4OGYH

Crystal structure of fab dx-2930 in complex with human plasma kallikrein at 2.1 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
219
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasma kallikrein
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/antibody
total genus 41
structure length 219
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogyH01
4UAOB 3L3OB 3I3DA 3TFKC 4JKPL 4R8WH 2NY1D 4PLNC 1WSST 3QH3B 4NT6A 1WC7A 3RVWC 4HUVA 1TVDA 1J5OL 4YFLF 1JL8A 3LV3A 3GSNL 5IVXA 3O45A 3NCYS 2HFFA 4OB5L 1TENA 3S34L 1V7NL 3EJYD 3BKJH 2W60B 4XPGH 5DEZA 4OCSH 2HT3D 4WRLA 3L5WA 1T7WA 3MRCB 4X80L 4DQOH 4JY6A 3P4MB 3H8NA 3DIFB 5TE7L 1EUTA 3ALWA 5DDHB 1LE9B 1KBGH 4M62L 5HJ3A 3GSVB 4XBEH 1REIA 4FA8A 4PYGA 3HAEH 5L7XL 2CUHA 4FQ2H 3MRIB 4LSRH 2LV4A 4CUCA 4JHAL 5JPMB 2IFFH 1MY5A 4JQIL 3WD5L 3OG4B 3VFNB 4QHUB 2YPLA 5B3NA 1TTFA 2ZSVA 1QG3A 3I84A 4MCZA 1ZS8A 5KSBA 2BY0A 4XVJH 1JZ2A 4LSVH 1KIPA 1PFCA 2OXHA 4M1DL 4LARL 2YD9A 4ZSOA 1NC2A 2G9HA 1MHPH 1EH9A 4F9LC 3H9ZA 4NC1E 3H7BA 4GG6B 5AYQA 3HLAA 3P11H 3U9PL 4RWYH 5ETUA 2DTML 4Y16C 2VDQL 1PSKH 2EYRB 5MI0B 3RKPA 4O2FA 4MQ7A 4DK6A 3SKOB 2N4IA 4NJAL 3RGVB 3UTTB 2LQRA 1FVDB 4NM8H 3D18A 5K9KB 5INDB 4LHUD 2J3SA 5IVZB 4J8RA 5D1ZB 1NGPH 3BZEB 4NC1C 2A38A 1U8QB 5BOPA 1JYNA 2FHFA 1EJ6A 4JO3L 5BO1L 4W68A 2AK1L 2WLZA 5CGYC 1OARL 2EEDA 3QUZB 2WAHA 4NQEE 4PRID 4DW2H 4BQCA 4XPHH 5KSUA 4I77H 1V8HA 4X0KA 3Q1SH 4JN2B 5GRUH 3LEVL 3CFBA 4KUZH 4WEMB 4HWEH 1OB1B 4JJ5B 4XCFH 4G43A 3FT2B 5GGVL 1A7RL 3RTQD 4Y2DA 5HI4C 1S7UA 3VRJA 1BEYH 4ZUTB 3OXSA 1T1WB 4KROC 5KJRL 4K07A 4WUUD 3NA9H 4F7CB 2XT1B 1SMOA 4TTDC 2EDYA 5EO0B 1TQCC 5HYJA 3LN5B 3STZB 1T2XA 3MLSH 4KPHL 3V6ZA 1Q0YL 1EBPA 3CPLB 3TA3A 2XZQL 3HE7D 1C12B 4PJCA 1QFUL 4ELMF 3SCMD 4HT1H 3HN3A 1G7LB 3BD4A 4X4XA 2EDHA 4M5ZL 4TPRH 2NY6C 3I85A 4OQTH 1XZ0A 4XGZA 1MRFH 4HC1L 1GC1L 1QEWA 5JIHA 5GZOD 4LSQL 4JFXA 4HIEB 2P5WB 4KDVA 1VENA 4HFWB 3QUXA 1KIQB 4H26A 4EN3A 3QI9A 3FAWA 2DQUH 2CK0L 4FXGB 3GI9H 1GC1C 3LS4L 1FN4B 3P73B 43C9B 5IMLA 1QO3B 4NRXA 5CD3B 4GAYB 1V3KA 1DN0B 1UKTA 2BXZA 1N5AA 2IBBA 3I50L 4ODSH 5F9WC 4OFVA 4KRPD 1DFBH 1F4WL 1XF5A 4P99A 1N0LA 4OFPA 1L0QA 3UYOD 3JV0A 3ZDZE 3LHPH 1UXWA 4Z5RA 3V4UL 1AJ7L 3Q6GH 4NKMB 3ARGC 4PRPE 3DRTB 3WIHH 3RWGB 3DTXA 3JV4A 4RDQG 2BSSB 2O5ZL 3W9EA 3U2SB 2PYFB 3UCRA 4BSVA 4L8SA 3QXAA 1S5HA 5JHDA 2MCPL 4P5KB 5AYUH 4LVHB 5MI0C 4YBHA 1HHHB 2NY0D 5L2KA 3BH9B 3ILPB 3ZE2F 2ZUYA 5D1XD 1ZLUK 1LO4L 2FJHB 3RGVC 4KVCH 4TNVK 4OCRL 5JXAH 4ZDHB 4Q9RL 2YEZB 3TN0C 1YMMD 2YZ8A 5BXFB 4R7DB 5CIPA 1N26A 1JZ7A 1NFDB 4NNYA 4QEGA 3OQ3B 2DQJH 2IQ9H 5DD1H 1MAMH 3F8UB 4R7NA 1HHKA 2DQDH 1Q9WA 4MB3A 1B0RB 4OZHA 4ZFGL 3BPNB 1G6VK 2ICWB 3K2UH 1I7UB 3R1GL 3UDWC 2P5ED 3BVNB 2XXMB 4XCEB 3MRHA 5IW1B 4X4ZA 3BGMB 5TPWH 4FMFA 2CRYA 4EI5B 3VXTB 2OJEB 1FFQA 4CW1B 4QWWC 3O8XD 5C09B 5A43C 2AXJA 1J1XH 5KSAC 5HD8C 4D9LH 1X3DA 4X83A 2XZAH 3MXVH 1LEIB 3GRWH 4EQ2A 1U93B 3PGDA 2RIKA 4HKJB 3FB7B 4PR5A 2XICA 3T0EB 1J8HA 3V2AR 5D7JC 2OK0L 3LSOA 4MNQA 12E8L 2MCG1 4NGHH 5C08E 3WUWA 5KSVA 5DGRA 4OF0A 4JDTH 5I66A 4X4YB 4PJ9A 1YQVH 3CCHB 4NHCH 3LDBC 5IEKB 3IJYB 4UOW1 1G9MC 5J9PB 5EOCJ 1FIGH 3RWFA 2FBJH 3GJFH 1NJ9A 2FRGP 1DZBA 1KCVH 4U1HB 1T4KA 3E8UL 1JYVA 1YMHB 2R69H 2X42A 5T33H 5T5FH 1NAKH 2L7UA 3OKKB 3IXAA 4OJFH 4W4NA 3V5HA 1CFNA 3TEUA 4XP9H 4P23B 3JV6A 2G5RA 3L95B 1A5FH 4L29B 4D8PA 3IJHB 4NKDA 1CL7I 3PGFH 4LNRB 1CTOA 1NC4D 4PJHF 2GEEA 3Q5TA 4HBCL 5EIVA 3DX9A 5D5MB 1YEGL 4M02A 1EAJA 4ZXBB 3IDXH 4MAYB 5F6IC 3VGDA 4TUOA 3FOMA 1S7TA 5F7UA 4WFFD 4LVHC 2X4RA 4HKBB 3TBTA 5J11C 2HTKD 3NIGF 5CEYB 1FSKB 1S8DB 5FF6B 5GRZA 4S11A 4HK3N 4EDWL 4PY7B 3WFEH 3F58H 1U8KB 4KZDH 3PWJB 1X5GA 1GAFL 2QR0A 1AQDB 4DN3L 2I9LB 2HT4D 5KAQF 3BPLB 5D7LB 3MJ9A 5LWYH 4P2QD 4KMTH 3MACL 1RIHL 4H20H 4LVNB 3FT3B 5T1LB 4GG8B 3F7VB 3GMMB 4MD4B 3HS0A 5EU6D 4P57B 3SJVD 4U33A 1VGKB 1SEBA 3S5LA 3WYRA 4PRDA 2AABL 4RQQB 1IC7L 2R1YA 3UO1H 5HY9A 3O6FB 2YWZA 2AJVL 3WFCH 2P8MA 4P2CG 1NCDL 3WHXA 4OCMC 4PJEF 3UZEA 4MXWH 4OLUH 3L3JB 4FFZH 4DN4H 4PBXA 5E2VL 4OCXL 5GQBA 2R0ZL 2Z93B 4J1UA 5T1KB 5TH2B 4CADB 4NQXB 1OTSD 3WDIA 5C0JB 3RRQA 5GS2D 2BFVL 1ZLSL 1U6AH 4WVRA 3G6JF 3SDAA 2CRIA 3FN0L 4PJ8C 3I75B 1T5WA 2EDFA 2ZUSA 2YRLA 3RVTC 1A14L 3WKNA 4ONHB 1U91A 1JNLL 4W4OC 3RZCA 4BQBA 1OSZA 5AWNH 2QQNL 5IOPA 5EOCH 1XF3A 5CEXA 1HILA 3P0YH 1YECH 5B39G 3DRQA 1CICC 3Q5YA 1YN7A 1RFDL 2JJTC 2YKLL 4XRCB 1ZLVH 1PD6A 2RCSL 4OM1H 1TJHL 2CUMA 2A74B 4YGVB 4DGVL 5FYJE 3NVQA 5IHUL 1UB5A 2Z35A 4YR6A 2OXGA 2XPGA 3JUYA 5E6IB 5F9AC 4ODXA 4G5ZL 5JHLH 1QYGL 5IR1A 2VIRA 5DLML 5FYJL 1H5BA 4M8QA 4ZUSB 4H88L 2FR4B 4I0PB 2H6PA 2VDLH 2NX5B 4NP4H 4PRHE 2FEEI 2XWTA 3KJ4B 5ADOL 3MZGB 1MHEA 5DK0A 2PR4H 2C3GA 1DQML 3KJ6L 5T1DL 3VFPB 5KBNC 3MV8B 5GHWH 3U46B 1AE6H 2VABB 1UJ3B 4ZXBC 4MAYC 1UM6H 3BGFC 3OV6A 4LLMB 2I9TB 5EBWA 1LHZA 1B9ZA 5EOQH 4F7TA 1ULVA 1AGCA 4PLOB 1S7QA 3Q3GB 2JELL 1CGTA 3OHXA 4H1LH 2QADC 4XXDB 3HFMH 3BZFA 4HJJL 4Y2DD 2B4CH 3BPLC 4ORGA 4U2YA 5EC1B 1S7XB 4XVTL 2EC9U 3KAAA 3K8MA 4YK4B 1CFQA 3FMGH 2OR7A 1HCVA 5I1KL 2X6MA 3VI3F 3SDXA 4APQC 1EHAA 5HYJD 2YRZA 4DOHE 1A2YA 4ZPTA 2VXTH 1MY7A 3BEWA 4PLJD 4WV1A 3PWLA 1JF5A 4ZFOL 1NKRA 3P9MB 5AD0A 2VZUA 3JBG7 1JNHA 4DVRH 4UU9B 3BO8A 5CHNA 2VLRD 3HI1A 3FRUB 5IF0A 3RVUC 3SDCC 4KGJA 1E4KC 1UWGH 3BKCH 3NZ8B 1OTTC 4C54A 4NIKB 4L8BB 2PCPA 4OZIF 1U8LA 4NO3B 1KB5H 4EN3D 1S9KC 4GSDH 4RMWA 5TF1L 2APFA 2EKSB 5EC2B 5FO8A 4F2MA 3SY0A 4KQ4L 1UG9A 5EBMB 1ZA3A 3KYOA 5IVXF 1QD0A 1WEJL 4OD3H 1FDLH 4YWGH 5H94B 2VERN 4KKNA 1A0QH 3E6FB 1JHTB 1I1AD 3FQWA 1P7KB 4JZJA 4J23A 3HZVB 3BAEH 1MJJA 1C5CL 5MHSE 4PJDA 2MQ0A 3MRDA 2NYYC 5FM8A 3D69B 4OD2A 1QLEH 5EO1A 1MJUL 1A7NH 3ESUF 1DN2A 3RJDA 1UC6A 3VXNA 4H8WH 4IHOB 1E4JA 32C2B 1CQKA 1CGYA 2HTLD 2MHAA 5DUPL 4I0PC 2R4RH 4MS8C 1FJ1B 1NKOA 4L4VE 4JPWH 5GRVL 1N4XH 2AEPH 1IKFL 5KSBF 1CF8L 3MOQA 4PJXE 3QB7C 4L4TB 4KJPC 2CKBL 2KPNA 1RULH 4YHIA 1X9QA 2D0HA 1T1YB 2YBRB 4F37F 3DV4B 4FQJH 3V52H 4JFDB 3D85B 5LGHH 1FZMA 5E4EB 1NEZB 4NRZA 4QHLA 3HZKA 3M8OL 3BJLA 3GIZL 1YJDC 3HZMB 5DRXA 4ALAL 2F58H 2XN9A 4TSCL 1U58A 1VADB 4CRPA 5IMOA 3HZYB 4WWKA 2BSED 3A6BL 5FB8B 5KVMC 3HRPA 3AFLA 4QRQA 1D5MA 1XGRA 2FECL 3MRRA 4LPWA 1FORH 4ZAKA 1X7QB 2OR9L 5K9JH 2E27L 1S7SA 3VXUB 4YO0A 2RHEA 1MCNA 3ARRA 3CFDA 5IMMA 5FYKD 1LVEA 4DKEL 4ODTL 2HFTA 3JWDC 1LO3L 2BVYA 2VJXA 3DXAB 4XH2B 5IBUG 4OZ4A 1CBVH 2PTUA 1CXEA 2IH3A 1J8HD 3V7AG 3KXFA 4MNQD 4IRJC 4JRXD 1EAPA 4L3ED 3TVMD 4WO4C 2VQUA 2J8UB 2GYSA 3NIFF 4KV5F 2Y1VA 3W2DH 1LEGB 4PJ9D 2QQLL 1JGLH 2Y06H 2CDEB 4Z7NE 3NACH 4LF3B 1QRKA 4N0FB 3H9SB 1F97A 3PQYE 5E7FA 3TBSA 3KLAA 4RZCB 4GW1B 4GLRI 3CFEA 5C92A 5I16A 4KK5C 5C9JB 4X9IA 1MI5E 3EYOB 1YEDA 3OL2A 5ERWA 1JGEA 2VWEE 2O93L 5A16B 3RNQB 1IAMA 5DJDA 5CEZE 2BNQD 4M61B 3GHBL 4KXZH 1U8MB 4LEOA 2EH7L 5J1AB 5EU3B 3MRLB 3PABA 5CZKA 2JE8A 3HMXA 3UBXI 1UCBL 4Y4FC 3GMRA 5JORA 5JZ7C 4XAKE 5CEZL 5HHOE 4Z7UF 1AC6A 2VN4A 2YXMA 5DUBB 1G9NC 1H15B 1Q9KA 3OJ2C 3VFGL 1N7ML 2GK0B 3BQUB 3MOAH 1LEKA 3VGBA 4OLXL 2YUZA 3Q0HA 3O3EB 5D71H 4GRWF 2ICEA 1C08A 3PWVA 5DSCA 1IC5H 3RL1B 5D1QB 4JO4L 1TCMA 4JY4A 3EYUH 1KSRA 1KN2L 4M6NH 3T3PE 5DHVH 2NQCA 3IDGA 2C7UB 2H41A 5DVLA 1HH9B 4JKPH 3DX6A 4ETQA 4V1DE 4S1DC 4NDMA 1J5OH 5IB3A 2O5XL 4X9GA 4WI8A 2VKWA 3JTSA 3GSNH 5IT2H 5ESAB 3HNVL 2A6KA 4F58L 1K3IA 2BRRL 2N7AA 4FZ8H 4OB5H 3GSUA 1QVOA 4U6YB 3S34H 1V7NH 5ID1B 2BOCB 3MLVL 3M07A 1S9XA 4O2CA 2WBJB 4RBPK 3S37X 1Z9MA 1DLHB 4X80H 4R97C 3WUWG 4P2YA 1B0WA 4WJ5A 2WIIA 5TE7H 2FB4H 5C0IA 5T3XE 3VDAA 5I76A 3IFPA 4M62H 5GGRB 1KB9K 2DAVA 5L7XH 2X40A 1E28A 1WIUA 4K8RC 3TIEA 1BFVL 1I4FA 1CWVA 3CX5K 3PWPE 4JHAH 3BIBX 4OZHF 4UI2A 5T3XL 1HK6A 2GQHA 4JQIH 4M93C 3WD5H 2X70B 3B9KC 1GOGA 3GI8L 5D2LF 1EHNA 3B6SA 5MEPB 2W65B 2ZG3A 1QNZL 4WW2C 3RNKB 5JNYB 4L8CB 4CDGC 4XWOC 4UDTA 3GEWB 3QEQA 4M1DH 4LARH 3MJ7B 4G8IA 5HGHB 4JFHD 2A0LD 2Y07L 4LDLB 3RZCD 5J6HB 5MENE 4WWID 4BSWB 1H3TA 2VDQH 1SEQL 4KQ3L 3MX0A 4LCUA 4ZPVB 3QWOA 4UT7L 2CDFA 4FQHA 2PXYD 4YEFA 2ZUVA 5C0DA 1T3FB 4H5SA 5HHXL 1CT8B 5ADPL 3TLRA 3O4LE 2B2XL 4RAVB 1J11A 3QUKA 4DZ8A 1A6TA 1CD1A 1JRHL 2X4QA 2DMBA 3RY6C 4R90L 5BO1H 4Y19D 2AK1H 3KPOA 1OARH 3U9UB 1VDGA 2CXGA 3UMTA 4YHPA 4MD0B 3P4OA 2UY7A 5HGAB 3IVKA 1RIVL 3C5ZC 2EDXA 3LEVH 2D2OA 5J3HD 5GGVH 3VG9B 1EXUA 2AJZB 2GK2A 1A7RH 1U3YA 4LLVA 4YHML 1OP3H 1WBZB 4JFZL 4J3TA 3GMPB 4N90E 5KJRH 3S5LG 1DQLL 3O3BA 4Y1AE 3NAAL 1WF5A 2BVPA 3VWKB 5C0ND 3TIDB 4RAUA 3RIFF 1O0VA 4KPHH 1FNEB 3N50A 1Q0YH 1MWAL 3L3IA 2XZQH 3OKYA 1VFAA 2PYEE 2OTWA 1QFUH 4F7MB 2PO6A 3T77A 4ZS6D 3IAPA 3DYMA 3CGTA 4M5ZH 4P2OB 4P46A 3P4NB 3VA6A 4YLQT 1GC1H 1CFVL 4WHTA 1TZHB 2R2EA 4LSQH 43CAA 1ZE3C 2R8SL 3KLDA 1MVFA 4X6DB 5F1NB 2HFGL 2NY4D 2DQHH 3H7LA 4LCWE 3GMLA 1MIML 2CK0H 4Z9KB 5FKAB 5F93C 1R3LB 3LS4H 4JJHA 3FO1A 3LEYL 2Q1EA 1BZ7A 4XX1E 2YN3A 4M1CC 4HS8L 4IIQA 2JCCA 4ZUWB 5B38B 4C83B 1ED3B 3I50H 5C3TA 3NFPA 2CLVA 1U8PA 2ZCLL 1FL6A 3MRKB 1F4WH 4N8VA 3V4UH 1AJ7H 5IW3A 1F4AA 3PG2A 4Y4HA 1VEOA 3NIDF 5GIRB 4YXKL 1H8SA 3TO4D 2O5ZH 2V5RA 3KWWB 5J89A 5ACZB 3T4AB 5JXEA 1EVUA 1S7VB 1D7FA 3KYMA 2MCPH 4OT1L 1KPVB 2CRMA 1PAMA 3LEXB 2MMXA 4R3SA 3T2PA 2V6HA 4FQPA 1IEBA 3IKKA 1VFOA 1NCBL 3QDGB 1LO4H 3ECBB 1FFNB 2EIEA 3QDMA 4OCRH 3RWCA 1I3UA 1X5HA 1XGUB 2XI9A 1CDCA 4HLZH 2DYPD 3TH2T 3LRSA 2ED9A 2AQ1A 1EUUA 2N56A 2YPVL 4HKZA 5KN5A 3ARBD 4ZFGH 5EN2B 3OG6B 1HN1A 3I6KB 4HUUA 3ARFC 4BUHA 3MNVB 4U1SB 3R1GH 4J4PA 1EFXB 4JLRA 4XTRD 5EUOF 3MRBA 1F3DJ 1KTLB 4D0BA 2LU7A 3SHSA 3VG9C 2AERT 3O2VL 2MNUA 4GW5A 1I7RA 5DI8A 2QV2A 4Z0BL 1PEWA 3OAZH 4RRPA 2VLJA 3LQZB 3FQTB 3MBED 5CAYB 1XF4A 3ULUE 2Q20A 4QTIL 1BJ1J 4LAQL 5IB5A 2H32H 1A1OA 5EFIA 3VGAC 3VXRE 3EYSL 1RUML 1OF2B 3ULUL 2ADFL 5E8OA 4G6JL 3D3VB 1FVCB 4L3CA 4WWKD 2OK0H 4MA3A 4Q0XL 5ICXA 5IVNA 3KPTA 4G8GE 12E8H 5HYSB 4IOIA 4NC0B 4B7IA 3VRLE 3FQNB 2WV3A 5C07E 4LKXB 1XF2B 2BY2A 4OQ1A 4UIMA 3ULUC 3KYNA 3S36X 2WUBL 4IJ3B 4O51A 4PJIA 4ZTOL 5F7HA 2E3VA 2PW1B 1U42A 3G5ZB 3UZQA 1TXKA 1YQ2A 1IM9D 4IRSC 1LP9E 2C4XA 3F7PC 3WNMA 2NZ9C 5CP7B 5FA3B 3O9WD 1PZ5B 4GRLA 3WXWH 1Z5LB 5F72S 1EERB 1IAIM 2QSQA 3QIWB 4F57H 4BQ9A 5CZXC 4LPTA 4G6KL 3SDXF 2X4NB 4I5BB 5EZLA 1I9JL 4C4KO 1PQZB 4U05A 2NXYB 5DJ6A 1HQRB 4OCLC 4QHNA 2MKWA 3GSWA 3MTRA 4C59B 4GOSA 1WWCA 5F7DA 2C3HA 4HMCA 1KJ2B 4HBCH 4MVBD 3FO2A 4OZGA 1YEGH 2NPLX 4OIAA 3ZYJA 4JZNB 4KU1A 2WINB 3O2DA 5IWLC 1U8IB 2CO6B 3QCVL 4HV8B 2ENSA 3HUJF 2AV7A 5F9JB 3DMMB 1IGCL 4NNPL 1NPUA 4LPCA 3RKDC 1KGCD 1VHPA 3FT4A 1RI8A 4EDWH 3MA7A 2B8OT 4N9GA 3CD4A 1GAFH 4NKIL 2EIZA 4DN3H 4XMKH 4DEPC 2ZCKH 3C2SA 4FXKB 5HPOA 2CPCA 2YR3A 3MACH 1RIHH 2V7HA 5ENWA 2M26A 3FN9A 5D9SA 5ESQB 3ET9F 1TJIL 1D5BA 4WI7A 3S96B 3G9AB 3O0RL 4G80B 4BSJA 1J86A 1MRCL 2AABH 2H26A 4HCRA 4EXKA 5IMKB 4G8EB 1FO0A 3OR6B 1EVTC 1IC7H 5M7QA 3VCLA 3G04B 1NAML 1PW3A 4HDIB 3EHBC 4LBEB 5CBAA 1QTYT 3C2AL 4AIZA 3FB6B 1F6FB 4L8DA 5DJZA 1BJ1H 2AJVH 2GJZA 4NQEB 5BVJB 4PJDF 1NCDH 4DGIL 4PJAA 5J1TC 2N7BA 1MQKL 5H37G 1AHWA 5E2VH 1I7TB 4OCXH 4QRPA 2R0ZH 2AKRA 1FFOA 1RY7B 3CFJB 5C0EB 4OM0L 5BZDB 4XVUD 3B9AA 2BFVH 3QG6A 1ZLSH 5LGKA 3FN0H 4H0IA 2VZ3A 3QPXH 3CDYA 4XI5C 2D4DA 2WNGA 3PHQA 4QRUB 3TBYA 3JWOC 5BQ7B 2KH2B 1A14H 3VXQA 1JNLH 3HPLB 4OF8A 5SWSD 4JM4L 1AD9A 2QQNH 1PG7L 2VSDA 5ECJE 3C9NA 4Y5XC 4FFWC 1D5IL 3FO9B 1J0YA 2F54E 4UBDD 1RFDH 3PIQB 2RCSH 5IBLC 1TJHH 1NL0L 5HHMD 5KS9A 5C8JB 5E8PB 4UT6L 5IHUH 3O3AB 4LKCB 3ISWA 4R2GB 5D93C 1IL1A 4YDJA 1QYGH 5FYJH 3CMOH 3BZDA 4H88H 1HXMA 2NW3A 4EI6B 5IFJB 3DLQR 1KLUB 3QJFA 3QIBB 3FN3A 1DVFB 4QHMA 3ETBF 3U0WL 3EO1A 5ADOH 3ABZA 2C5DC 4JQXA 1DQMH 2AJXL 3PGCA 3KJ6H 5T1DH 3F12A 1JWMA 3QRFM 4ONFL 5FM5M 1ZOXA 5I1AA 1NDGB 3DJ9A 3L3HA 2P8PB 3EFFA 2RAMA 4LNVA 2VXVL 3DMMC 2C4FT 5D6CB 3LKQB 5DO2C 4QY8B 3D2UA 1T20A 1ZVYA 2GTZA 1P1ZA 2JELH 4YIQB 2AQ3A 3AREB 3MV11 2HJLB 1JPST 5I30L 1OL0A 4G8FA 1A6VL 4HJJH 3GNML 4FFVD 4YHKL 1F5WA 4A6YA 4G6FD 3FQUA 2J7LA 1BF2A 5I1KH 1UT9A 4TTGA 1WAAA 5CJBA 1MHCA 3SGDI 3F65A 3HHRB 5DMIL 2ZUQC 4ELME 3DVGA 4JG1L 5BZWA 1RZKC 1Q72L 3GSXB 1IT9L 1MVUB 3O11B 3V0VA 1K4CB 1XGTA 1EO8L 3FOLB 4NZRL 2EZ0D 2FD6L 3FQRA 5E9DE 1YY9C 5ABDE 2VE6A 5HYQA 4BH8A 3VFOA 1BQHB 4GXUM 1OWRM 3WE6A 4X98B 5FV1L 2AS5M 4CMMA 1G6RL 5JW5A 1HI6A 5TF1H 2EYTA 2IQAB 1MCFA 5FKPA 2RQ8A 4KQ4H 4U7MA 5BCAA 2L4OA 1ZANL 4RFEA 1QRNA 1S9VB 4PGDA 1RUQL 1WEJH 1K2DA 2HN7B 3V6OE 2ITCA 3C08L 3GSQB 4P5TA 1DANT 3OXRA 4TSBL 4N0UA 1AGEB 5J13B 4B5EA 4QGTA 2HLFD 4RGMC 4Y4HD 1A6WL 4D9QD 1FHGA 1A6ZB 1YDPA 1DE4B 1C5CH 3IYLW 1FAIL 15C8L 4FTVD 3EFDL 4LVOC 1MJUH 3RZWA 5F1SA 1W0WB 3L3OA 3V6OC 2OTUB 2QKIB 4JFFD 2GY5A 4NO2B 2XFXB 2HLAB 4JRYA 3OAYK 3QIBC 2HT3C 1DVFC 2Q76B 3ZE2E 1WJ3A 2P45B 4LSSL 4EUPH 1IKFH 2LABA 1CF8H 4JFYB 4JFOB 2CKBH 3PV6B 1YJDH 2W60A 2NR6D 4C56A 5JA8B 2KUTA 3T0BA 4M5YL 3HNSL 1EDQA 3MRCA 3M8OH 5FFLA 3P4MA 3DIFA 3GIZH 3S8WA 4XP6L 5DDHA 1P4BL 4ALAH 4TSCH 2AAVA 4NN7C 3G5VB 3MRIA 4UNUA 1QSED 5JPMA 5C6TL 3A6BH 1T6WA 3PHOA 3PXJA 3GMQB 2D7QA 2Z31C 3JWDH 3VFNA 1KG0B 4QHUA 2EE6A 2F15A 5IESL 2HJKB 1OQOA 3JUZA 5CWSB 4CGTA 2OR9H 5DQJB 2E27H 5DJCA 3HC4L 3RDTD 3GBML 1LGVA 4KGLA 4PRIE 1JTOA 4DKEH 4ODTH 4OSUL 1ZT1B 5DD5L 4NPYA 1QFPA 4PV8B 4F8QA 4GG6A 4NZJA 3LN4B 2HRLA 2CIIB 4KJWC 4NKOB 3TT3H 2EYRA 4NFBA 3U82B 4O9HL 1YYML 1BAFL 1CIUA 2XZCL 4L9LB 4WUUE 4Z7VB 4N8VG 3O4OB 4LLUB 3SKOA 5FGBC 3RGVA 3UTTA 5HVHC 1JBJA 1FVDA 4GBXC 4HAFA 5INDA 2X1XR 1N6UA 5IVZA 5L8KB 4PJFB 1T2JA 2AGJH 5D1ZA 3BZEA 5L6YL 2P7TA 5GZNC 1OD7A 4GFTB 5HYIA 3T1WA 2ADGA 1U95B 3QUZA 4ZD3H 3K7UA 1HQ4A 4JN2A 1JWSB 3GHBH 1LO0L 2EH7H 3QNYB 3ZKMD 3BRGC 5ELIA 3P9LB 1UCBH 1D9KC 3C6SB 4ZUTA 3IFLL 4HS3B 1K5NB 2JB6B 5CEZH 1C5BL 3HG1D 3VFGH 1OAKH 1N7MH 4E5XB 4PJHE 3STZA 3OBAA 1YEIL 2NY2B 4OLXH 2JCCF 1Q94B 4XXCC 3CPLA 5GZOC 1RK1B 3H9YA 3G6AB 4JO4H 1C12A 3TP4A 1J05B 4OLZL 1KN2H 1G7LA 1Z2KA 4LMQI 3NIGE 3WDJA 4UQ3B 4RRPG 2J12B 4S2SB 4YH6A 2GUOB 1VERA 1SBSL 4HIEA 2P5WA 1AD0A 1M6OB 2J5LC 1ADQL 3LQAC 2FIKB 1CU4L 4WEBL 3WN5B 4Z7WA 2O5XH 4OAWB 1AKJB 1KIQA 3ARDB 3GMOB 3HNVH 4FXGA 2DJSA 3U4BL 2BRRH 2OX5A 1FN4A 3P73A 43C9A 5SWQB 3GUTB 3L3GB 4GUPA 1JTPA 1QO3A 1L6ZA 5F7LB 5GSVB 3MLVH 5CD5D 4GAYA 4HQQL 2EXYC 4IRZH 2IC2A 1DN0A 1EGJA 5DVKA 1FCCA 2LE9A 2R4SL 3MPCA 1YMME 4PRBB 4PJEE 1BFVH 1M1SA 1R3JB 3MRFB 3DRTA 3RWGA 5ALCL 3QHFL 2BSSA 5T3XH 3UTSD 3U2SA 4JHWH 2IAMC 2P5EE 1CFSB 5IG7B 2APXA 3ZTNL 3QFJB 4S1SL 3QUYB 2AJYL 1FNLA 5IROA 1QNZH 2UUDH 4ZFOB 4HX1B 5ESVA 2W59A 1UEYA 2J6EL 3G08A 5HHQB 2GJ6A 2C26A 2CQVA 4DOHB 1IEHA 3BH9A 2Y07H 3ILPA 5TGBB 5DYOB 2FJHA 1JP5A 4TOYL 4ZDHA 1SEQH 2YEZA 1M7DB 4KQ3H 3K8LA 4UT7H 5MP6L 3MRGB 3RQ3A 1NFDA 1CZ8L 3RBGA 3SBWA 1B0RA 1Q9LB 5HHXH 4HUVB 2ICWA 5ADPH 5DMGC 1MFCL 2B2XH 3V5KB 3SEPA 2Z4QB 3BVNA 3LKRB 1GSMA 1JRHH 4XCEA 4ZO6A 5IW1A 4RSVA 5IQ9B 2BNRB 5ACLA 4R90H 4G9FD 2D31B 4PJIF 2Z9TA 4EI5A 3TFKD 4RFOL 2OJEA 4CW1A 2R0WL 4LLWB 3RVWD 2LVCA 4D0CB 2BOBB 4M4RA 5C09A 1YPZB 1RIVH 1ONQB 4OGYH 2F8XC 3CSBA 4K9EC 4JDVB 5DD6A 1LEIA 3FL7A 4RGNB 4YHMH 2A83B 4JFZH 2VZTA 5DA4A 1U93A 1X4YA 5I0DA 1DQLH 5C71A 3NAAH 2EEAA 4HKJA 3FB7A 4NUJB 3HC0B 3T0EA 1JPSL 3LN9A 2YD4A 5GGRY 1CLCA 1JIBA 1U8JB 4ZQKB 3D2UD 3BHBB 1MWAH 2M8XA 1YY8B 4FXLA 3BGAA 4MCZB 4MDIB 4X4YA 2DWEB 3CCHA 4BFGA 4DKFL 3CZFB 5IEKA 3R4DA 3IJYA 1NC2B 1KFAL 2YC1B 3ARDC 2WMPA 3CU7A 1CFVH 4XAWL 5ETUB 5J9PA 4NQCD 3ARZA 4XP4L 2DJUA 1DR9A 3WEXB 4WFFE 2R8SH 3VI3E 4PJXB 3Q2CA 3N1GC 1G7QA 4HUNB 2IPTL 1J1OL 4P9HL 4U1HA 1MIMH 3WJJC 3LEYH 1KT2B 3OKKA 3D18B 3VXSB 3OF6D 5HBBA 4Y16D 1FGVH 4P23A 3VRIA 3EZ8A 3L95A 5F1OB 3VD5A 3IFNL 4P2QE 4P9HC 4X4ME 1XR9A 4L29A 1UWXH 1HSAB 3IJHA 2ZCLH 5EU6E 4LNRA 3SJVE 4O02L 4N1CA 2EIDA 2EXWC 5E4IA 4OZIE 2DLTA 3RWDA 2VUYA 4I18C 4MAYA 3WO3B 3ZE1F 3OZ9L 4OI9A 4LPUA 3BN9D 4AY0A 1OOAA 2HT4C 3CAFA 2ARWA 3K1DA 4HKBA 4HSQA 5CGYD 4BJLA 2RB8A 3HA0A 5CEYA 3JVGC 1I8LC 3VW3L 1S8DA 5FF6A 4OT1H 2CUIA 4PY7A 1U8KA 5EU7C 3PWJA 5GS0C 1X4XA 4Z76B 1AQDA 1H0DB 1VPOL 2I9LA 2DLEA 1NCUA 5D7LA 5HI4D 4ODWB 3QEGL 2W9DL 4NCDA 1NCBH 2DKMA 4KROD 5IJVA 2XYCA 5T1LA 4GG8A 4PJCB 1KNOB 3F7VA 3GMMA 3CSGA 3AVEA 4P57A 4TTDD 3QAZB 4X4XB 3C6LA 1VGKA 3RI5F 2YPVH 4RQQA 1J0KA 1H3VA 1CD9B 2VISB 3O6FA 3T4YA 3BPOB 1MI5B 3IETB 2NY6D 5I1LB 2Z8SA 4Y5VB 3DARA 5KSBE 1MCWW 3W5MA 2UWEB 5KS9F 1WTLA 2VB5A 4CADA 5IMLB 4NQXA 4RGNC 4NRXB 4Z0BH 5C0JA 4LLQA 4ZSOE 3C8KB 4WHYH 2NXZB 5JR1L 4BELD 3PF2A 3UAJD 4F9PA 4QTIH 4LCIL 2K7QA 2VL4A 4LAQH 4ONHA 1QSFB 5IJKA 3ZKXB 3EYSH 1RUMH 3ULUH 3R0MA 2ADFH 3IF1B 3JV4B 4G6JH 2X4SB 4PP2B 3IB4A 4Q0XH 3GK8L 3B3IB 1C7TA 3F5WB 4NCC2 4NHUB 3MCKB 1J7VR 3WUZA 5TJWK 5JHDB 1CYGA 1X5KA 4XRCA 1R3KB 1YNLL 1MCLA 2WUBH 4YGVA 2A74A 4ZTOH 4PYHA 4F33B 4XNZB 1OAZH 4BZ2L 5E6IA 3H3KA 4LFHD 4ZUSA 4OCWL 4Q74A 2FR4A 5I1JL 1IGFL 5CIPB 3WIFB 3JWNC 2NX5A 3BD3A 4HKXB 3BYTA 5FHBL 3NIFE 4KV5E 3RGVD 4WI3A 4G6KH 5HYJE 3MV8A 2GAZB 4U1KB 4X6BB 3U46A 1I9JH 3IDUA 2VABA 1UJ3A 5D1ZD 4LLMA 2YD2A 3EGSA 4Y2DC 3QUZD 4XBPB 2VLRE 3IDJB 3CFCL 3Q3GA 5J0BA 3OKDB 4X5XB 4Q7DA 4U0RC 2IJ0C 3REWB 3H3BC 4XXDA 3QCVH 2HJFA 1OSPL 1FP5A 8FABA 4NNPH 3T8XB 1DUYA 4N0RA 5EC1A 3T2NL 1CLZL 4DVBB 1S7XA 3TA3C 4Y0GA 1OGAD 1KEGL 4Z7UE 5HD8D 3BXNB 3MJ8B 4NKIH 3DECA 1ZT4B 5F89B 3QAZC 3MV9A 1V7ML 1MCHA 3DO7B 1R24B 3E2HB 3FTGB 4GRWE 3MXWL 1FV1B 1VEPA 4JAMB 4K71C 4QKXB 4XNXL 1TJIH 2A73B 3CVHL 3P9MA 2Y7QA 3O0RH 4C4KT 2FEEL 4UU9A 1MRCH 3QUXC 2P4AB 4PY8J 3QI9C 4XCYB 2VAJA 5D96C 1QFOA 1D6VL 4WENB 1NAMH 5FM5O 3FRUA 2F53D 4X6CB 3NZ8A 3T2QA 5C0CA 3LKOB 4L8BA 5JDSA 3QQ4B 4TSAH 4DGIH 2AXGB 2XKUA 1MQKH 3E3QE 4NO3A 3NN8B 2EKSA 4OGAC 4NN6B 5FO7A 4J12A 5I1EL 3JV6B 1FQ9C 4OM0H 3N9GL 3ZKXC 3BEVB 1MWAB 1I8KB 4S0TD 5ILTL 1Y6MR 4PS4L 3KPSD 5H94A 5FO9A 4KTEL 4L8SC 1BJMA 3E6FA 1JHTA 4FQIL 4JM4H 4XNMB 3PUCA 4S0SD 1P7KA 2VLLB 1PG7H 2DWDB 3FOMB 4WGWB 1J8KA 1IC1A 4OZHE 1N2RB 4OFIA 2VXUL 1EEZB 1D5IH 5FECA 4YDKL 2X4TB 5D2LE 1QHOA 2OS7A 3BH8B 1P7QB 4HZLA 4JKLA 3VGEA 3HNTL 4IHOA 32C2A 3B5GA 3STBA 5E94A 2QR0B 5JIKA 4UT6H 4F15C 5I71C 1GZPB 1FJ1A 4LCWB 1EK3A 1YYLL 2F19L 5EZOL 3HS0B 1A3RH 3L7EB 1MCSA 3EKCA 1T1YA 2YBRA 3DV4A 2VZ1A 3U0WH 4GG6F 1YEHL 4JFDA 3D85A 5ANME 3W11C 1NEZA 1J8HE 2WZPD 2AJXH 1OHQA 3WS6A 4MQXD 4MNQE 3S3SA 4JRXE 3HZMA 4ONFH 4L3EE 4U0QB 5E56A 4ZYKB 3WHXB 5MEOA 1VADA 2V17L 4K7PX 2VXVH 5GGVY 3RWHA 3WS3B 3B9VA 1K85A 4MA1B 1EZVY 4EI5D 5L9DL 4XBGB 2FSEB 3MR9B 1I3GL 3UTOA 5C09D 1JK8B 1NLDL 1X7QA 3SDAB 3OKEB 4DFHA 4P49A 3VXUA 2VO5A 1A6VH 5F7KC 3UXFA 4YHKH 4RISH 1NANH 2IPKB 1RIUL 3DXAA 4XH2A 2BNQE 4G7YL 5CEXB 5I19L 4PJ9C 3P0VL 4JKWA 3DRQB 1FRGL 5DZNA 1NGWB 4F80A 1YN7B 4KRNA 3RVTD 3O41B 5DMIH 2D7TH 2J8UA 3QIUB 4M7LT 3RWEB 5FCUL 1C5DA 5FA4A 4JG1H 4UIKL 1LEGA 4OLEA 4XB7A 2DD8L 1IT9H 4LPVA 2CDEA 2E7HA 4D94A 2CK2A 4YR6B 4LF3A 1KENL 4N0FA 1EO8H 1BECA 4NZRH 1JNJA 4FG6C 5B8CB 4MJ2A 4RZCA 4GW1A 4NN6C 4PGEB 4YE4L 3SQOL 1H5BB 4M8QB 3SE3A 3W0WD 3QG7L 2H9GB 3EYOA 4LHJB 1U92B 1NDMB 3RNQA 5A16A 1G6RH 1HNFA 2AK4D 1KCRL 3HB3C 4AIOA 4M61A 1MHEB 1U8MA 2PNDA 5J1AA 3UBXG 4BFEA 5EU3A 3MRLA 4P23D 5EPMB 4WTWA 1ZANH 1ZLWK 4HPOH 1JV5B 2FGWL 1RUQH 3KPMB 4MHHI 4QNPF 2G2RB 2OI9B 3C5JB 5DUBA 1H15A 1M4KA 2ZPKL 2DIBA 3C08H 4TSBH 4F7TB 2GK0A 3U83A 3BQUA 1XR8B 3DGCR 3MJ9L 5C0BA 4M48L 3BW9B 3O3EA 3W82A 4DAGL 4ZXBD 4MAYD 1F42A 3RL1A 5D1QA 2DL9A 3NIDE 1A6WH 4W81A 1UWEL 5KVEL 4P2RB 2UVFA 1RUAL 1FAIH 3U30B 2C7UA 3EFDH 3ZT5A 4JO2H 1HH6B 1LP9B 1SJXA 3ARPA 1FYTA 1HH9A 2QADD 1MFEL 4N8CH 3KHQA 1ITBB 1UZ8B 2IEPA 4XP5L 4CBPA 4LSSH 5ESAA 4U6YA 2PF6A 3UJJL 1XGYL 4ZUVA 4BK5A 1N3NB 2BOCA 4JFHE 5CHNB 1JNNL 4APQD 5I1CL 4M5YH 5KZCB 3TZVB 2WBJA 4P3DA 5BV7L 3HNSH 3IAGC 1T89A 1DLHA 1ACZA 3F7QA 1UH4A 4G3YL 4O2EB 1FC2D 4F8TA 5I18L 3O6FD 4XP6H 1P4BH 1IBGL 4JKMA 4QF1B 3GM0A 2AJ3B 2HG5B 5GGRA 2A6IB 5EUOE 3SDAC 2JB5L 3TNNB 4HAGA 3I6LD 5FGCB 4Y8DC 2DMKA 5EULV 5C6TH 3RVUD 5T1KD 4HIXL 5FO8B 2X70A 4FQXB 1OTTD 5IESH 5MEPA 2W65A 3BP4B 3RZCC 3C8HA 4CMHC 1NLBL 2BHYA 3HC4H 4Y19E 3RNKA 5JQHC 1EEYB 3GBMH 1T7ZA 4OGXL 4EQ3A 1T83A 3MJ7A 4OSUH 1FVEB 4ODUB 5DD5H 1J88A 3VXMB 5J6HA 4ONGL 4BSWA 4RMRA 4ZPVA 5AUMA 1YYMH 1BAFH 3L6FA 3CXDL 1A7OL 1QOKA 4RCAA 3VXNB 4NN5C 1BWMA 5D7IF 1MFDH 1T3FA 1H5BC 4YQXL 3NTCL 4Q2ZB 2Z92B 4RAVA 2UYLA 5L6YH 3N1PC 2WW8A 5KVFL 1SYVB 5JUEH 3LS5H 3QWRA 4OBRA 1CVRA 2OQJB 4U3XA 3U9UA 2WBKA 1ZHKB 1ZGLB 4YHIB 4Z7QF 4I0PD 5DT1L 4MD0A 2FH8A 5HGAA 4Z0XB 1RK0B 2HT2C 4NRZB 1OD9A 2DICA 3SDXE 3BDBA 4KJPD 3ZKQD 1VFBB 1WBZA 1WIPA 1UVQB 3IFLH 3GMPA 2ATKB 3ZL4L 1C5BH 4LSRL 4XNUH 3VWKA 3TIDA 4F7PB 3QSKB 4TYUA 5E0QA 1EEQA 4MD5B 2F54B 1KOAA 1G9EA 1S7SB 1LK2B 1ZWIB 5I74C 5DJ0B 4F7MA 3HUJE 3LQAH 4OLZH 1I9RL 1U3HB 4CVWA 4P2OA 4WV1C 2PN5A 5D5MF 1FZOB 1CGUA 1N6QL 1WFUA 3P11L 4JREC 1TZHA 4OZ4B 3ZYIA 4KDTA 2KQMA 1ADQH 1IGMH 1CU4H 4WEBH 5F1NA 1BJ8A 2XNAB 4JGMA 2BP3A 3AB0B 1U41A 5JPNB 3BUYB 5FKAA 3WL9B 1R3LA 1MLCB 4RMTA 1RJLB 2B7DT 4YUEL 3TJHC 1FPTL 1IKNA 3O2WH 1ZHBB 4IRJD 1P84K 2J1KA 3B2UC 4HQQH 4WO4D 3BP7B 5B38A 3G5XB 4C83A 1ED3A 2R4SH 5BRZB 3CFEB 1HXYA 4J3UA 3CXHJ 3MRKA 3I3BA 3QCUL 2AV1B 1JVKA 4L5FL 4PJDE 1YC8A 3DURB 4XPHL 4QOKB 5DJDB 2EE9A 3Q1SL 4GS7C 5ALCH 5GIRA 1INEL 3QHFH 3VE0B 5ACZA 3T4AA 4KK5D 4P4RB 3OB0H 4U1GC 4C58B 5J56B 4WTZG 2AJYH 4JZJC 1KPVA 4ZO7A 3FFCB 3OKOB 5CKGA 1OAXL 2J6EH 3LEXA 5IP4A 3NBNA 1X5AA 1A9EB 3DHMA 2GITA 4Y4FD 5DRZA 5JZ7D 4OV5B 3PWVB 3QDGA 4NO0B 1FFNA 4JY5L 1XGUA 4TOYH 1RZJC 2VITB 4M3JA 2FATL 4I3SL 5MP6H 3HCVB 4OQTL 3ZYOA 3WJLA 1MRFL 1CZ8H 4K94C 1Z0MA 5EN2A 5E9DB 2XQYK 2X4PB 3I6KA 1MFCH 5IB4B 4U1SA 4OUUA 1EFXA 1UM4L 2KQNA 4Z18A 2H2PC 2V5SA 1QVOB 4ZG1A 2NY1B 3SGJA 1CFTA 3QISA 4RFOH 4L4TD 4U49A 2R0WH 3CDGB 4XHJC 3LQZA 3FQTA 1IGIH 1QZ1A 2YD7A 1AR1C 4PG2A 1IAOB 2FLBT 3D85D 4WWKC 1M7IB 4N5UA 1NFIB 1H3GA 5CINH 4ZAKC 5DFVC 3X12B 4YBLC 1II4E 1OF2A 2W1NA 2B1HH 1AGFB 1JPSH 4WFHD 5HYSA 1ZHLB 3FQNA 4LKXA 1FNFA 1XF2A 4K8RD 3VXUD 4DKFH 2PW1A 3QEQB 4WU5B 4Z95H 4JR9L 4X7CC 3B43A 4X7SL 1KFAH 3B9KD 1PVHA 4XAWH 4TUJB 4M7LL 4XP4H 3RWJB 5CP7A 5DS8B 5FA3A 5JIIA 4S10A 1PZ5A 2ARJQ 2EDLA 3K1KC 2XKSA 4XWOD 3KHOA 2J4WL 1KGCE 2IPTH 1Z5LA 3RUGB 4BKLB 1J1OH 4P9HH 5IK3B 3EJZC 4AEEA 3QIWA 2DQJL 3ZHKA 4K3HA 4YDLB 8CGTA 4QRSB 1BVLB 4H5SB 2X4NA 1AQKL 4I5BA 1PQZA 2VLKB 4DZ8B 2X4QB 1HQRA 3H9SD 4FZEL 5DMKB 3UPCA 3P77B 3SKJL 1TZIB 4LHUB 4O02H 3TF7C 3Q48A 4YHPB 4XMPL 4X7FC 1U8NB 3OZ9H 4JZNA 2WINA 4HV8A 5I8CA 3EW3B 4LLVB 5ISZD 7FABL 4PRIB 3VW3H 3EDDA 4JRWA 4YFEA 2DIAA 3C5ZD 2JLLA 4IBLT 1G7IA 1WCBB 1VPOH 1FNAA 3V0AC 5CGMA 5FV2A 2W9DH 4FXKA 2E7LA 4WUUB 5ESQA 3NPSB 3QYCA 2XA8L 2PO6B 3LVEA 3IKCA 2AEWA 4RMQA 5GS2H 4G80A 4U6XA 5DEGB 3ZZ1A 5SWSE 5IMKA 2Z0BA 4G8EA 3LKNB 1NUFA 3OR6A 3HE7B 3G04A 5A2IH 4X6FB 5F7NC 3SCMB 4HDIA 4LBEA 4TQEL 5CJXA 3MUGA 3FB6A 4U1LB 4NQEA 4PRNB 5BVJA 3UX9B 1NBYB 5HHME 1I7TA 4TVSa 2VR5A 5CFHA 5C0EA 1DUZB 4IIQB 5BZDA 1WBXB 1KB9J 5JR1H 2WBJD 5FHAL 4NRYB 4UZGA 4X99B 2YZ1A 1EHLL 4PGBA 2ERJB 1SM3L 1U8PB 3A0OA 5KANI 4P4KB 5TDNB 1S9WB 3BRFA 4QRUA 4JPKL 5BQ7A 1F2XK 2R0KL 3QQ3A 4M1CD 4N8VB 3HPLA 2KBGA 3MJ6A 4RNRB 4HC1A 3PDDA 3TH4T 2V5TA 1VESA 2A6JB 5LG1A 1RD6A 3GK8H 4O00A 1KIUA 2WANA 5FOBB 3FO9A 2DTSA 1BOYA 3U79A 4CU6A 1YNLH 3GJFK 4KZDL 4LU5L 1KELL 3QJHB 5C8JA 5E8PA 3DUHA 4BZ2H 3O3AA 1PLGL 3KR3L 3ZKNC 3AXLA 2VNCA 3V5DB 4P0DA 5GSRB 3LRSB 4OCWH 4BFIB 5I1JH 4EI6A 1FG9C 5IFJA 1KLUA 1VKXB 2NY0B 2APWA 3PE9A 4Y5YA 1DVFA 2ZUUA 4MMXC 5KN5B 5FHBH 1AXSB 4WW2F 4HIHB 3QXUA 3IRZA 1JPGA 4ISVB 5CJ5A 1NDGA 4S1QL 2J8UF 3X14B 4PRPA 1Q8MA 2P8PA 2OL3L 1W8NA 3QWRD 2DKSA 4L1DA 3W9DB 5D6CA 3LKQA 3S36L 4QY8A 3ARFD 3CFCH 1F3JB 2P5EB 1MLBB 4YIQA 3AREA 1CDIA 2HJLA 1OSPH 1HE7A 3OGOE 2OBGA 5BJTB 1EA9C 1U9KA 1VA9A 3T2NH 3VFMB 1CLZH 3H0TB 1KEGH 5EOCL 3JSSA 2PO6C 1NUNB 3VWKD 3P0YL 4QXWA 4H1LG 3GHEL 3O81A 5DJXA 2Z8RA 3ZSTA 1V7MH 3R0NA 2JCCE 2DS4A 4P46C 3SOBL 4XNXH 3MXWH 4JEGB 5EU4B 4ODVL 3CVHH 2NY5C 2EDKA 4O51B 1MAJA 4LQFL 3GSXA 1MVUA 1K4CA 3CUPB 3WNKA 4GRWH 1D6VH 3FOLA 2COQA 3DUSB 4D9QE 4MJ6A 3G5YB 4EKXA 1BQHA 5F9DC 4IIQC 4X98A 3QULA 4FTVE 3T3MF 1WT5A 4IRSD 2H32A 5D2NB 1G7HB 2NZ9D 2IQAA 2P42B 4FOMA 1Z0NA 4JFFE 3LIZL 3RY4A 5AAWA 5I1EH 2IMNA 5GHWL 3N9GH 3PNWB 4M03A 3SO5A 4X9HA 1S9VA 3SPVB 4U3HA 1ES0B 3GSWB 2HN7A 5CZXD 5ILTH 3GSQA 3IXTB 4PS4H 5JXEC 2VRAA 2QTEA 1Y0LB 2FWOB 4XNYL 4KTEH 4QCIB 4OZGB 4GW4B 4FQIH 5DC4B 2OZ4L 3ME0A 3HFML 3VDCA 3OPZL 3C60B 5GGTL 2AV7B 2QEJA 2VXUH 2EECA 1A6ZA 4N1HB 1DE4A 4YDKH 4I0CC 4XP1L 2B4CL 3TCLB 3FT4B 1ZMYA 1H3XA 4XXCA 5CP3A 3MA7B 1W0WA 1I7ZB 3K2MC 3HNTH 1QSEE 4CN4A 2OTUA 3CX2A 2NR6C 2QKIA 4MZ2A 4NO2A 2XFXA 2HLAA 3OGCB 2Q76A 2VXTL 2V7HB 5EZOH 5LVEA 1D5BB 1QP1A 4JFOA 3PV6A 3KPRD 2HFEB 2FYYA 1FIEA 4J4PC 1B2WL 4P2QB 1YEHH 1GZQB 4MNGE 5D72L 4PRAB 1WZLA 3SJVB 1RJCA 4PJAB 5DQ9A 2DI8A 1CDJA 2DQIL 4N0YL 4QRPB 3LD8B 1BZ9B 4OGZA 5DMJB 3VD3A 4U2ZA 5L9DH 1BREA 1KG0A 1I3GH 2HJKA 1NLDH 5IHBA 5CWSA 5DQJA 3U7AA 3I6GB 3D39B 3PL6A 1RIUH 4PFEA 4G7YH 5I2IB 5B38G 3LN4A 2CIIA 1OP5H 5I19H 3P0VH 5T5NG 4KK8C 4NKOA 3ZSSA 3C9NB 1T04B 3D3VD 2YMXL 1FRGH 3S7GA 4L9LA 4LLUA 5FCUH 4Z77B 4C55A 3HG1E 4UIKH 3QXVA 4GRLC 4LSTL 2DD8H 4HJ0D 2W07A 1JPFB 1KENH 4HGWB 2DQEL 4KHTL 5DC9B 4ZUUA 4JPWL 3ZKMC 5IBLD 3SQOH 4YE4H 4OIIL 1BFOB 1HXMB 3QG7H 2NW3B 1RULL 3T09A 2IADB 2R15A 1WLHA 4QHMB 1ND0B 4XHQA 1JWSA 2D9CA 3QNYA 3IJSB 5LJYH 4X6DF 3P9LA 3DSNA 3B2VH 2FGWH 1K5NA 4HS3A 2JB6A 2NXYD 3L3HB 2IMMA 2ZPKH 2CLZB 5TDPA 4E5XA 1MCPL 3FHQA 4MA8L 5KVGL 1WIOA 3MJ9H 1T20B 4M48H 1P1ZB 1Q94A 4I2XE 5FEBA 4DAGH 3ZE1E 1RK1A 3G6AA 2NY3B 5A2LH 1HEZB 1J05A 1UWEH 4MXQD 4G8FB 1NBQA 5KVEH 4FFYH 3DMMD 5HDLA 1RUAH 5DO2D 5JW3L 2WBWB 4UQ3A 5I75B 5B4MC 1JFQL 1NEUA 4S2SA 2GUOA 3FQUB 1ERNA 4POYA 3FRPA 3UTSE 1MFEH 3MRNB 1M6OA 1J1PL 2FIKA 3WN5A 4GLRH 4OAWA 2EYSA 4XP5H 3V8CA 1AO7B 3GMOA 2BZDA 5EUKB 3UJJH 1XGYH 3IDIA 3L3GA 3PDOA 1JGLL 5I1CH 1JNNH 5E8EB 1ROWA 5GSVA 1L0YA 4Z7OF 4FABL 3NACL 4HG4J 5HYSG 4O58L 5BV7H 1AHWC 4JFQB 4K3JL 3IU3B 2DMCA 2FLRT 1H3WM 4PRBA 5GS1B 5L8LB 1X5ZA 1IBGH 2R1XB 2JB5H 1YN6A 1R3JA 4WY7L 4BZYA 3MRFA 2EYTB 4KFZC 5KS9E 3QFDB 2CGRL 4HIXH 5K9OB 4U1MB 3BKYL 1CFSA 2HVKB 5IG7A 4LCCB 3QFJA 4AH2B 4D0DB 2JIXA 3BP5B 1IAIL 1NLBH 3QUYA 1XH3A 1FL5B 3FO0L 4G9FE 4I3RL 5I6XB 4Z7UB 4ZFOA 4HX1A 1AFVL 4OGXH 3CVHB 4LLYB 2AW2A 5HHQA 3TBVA 2R56L 4LQ1A 3MOAL 2DM2A 3WXVL 3QUML 1RHHB 4ONGH 5TGBA 5DYOA 2A9NH 3V9FA 1M7DA 4UV4L 1YDPB 5GS3A 5C7XL 3CXDH 3EDJA 4K2UL 3MRGA 1VACB 1I1AB 4NZUL 1C8PA 4I8DA 1WCQA 1BQUA 4WEUD 3UYRL 2OSLB 1KACB 1Q9LA 3MV7D 4JRYB 4WHDA 4YQXH 3NTCH 3V5KA 2Z4QA 4Z6AT 3LKRA 4R2GD 4IMLB 3TYGH 5IT2L 4MAUL 5IQ9A 5KVFH 2BNRA 3LMJL 4FZ8L 3CH1B 2D31A 4JQXC 3U0PB 1VB9A 2HMID 1FH5L 4C56B 4LLWA 5DT1H 4D0CA 3QIBD 2BOBA 3VH8B 1YPZA 1DVFD 4NQCE 1ONQA 2BY1A 5IIEB 4JDVA 2EEBA 4NNXB 3WSQL 2FB4L 3EO0B 3IFOB 4KVNL 4OKVB 2A83A 1T5XA 2YOCA 3MCG1 3CK0L 3ZL4H 4NUJA 4ZNEA 2HKHL 1NGYB 3HC0A 1C16A 4BYHA 1TITA 3PHOB 2XY1A 1W72B 1OAUL 1TDQA 4PB9L 1R3HB 1U8JA 4ZQKA 1DBKL 3BHBA 4YXHL 5D2LB 3UTPD 1YY8A 5B22A 5DJCB 3WDHA 4MDIA 4XPAL 4GKSB 2DWEA 4EUPA 3CZFA 1I9RH 3QXDB 5IBTL 2CKBA 2RFXB 4X8JB 1C7SA 2Z31D 2YC1A 2FCBA 4NPYB 1N6QH 3INUL 2OCFD 4J3VA 3VFRA 1RZ7L 4GMTH 3N1FC 3WEXA 5KOVC 4PJXA 2PW2B 3RY5A 3WFDH 1GHFL 1FGNL 2H2SD 5DURB 2A6DB 4YUEH 1KT2A 5ANMB 4KJWD 1FPTH 3VXSA 1XAUA 4N0UE 5DJYB 4JRXB 3MLRL 4L3EB 3TVMB 2B1AL 2P7TB 1HSAA 1RZGB 3BN9C 2UY6A 4LRIA 3MUJA 2ADGB 4GBXD 3QCUH 3OKLB 4L5FH 3MREB 4HFUL 4AM0B 1HQ4B 3MRQB 2VUOA 2X7LB 1WZKA 4POZC 5GZND 1WFOA 1HIML 1INEH 2OJZL 3MROB 4P5TC 2L0DA 2ZP0T 3NH7L 5FK9B 1G7JA 3FB8B 4PB0L 4YHNB 1KJ2L 5TQ0L 3SKUD 2BNQB 3I9GL 1OAXH 4EEEA 2DLHA 4Z76A 1H0DA 2X4OB 3OX8B 1I8IB 2WWMC 1FZKB 2YD6A 4ODWA 5E8DL 1D9KD 4HJGB 3D6GA 1KNOA 4JY5H 4UAOC 4GAGH 4QGYA 5FYKU 3MA9L 3S37H 2FATH 4I3SH 3V0WL 1WZMA 1BPVA 2BVOB 2ZSWB 2Z91B 2XTJB 4MJIB 3ALPA 4R4NC 3BDYL 4FHBD 2VISA 35C8L 1AD0B 1D5ZB 5GISL 4HPYL 4Z7WB 1MI5A 4HLZG 5T3ZD 3IETA 2DQHL 1MCQA 5I1LA 5C6WH 1UM4H 2D0GA 1AIFB 1L9MA 3KPLB 4Y5VA 1PJ9A 3UAJC 2UWEA 1GGCL 1JPTH 4TNVF 4GUPB 1OP3K 3E6HB 2V5MA 2Y5TB 3C8KA 3U36A 1H3PL 5HHOA 1U2CA 2ARJB 4HH8A 5TDOB 4OFKA 1OW0A 3K74B 3SDYL 1IGJA 1RJZB 1QSFA 1NGXB 3CSYB 5L0QB 2EXYD 4HWBL 1MCWM 1Z9SA 3IF1A 2X4SA 2IANB 4PP2A 5E00B 1CD0A 1X5LA 5E6YA 1JJUA 3B3IA 1BQHG 3F5WA 3VFTB 4NHUA 3MCKA 1IARB 2IH1B 2IALB 1R3KA 4R4BB 5ESVB 4M9OA 1JZ5A 4V1DA 3I3EA 3G08B 5MEQA 4JR9H 2GJ6B 4F33A 1P9MC 4X7SH 4GO6B 2IAMD 2E6QA 5BVPH 3QPQC 4M7LH 3UBXB 1HOCA 2J4WH 1BIIB 5D8JL 4KJYB 4OZFB 5D1ZC 3WIFA 3OMZA 4HKXA 1OGAE 3RIAK 5F9OH 2FNBA 1L6XA 1CE1L 3QUZC 3VA2C 2ADIB 2BX5A 3HMXH 4FQCL 6CGTA 2IFGA 2GAZA 1AQKH 4U1KA 4X6BA 1HINL 4UQ2B 5DHYB 5EUOB 4FZEH 4NC2B 3PWPA 2PXYB 3NOIA 4YZFF 3SKJH 5D70L 1EV2E 1T80A 4XBPA 2P8LB 3QDJB 3IDJA 5DMGD 3T0XA 4XMPH 2ZNXA 4JO1H 5EBLB 1WV7T 3OKDA 4X5XA 5MERB 4RDQF 3REWA 4YGAB 4Y19B 2DBJA 3KPQB 4HIIA 5DD6B 2F53E 3PJSA 3T8XA 7FABH 4LOUC 4RX4A 5LKNA 1JCKA 4DVBA 2CD0A 3EYQC 4QNPE 4XC3L 5MENA 1CDHA 3BXNA 3MJ8A 2E7CA 5I8KL 5C1MB 5SX5H 1ZT4A 3DROB 5F89A 1BBJA 1BF8A 5D7KD 4OFDA 5M94B 2NY2D 3IDNB 3DO7A 1R24A 1G9ML 3FTGA 3I2CL 3KNBB 4W70A 1FV1A 4JAMA 2HVJB 2A73A 2XA8H 3KPSE 3DVNB 4I3GA 4WW1A 1IILE 4XCYA 1FCGA 1EGJL 1TVBB 5GGUB 1V5JA 1J10A 4TQEH 5EZIL 4X6CA 4O5LL 3W39B 1G7QB 3WXWL 3OAZK 1MFNA 4XWGL 3LKOA 3ILQC 3QQ4A 2AXGA 1J87A 1AKJD 4HXBL 3STLA 3ARDD 3NN8A 3HAEB 2GW5A 4PJ5B 3PP3H 4GAJL 2M2DA 4F57L 4JM2B 1GGYA 3VRIB 2NY4B 4UINL 1EBAA 3BEVA 1XR9B 2DLFL 3MRPB 1MWAA 5FCSH 5FHAH 1I8KA 5L0QC 1EHLH 4QXTB 4HMDA 4XPFL 1SM3H 5C9KA 2YUVA 1UH3A 4JPKH 2R0KH 3IGAB 3NCYP 3RWDB 3S88L 4XNMA 1IGTB 5SV3A 5IROC 3S4SG 2VLLA 2DWDA 4D3CL 3EBAA 1Y6KR 2DM7A 1N2RA 4DUWA 3HUJB 2JK5B 2HRPL 1EEZA 2EXWD 2X4TA 1XMWA 5F97E 5JW4R 3WNNA 3ZLQC 2AI0L 3QFJD 3WO4B 3BH8A 1P7QA 3U7YL 3SDDA 4LU5H 1P4LB 1KELH 2XZZA 3IS1X 4XMKL 1GZPA 1PLGH 3EJJX 3KR3H 3NZHL 5CILL 2ZCKL 2EDJA 4CL7A 5C09E 4LCWA 5AZ2L 1QPPA 5IJVB 1HHJA 3SBWC 3SE4A 4MQXC 3BPNC 1BOGB 5SWZD 5GS0D 1MCIA 1GXEA 2PTTA 3C6LB 3L7EA 3Q5OA 1IAKB 3A67H 3U4EB 4G6ML 3RA7H 2HH0L 5D7IE 1PDKA 3IDMB 5IQ7L 2DYPB 4EI5C 5A2FA 5HTSA 3T4YB 3HE6A 4PJGF 4ZYKA 4Q9CA 4YHYB 4S1QH 4Z7VF 4RGOL 1A7BA 1RUKH 4YAQB 3ARBB 2OL3H 2BNRD 2ZG2A 5FYLD 3WS3A 1MUJB 3FRPG 3VWJB 3S36H 4XBGA 4LLQB 4PJFF 4Z7QE 2FSEA 3MR9A 3F7YA 3GB7B 3REVB 3UJTL 1JK8A 4WI9A 3OKEA 3QPXL 3T0EC 5I9QB 4FQLH 5DVNA 3W0WE 3FHAA 4RGND 1INDL 2IPKA 3MBEB 1LO5B 2AK4E 4MGXA 4LIQE 1BP3B 4GXUN 3SE9H 1XGPA 3GHEH 3QO0B 3T2OA 1NGWA 2ZOKA 3SOBH 2YPLD 3RFZC 3O41A 3QIUA 4LIQL 4ODVH 3ULVD 3RWEA 2NW2A 4LQFH 1NC2D 5D5ME 3ORJA 1RHFA 4EIGB 4GRMB 5B8CA 3WKML 5FUOL 3MBXL 2CLRB 4PGEA 1HYRC 3CMOL 4P23C 2R2BB 2GJJA 4Z8FL 1WK0A 2H9GA 4AT6B 3BZ4B 1INQA 1U92A 1NDMA 2AQ2A 1FZJA 1FYHB 2YWYA 3O9WB 3WLWC 3LIZH 2DLIA 4DGYL 3VXSD 5F1IA 3VMPA 1T1XB 1GGIL 3B4NA 3E1F1 2EE2A 5EPMA 3V6FB 1Y18A 1ZHNB 1JV5A 3EGSB 3CJJA 3KPMA 2NMSA 1F6LL 2G2RA 2W0FB 3VXRA 3C5JA 3GSRB 1ZGLM 4XNYH 1XR8A 1FSKC 2OZ4H 3BW9A 5DJ8A 1N59B 2VR4A 2BSTA 3SGDH 5E5UB 4KDWA 1E4XL 1AC0A 2HJFB 3OPZH 2QQQA 5GGTH 4R6UA 2LTQB 8FABB 2P24B 4P2RA 4XP1H 1DUYB 2O5YL 1HH6A 1LP9A 4LVNC 3I6LE 2Y4SA 3C6LC 3MMEB 4NOBA 5IB1B 3MV9B 3SKNB 1UZ8A 2F5AH 1GGUA 3LQMA 3TA3D 2LAAA 4QXUL 2Y7QB 5C3LD 3O6FC 1N3NA 4G6AC 4FP8L 1I9IL 5BS0B 3TZVA 1B2WH 4UOW0 1CE6B 2WUCL 4K7FB 1T0NB 5D72H 4O2EA 3GGWB 3C09B 4EUPG 5C0CB 5JDSB 2VDNL 4QF1A 4RA0C 2AJ3A 2HG5A 3QUXD 1FLRH 2A6IA 3QI9D 1N0XL 1NH6A 2DQIH 3TNNA 4N0YH 3X11B 1RURL 2AJSL 5I9QC 4F9PC 5FO7B 1KYOJ 2DQGL 5CUSL 3PWUB 1UA6L 4FQXA 4Y2OA 5IJKC 2XRAL 2R2HB 3BP4A 4YC2B 2Q7YA 4YHLL 4ZFZB 5A1AA 4JQVA 1OPGL 1EEYA 4WFED 4OGAD 1UADC 5FO9B 4BFBD 1F45A 1FVEA 4N0CD 4ODUA 4PJ7B 4KHXL 1V3LA 1YPZF 1K3ZA 1QSFD 3VXMA 1MIEH 3D25A 4YDVB 1IEAB 1NAMA 3UYPA 1EHXA 2YMXH 3GJFB 3N1QC 4W6WB 3AC0A 5SX4I 2EDRA 5FECB 5I1GL 4B53A 4IMKA 3ELAT 5E6IC 3UJIL 5JHDD 4HZLB 5GRXG 1T0MB 5E94B 1A6AB 1H3UA 4LSTH 4K7PL 5DZOA 4Q2ZA 5CMAB 2Z92A 2DQEH 4KHTH 2VQ1B 5L2KD 3KJ4C 1KC5L 3ULVF 1SYVA 3MGOB 4OIIH 4X7DC 3LKPB 4JFPA 1YJDL 2OQJA 4R9HA 4P48A 1ZHKA 3ARYA 1ZGLA 2P46B 1UJ3C 4QLRA 4Z0XA 1FG2B 1RK0A 5KOMC 2AXHA 3RHWK 2JJVA 3R06B 4PJXF 3L7FB 1XIWB 4MQSB 2HKFL 4HH9A 4PD4J 1VFBA 1KTDB 1UVQA 2ATKA 5MEOB 3SE8L 2GSGB 5D6DA 3RWHB 3W11D 4F7PA 5KVGH 1MCPH 4MA8H 3RU8L 2V9TA 3JWDL 5JMOC 4MD5A 2F54A 4YK4C 1LK2A 1ZWIA 5DJ0A 1NCCL 3SQBA 5EORL 1G0XA 1EO7A 1U3HA 3O3UN 5JW3H 4RX4D 1JFQH 3WNPA 5GRVK 1FZOA 3LKSA 3TT3L 1J1PH 2FDBP 2FJFB 5DJ2B 4KK9C 2XNAA 3BX7C 1P4IL 5JPNA 3AU1A 3BUYA 4ZOBA 5EO9A 5GPRA 1LK3L 1MLCA 1RJLA 1UXSA 3WL9A 1C5DB 1XT5A 2QBWA 2B5IB 2FIRT 4QRRB 5FA4B 1DSFL 1NBVL 2D7PA 2MOVA 5F96L 1ZHBA 4FABH 4PUBL 2AGJL 2YA2A 4O58H 3BP7A 2YSSB 3G5XA 4K3EL 4K3JH 4PJCF 1AP2B 5BRZA 2L7JA 5HDOA 1QBML 2APBA 4ZD3L 2AV1A 3MNZB 3I02B 4Z78B 3BP6A 3DURA 4PJBB 1NMCB 2VDRL 4QOKA 4YC2C 5F21B 4WY7H 5KTEL 1MEXL 4FG6D 1G9NL 2CGRH 3MRMB 3AM8A 3VE0A 3BKYH 1JN6B 4FS0A 3QP3A 3LB6D 4P4RA 5C0RL 4MNHB 3LRHA 1IAIH 1QQDA 2C3VB 2WP3T 1YNTB 3FO0H 3OTTA 4I3RH 1AGDB 1LDPL 3HB3D 3FFCA 3OKOA 2UWEF 1AFVH 4L4TE 1OAKL 1BVKB 1MAKA 2R56H 5C0BB 5J1SC 2R39A 1A9EA 3WXVH 4BQ8A 2CR3A 3QUMH 4OV5A 4Y4KA 4MXVE 4NO0A 3FB5B 4ORZC 3HR6A 2N1KA 4I1NB 5FUZL 2VITA 4UV4H 4HMEA 2B39A 5C7XH 2YA0A 4K2UH 4K3GA 5C70A 3HCVA 1NBZB 4NZUH 5DRWB 1FYTB 3UYRH 1P7QD 1G6RA 1CLOL 3JV5A 5E9DA 2X4PA 3FAXA 4WFHE 5IB4A 4FTVB 3PWNB 1LDSA 2X89A 4MAUH 1M05B 2JF1A 3LMJH 5E4EC 3VXUE 1MPAL 3WS6C 4ZUVB 1FH5H 5DTFB 3CDGA 5I73B 2UV3A 5J12B 4K8RL 4P3DB 4IRZL 1UH2A 1LMKA 4BZ1L 1IAOA 4H1LB 3WSQH 1M7IA 4CN6A 1S9YA 4CNIB 4KVNH 1NFIA 5ITBL 1P69B 3CK0H 2VKXA 3TWCH 2J8UE 3X12A 1PX4A 2YUWA 2HKHH 2X9YA 4WFGD 1AGFA 2YD1A 5J4MA 1OAUH 4JHWL 4PB9H 4YXHH 1DBKH 4D9RD 1ZHLA 1A47A 3H9SE 3SDAD 3LAFA 2D7MA 4XPAH 4NBZB 1S3KL 5IBTH 4WU5A 1T6VN 3OKMB 5K9QG 2YUXA 2ICCA 2WQ8A 3INUH 1RZ7H 4TUJA 3RWJA 5DS8A 3RDTB 1LE5B 5ISZE 5AUMB 3HKFA 4E41B 4KC3B 4CVUA 2OMNA 3DYPA 3L6FB 3RUGA 1M7XA 5GJTL 1GHFH 4BKLA 1FGNH 2QSCL 5IK3A 1A4KA 4M8VA 1KB5B 5JMRA 4MNGB 4QRSA 1BVLA 3WV0A 3SE3C 4G9DB 1RU9L 3MLRH 1QR4A 2MFNA 4KKCD 3VI4F 5IHZB 2B1AH 3BRDA 2UYLB 5AEAA 2VLKA 1HSBB 4NM4L 1O7SA 5C0AB 5DMKA 2X41A 3P77A 3LPGA 1TZIA 4PREA 4LHUA 1UACL 5DFWH 4HFUH 2ESVB 3T3ME 1U8NA 4OGYL 2UUDK 1HIMH 3O6ML 2OJZH 5DD0L 3BI9X 1P6FA 4X6CF 3BQUC 3NH7H 4PRIA 4MJ5B 3P30L 4XX1G 5BMFL 4PB0H 1KJ2H 5TQ0H 5D1QC 3I9GH 2IBGA 2HT2D 3TT1H 1NSNL 4HEPG 1WCBA 1VFUA 2VLMD 3RTQA 5GXBB 5E8DH 1TZGL 3ZTJH 2QL1A 4OBSA 1RAMA 4WUUA 1Q9OA 1RZIA 3OJMB 1MJ8L 3HG1B 3MA9H 4HUXB 3V0WH 5E2UL 3R8QA 5C6PB 5DEGA 4P2RD 3PP4L 1SY6L 3LKNA 2DOCA 3HE7A 4HUWB 3BDYH 1CR9L 35C8H 4U1NB 4X6FA 3SCMA 2BVQB 4NQTA 5GISH 4U1LA 4HPYH 4MYWB 1OAYL 2BC4B 2BHZA 1KCKA 2JJUA 4PRNA 3QHZL 1KPUB 2WBJC 2VL5B 1T89C 1NBYA 2DF3A 4CVXB 1PKOA 1UM5L 2W9LA 5HHNB 1GGCH 1DUZA 1BD2B 1FGVL 4PBWD 1QLRB 5B21A 4E0RB 1WBXA 2G75B 5KZCD 3V7MA 1H3PH 4JFEB 4LP5A 4NRYA 4X99A 3GBNL 1HXYB 4P4KA 4PV9B 5TDNA 3TJHD 1S9WA 4FQQB 2A9ML 3SDYH 4I2XB 1G7PA 4RNRA 3B2UD 4HWBH 4WHYG 1NGZB 3BIAX 1UQSB 4J2XA 2VZVA 1DDHB 1T83C 4RWHA 1WVZA 2A6JA 4EVNB 1ADQA 5LGJA 4HHAB 5FOBA 2JJSA 4R0LB 2QHRL 3GM8A 3MLTB 2BVUA 4FQ1L 4NQSB 1LNUB 1KJVB 2I5YL 4AENB 1DQQB 3QJHA 3UTSB 5JA9A 3T65B 1A4JB 2CKNA 4KRMB 2GITB 4M43H 2QHLA 4MMZC 4DKAA 5DRZB 1AR2A 1L0XA 3V6BR 3VXMD 3VXPB 3X13B 3V5DA 5B3JF 5GSRA 1CGXA 5DEFB 2CO7B 4BFIA 1YEJL 5D8JH 4Q6IB 1VKXA 3IDYB 4MSWB 3QEUB 3MLWL 4UDUB 1UWXK 5D1XA 1AXSA 1CE1H 2ICWJ 4HIHA 2BDNL 2EDEA 4CDHA 5ID0A 4XPTL 4ISVA 4FQCH 4AEFA 3H6JA 3MGTB 3N85L 4Q9QL 1RVFL 5TE6L 4OUUB 1HINH 1ZVSB 1J9CT 3OB8A 5GGQL 5HHPB 4PJEA 4X5LA 3X14A 3GJEB 5E1AA 1SJVA 5D70H 4XZUB 2G60L 1CFTB 4NQDB 3W9DA 3T0VA 3U48A 1F3JA 2P5EA 1BFTA 3EAKA 1MLBA 4NQVB 4KKAC 1DBAH 2QLVB 3VWKC 3QUMB 4G9FB 2H2PD 2EH8L 4H8WC 1A02N 3AS3A 1YUHA 5D7SL 4X6DE 1RQ5A 3BPCB 5BJTA 1NQBA 5LAXB 3MLZL 4XHJD 3VFMA 5DHVB 2XN9D 3H0TA 3O8XA 4XC3H 1VEMA 1AR1D 2XWBB 4MZ3A 1SJEB 5I8KH 4BH7B 3UZVB 1A7PL 4P2OC 4QHKJ 1G9MH 2VDPL 3I2CH 3MRJA 4Q9BA 4ZAKD 1V3MA 3GSNB 5DFVD 5EU4A 4PGCB 4GKZB 4KDTC 2EE3A 1JWUB 4KZEH 2Q6WB 5HPMB 1OAZL 3CC5A 3CUPA 1NMAL 4XPBL 3RBSA 1EGJH 1NGQL 4Y88A 1BQLL 3DUSA 3KG5A 1DBBL 3G5YA 5EZIH 1IKNC 1GGBL 4O5LH 5HVWA 4XWGH 3KXFD 5A2JH 1WFTA 4QYOB 3THML 4HXBH 1U8OA 1P84J 3RX8A 5HDBF 1LP9F 4NQCB 2FH6A 4GAJH 4RFNB 1FFRA 5D2NA 1G7HA 2I60L 3CNKA 4Z7OE 4N8PA 3K4AA 3PNWA 4UINH 3SPVA 1DQJB 2DLFH 2XKNB 1ES0A 3EJZD 4XPFH 4OI8A 3X3FL 1X44A 5BRZD 1I1CA 4Y16B 1G7MA 3IXTA 1HKLL 3KPRE 5CJQL 3RPKA 4X7EC 1Y0LA 2FWOA 3VFVB 3S88H 4QCIA 1K6QL 1F8TL 4GW4A 4U1JB 4QOKD 4D3CH 1D6EB 2CIKA 3C60A 5I8CB 1T22B 3EYVB 1IM3B 2HRPH 2VDOL 4E42B 3LPFA 3TCLA 3QCTL 3MZTA 2AI0H 1GPOL 3U7YH 1I7ZA 3EZJB 1G7IB 3FFCD 5EOTB 3NZHH 5CILH 3OGCA 4I4WB 5DA0B 2Y72A 5AZ2H 3WJLC 2DQFB 1HKFA 3ZMRA 2QJDA 1A1NB 2R29H 1F3DH 3TBWB 1MCKA 3IKCB 1AI1L 4U6XB 2HFEA 2P44B 4G6MH 3VFUB 4P2QA 4X4MA 4KROB 2HH0H 4U1IA 3M1BB 2O61A 1GZQA 5IQ7H 3D3VE 3SGJC 3MUGB 4PRAA 3SJVA 1TQCB 2F8VA 3CFIC 5EDXA 4OZIA 4RGOH 2X89D 4PG2C 1VGEL 3JTTB 1BZ9A 2I26N 3JWOL 1TQBB 2XXCB 1I85A 3K3QA 3P9WB 2NY6B 3UJTH 1DEEB 3QA3B 4R96A 4OLYH 3ZKSD 4PGBB 3T0AA 1Z9LA 3I6GA 3QQ3B 1INDH 3D39A 4PPTA 5DQDL 3VGGA 2UZYB 5I2IA 4DK3A 4IJ3C 1M71B 1T04A 4HJ0C 3CSPA 3ARSA 4JG0L 4LIQH 5F9WB 2Q87A 3ZDXF 4Z77A 1UKQA 3N1MC 1T03L 3QEQD 1JPFA 3AXLB 4HGWA 4MJ4A 2BSRB 3QIWC 3H42L 3ARQA 3WKMH 3ARGB 4RFNC 5ALBL 5FUOH 3MBXH 3V95A 1BFOA 4HLJA 1A3RL 3BYYA 4NSKB 5E2WL 4Z8FH 2IADA 4Y5YB 2NXYC 3ZKND 4BUGA 1ND0A 4XCCL 1R0AL 2D0FA 3IS0X 3KYKL 2LU4A 4DGYH 1GOFA 1JPGB 4HXAL 1KCUL 1GGIH 3IJSA 5EA0L 5FAAA 2ZCHL 2ENYA 2VLKD 1J0JA 1F4HA 3BMWA 4PRPB 3ZDYF 2P48B 2VN7A 4MXQC 5IUSA 2CLZA 3TN0B 5IW6B 4EBQH 1FLTX 4ODBD 1E4XH 1HEZA 2Y25A 4TULL 4YPJA 2WWKO 2C9AA 4RISL 2O5YH 2Y9RT 2E7LC 5JQ6L 1R5VA 3O6LL 3MRNA 1RZKL 5DJXB 1OLLA 1QUNA 1AO7A 3S35X 4IDJL 2V7NB 1OGAB 2D7TL 5KSAB 1JZ8A 4M4PA 4QXUH 5EUKA 5CJXC 2PO6D 4MB4A 5C0GB 2P43B 3BN3B 4FP8H 1I9IH 5E8EA 2NNAB 3AGVA 4P46D 2WUCH 4JFQA 4H0GA 5DUML 3IU3A 3J8F7 4MJ6B 2D9QB 3UPAA 4GXVH 5GS1A 5D7JB 1TQBC 3ARUA 2VDNH 1BM3L 3QULB 1Z6JT 2ID5A 2VLRA 4ODHL 2GY7B 2VH5L 2R1XA 1N0XH 4YJZL 2H32B 1RURH 2AJSH 4J3SA 3MV7E 3QFDA 2F53B 2DQGH 5CUSH 3LDBB 5K9OA 4U1MA 1UA6H 4GAFB 2HVKA 2XRAH 4OIBA 2Q8AL 4LCCA 4AH2A 2VTFA 4HPOL 4D0DA 3BP5A 4YHLH 1FL5A 1RJYB 2EDBA 4J7RA 1OPGH 3RWIB 4BM7A 4Z7UA 4JPIA 3ZHDA 3CVHA 4LLYA 1P7HL 4P4KD 1UFUA 1T2QL 4OF5A 4KHXH 3DYOA 4XNQB 1RHHA 3D0LB 4J3OC 5C08B 1F00I 5GRJL 2NY7L 3DOSA 3V4PL 3KPSB 4LHUG 5I1GH 5TQ2L 5JXED 1YEEH 2NLJA 3LPWA 4R2GC 1VACA 1I1AA 3UJIH 1NCWL 4JO2L 4DZBA 1SQ2N 7CGTA 4X6EB 2OSLA 2HMIC 4N8CL 1BIHA 4K7PH 3DETC 3UTPE 4Y5YC 1JI1A 4IMLA 1DBJL 5F6IB 1KC5H 3C8DA 3QDMD 2E7BA 3CH1A 2YS4A 3U0PA 3QRGL 1KN4L 3L9RB 5FDWB 5J11B 4JKKA 2FYYB 1WWBX 1IMHC 2W0LA 3VH8A 3VD7A 3FKUS 4NUGL 4ZS7L 5IIEA 3QZWG 1RMFL 1T1ZB 4NNXA 6FABL 3EO0A 2IGFL 1RUPL 2DBLH 3IFOA 2HKFH 4LASL 4OKVA 4HWZB 2YD5A 3CDCA 3RUGF 1CLYH 5DQ9B 3AREC 4J4PD 3SE8H 4YZFE 1NGYA 4H0HB 4HK0B 4CU7A 1W72A 3RU8H 2NTFB 1R3HA 3S97C 2VLJD 5D2LA 4ZOEA 1QFWM 1UB6B 1PKQE 1NCCH 4GKSA 5EORH 1JHKL 3MODL 3QXDA 1WZ1L 2RFXA 4X8JA 2H2SC 3PL6B 3ULSB 4WI2A 1MHHB 2DJ4A 1OVZA 2D3VA 2PW2A 3QXWA 1P9MA 1P4IH 2UVEA 3CIQA 1LK3H 2A6DA 5D7IB 1T66C 5ANMA 1DSFH 1MFDL 1WWAX 1NBVH 2GCYA 2DI9A 4KK8D 4PJ8B 4POUB 1ORSA 1TJGL 5F96H 5DJYA 2V2XB 3SKMB 4JRXA 3MV01 4L3EA 3TVMA 4PUBH 5GJSL 1DCLA 1WT5C 3S4SB 2IF7A 2UZIL 4ZUUB 4K23L 4K3EH 5JLZB 1RZGA 5JUEL 3LS5L 1QBMH 4NOFA 2F8OA 2WSKA 4GRLD 3OKLA 5IFHH 3MREA 4P3CH 1CICB 4AM0A 4UB0L 2VDRH 3MRQA 5FM4A 5KAQG 5KTEH 2X7LA 3EYFB 1MEXH 1F4YL 4AG4L 1G9NH 1N6VA 1MSPA 3DNKA 3MROA 5HYEA 2XQBL 3HI6L 4GT7A 5TF0A 3W0WB 2FX9L 5T3ZE 5J13C 5KG9A 5C0RH 3NCFB 5FK9A 5GGSB 5BW7A 3FB8A 4YHNA 2BCKB 2AK4B 2OYPA 1LDPH 2BNQA 4XNUL 1K8DB 4NQUA 4XVSL 4XCNB 4IEFB 1F11B 1QR1B 5CSZB 5F7MC 5T3ZL 3BE1L 5TDPB 2X4OA 3OX8A 5CS7A 1I8IA 1FZKA 4KTYA 2F74B 4HJGA 2VZOA 1KIRB 1PY9A 3ZHLA 5FUZH 3C60D 3LQAL 3T1FA 1IAII 3T08A 1WQVT 2BVOA 2ZSWA 2Z91A 5H2BB 4MJIA 3BGFB 4MCYB 1LD9B 1CLOH 3UTQB 2VQTA 1IGML 4HF5L 1D5ZA 4WUKL 5C0FB 5DRNB 2EYSB 1T7VA 5B4MD 4PRHB 1ODAA 4B0MM 1AIFA 3KPLA 3U6RB 2QADB 3HMWH 3MYJA 1U2HA 1MPAH 1CXLA 3IDIB 4IDLA 3VJ6B 3L5IA 3MFFA 3PDOB 2EO9A 1V3JA 3E6HA 2Y5TA 3O2WL 4HS6A 4NYLB 4TNWF 4K8RH 2AJUH 3BUTA 3VFSB 4BZ1H 5KW9L 2ARJA 5ITBH 5TDOA 4NZDA 4TVPH 4APQB 4PJGE 5EIQA 1RJZA 4LK4A 3MGAA 4Z7VE 1NGXA 1YN6B 3CSYA 3FJTA 5K93A 3BWUC 3RP1A 4R26L 2X1OA 4YNYB 1IQDA 4QRPD 1J0ZA 2IANA 5E00A 1CDBA 1U0QA 4PJFE 3VFTA 3PL6C 4LGPB 2JIXB 2IH1A 3G6JE 1XH3B 2IALA 3HPJB 5H35B 1MCOL 4A2MA 4R4BA 4UTBL 3IU4H 1S3KH 5FYJU 3SDCB 3TBVB 4EOWH 4L9LC 3D39D 1I8MB 2ATPB 3O4OC 3U1SL 3UBXA 4YBQC 4M6OL 4MX7B 1BIIA 4OCNC 2X5PA 5GJTH 4KJYA 4OZFA 4IS6A 2QSCH 1JYXA 5F71A 3DPBA 3ES6A 3WHE0 1MREL 2ADIA 5D7KE 1RU9H 3V4VL 3CLEL 1MCBA 5T1MB 4NM4H 3CFKB 4RIRA 4UQ2A 5DHYA 5EUOA 4DUVA 4K9EL 2PXYA 1JGDB 4B50A 4CN1A 1UACH 4WNQB 3OB0K 1DL7L 1X6NA 2P8LA 3DX8B 3QDJA 5L88L 3EOBB 5EBLA 5HGDB 1IGIL 1H8NA 5MERA 1ZGLP 3O6MH 4Y19A 4R4FL 3KPQA 1RZFL 5DD0H 5LCVL 5ICYA 5L2JB 2VDML 1T5XB 2NY2C 4CAGA 5CINL 1BBDL 3P30H 5BMFH