVK 3VI3E 2FEEL 4MJ6A 1JPTL 1M05A 2WIIA 1D5MB 4JG1L 1C12A 3H3PH 3TZVD 2CDEA 1Z3GL 1DLHA 4KZDH 3F12B 2YUZA 5EZIH 3KPQB 4AMKL 4EOWL 3T8XA 3WBDA 3EO9L 2E7CA 3S3PA 5HBBA 1QYGH 2R2CA 3EBAA 4QF1A 1MIEH 4UV7L 3HI6H 3SKOB 4G5ZH 2LVCA 5A2IH 1YNTB 3F7YA 1UXSA 3U9UA 5K59F 5IB2A 3VFMB 4L8DB 1EHLL 1QG3A 3GZKA 3EDEA 3DPBA 3D69A 5FAAA 5SWZB 2DQEL 3QWQB 1Q72L 4A2MA 4I0PB 5C09A 3P4NA 5I8KH 3PV6A 3QHFH 2KZWA 3K8MA 1D5IH 1ITBB 1CDYA 2DIAA 2XXMB 4NQDA 3V7AG 1PEZA 3OTTA 3PWPB 1UH4A 3UMTA 5L9DL 2CRIA 5EO9B 2YPVH 2HJKB 1NLDL 2DF3A 1BM3H 3MO1B 3OAYH 3TYFA 4TPRH 4D0CB 1FCGA 3U7YL 5EZLB 32C2B 2B20A 1AGEB 4FTVB 4NOFA 4CN6A 5F9WB 1JI2A 4QRRE 1TCRB 6CGTA 5E00A 3TO4B 5BV7H 5FEBA 1I1RA 2CMRH 4E0RB 2ZSVA 3ABZA 3GSOB 3L9RA 4GJTB 5DXWA 4ZTOH 4EI5A 4P2OC 2QHRL 1I3GH 4K7PY 3K74B 3D39D 2BNRA 2VAAB 4G6AC 5DC4B 3AS3A 1JNLL 3GMRB 3HRZA 1KCUL 3PP3K 1ZLSL 3C5ZB 5EN2B 3DMMC 4HV8A 2WUCL 3H6JA 1H3PH 4RAUB 4Z95L 4ONGH 3NH7H 1FH5H 1NUNB 1DANU 1Y6MR 4YO0B 4AQ1B 2LTQB 2XT1B 2BVYA 4J3OC 4JR9L 3ZKQD 3QIWB 3QDGD 4OV6F 1TZHB 4NUGL 3SGDH 4YDJB 2CIKB 5E8DL 3OG4B 4L5FL 3BWAA 3MGTB 5ELIA 5DRNB 3M17B 3CDYA 3SDXF 3VGBA 5HDBE 2PNDA 5I1IL 4U1NB 1UKSA 3OAZK 3OGCB 35C8H 4KHXH 4MA7L 4FABL 4KKLC 1JWMB 2UVFA 4YHYB 2H9GA 4BZ2H 1YMMB 3OV6A 1AFVL 1NKRA 2CKBA 3HE6C 4XPTL 4D9QE 3P40A 4OFIA 5J13B 1KC5L 5DVKA 5T1DH 4BK4A 2DWEA 1MSPA 3EJJX 4HDIB 4U6VL 4ZFOA 4OB5L 5E9DA 5FF6A 3LN5A 3MLPA 4JVPA 3D3VD 4JFHD 2MCPH 5D72L 3MUGA 4AIZA 4CU6A 3VXTA 5TPWH 4S1QL 1CG9B 2BVQA 4OZFA 5KTEL 3QHZL 2F15A 2OL3A 4JM2D 3FQRA 5DJDB 2R0LH 5I17A 1TQCC 1H0DB 4JAMB 4U1HB 4M6OL 4FA8A 2AK1H 1P4IL 5AAWA 3CXDL 3MC0A 2P5WB 1YYML 4BSVA 4YQXL 1HH9B 5CD3B 3MMEA 3CVHL 3VI4E 4MD0B 4Q97A 3KYOA 2W60B 1KLUB 2OP4H 3JSSA 2WBJA 1A6PA 5DZLA 4OF7A 1PDKA 2EXWC 1OW0A 5FUZL 1QFHA 5AWNL 3MLTA 4AQOA 1A6UH 4XPBH 3F58H 4OZHA 3MA7B 5D1XD 5KVEL 4F7EA 3MREA 3PDDA 3G08A 3KJ4B 4NQEB 4XP5H 1MEXH 3VXRE 1EO5A 1NMAH 2NX5B 2VZTA 1UVQA 4FQIL 3DX7B 2PXYB 1N8ZA 1FFOB 2YMXH 3CFJA 4LCWE 1BD2A 1JUFA 4PP1D 4OLXL 5D2NB 1OLZA 3VG0H 4JB9H 1DJSA 1NGYB 4Z78A 1KLGA 5DJZA 1CK0H 1R3HA 4RRPG 3BH8B 2VAJA 1JZ2A 4IJ3B 5I74B 1UACL 3WNOA 3WHXA 3E6FA 4KDWA 1GZQB 1Q9OA 3JWDL 2XWTA 3SDAA 3O3AA 1SEQH 3VWKD 3GO1L 1R5VA 5BW7A 2X9YA 5HI3C 3C9NA 5C2BH 5IBTH 1E6OL 4A6YA 1RZ8B 1U93B 1DBKL 1R5WA 3HUJA 3L3GA 4AL8L 1FYTE 1HDMB 1J0HA 1JGUL 3AY4A 4XXDA 1Q0YH 3QCUH 1N5AB 5C0EA 4G3YH 3SKUD 5F9OH 4HUXB 4LQFH 1BZQK 1T1ZA 5HHMB 4WO4A 1QRNB 4Q6IC 2JKXA 4C56A 3SCMA 4JZNB 1S7VA 3GSRB 3S5LG 4NM4L 3RIFF 1IGML 1JK8A 5D4QA 1K8DA 4YXHL 5TDOA 4TVSa 1GC1H 1U8KB 1MCPL 3B43A 3OR6B 4BZ1H 5K9KB 5IFHH 1B6DA 4IRSB 1I85A 1U8QA 3OKOA 4XCEA 4JRYD 4YBQC 1W72H 3U4BH 3VE0B 1ZS8A 3ZL4L 3MFGB 5F1NA 3UYRL 4D2NA 1MIML 4DGYH 2SEBB 1JIBA 4U2YA 1S5HB 5HHQA 1XCTA 3N85L 1JFQL 5GRUL 2QQKL 2W0PA 3U46B 1AHWA 4LVOB 3RDTA 4X7SL 2BZDA 4RMRA 5D7JC 5ITBH 5JLZA 5DJCA 2VIRB 2R0ZL 1T03H 2VL5B 3JV5A 5MENE 3PXJA 2CXGA 5E8OA 3MRQA 1RZJL 3LKNB 2OQJB 4OIIH 1C8PA 3FTGA 2HJLB 4E41E 4O2FA 3M07A 2BHYA 3X13A 5K9OA 5HHXL 4O4YH 4NKMB 4WTXA 1ADQH 4YXKL 4N5UA 4P9ML 3NIDF 4ZUSB 5GJTH 4S2SA 3PNWA 2XPGA 3LH2L 3BYTA 1HINL 4XGZB 3K2UH 1YDPA 3V5DB 2A2QT 4P2QD 3D0LB 3ZSTA 4ONFH 4UAOC 2VDNL 3C2SA 5DRXA 5D1QB 1MVUB 4XHQA 3D85A 3U0WL 3VDAA 3H3BC 3OXSB 4EIZC 3ARYA 4NGHL 4X0KB 3RIAK 1FVCB 3H9ZA 1S7XA 2ENYA 1BJ1H 1ZT7A 2GK2A 3MV9D 4QGYA 4HXAH 2V9QA 3ARZA 4EBQL 2R1XA 5FOBA 1ERNA 5J3HC 4W81A 5L7XH 2J6EL 3UJIL 5CUSH 2MWCA 2YD7A 3VXMD 3KNBA 1W0VB 4YDVB 4K3DH 1RMFH 5C0IA 3FONB 1CL7L 3P9LB 2B1HL 1B3JA 5LCVH 2CRMA 4PY8I 2P5ED 5TE4L 3JWOH