4OGYH

Crystal structure of fab dx-2930 in complex with human plasma kallikrein at 2.1 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
219
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasma kallikrein
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/antibody
total genus 41
structure length 219
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ogyH01
1QHOA 1QFUL 3QEUB 4PIRF 2JB5L 5GIRA 4JFDB 1HILB 4XB8A 1CDJA 5FA4B 4UQ2B 4UT7H 2ZUUA 4J8RB 1EHAA 3CSYA 4HHAA 4JKMA 2F8OA 5C0EA 1UWGL 1LP9F 4UNUA 5D4QA 2GI7A 1QA9A 5GQBA 1A7RH 2XQYK 4N90D 3MRNA 3SDYL 4CDHA 2H9GA 5DJYA 3EFDL 2VDKH 1P4LB 2C3XA 2JB6A 1NGWA 2PNDA 1U95B 5HBBA 1ZVYA 25C8H 1B6DA 1I9RL 2V7HA 2DQDH 2FD6L 3IDUA 4HX1A 1NMCC 1R3JA 2WLYA 4GBXC 3ZE2F 1EA9C 3UTTD 4OGXL 3C8DA 3BHBB 1FL6B 5E08H 4O5LH 5DK3A 2VZVA 3LAFA 2IFFH 3ZL4L 1S3KH 4RNRB 3NFPB 5A2IH 4OM1H 2EYRA 5IQ9B 4QRRE 5C86A 1NGPL 3WHXB 2V5RA 1O7VA 3NIDE 5L88L 4AENB 4A2LA 3STZA 4PJAB 4F7EB 1MJ7H 4NZDA 5BRZA 2VABA 3MLSH 1A1OB 4I3SH 1U3HA 3OR6A 4I0CC 4N0RA 5TE4L 1RZFL 1F4YH 1RIHL 5DEZA 4J6RL 1RJLA 3HZKB 2AXGB 3MACL 1GC1L 1TJIL 2ZCHL 4WDIA 4M00A 1DBAH 3N9GH 1AH1A 4L8SA 5SWSE 3RJDA 3TNMA 3MV9D 1RFDH 5F7MC 4X6EA 4P23D 2DTMH 5E5UB 3Q1SH 1N64H 2PETA 3Q6GL 1DUYA 2Z8RA 3MCKA 2XKUA 3TZVB 4X7DC 5E4IA 3SGJC 4HAGA 1CTNA 1IEAA 3D25B 1IM9B 1I75A 2Y5TB 4X9GA 5IFAL 5MP6L 4TYUA 3SKNA 1WZMA 2EDNA 3SKOA 1M7DA 8FABB 4ORZC 4N0CC 43C9A 2OZ4H 5E9DB 4QRQB 1C8PA 2QSCL 2QSVA 5T3ZL 4PJ5D 4K9EH 3FO1A 4PGCA 5C1MB 3IDJB 5TQ0H 3IXAB 2W60B 1NMCB 4M7KL 2VL5A 3B83A 3UPAA 4BKLB 2C9AA 1A1MB 2EC8A 3HR5A 1IZJA 1ZGLM 4ESKA 3PQYB 3S96A 5IV2B 3G08B 1T03L 1RUPH 5T1DH 2WWKT 5DRXA 1UVQA 3MNVA 3FB8A 3OAZH 1YJDH 3WJLA 2Z35A 4XBPA 3KHQA 1S5IL 4HG4K 3M1BB 2PXYC 4XPHL 3MC0A 3OX8A 5ICYB 3HLAA 4QHKJ 3IXTB 4R90L 1F2QA 2W0LA 3O2VH 2QADD 2DQEL 4OCSL 2IQAA 5GRWA 4RGOL 4ZO6A 2BOCA 3Q3GB 4LCCA 1IJ9A 5C92A 1DL7L 2YD5A 1FFPB 4HIHB 5DQJB 1R5WA 4WW1B 4ISVA 4PP1C 2YKLH 3KNBB 4LIQE 3WNKA 1U3ZA 5HYJA 3GJFB 5ABDE 4X5WB 3MOBL 1AO7A 2VXVH 2WQ8A 4CVUA 4ZUVB 1CGVA 3NH7H 4XVJH 1J8HB 1V3LA 2EE2A 4AM0B 5J7CC 4LCWB 3ZDXF 1FFOB 4M43H 1YPZF 4OFYA 4ZSOE 4KJYA 2DD8H 4JDZB 1RZIA 4KXZH 2N7BA 2J8HA 4LFHD 1ZT4A 2VITA 3OKOB 2G2RA 4J23A 4ZAKD 1CK0H 3RWEA 3SGDH 2VZOA 4I3RH 3C6LD 3SE4C 1YYMH 3LRSB 1G7HB 1LO5B 2MNUA 4EN3A 2QQLL 4ZUSA 1A6TA 2J6EH 4NKDB 5T1KB 1NFDB 1U8LA 2OJEB 4OCYL 5ICXB 5IBLC 2JTDA 5CHNA 3F7QA 5JA9A 1ZVSB 1Q9LA 3WIFB 1IAOB 2RCSL 3IETB 3LS4L 2V7NB 4JY6B 2HT3C 5D7SL 1JGDB 1JWMB 1B4JH 3WD5H 1JNHB 1F4WL 3UPRB 1EPFA 1D9KC 2BVEA 4JFOB 1MCLA 4M62L 1X7QA 4C55A 1NAMH 3WUZA 3RDTD 4LVNB 3DX9A 3JV4B 1VACB 3ESVF 3L7EA 3LS5L 4NM4L 1HNFA 4XP1L 3EFFB 4ODXA 1DN0B 3D85B 3VFWB 1FH5H 5GGSA 3FCTA 4P2QB 4WW2F 5TGBA 1FL5A 2BP3A 1QP1A 4GQ9L 4U33A 4HFWB 2VUYA 1RJCA 3MLZL 4Y5XC 1XZ0A 1S5HA 2X7LA 5T3XH 3ZYOA 1A4KA 1JGLL 1VFAA 2VR9A 3MXVH 4R8WH 2ATPA 3U0PB 5IWLC 2F54A 2J8UE 1FPTH 1B0GA 3ARDA 2EEBA 3SJVD 2VIRB 4JM2B 1TNMA 1FNSH 3LMJH 4FTVD 5IESL 1AKJB 2ZZUT 1G9ML 2FGWL 4ZUTA 3MOAH 4PJFB 4HWBL 4RAUA 3DTXB 2DI9A 5BZWB 4D9QD 2BVUA 2XTJD 3NCYS 1JNNH 4JFFB 1MFCL 4IS6B 2DF3A 2XZAL 4KTDH 5A3IC 3HAEA 3DJ9A 4LSRH 4HJGB 3QDMA 3G5YB 1OPGL 2ZOLA 3UROR 2EICA 2Z8SA 3AGVA 4ZD3H 2EZ0D 3VFPA 3L3KA 3TWCH 2X09A 5DC0A 3BVNB 5D1XD 3CDGA 5EU6A 5F72S 3U79A 2AK4A 5ESAB 1JPGB 3CPLA 5I8EB 3CZJA 4Y8AA 5HJ3A 3WBDA 1BPVA 3IDNA 4QHLA 3PWVB 3AU1A 4G8GB 1HEZA 2E5EA 4KZEH 4JPKL 2H3NB 1MFDH 5D2NA 3KYNB 4OCRH 4OKVB 2OR7A 3U7YH 3DX7B 5T3XD 2F53A 3DX8A 4U1JB 4U3XA 2HWZH 4DCQB 1S78C 4G80A 1D9KB 4K8RL 1YA5A 4LFHG 4XVTL 3ZYZA 4Q58C 3T77B 1NMBL 2XKSA 2Z4QB 4PJHE 4L29A 1NLBL 2D0FA 1CFSB 5B39B 1H3PL 4QY8B 4D9RE 4B7LA 4JKWA 2OI9B 3LKNA 3W9DB 1FZMB 3A67H 3U4BH 1CDUA 1BQHG 3CH8A 3WDIA 1QRND 4TNWK 4APQD 2XQBL 1MFNA 1X3DA 4XPBH 3MLPA 5CGYD 5E1AB 2DYPD 5F96H 1JWUB 1WZ1L 5EU4B 3A6CL 2QTEA 1WCBB 4I9WE 2GUOB 4FQHB 4AL8H 1UM4H 3QDJE 5IBUG 1WIPA 5D7JD 3P9LA 1K8DA 1MUJA 3P30L 2YD1A 1KTLA 3DUHA 4JJ5A 3K1DA 5BW7A 3BP7A 1XIWA 3MRPB 2UVFA 4MAYB 2QR0B 1GIGH 2VH5L 5T1LD 3OXRB 4XCNA 5JPMB 3VH8B 1A2YA 2GJ6A 3INUH 3DROB 5GGQH 4JM4L 1Q72H 4PJIA 1WITA 1ZK9A 1JZ7A 1HKLL 1T1YB 3CFKA 3SDDA 4GXUN 3CFIC 3ARZA 1KSRA 5KSAA 4PR5A 3L95B 4BH8A 3P4MB 3H0TB 4XPTH 1EX0A 3VU2A 3ARBB 4GG6E 4PGEB 2FEEL 1D5XB 3HZYB 5BV7L 4H1LH 2ADJA 5GSRB 2VAAA 3VXUD 4FQJH 2AXJA 1QLEH 1KJ3H 1GRWA 4F9LC 1RHHB 2R4SH 4FXGA 4HWBA 2XXMB 3EYSH 4HAFA 1NUDA 4BQ8A 3VGDA 1QD0A 4Q9BA 4OZFH 4XXDB 3D69B 1MREH 3DO7A 3KLHC 2CQVA 1NGQH 1U8IB 3MJ7A 1WAAF 4UTAH 3WCYA 5I76A 1AR2A 4OLUL 1PG7H 3IVKA 4J1UA 4JGUA 3OJMB 1KF9B 3QIUC 3VFGH 5DJZA 4JQVC 4JE4B 4LU5L 43CAA 1J0JA 3NOIA 2NR6D 4DVBA 3OR7B 3CFBB 4WUKH 4F7MB 3BPCA 1BD2B 3L5JA 3OJDA 1QTYT 1S7XB 3WFZA 2YK1H 3ZE0E 2NX5E 4GKZA 2NY3C 3C08H 4OD2A 3S37H 3FRPG 3IDIA 2D4FA 3LQAH 1KCSH 1BBJA 4X8JB 2Y1VA 3OKEB 4DQOH 2AK1L 1SYVA 1LK2B 4U1KB 4C54A 4HZAA 4NHCH 1NANH 3HG1B 3OKYA 1HDMB 1R24A 1OAXL 2K3TA 3BRFA 1KGCD 2YR3A 3IFLH 3T0EA 3SDCB 4XGZB 4XNMB 1LD9B 5JMRA 1MCQA 3OB0K 1CIUA 4JFDD 2C5DC 3IFPA 4IRJC 4GQPH 4OM0L 5IQ7H 2Q20A 3HUJF 4K94H 4KK5D 2Q6WA 5J3HC 1X4XA 4QXUL 2EIZB 1OTTC 3IKCB 4N0UB 3WDJA 3K3QA 4DN4H 3QZWB 2AJVH 3OMZA 1QPPA 4F7CA 3ARGA 3DUUB 2JKXA 1JRHI 3EHBC 3KYKL 4L4VA 3EJZD 4U49A 2WSKA 5DK2A 2VLLB 1D5BA 4P5KA 2Y36L 2R0ZL 4N0FB 2ICEA 3QIUB 3B9KC 4XNZC 5EC1B 5I2IB 3KWWA 4P59L 4ZFOL 3VW3L 5I8OL 3ULUL 2UWEA 4L4TA 2EEAA 2DQHH 3PWLA 3K8MA 1RK1A 4JFEB 4M6OL 2ZJSL 4LLQA 4ORGA 4U1NB 4MD0B 1T2XA 1RJZB 1K6QL 1JF1B 3QUMB 4M7JH 2ID5A 2WUCL 5SX5K 4DW2L 5ILTL 3VXUE 1CDBA 3SE8L 3LRGA 2R9HD 2NY3B 5ESQB 2BX5A 5DD6A 3V5HA 3WXWL 5FO9A 3V5DA 4Y8DC 5ERWA 3MA7B 3X13A 1AY1H 4PJCF 5I0ZA 5E2JA 5IBTL 3RWCB 4MD5A 4M1DH 3AROA 3HUJA 5I1IH 2QBWA 3NPSC 3HNTH 1U58B 3MRQB 3UZVB 3IKKA 5CJQL 5EC2A 5LCVL 2HT2D 4GSDH 2X70A 3RZCA 3W11D 3K2UH 4RRPA 3P9WB 2FWOA 3V6BR 2FJHB 3KYMB 3C6SB 4H8WC 4LGPB 1YNTA 3IU3A 3TZVD 3HE7B 4IMKA 5DHVH 2A6DA 4Z76A 5ID1B 1IM9D 4GG8A 4IRJB 2QJDA 4WO4C 3V8CA 4OZIE 1JL8A 1RZKL 1ADQA 4Y5YA 4EDWH 1QO3B 3RVUC 1RU9L 3B8YA 1UM5H 5J06A 1J05B 3ROOA 1YMMB 1LEGB 4X6DA 5E9DD 5DUPL 4ZOEA 3VXNB 5IMOB 3GJFH 3VG0H 3F5WA 1MRCH 3LQMA 1FYHB 4WU5B 3VXRB 5JXEC 4M3JA 4QHMA 2BVYA 2WBJC 3GIZL 5GIRB 1A7OH 3BGFC 2MSPA 4H1LG 4FQQA 4G6KH 1OTUD 2BFVL 5HI5C 4J4PD 4OZGF 3CSYB 4HHAB 1E6JL 4XNZB 2P1YA 3I50H 1KV3A 2R0LL 3PWJA 1LNUA 1QA9B 4OZFG 2NY1C 4X9HA 5CMAA 3MRNB 3P0VL 3NFNA 2H9GB 4NZJA 5DJYB 2JB6B 1NGWB 1NGZA 1CL7I 5DGQA 1FAIH 5BO1H 2V7HB 3VXSE 3RU8H 3HMWL 4HX1B 1R3JB 4DGIL 4G8FA 4KJPD 4C4KO 4JB9H 2PYEA 4S1QL 2WM0A 4TRPL 1OSPL 4IRZL 3ARWA 1V3KA 2EYRB 4QRTA 1T4KA 1F42A 3S97C 4OGYL 5CKAA 5IW6A 3UTSE 1CI5A 5EDXA 2WZPD 4GXVH 1GHFH 2FYYA 1P4IH 3ZZ1A 5E8NA 4ZFOA 4XVUC 1RK0A 3STZB 1G7QA 5BRZB 2VABB 1UENA 2HH0H 1U3HB 2X4NA 1FBIH 3V0WL 5DD1H 3C09C 3F6IA 4HCRL 1RJLB 3L3JA 3GK8L 4LSSL 5LGJA 4LCWD 3FHAA 4L9LA 3WLWD 3ZTNH 4WDIB 1S9XA 4MLSA 3BWAA 4N0CD 1X5XA 3LV3A 4LCIL 4KGJA 3HMXH 4L8SB 1J11A 4TSBH 2Q86A 4QRPA 1H15A 4P9HC 5DZOA 5FYKH 1DUYB 3MCKB 2AJXL 3QJHA 2UZIL 4OTXL 5GZOD 4K3DL 1CLOL 1IEAB 3VWKA 1NCCH 2AS5M 3SKNB 1KEMH 3SKOB 5AYUL 1EEQA 1M7DB 4Y1AE 4Y4KA 4GS7B 3FZUC 5T1KD 4LPYA 2NY5C 3RUGF 5IB5A 4PRNA 5INDA 43C9B 1NFIA 1A6VH 1NSNH 1BQLH 2A77H 1BLNA 1OD9A 1A7NL 1GGCL 2VDML 1IC4H 3ZE1F 2LFGA 1ETZA 1BGXH 3FO1B 4PGCB 3EZ8A 5ELIA 1AQKL 2EDKA 4NWUL 3CK0H 4R4FL 3HRPA 4ODTL 4U0RC 2ED8A 4OSUH 2VL5B 2ZUTA 1RSFA 5HHME 2Z8WC 2VQ1A 2XZCL 3BPOC 3DLQR 3KHOA 2W9LA 3HR5B 3T65A 5SX4H 2DKSA 3QXUA 3S96B 5DDHA 3MQIA 3WNNA 4LMQE 5DRXB 1ED3A 5DR5L 2EO1A 1UVQB 3MNVB 2O5YL 3UTZA 3FB8B 5CJXA 1NL0H 4PP1D 5DJAA 5GGUA 4PY8J 4HWEH 2Z35B 4XBPB 3D85D 4YE4L 4ZO8A 3QNZA 5GRZA 3F58H 4M4PA 4C83A 2EDEA 2CLZA 1WVZA 2J88H 3PQYE 5FYKD 3OX8B 3HLAB 5AZEL 2AJZA 2EKSA 3RWJA 5HDQH 5CUSL 1NUGA 1OT1A 2IQAB 3FB5A 3MODL 2BOCB 4LCCB 1CQYA 2X89A 1R5WB 3JV5A 3OZ9L 1YEHH 4ISVB 5FUOH 4YEFA 1C7TA 4XCCL 5B3NA 3DXAE 5HYJB 4YH6A 5CEZL 1AO7B 5C2BL 1JFQH 3QDHA 5CCKL 4JM2D 2JCCA 1AKJD 3PF2A 3NCMA 3WHE0 4KK6D 1BVKA 2AJYH 1JGUH 1IC5H 3QISA 3PDOA 1H3VA 4JFFD 1J1PL 3BKJH 4JO2L 3IJYA 3DV4A 1BFOA 2Z8VC 4Z7UA 4KJYB 4PB0L 1INQA 4IJ3B 3ECBA 4JG1H 1RZIB 3ARDC 3TYGL 4YHKH 4UV4L 1J8HE 4F33A 2BNQA 5KSBA 4M3KB 3S34L 1ZT4B 2VITB 4BFGA 4J2XA 2G2RB 2OMBA 5CILH 5EUKA 4LCWE 4JFHE 1HXYA 5J57B 4G8GD 4RWHA 3RWEB 3NCBB 4GT7A 4BZ1L 3E6FA 1DJSA 4U0RB 3P4NA 5HHQA 2HT3D 4FG6C 5CD5D 3B2VH 4EN3B 1C08A 3GSQA 3GB7A 4ZUSB 4Z8FL 1A6TB 2BRRL 1DQDL 3KPMA 4NN7C 1U8LB 3HZVA 4QXTA 1D9KD 4R9HA 3JWOL 5BOZG 3STLA 3ARYA 5CHNB 3AVEA 1FGVH 4OBRA 1ZS8A 1VPOH 1Q9LB 4UMGA 3V95A 1MIEL 3W2DL 2WWMC 5IK3A 3RGVC 5AG9A 2H6PA 1LO0L 2ENSA 2GYSA 2IH3A 4XCFH 4ZTOH 1NFDE 2YD3A 1AR1C 4C58B 4F7TA 3QH3A 4KH2A 3PGCA 1Q0XH 4MNQA 3H3PL 5FUCC 5F9AC 5ITBL 4XPAH 3O4OB 3MA9H 4JZJA 4M6ML 1X7QB 4YFLI 4P2YA 3V6ZA 3DX9B 3L7EB 4PRHA 3Q5TA 2YHGA 4FZEH 5DVNA 1LO2H 4YXHH 4ODXB 4FFVC 4QOKE 1DQLH 3AMKA 2W0PA 1FNGA 1Q1JL 5GGSB 2VQTA 1UKSA 3U30C 5GISL 3FCTB 1UZ6F 5TGBB 1FL5B 2OSLA 5GGVY 3H7BA 1UXWA 4X6BA 3T3ME 1AC6A 4MAYD 2XIDA 4HBQA 1BOYA 1F4XH 2VDLL 1JHLL 1XZ0B 4Z0BL 1S5HB 1KYOK 2YPLA 2X7LB 4I3GA 1CU4L 2JLLA 5HVWA 1A4KB 1OD7A 3ZDYE 5HXMA 4DZ8A 5JW4M 2EH8H 1VFAB 5IB3A 5IP4A 2ATPB 5JOEA 4P2QE 4KVCH 1EH9A 3VDBA 5EPMA 2F54B 5D96C 1B0GB 3ARDB 3P9MA 4Y2DA 5BW7C 1IGJA 4RA3A 2FB4L 1A7QL 1U3YA 4M5YH 4ZUTB 4RAUB 2R0KL 1BOGA 3ARBD 3FJTA 3R8BB 2IBZY 2CLRA 1L7IL 1MCWM 1HQ4A 1CLYH 1KENH 3UEZA 3HAEB 2AQ2A 3QDMB 5DYOA 2BHZA 3BRDA 2R29H 2ZOLB 2VMFA 4Z7NE 2YRZA 1R0AL 4KVNL 1MWAL 4NN7B 3WUWA 1CL7L 1P9MA 3WV0A 3SDDC 4M93C 2ZKHL 3VFPB 3L3KB 4AY0A 4HWZA 4OJFH 1E6OH 3BFOA 5EU6B 3CDGB 2IPTH 4PJFE 3MMEA 2AK4B 3D3VA 2PTVA 5TFSH 1JK8A 3CPLB 4YDIL 1QSVA 5KSAC 3RWFA 4RFNC 5HJ3B 3CX5J 2IG2L 1JBJA 3IDNB 4QHLB 2HFGL 3ZKMC 3AU1B 2NXZC 1HEZB 3TM6A 1T22A 5LWYL 5FM4A 5D2NB 2VC2L 2F53B 3DX8B 1VFUA 3QFJA 1SEQH 1S8DA 2VZ3A 1DFBH 2MPAL 4G80B 3W5NA 1BD2D 2YUZA 4AQ1B 3OKDA 2CR6A 2LABA 5SWZD 2H26A 4G8GE 2FBJH 4L29B 12E8L 1MCOL 4U6TA 4ALAL 4LLAA 4FMKA 3LKNB 4W81A 2CD0A 3TJHD 1WZKA 5AZ2L 1NBZA 1NGXA 2LU3A 5D7KE 2AEPH 4HS6A 3T2QA 3NMEA 3BW9B 5IW3A 3RPIA 5I1GL 5J6HA 1OM3H 1BFSA 2CDEA 4TUKL 3VGAC 3HG1D 1KB9K 1BF8A 5B39G 2R56H 1SY6L 3EOBA 3QUMH 4MWFA 4YHPA 3MRRA 3P9LB 3SDCD 1K8DB 3RX8A 1MUJB 3R4DA 5D96B 1KTLB 4MS8C 4JJ5B 2D0GA 1QBLH 2M1KA 5LGHH 3BP7B 1XIWB 4X7CC 1N2RA 3MRCA 1CICC 3MLYH 1FV1A 3BSZH 3MRFA 5JXAH 2AEQH 4QHNA 3WFDL 4XCNB 4KHXL 3MCLL 4YUEH 1A2YB 2GJ6B 4LPUA 4XX1G 2ZPKL 4PJIB 4NSKA 3T0EC 4Z7QF 3WIIL 2P44B 3BGMA 3SDDB 3CFKB 2D7NA 1FIGL 5KSAB 3CLEH 3PHQA 1QVOA 4PR5B 4BH8B 4RFNB 4H20L 3IDYC 4KMQA 3VH8G 2YWYA 5MENE 4J3OC 4CVWA 2IBZX 5EO9A 1OAZH 2ADJB 1VGEL 2IANA 2VAAB 1QSEA 3PWPA 3DVNA 4DGVH 4JFED 4OCLC 2IEPA 1NCUA 2AQ3A 4P9MH 3EYQC 4XMLL 3QJFA 1A3QA 3QHZH 3DO7B 1QR4A 1L0QA 2MQ3A 4G9DA 3S8WA 3MJ7B 1KC5L 4P5TA 1YN6A 2D9CA 3A6BH 4Q0XH 5I76B 1MWAA 1NDMA 4WY7H 1TCRA 4J1UB 3U1SH 2NY3D 5HDOA 1UWEL 5FM5M 4J3SA 5FKPA 4W4OC 5DJZB 4RFOL 4HPOL 43CAB 3F8UB 4OLEA 4DVBB 2HT4D 3X12A 4BQBA 5DRWA 4KHTL 4NKMA 4M7ZC 3BPCB 3O3DA 3KS0J 1KG0A 3OJDB 4MDJA 2RIKA 2XOTA 1RZGA 4TVPH 3ZSSA 3TT3L 4Z7VF 3O6FA 4GKZB 4YR6A 4IOIA 5A2KH 4OD2B 1RULL 3H9SD 3IDIB 3HE7D 1BECA 1TZIA 1BBJB 1KB5A 4HIXH 3VCLA 1BD2E 1SYVB 4G6JL 1KPUA 4K71C 4MQXC 1IRAY 2ZUXA 1YMMD 5CGMA 4KTEL 5J3HD 1G7PA 1E28A 1R24B 5I1CH 1UCBL 1WIOA 3CU7A 3MLXH 4NGHH 3MOQA 1X5GA 1FGNL 1AHWC 2BC4A 4R7NA 3T0EB 3VXRD 1N5YH 4JHAL 1N4XH 1QYGL 1T83C 4CGTA 5FYJH 2UUDK 3BWUC 4XPFL 4YNYA 5FCUH 4NKIH 1LO3L 1MHPL 4IMKC 1TTGA 1IAMA 1N5AA 2E8YA 3ZKSD 3CX2A 3IFPB 1D5MA 1QR1A 3IDYB 5C0AE 3DI2B 5DUBA 1BX2B 1NCAH 1BM3L 2AXFA 4JY5H 4Y5YC 2FATH 5J9PA 2Q6WB 4LVEA 4XWOD 1FAKT 3LIZH 2JELH 3PJSA 1I9EA 5A1AA 5FECA 5E4EC 5FM5O 5IGXL 3KS0H 4F7CB 1YEEH 4L9DA 1XGTA 1H5BA 1QG3A 3ARGB 1IGCL 4LEXH 4L4VB 4TVPD 4HW6A 5TQ2L 5HHVL 3QEHA 4JKPL 3N1MC 5DK2B 4UDTA 2Q8BL 1AJ7L 4LQFH 3AXLA 4PTTA 5L0QB 1D5BB 1EJOH 1JGEA 4P5KB 4P49A 2DWDA 2ICEB 2IH1A 3QT2A 4IIQC 1RURL 3QQ9C 5F7EL 3QZWG 3KWWB 1FVCA 2X1OA 3O4LA 4Z7OE 2UWEB 1B6UA 2YS4A 3PWLB 4OF3A 1RK1B 3MV8A 5KN5A 3ARSA 4LLQB 4ORGB 4PLKC 2JIXA 1FDLL 2OJZH 3OPZL 4M7ZB 3L5XH 1CFBA 5IR1A 1CFVH 1DBKL 5BV7B 5E70A 3TVMA 3AM8A 5FO8A 5DLMH 5IG7A 4K23L 1Y6MR 5BRZD 3TH3T 5FYJD 2HA1A 1U3HD 2D7OA 2C4XA 4NJAL 4TNVK 5DD6B 1QFUH 3V5HB 4FP8L 3V5DB 5FO9B 2JB5H 3SQBA 5ERWB 5HI3D 1J8KA 5F8RC 3X13B 3RVUD 4K71B 4MD5B 3HUJB 5B8CA 4XHJD 3G5ZA 4JVWA 3NA4A 2ZCLL 5C6TL 4OIBA 5EC2B 1RV6X 4IDJH 4CDGC 2X70B 1MCHA 3RZCB 3SDYH 1JHKL 2FWOB 3EFDH 2FJFA 4ZUUA 1YNTB 3IU3B 3T1WA 2A6DB 1I9RH 4Z76B 1A7PL 1XGUA 4GG8B 4L9LC 4Y5YB 4WWKA 4R7DB 3ROOB 3RQ3A 4X6DB 4R26L 2YEZA 3F5WB 5FHAH 5E4EB 2B0SH 4ZFFA 5D7LA 5DHXB 5DJ0A 4QHMB 1NGPH 3IFOA 1IGIH 1F90L 2X4TA 2GTZA 3DSFL 3LN5A 3KPRA 1JN6A 4NZTL 3VWKC 1JMXA 4FQQB 1C7SA 1A3LL 5EORL 1CLZH 3NAAL 1NCTA 3GRWA 3PWJB 3VXRE 4X4YA 1LNUB 1INEL 2NY5H 1RZFH 4XNUH 3QWRA 1RIHH 4HUNB 5CMAB 3JVGC 4J6RH 4JAMA 3SE3A 4G6AC 3NFNB 5FCSH 1NGZB 1B2WL 1TJIH 4YHYC 3QRFM 2A38A 2NNAA 3O11A 2VWEC 3P40A 4G8FB 4HK0A 4YHIA 1DLFL 3MGTA 4WHDA 2I5YL 2VDNH 3ABZA 2PYEB 4OZ4A 3MLWL 4KMTL 1FFQA 3MTRA 3WIHL 3Q6GH 4QRTB 4Y7MA 4ELMA 5E99L 3UJIL 4ZNCD 1T4KB 5IW6B 3PXHA 4KI1A 5CJXC 4YDVA 3WEXA 4LCUA 2FYYB 4FZ8L 3N06B 3AMLA 5E8NB 1PQZA 4ZFOB 1JTTA 1RK0B 1G7QB 4CNIA 1V5JA 4M9OA 2FDBP 3S6CA 2X4NB 4F57L 2QSCH 5D5MF 5T3ZH 3O6KL 1JHTA 4GW1A 1SM3L 3ZSTA 3L3JB 2HLAA 3MJGX 5MI0C 4L9LB 2YZ8A 4M7KH 3BWAB 3BN9C 3LV3B 4OFYD 3W81A 2C4FT 1H3UA 3WHE1 2VXQL 2Q86B 5A16A 4QRPB 3SO3C 5IMKA 3B5HA 1E0OB 3QEQE 4G42A 4P2OD 3QJHB 3OGOE 4XP9L 3QPQD 3TO2A 3VWKB 5DMKA 4P57A 1GL4B 4EN3D 3UYOD 4WNQA 4AIOA 4Y4KB 1T20A 3LN4A 4NQEA 4LDOB 5IB5B 3H6JA 1XGQA 4O51A 4PRNB 1NFIB 3E8UH 4R90H 5C0JA 5INDB 1I3GL 4M61B 4MB5A 3M8OL 1V8HA 2Q87A 1CFTA 2XKNA 3VD9A 5JIIA 1HINL 4NO5A 4E0RA 5IMMA 1ETZB 1I8KA 3ZE2E 4PYGA 5DSCA 4MMZC 3LEVL 1SBSL 4YHLL 4FRWA 1IT9L 3MOBH 3DVFA 2PR4H 2VQ1B 5T3ZD 4JCMA 3KR3H 3T65B 1MFAH 5DDHB 3HTLX 4AEHL 1ED3B 4DGYL 2RAMA 4YHNA 3QNYA 3UTZB 1TTUA 5GGUB 5DJAB 5IHUH 4PJDA 3RAJH 4L3EE 2EEDA 3VXTA 5KVGL 3QNZB 5DZNA 1C5DA 4TNWF 4C83B 4LASL 2CLZB 4BK4A 2JJTA 2AJZB 2EKSB 3BXNA 1QNZH 4OAWA 1LHZA 3GHBH 2LTQB 2I9LA 3FB5B 1X9QA 1DBML 1WV7T 2GK2A 1LEKA 4Y16D 4OGZA 3WXVL 4MSWA 5D71L 3MSPA 2QQLH 2XNAA 1ZHKB 3ARDD 4OCYH 5BXFA 1Q8MA 5F6HJ 1CD9B 2JCCB 4TPRL 1BVKB 4DUXA 2IBBA 4GRLA 2AVGA 3PDOB 2EDJA 4M7LT 4FG6D 3LCYA 5HYJE 3DV4B 1I3VA 3QDMD 1BFOB 1AO7E 5FAAA 3GI8L 3IAQA 4Z7UB 3VXME 1INQB 1F4WH 1TCMA 3ECBB 1OL0A 5EU6D 4Y2DC 3FT3A 4HK3N 4F33B 4RGNC 2BNQB 5KSBB 4M62H 2E7HA 5EUKB 1UACH 4B50A 1EHXA 1HXYB 1P6FA 3DETD 5E2UH 1AE6H 2DWEA 3QG7H 2WWKO 4YPJA 3P4NB 5HHQB 1XAUA 1AR1D 3BT2H 1I8LA 4LIQL 1C08B 3GSQB 2VR5A 5E2VL 3GB7B 4J3VA 1ONQA 2F53D 1QFHA 2PO6A 3KPMB 4X83A 3HZVB 3MLZH 4QXTB 1BVLA 5C0DA 1JP5A 3STLB 1CFQA 2BJML 2WINA 1ZS8B 3QG6A 1JGVL 2YUWA 5KVDH 4BUHA 4FFVD 5IK3B 1FLTX 2OTWA 3VFRA 4RMQA 2KZWA 1N6VA 2IH3B 4TSCL 5C0CA 4PP2A 4MJ6B 2DM3A 4F7TB 3QH3B 5E94A 1NBYA 4MNQB 5IESH 3MLVL 5HVGB 2VO5A 1G9MH 4I5BA 5KANG 5CZXC 4HWBH 2FEDD 4JZJB 2XG5A 4RMTA 2WK2A 4PRHB 4WFHD 4Z9KB 5SWSA 1NDGA 3BJ91 3QUZD 1OPGH 1A7RL 1FNGB 3C5ZC 4M03A 2F19H 1RUQL 2VDKL 2OSLB 1P84K 3H7BB 1UXWB 4X6BB 1TQBC 1XIWD 25C8L 4XAKD 1VA9A 2DQDL 2XN9A 5EA0L 3ZDXE 2YPLB 1S9VA 4YDKL 4WI5A 5J89A 5CZVH 4IDLA 4ZS6D 2GJ6D 4DZ8B 3VGBA 5E08L 4NQDA 3VDAA 4JPVH 1NUFA 4NWTH 5IB3B 2JJVA 4GRMB 1S3KL 4U6XA 4F7PA 3BUTA 2IPKA 4OM1L 4PD4K 5EPMB 3SDDD 2AQ1A 1DLHA 1Q38A 4N0YL 3F65A 4XB7A 3P9MB 4Y2DB 5J11C 4WHTA 1IGJB 4HWUA 4XVTH 2VLJD 2MQCA 2W38A 4P3DA 5DRNA 5KSAD 1NMBH 4XI5C 3E3QC 1BOGB 1MJ7L 1BHGA 1FFNA 2CLRB 4I3SL 2F54E 3WLBA 5HYFA 1F4YL 5DYOB 1N6UA 4RGMC 5JUEH 4OV5A 3SDXF 3WUWB 4IRSC 4G8IA 3CH1A 3HB3D 4G7YL 4HWZB 3ILQD 3DV6A 2ED7A 3D3VB 3MMEB 1JK8B 2NYYD 3A6CH 3BYTA 3FQNA 3MGAA 4TTDC 3RWFB 3K46A 2DMBA 2KUTA 3H8NA 3JV6A 4JFQA 1RFDL 1T22B 4PJ9C 1A14L 2YXFA 1HSBA 3T1FA 4L8DA 1N64L 1EO7A 4KRPC 1EERB 4TQEH 2C3GA 3QFJB 2XWJA 1S8DB 2AK4E 2DM7A 2A0LC 3QIBA 1WK0A 3OKDB 2GKIA 4UDUA 3U83A 1RZ7H 1WISA 2H26B 4JVUA 3NABL 1WT5A 4X0KA 3TBWA 1G9NH 4POYA 2OZ4L 1A6PA 4CU7A 4F3FA 4JM4H 4XNQA 4K8RD 1DQML 5BS0A 4S1DD 5JMOC 1HQRA 4PBVC 5FUCE 1I8IA 1NBZB 1NGXB 1YEJL 3B9EA 4HS6B 3RPIB 1PLGL 2BY0A 2DOCA 1BZ7A 5J6HB 1CXFA 1FP5A 1J1OL 2QSTA 3T3PF 3UMTA 4U1LA 4FN0A 5E2TH 1SVCP 5BV7H 2E6PA 1FC1A 1JNJA 3EOBB 4MWFB 4YHPB 3MRRB 3SDXA 3NTCH 3O6FC 2BSTA 1RIVL 1RUPL 2EXYC 4JN2A 4M02A 3SGKA 4BFIA 1U8NA 4Z6AT 1CVRA 1U0QA 5ANMA 1N2RB 4DUWA 3MRCB 2V6HA 2GEEA 1FV1B 3MRFB 4S1RH 3LKRA 3O2DA 3C5JA 4QHNB 4ONGL 4OLUH 4WFHE 2WLZA 5I1AA 5HSFA 1T2JA 3OG6B 1J1XH 4LU5H 1EMTH 4NSKB 5F7WC 5E5MA 4RGMB 3ARGD 1A6AA 1F3DJ 1TQCC 3BGMB 5EU3A 4PGDA 4JFYA 4L4VD 1F8TL 2P5EA 4XAKE 5F7NC 2OK0L 3WS6A 1TZHA 3GSNA 3PHQB 1QVOB 2PW2A 4AT6A 5HGAA 2GJ6E 3EDKA 2VXVL 1ACYH 4PJIE 5EO9B 4I77L 1ADQH 2IANB 1QSEB 2V5MA 3NH7L 4L8BA 3PWPB 3DVNB 4KRPB 5J1AA 2AK1H 3QDGA 2D9QB 1NEZA 2B4CL 1SEBA 3D18A 3QJFB 3HPLA 1BIIA 4G9DB 4OB5L 4P5TB 3BZDA 1YN6B 3MJ9A 4M9PA 1MWAB 1NDMB 1TCRB 2DD8L 5FGSA 2DIAA 5FKPB 2HTKD 3BE1L 1A1NA 3MREA 3BD3A 5FGCB 1EJ6A 4KZDH 1CK0L 3X12B 4I3RL 5DRWB 4NKMB 1S7SA 5IVZA 4OM0H 3O3DB 3WO4C 3AM8C 3EYOA 5DJ8A 4JREB 4MDJB 5EG6C 2J6EL 1RZGB 2CSPA 1F3DH 5HYQA 4QXUH 2J8UA 2I24N 3QEGH 1R3LA 3RZCD 3C8HA 1YEDA 3O6FB 4P2CG 4YR6B 4IOIB 2C7UA 1DSFL 1TZIB 3TIEA 3OAZK 1KB5B 5HGDA 3VCLB 1RZJC 2XFXA 1HCVA 1KPUB 3WNPA 2RQ8A 3P4LA 1ZHLA 2Y36H 2YPKA 5B8CC 2E7BA 1LWRA 1G7PB 1E28B 1B4JL 4MJID 3WD5L 3CVIH 3Q48A 3RRQA 3VW3H 5I8OH 4R7NB 3ULUH 2BC4B 4M6OH 5C2UB 3QAZB 4YAQA 1NAML 4YNYB 3S36X 1UH2A 1N5AB 1Z9SA 2E7LA 3GFUA 4HXAH 1D5MB 1QR1B 1FH5L 5DUBB 2MWCA 2VB5A 2AXFB 4LMQI 4WWKC 4DW2H 5ILTH 3DSNA 4NRXA 3SE8H 4G6FB 5J9PB 3T0EE 3X11A 4YC2C 1QFWI 5J56B 3RWDA 5C9JA 3SBWA 3PJSB 1PX4A 5FECB 5GS1A 1A47A 5T3XL 3WXWH 3MPCA 4PLKD 1CCZA 5MEPA 1UB5A 3QUXA 1XGTB 1H5BB 2H8PB 4PJHA 4JN1H 4R8WL 4Y4FA 5IBTH 3QEHB 1EDQA 1W0WA 5HVHB 3F6LA 3K0WA 4YZFE 2XG4A 4UDTB 4CMMB 1MQ8A 3AXLB 4PTTB 4WV1C 1JGEB 4EUPA 1WWCA 4PJGF 2DWDB 2IH1B 5D2LF 3LMJL 1FVCB 3KG5A 3O4LB 1GC1C 3KGRA 3MOAL 3SE3C 5DMGC 3MV8B 5KN5B 4TN9A 1T7YA 1I9IH 2JIXB 1HCFX 1JNNL 3GKZA 1MI5E 5IR1B 1BQSA 4KTDL 3TVMB 4LSRL 4ONOA 5FO8B 3ULUD 3OKKA 5IG7B 5JR1H 4NCC1 5I1HH 5DUPH 4RDQG 4JRXD 4ZD3L 5HHOE 2EE3A 3X3FH 1P5VA 3KJ6L 3EO9L 3VD4A 3TWCL 3MBEC 1GJIA 1IVLA 3K4DA 3THMH 4L4TE 1SHMA 2DMKA 3GIZH 2ZUYA 3MZGB 3BPLB 3PP4L 4KZEL 2ATKA 4HUWA 4OCRL 3G5ZB 4OD1H 3U7YL 1E6JH 4O4YL 2EC9T 2R0LH 3KPTA 2HWZL 3EZJB 4QRPD 1MAMH 4NNPH 4N9GA 3HR6A 5IUSA 1ZAGA 3P0VH 2DAVA 3UX9B 4WFGD 3IGAA 1KCRH 2FJFB 1EUUA 4ZUUB 2CUMA 1HN1A 3HUJE 1VFBA 1XGUB 2ZWLT 4MDIA 2ZUQB 2LVEA 2QHLA 5I8KL 1UC6A 3ES6A 4Y4KD 4UOJA 4NNYA 4DGIH 4MA7H 2X41A 1CD0A 2Z92A 4XPBL 4LOUD 4PRIE 1QUNA 2YEZB 1OSPH 4IRZH 3MRDB 5F96L 4ZFFB 5D7LB 4L4JA 2KZ1B 3MLTA 5DJ0B 5E0QA 3ESUF 3IFOB 4OGYH 5EBGA 5FV2A 1HYSC 1MHCA 2X4TB 2V5TA 2GTZB 3LN5B 3LH2L 5JW5A 2XA3A 3KPRB 1JN6B 2G5RA 1MHHA 4H0HB 3SQOH 4X6DE 3N1FC 3W82A 4DTGL 4L1HA 1ACZA 4U6VH 3V0WH 4X4YB 3AS3A 4HCRH 4JEGB 4PJ7F 2A2QT 4JAMB 4LSSH 2BVOA 3INUL 3IS0X 4AEIH 2PYFA 1FVDA 3RHWK 5GGQL 1Q72L 2VXSL 2NNAB 3O11B 4HK0B 5EO0A 4YHIB 5I1KL 3F7YA 1V3MA 3MGTB 3VGFA 3VFSA 4OZ4B 1SMAA 1A6WL 1CE6A 1WFUA 3ORJA 4ELMB 2WV3A 4XPTL 2X89D 2UZIH 3VRIA 1I3RA 4OTXH 1CLOH 4YDVB 3WEXB 3LKPA 4LCUB 4LVOC 3BN9D 2BY2A 5AYUH 3EJYC 4H26A 1KJ3L 1OP9A 3KPLA 4CNIB 3IAGC 2PYEE 3BD4A 1X5LA 3MFFA 3EYSL 3OKMA 2Q3ZA 3GM8A 1G6RA 1H8NA 2JJTC 2PW1A 1A7NH 2VDMH 1MREL 2AJ3A 1VSCA 5IB4A 1NGQL 1JHTB 4GW1B 5HGHA 1MIML 3BAEH 1JF6A 3HFML 3KPNA 4LGRB 2X4UA 2HLAB 5GS0H 4NWUH 4R4FH 2BK8A 2NY2D 2OMNA 5IVNA 4BQ9A 4F37K 4OF7A 2XZCH 1J5OH 1OAYL 3MRGA 4ZXBA 3Q2CA 2ZUSA 5IMKB 2BNQD 2W9EH 1WBXA 4FFWC 4M4RA 5DR5H 3ARFA 1CXHA 3DBXA 4G42B 2O5YH 3WE6A 3KJ4C 1JPFA 3QUYA 1GOGA 2YK1L 4D0DA 1FQ9C 3TO2B 5FOJA 5DMKB 4P57B 3C08L 5JW4R 4WNQB 1T20B 3LN4B 4L5FH 4KDTA 4F9PA 3LQAL 2D03H 4HZLA 1XGQB 4O51B 5C0JB 5GS3A 1KCSL 5CBAA 4OT1H 1A9BA 4DQOL 1P7KA 1HZHL 1CFTB 2XKNB 3MODH 3AS0A 1TLKA 4KROC 3PABA 5IIEA 2FX8L 4NHCL 4NO5B 1PY4A 5CBEA 4E0RB 2CRZA 3BDBA 5IMMB 3ISWA 4YQXH 1I8KB 5DSCB 3OZ9H 4KC3B 4JHWH 3UTPE 3WS3A 5ICZA 3DX6A 3B5TA 1B9ZA 4GJTB 3LKOA 5CEZH 1UH4A 1TJGH 1NGYA 4MNQD 4OLVH 1QBMH 4YBLB 4OFDA 3CJJA 5GS0D 1RQ5A 3HE6A 4GW5B 1BWMA 4PS4H 1KEGH 1RUKL 1J1PH 1P5UA 4YHNB 3KLAA 3QNYB 3ZMRA 5IQ7L 4K94L 4LVOB 4PJDB 2VWEE 4E5XA 3VXTB 1DE4A 1C5DB 2AJVL 1JRHH 4PB0H 4NOBA 2HRLA 5I19H 4RBPH 4UV4H 4OAWB 3ULVF 2I9LB 4M48L 2YPLD 3S34H 3FQUA 5E6IA 1LEKB 3OTTA 4OFPA 3FTGA 1IL1A 4BFBD 3U82B 1AXSA 4J3UA 4BZ1H 4AEFA 4XMPH 3BZEA 4MSWB 1T1XA 3C60D 4KI5D 5DO2C 1MCPH 4GMTH 2EDRA 4F80A 1H8SA 1OTSC 4Z8FH 5ECJE 1DQDH 1SMOA 4Y2DD 4YO0A 4GRWB 5BXFB 5ETUA 1A6ZA 3CCHA 3V52L 2Y4SA 4GRLB 1MIEH 2WIMA 5CEZD 4M7JL 3KJ4B 3RUGE 4EEEA 1LO0H 1ZTXL 4PJBF 4OKDA 3PDGA 4WEUD 3UC0H 3ZE1E 1DQJA 2YA1A 4KUCD 3RX7A 5ITBH 3FT3B 4M1DL 3VXSA 4M6MH 5I1IL 3AS1A 3HNTL 4NNXA 2NY0B 2VDQL 1J9CT 3EYVA 2DWEB 5TDOA 3JWDH 2PF6A 3QNXA 3L3GA 3VD3A 4Z7UE 2BNRE 5DC9B 1ONQB 3QFJD 15C8H 3QIWA 2PO6B 1G84A 2BNQE 1BVLB 3UTSA 5CZXD 2VDLH 5C0DB 1CFQB 3VMOA 2WINB 4EDWL 3QG6B 3TT1L 3SY0A 3TBVA 1ZLWH 3VWJA 2WAHA 1X5YA 1VESA 1AD9A 2OTWB 1Z0MA 3RIFK 3VFRB 3E2HC 3VG0L 4F8TA 2MFNA 5C0CB 1IGTA 5E94B 1MFEL 3DYPA 1NBYB 1W72A 2FB4H 2ZNWA 1A7QH 3QB7C 4I5BB 2GIYA 4O9HH 2ICES 4RCAA 3QI9A 2C4FU 1CLCA 1WT5C 3RTQD 2DQCH 2JJUA 5SWSB 1NDGB 1Z3GL 1R0AH 1MWAH 5IW1A 1CL7H 3MCG1 1I4FA 2ZKHH 4O2CA 1FAIL 4EI5A 4HGWB 5BO1L 2DB8A 4XI5D 2XWBA 2XN9B 4YDIH 4Y89A 1DEEA 1S9VB 4PRHE 4X99A 4M6AA 3QWQB 3MRIA 3BUYA 3QR2A 4JB9L 4NQDB 3D0VA 4X7SH 3HRZA 4IHOA 5E5RB 5TDPA 3SCMC 4F7PB 1BEYH 1D5ZA 2IPKB 3I6LD 1DLHB 5DJ2A 5F7DA 2R1XA 1U6AL 3P73A 3SGKC 4WHTB 5HYIA 1GYAA 1GHFL 1I1FA 1P4IL 2B5IC 4P3DB 2O5XH 2FHFA 1KB5H 1LO4L 5C8JA 4OI9A 2XRAL 5JOPD 2YD9A 1CE1H 1FFNB 5GGVL 2IAND 4ALAH 3MV7E 2CJUH 2HH0L 1ZLUH 4Y19E 1QSED 4ONFH 4M8VA 1FBIL 3WLBB 5DD1L 4KRPD 4LEOA 2BMKA 4E9LA 5AZ2H 4OV5B 3RVXC 3ARRA 1ZLVH 4RGNE 2Y06H 4G8IB 3CH1B 3FFCA 2IC2A 3TCLA 4HUUA 3E1F1 2A0LD 3IU4L 2JF1A 3DV6B 1KCLA 4R2GC 5HVFB 2NCMA 4P5TD 3FQNB 3JV6B 1GZQA 3HMXL 4K7PY 4NRYA 4TSBL 4JFQB 3E2HB 2NY6D 3GJFK 4KUZL 2I9TA 2UYLA 1JZ3A 1HSBB 1BJ1H 3T1FB 1XCQA 3ELAT 1T7XA 3L9RA 2HFEA 1D3CA 4L8DB 3WUWG 4PG9A 2XWJB 3V9FA 4NO2A 3D3VE 3DYMA 1S7VA 1NCCL 2I27N 3QIBB 3RA7H 1KEML 5EIVA 5LGKA 4X0KB 4MNGE 3TBWB 3DXAA 3RX5A 3O9WD 5GRVL 3WKMH 3GEWB 4LSQH 4YFEA 5DXWA 4TNVF 5T5FL 3V6OC 4F3FB 1NSNL 4E42A 3MUHL 2HKHH 3C2AL 3U4AA 4XNQB 5BS0B 4O2FA 1XF1A 2EXYD 1QLRA 1HQRB 3O41A 1IC4L 4KKAC 1I8IB 2XT1B 3R1GL 1BGXL 4LK4A 5J1TC 2ENYA 1M71A 3GMRA 1BZ7B 1FSKB 3FO2A 4H20H 4Z95L 4OSUL 4PJEA 3EYFA 5DFTA 4U1LB 1VGEH 3X17A 5I0DA 1J0HA 3SDXB 3BH9A 2BSTB 3RBGA 2DQTL 2YMXL 4HKBA 5CP7A 4JN2B 3UYPA 1U8NB 4BFIB 4HV8A 3MUZ1 4N1CA 2B5IB 5ANMB 3LB6D 1J88A 2VE6A 2MMXA 1W8OA 1XT5A 3KYAA 3LKRB 3C5JB 3F58L 1DR9A 1RZJH 1T21A 5CGTA 4G6FD 4WI2A 5I1AB 2EECA 3OG4B 3I9GH 5E5MB 2W1NA 2Y72A 5E8PA 4U2YA 1CR9L 4MZ3A 1A6AB 5EU3B 3N1GC 4PGDB 4JFYB 2P5EB 3TPKA 4KHTH 3E3QE 1TZHB 3GSNB 2VYRE 2BRQA 2PW2B 4AT6B 5HGAB 4I0PC 3TV3H 6CGTA 4MXQC 1JFQL 3O81A 3K8KA 1PX3A 5CSBA 4G5ZH 5GGRY 3O4LD 3B6SA 5C08E 4L8BB 4MVBD 3SBWC 3UZEA 1JGUL 5J1AB 1IC5L 3LHPH 2JIXD 3QUXC 3B4NA 4ZFGH 3QDGB 1NEZB 3RVVC 4Y4FC 5IVOA 1SEBB 3D18B 1CDGA 3TVMD 2PXYA 1UJ3A 3HPLB 4R97B 4QOKA 3UDWC 1BIIB 1REIA 1SVZA 5GRVK 2XXCB 1QSEE 3AAZA 4JG1L 4NT6A 5AUMA 4ENEC 3PWPE 1TJHH 2XZQL 4YHKL 3RIAK 4XMKH 4OGAD 1QYGH 3BIAX 1U92A 1E4WH 2YD6A 3JTTA 2D3VA 1A1NB 3GRWH 3MREB 5CILL 4XPFH 1MHPH 5KOVC 4X9FA 2L7UA 4FOMA 5IVZB 1S7SB 3B2VL 1BM3H 2V2XA 2VUOA 3AB0C 3EYOB 5DJ8B 5AG8A 2AKRA 1G7LA 5HYQB 2J8UB 1MSPA 1R3LB 1YEDB 5CJBA 1KPRA 3CVHA 2C7UB 4XHQA 3OXSA 4HEME 5FGCE 1VPOL 1IGCH 2GT9A 3TIEB 2KKQA 5HGDB 2XFXB 2Q8BH 1QKZL 2V2WA 4XCFL 2AJUL 1L9MA 1FYTA 4KV5F 1ZHLB 2YPKB 5ISZA 2HJKA 1Q0XL 5F7EH 3PWNA 5D7LD 4HS8H 4XPAL 4NQCE 4YAQB 4MA1B 2APBA 1Z5LA 4FZEL 1DBKH 3KPRD 3VI3F 1LO2L 4CW1A 2EDXA 1XCTA 3UPCA 5FYLH 1YQVL 4N1HB 1I7UA 4NRXB 2VXTL 2DMCA 3B9AA 3X11B 5F9OL 1LDPL 2HVJA 4EQ2A 3EDFA 3QWRD 3RWDB 5C9JB 4X6FA 5DMGD 5GS1B 5J1SC 4PGZA 4K3GA 5MEPB 1OLZA 1UB5B 3QUXB 3IJSA 5L2KE 1K5NA 4WFEE 2F5AL 4PJHB 2EH8L 3DGGA 3KPSA 4XP4L 4Y4FB 3H9YA 1W0WB 4ODSL 5H2BA 4KVCL 3T0AA 3OWEA 3REVA 2ZCLH 4EXKA 4EUPB 3JWNC 5LVEA 4F15C 5EUOF 4L1DA 4Y4HA 1S9KC 4M5YL 4RQQA 4U1GC 5FA3A 4O58H 4JRYA 4DKAA 1MCJA 1KENL 4Z7VE 1CYGA 5HD8D 1K8IA 3QDJB 2BNUA 4X7EC 4PYHA 1GAFH 3OKKB 3U46A 5F6IB 4ERSL 2WBWB 4R26H 4ZMAT 5FM8A 4Y5XA 3O4LE 5F9WC 5F71A 1OGTA 2NTFA 1E6OL 2A9MH 3DGCR 4X4ZA 3MV8E 5TFSL 3IRZA 5F7YC 4JQXA 4PJXA 3DSFH 5FYLD 5JIHA 5IVXA 1UG9A 5BZDA 5IWLA 1A3LH 2ATKB 5EORH 4HUWB 3WO3B 5ESVA 1EGJL 4YK4B 2YRLA 4HFUL 2C1PA 4PLJC 1A5FH 3LVEA 3GM0A 5D1ZA 4N9GB 1K4CA 1IKNA 4PREA 3UXFA 3IGAB 1UQSA 5I1JH 1B2WH 1GCFA 5MENA 1VFBB 4MDIB 1K2DA 4CVZA 1CIDA 2LVCA 3ES6B 1WSST 3GMLA 4NNYB 4OQ1A 3W0WE 1UM6L 1DLFH 2I5YH 2Z92B 5GRJL 2AEPL 4ZXBC 4UTBH 3MLWH 4QRUA 1OM3L 3WIHH 4JFXB 4GRWH 3MLTB 4XWGH 4KJWD 4U6YA 2R56L 1MHCB 3PV7A 4PV8A 3QUYC 2J2ZA 4FZ8H 5JW5B 2R4RL 3QUML 4MLIA 2P42B 1AGDA 1MHHB 2IGFL 4S2SA 3ZKXC 4XVSL 4F9PC 2CIKA 4KDTC 1H3WM 5LGHL 4F57H 5ENWA 2Y9RT 4AIZA 3MLYL 3O6KH 2BXYA 3OF6A 5BJTA 2H2SD 2AEQL 1MJ8H 1B3JA 3KPRE 3I6GA 1MQKH 2BVOB 1FG2A 4YUEL 3L3IA 3NN8A 3WDHA 2PYFB 1FVDB 1H3TA 5M7QA 4KJQC 4U2ZA 1FZOA 3O6MH 4N8VB 1I85A 1LGVA 4M1CD 4JZOA 5EO0B 4QLRA 3F7YB 4U3HA 2EDYA 5F9WB 3VFSB 5ADPH 4HUVA 2YPVH 3CLEL 3HE6C 5DHYA 1CE6B 5E24E 3VRIB 4H25A 1I3RB 4NHUA 5LJYH 3LKPB 2C1OA 4MA8H 5K9OA 1ZANH 2VXUH 4YXKL 5CEXA 1EHNA 4H26B 5JNYA 3KPLB 1CG9A 1I3GH 3MFFB 2QLVB 5B4MD 4FFWD 1GGYA 3OKMB 4MZ2A 1G6RB 2PW1B 2VERN 4QRSA 4ELME 2AJ3B 3BPNC 1EEUA 5IB4B 3I6KA 4GRLD 4UNTA 5F1SA 5HGHB 1QBBA 3HI1A 3I3BA 5C0AA 3KPNB 5FHBL 3RL1A 2X4UB 3U1SL 4K3EL 1R3IH 3D39A 4Q7DA 4S11A 6FABH 3JWOC 3BDXA 3MRGB 4ZXBB 1EXUA 4UT6L 5I75B 1WBXB 4AEHH 4DGYH 4LP5A 3ARFB 3DBXB 3OAUL 2NY0D 4TVPL 3WE6B 1JPFB 2CUHA 3TJEH 4D0DB 3RVWD 5KVGH 4P5MA 1DANT 3HI6L 2PO6D 4QRRD 3CX5K 4HZLB 4KKBC 4HIXL 1FNLA 1YN7A 5CBAB 1A9BB 5EBMA 1OGAE 1P7KB 1DBMH 3ET9F 4HJJH 3PABB 4PJ8C 4XBGA 3PWUA 5IIEB 5CBEB 4FQLH 5I1CL 4NJ9L 5HI4C 4NGHL 3WS3B 1M6OA 5ICZB 4NQEE 3DX6B 5DJ6A 1N5YL 3LKOB 5D7IA 1N4XL 2EDDA 5FKAA 4UQ3A 2DQJH 1NGYB 5FYJL 3BRGC 1MNUH 3ULVC 3MRMA 4FQ2H 4OLYH 3O3BA 5DD3L 2Z31C 1KJ2L 5LXGH 3HE6B 1X5ZA 3EYUL 1Q9KA 3VGHA 4RMWA 1LMKA 4JY5L 2FATL 3KLAB 4JDVA 4J3TA 3W9EA 5SWSD 3VWJC 2EC9U 3FMGL 4E5XB 3VXOA 1DE4B 2JELL 1QFWM 4RSVA 1BP3B 2BY3A 1KLFA 1YEEL 3AY4A 3FQRA 4LEXL 4JHZA 2XN9D 4YXLL 4HQQL 4JFZH 1A0QL 3FQUB 5E6IB 3FTGB 1IL1B 4LQFL 3QI9C 1G7JA 4NQDD 3UTTA 1AXSB 4R4BA 5HGGS 4XRCA 3BZEB 2J5LB 1T1XB 4YHOH 1Y18A 4ZDHA 1DVFA 1E4XI 3A0OA 4L3CA 1B0WA 3T09A 5HHXH 1W0VB 2BHUA 4AH2A 3IFNH 4YO0B 4RISH 5ETUB 1A6ZB 2OJZL 3R0NA 5J12B 1ZMYA 4NDMA 3CCHB 2BJMH 2X10A 5C0BE 4TTGA 3NBNA 4YBHA 3BIKA 4XT1C 4CBPA 2GCYA 1F3JA 1E4JA 4PGJA 2XY2A 1OAUH 5I30L 5GJTL 3MLVH 1DQJB 5IJVA 4R96B 4TUOA 2WP3O 1ROWA 4LHJB 1VHPA 3VXSB 1NC2A 2EH7L 2B20A 4HWNA 4NNXB 3B9KA 3EYVB 3MV9A 4PG2A 4IDJL 3O2DH 3QNXB 3L3GB 1RUQH 4Z77A 3N1QC 1SBBA 3QIWB 2W0KA 2NY4C 3GMNA 3UTSB 1U41A 5EA0H 3I75A 3CXDH 4ZOAA 3QIBD 1U3JA 4YDKH 2N4IA 4GAFB 3SY0B 4TSAH 3TBVB 3VWJB 3GSNH 1WGOA 1AD9B 4PB9H 4UBDC 2VQUA 5BS0D 5FHAL 1JYNA 2B0SL 3KPOA 2HP4A 4N0YH 1IGTB 1IGIL 4P9HL 1W72B 1FE8H 3CSGA 4OZHA 4WEBH 4BSWA 1CLZL 2OTPA 3QI9B 4FXLA 2P5WE 4MNHA 3BDYL 4JR9L 3BISA 5C0CE 2NY5L 4Q9CA 4XNUL 3MJ9H 1KJ2A 1NUNB 5DEFA 3CXHJ 5CSZA 5IW1B 3V7AE 3NVQA 3QEQA 1I4FB 1MCKA 3ALXA 3QQNA 4O2CB 3BH8A 4G7YH 4WI7A 1P69B 3RKDD 4EI5B 4WO4A 3WFCL 3MNWA 2XWBB 4EDXA 1DEEB 1LP9A 3D9AH 4X99B 5FGRA 4H88L 4N68A 4Y1AB 3MRIB 3BUYB 4X98A 5I1EL 3MJ6A 2VDNL 3D0VB 3O8XA 1A14H 3HRZB 5JXEA 1EHLH 4IHOB 5TDPB 2WBJA 2A83A 1D5ZB 3DUSA 1KUMA 2X05A 2H1PH 3F12A 2P5ED 5DJ2B 2R1XB 3G6JF 5F7DB 3P73B 2XN9E 3FRUA 5F70A 4ETQA 1I1FB 4KMLB 3TNNA 3NABH 1K9TA 4JQIL 4NQDE 5C8JB 5HHMB 3TO4C 3PL6C 1DQMH 3MRJA 5DS8A 5I71C 1BZ9A 2NY7L 4LEOB 2BMKB 1YEJH 2BVPA 1PLGH 2DRUA 4LRIA 2ADFH 3FFCB 5EZJA 3TCLB 4HUUB 1J1OH 1DQQA 4L3EA 3RVTD 3WN5C 4GBXB 5EO1A 5KZCB 1GZQB 2I07A 4NRYB 1ODAA 2CO6B 1TZGL 3LZFL 2I9TB 2UYLB 1RIVH 2EDBA 1XCQB 3L9RB 2HFEB 3RI5K 1VGKA 4NO2B 3U0WH 4S1SL 1DTUA 1IILE 1MEXL 1S7VB 4U7MA 3BEWA 4JPWL 1UJ3C 4ONGH 3LKSA 5F9JA 4GG6F 3DXAB 1ERNA 3E8UL 4G7VH 3WYRA 3AC0A 4Q6IC 4E42B 2UZYB 2HRPL 3KXFA 4O2FB 3H3KA 1U8JA 1QLRB 3O41B 1F8TH 2OK0H 3M07A 1M71B 2BERA 3GMRB 3SDAC 3FO2B 1IC1A 1OCWL 3VI4E 4QNPF 2PR4L 2NXYD 4PJEB 3EYFB 2FIKB 4HGKC 4I77H 2XV6B 2CLVA 3KR3L 3VXMA 5KSUA 3VDCA 4O2EA 5BS0E 1MFAL 3BH9B 3IDMA 1IARB 3GSXA 1C16A 4HKBB 4FQXA 4PV9A 5C0RL 5CP7B 1MH5A 5IFJA 2B4CH 4HV8B 5IHUL 3RAJL 5JW4Q 2VE6B 1TPXC 4OB5H 4OI8A 4QHUA 2XWTA 1T21B 3GO1H 3LY6A 4KK9C 3SDXE 1AIFA 2OYPA 1QNZL 1F3RB 3BE1H 3KDMA 3GHBL 1N3NA 4YBQC 5TF0A 3DMMA 5H35A 4QF1A 5E8PB 3QUXD 4UIKH 1MPAL 4YWGH 3RVVD 4Y4FD 5ANME 1UWXK 2X4PA 4D9RD 2PN5A 1PKQA 3TA3A 5FK9A 1F13A 4NBYB 3OSKA 1MFBH 4OCNC 3NIGF 1X5AA 1I7RA 4ZO7A 3RY6C 4CVXA 4HPYL 4FTVA 3B6SB 5ALBH 1DSFH 3W39A 2P5EE 3N50A 5C0ND 2RFXB 1W2KT 1MRDH 4I9WD 1JZ6A 3MRKA 3RHWF 5DRZA 4QO1A 3QDJD 2PXYB 1UJ3B 4EKXA 1KNOA 4QOKB 2EE6A 5KSVA 4Q97A 5ACLA 1NLDL 2E27L 3AAZB 4NT6B 5AUMB 3QRGL 5ITFA 5D1XA 4Y4HC 1U92B 1B88A 3G5XA 3JTTB 3QDGE 4GO6B 5EOCJ 4CN6A 1UACL 1YPZA 1NEZG 4U6HA 2F58H 3T3PE 3I3EA 3QA3A 5E2UL 5DUMH 1AE6L 5B3JE 3MYJA 3QG7L 3EOTH 4KRNA 1E4XL 3BT2L 1K4DA 1ZA6B 2V2XB 3H9ZA 3V6OE 2AKRB 2E7MA 1QLFA 4NYLA 1G7LB 2KDGA 2ZNXA 3G6DL 2H2PC 1KPRB 3CVHB 4X9IA 3OXSB 2HLFD 3R06A 3CMOH 2O26U 3CFEA 4GKSA 2GT9B 5KVDL 4LPVA 5IKCA 4JQXC 5TE7H 5M95B 4F37F 2V2WB 4MJ5A 5D93C 1FYTB 2ILLA 3HHRB 5ALCL 5ISZB 4LPWA 2HJKB 1RVFH 2CXKA 3PWNB 1KTDA 1AI1H 5GZNC 2BCKA 5D1ZC 5I9QC 3AFLA 4FABH 2A6JA 1IKNC 3NCFB 1ZGLB 1G6RH 5L7XH 4X80H 4CMHC 1Z5LB 4CW1B 3H42H 5TPWL 1XCTB 3RY4A 1LQSR 2E9IA 4JLRA 2F19L 1I7UB 3K2MC 3KJ6H 5EOCH 3EO9H 1RUAL 5JHDE 2HVJB 3NGBC 4HJ0D 3MBXL 4X6FB 3V4VH 1BJMA 3WSQL 3RGVA 4GH7B 5CZVL 5HYSA 3IJSB 1K5NB 3PP4H 3DGGB 3KPSB 5D1QC 4JPVL 4NWTL 4OZIF 4WW2A 5H2BB 1UXSA 2NX5D 1WWWX 3REVB 4O4YH 5F8QC 3PHOA 4NUGL 3DRTA 5A2FA 2R15A 5JLZA 4Y4HB 4D0BA 4KPHH 4EOWL 2X9WA 4RQQB 2Y6SC 1G0XA 1S7WA 5FA3B 3GMMA 3MNZA 4JRYB 3EGSA 4MD4A 1GGUA 4P48A 5I8KH 1N59A 5CIPA 3GSRA 1K8IB 1MCNA 2BNUB 3JBG7 1T0MA 1KACB 3U46B 1ZT1A 5JUEL 1I85C 4Z7WF 5KAQG 4WEMB 4Y5XB 5HDBE 1OGTB 2NTFB 3O6LH 4PJXB 2R0WL 4KKLD 2R23A 3LH2H 5IVXB 1JWSA 2A74A 5BZDB 1QACA 1FNEA 4WJ5A 1WC7A 1HIML 5ESVB 4DTGH 1X5FA 4TQEL 5I9QB 5MEOA 1K4CB 4PREB 3ARFD 4PLOB 5I73C 1M7XA 4B53A 1UQSB 1RZ7L 4G6MH 3H3BC 1G9NL 4CMHB 3QUKA 5MENB 1K2DB 2VXSH 4CVZB 4X7TA 1HKFA 5F1NA 4EQ3A 4D2NA 2VRAA 1I1AA 3GMLB 4KRLB 4Q9QH 4OIIL 1L7TL 2V9RA 3BD5A 5I1KH 3NGBB 4QRUB 3H7LA 3RZWA 4EI6A 1A6WH 2V9TA 2M8XA 5I74C 3MO1A 4U6YB 4PV8B 5E2TL 4PJAF 1BVZA 3L1OH 3L5HA 5DF0A 1AGDB 2KQMA 1A22B 4Z7WA 3NTCL 1R5IB 4S2SB 4OLZL 3EOYG 1WLHA 2CIKB 4XTRC 5ENWB 3WL9A 4RAVA 4WTXA 4AIZB 3VXPA 2HYMA 4UUJA 1VB9A 1MIMH 3HFMH 5BJTB 1X5KA 4S1RL 1OQOA 1TDQA 3I6GB 5HYEA 1FG2B 1NJ9A 3L3IB 3NN8B 3RIFF 4KAQL 1J1XL 1EMTL 2J12B 1FZOB 4OD3H 4OQTL 1OAYH 5GGTL 3QQ4A 4BQCA 3ETBF 4Y5VC 4HUVB 4KY1H 1XR8A 5E6ID 4N5EC 5D9SA 4FNLL 5DHYB 1I1CA 4LVHC 4K3JH 4H25B 4NHUB 4MJ2A 2OXHA 1ACYL 4UAOC 2C1OB 1ADQL 4FA8A 5K9OB 4N8VG 5CEXB 2J4WH 1AXTL 1ZE3C 1HHIA 5JNYB 1ZOXA 1CG9B 1VADB 2DTSA 1HZHH 1CICA 3AY4C 1RJYA 1NMAH 4QRSB 4GFTB 1IAII 3I6KB 1L6ZA 2FX8H 4AENA 8CGTA 3HI1B 1W72H 5C0AB 3RL1B 3D1MC 3VRLF 5CS7A 3GNMH 2KH2B 3PV6A 3D39B 1X5HA 1DVFC 3S3SA 3ARQA 4KKBD 2OS7A 1EXUB 4CN4A 4KZDL 1WAAA 2G9HA 3VXSD 1X5IA 1CD8A 5EZOH 1RUKH 3MUJA 3P3YA 3QXDA 5I74B 1U8KA 1FL3A 4UV7H 5FUZH 1XGRA 4NC2B 5HI4D 1D5IL 5JOFB 1W0YT 3QEGL 7CGTA 4G3YH 3MJ8A 3IB4A 1I7ZB 4KGLA 3QIWD 4PJ7E 1DUZA 5GSVA 1T66D 2MCG1 3UTSD 1YN7B 2VLRE 5EBMB 2AXHA 4LSUL 4M48H 2XICA 1MI5A 3VJ6B 4XBGB 3PWUB 3D2UA 3C2SA 5F7FA 3V79C 5EWIL 4W4OA 3CVIL 5HHOA 4O02L 1M6OB 4PG2C 2DIJA 5DJ6B 5D7IB 5FKAB 4UQ3B 3QCTL 2YSSA 4P23C 1O7SA 3MRMB 4HXBL 4W6YB 3C5SA 3O3BB 4NFDA 4AIXA 3V52H 4AQOA 3GI9H 5JQ6H 4HXAL 1Q9KB 3GMQA 4WUUE 4LVHB 4JDVB 1ORQA 1QFWH 3W9EB 1ZTXH 2OCFD 1L0YA 3VXOB 2YXMA 4HH9A 5LBSL 5IV2A 2DBJA 4OI7A 3B2UD 1TNNA 4IOFD 4RX4A 3FQRB 4EI5D 4XCYA 4JN1L 2RJMA 5I15L 1LK3L 1A6UH 3N85L 1ZHNA 5FGBA 1NAKH 4Y1AD 2VDQH 4OQTA 4JANA 5C07E 1G7JB 5GGTA 5ICYA 4R4BB 2A1WL 1AHWA 4XRCB 1YEKL 2HMID 5K9JH 5DHVA 5CD3A 4PRIA 1Y18B 2ADGA 4ZDHB 3ZT7A 1DVFB 1T83A 2IWGA 4L3CB 3DECA 4AH2B 1I1RA 4WHYH 3BP5A 4MXWL 2FH6A 1I9IL 4HH8A 3GDBA 4GUPA 4FFYL 4NDMB 3GUTA 3MRLA 3TT1H 5CEYA 3HA0A 3GJFA 4M7LH 5HHMD 3KLDA 5JR1L 5I1HL 3BIKB 4D9LL 3X3FL 2GCYB 1F3JB 4FQIL 3O8XC 3THML 3S35X 2QADC 4ZS7H 1MFEH 4CN1A 1NKRA 3FFCD 5IJVB 4HUMB 4A2MA 2X4SA 1FFOA 4TUOB 1C5CH 4GBXD 1NC2B 3EDEA 2CGRL 1KN4H 4OD1L 4IIQA 3B9KB 2ESVA 5C0EB 3PQYD 1Z3GH 1MAML 3U0TA 4NNPL 4PRPA 4JO4H 5FV1L 1YNLL 4CADA 4K9EC 3ILPA 4PJCA 1KCRL 4Z77B 2VL4A 3V8OA 2X4OA 4LRIC 1IGML 3GMNB 1W8NA 4I18A 2FHCA 2A73A 3I75B 1ITCA 3HCVA 3ZYJA 4MA7L 1DN2A 3DXAD 5FIEA 3SEPA 1OP5H 5T5NG 2E6QA 2CRMA 3FO0L 3RIAF 5MEQA 1N6QH 3ULVE 1YJDC 4JM2F 3V0AC 3SKUD 3KPOB 2ITDA 1U6AH 2V17L 5L8JB 5EBWA 2F5BH 4DVRH 4PJFF 4ZAKC 4OZHB 3NPSB 3FQTA 5CLWA 1SQ2N 1LO4H 3BP4A 3SQOL 5CP3A 2XRAH 4MNHB 5GGVH 5JIKA 4I1NB 1F2XK 3OR6B 2Y7QA 4U6VL 3MLUH 3T2PA 1J8HD 2LU4A 1KJ2B 1MJJA 5DEFB 3DO3A 5CSZB 3QEQB 2FX9L 2DM4A 2FZ3A 4JFHD 4EJ1C 3BH8B 4PRBA 3IU4H 1KXVC 3DVGA 4WO4B 3UBXI 4AEIL 3MNWB 4OZGA 3HNVH 3MV01 4EDXB 1LP9B 1MVFA 1DANU 4U3CA 5TDNA 3LEYL 4X98B 5DQDH 3TNMB 3WNOA 5FYKU 4KUZH 2BY1A 4X6EB 3O8XB 3SE9H 5EU5A 2WBJB 4RFEA 4NCC2 2A83B 3DUSB 5C09E 5JORA 1QBAA 4FQXC 3BGFB 4F58L 2DJSA 1BAFH 3FRUB 1TVHA 3RDTC 3CVHH 2OP4H 4ETQB 4U1MA 4V1DE 5EIQA 3I84A 1HXMA 3TNNB 2HTLC 4N1EA 5AAMA 3ARPA 5T5FH 3UO1H 4FQ1H 2NY1B 3C2AH 3JVGA 2VR4A 5DS8B 3MRJB 1BZ9B 4WTZA 3DMMC 3R1GH 3BAEL 2BVPB 5GS0L 5EZJB 2DIBA 3NIFF 1DQQB 2PXYD 4Z95H 4QOKD 1NC4A 4L3EB 3V6FA 3V0VA 3TA3C 5EO1B 1J5OL 3WJJA 2I07B 2CMRH 3P0YH 2OX5A 1HH6A 3U48A 1T7VA 2W9EL 2DQTH 2DKMA 2YMXH 5JQHC 3G6AA 4O00A 3FFCE 4TULH 3PIQA 1VGKB 2X2YA 3VFTA 4KRMB 2XTJC 3K7UA 4N8PA 3OBAA 3BEWB 1S7QA 3TH2T 4P2QD 3LKSB 5F9JB 2HVKA 4L5FL 2D03L 4DCQA 4OT1L 4PRAA 5ADOH 3C09B 2EZ0C 4OUUA 3KXFB 5JDJA 1CR9H 5D1XC 1U8JB 1CFNA 3UJTH 4YQXL 4AZ8A 1LE9A 3RUGA 4JHWL 4M5ZL 1P2CA 1FYTD 5HHNA 1TJGL 5ISZD 1CGSL 2VSDA 4WHYG 3MRBA 4OLVL 1QBML 5CLTA 2CLVB 2WNGA 4P4RA 4YBQD 4O2EB 3VXMB 5KSUB 3IDMB 4LSPL 3GSXB 5BVJA 1C16B 4PS4L 3TC9A 1KEGL 4J12A 2EDLA 5DURB 4F8QA 4FQXB 4PV9B 5IT2H 5IFJB 1MH5B 1DP0A 2B1AL 3DHJA 4HD9A 4M1GL 3HN3A 4PJEE 4QHUB 1WZLA 2E9BA 1BIHA 3IF1A 4ZG1A 3G9VA 1JRHL 2BNRA 2B1HL 5HTSA 5I19L 3VGGA 4LP4A 5IBLD 1AIFB 2XZQH 3CFCH 3KDMB 1N3NB 1VFMA 5CGYC 3DMMB 5H35B 3CLFH 4QF1B 5C0IA 4PTUA 4RWYH 4XNXH 3E0GA 2HJFA 5DVKA 1UCTA 2X4PB 4XMPL 1MCPL 1PKQB 4GMTL 5FK9B 3BPOB 5D7JC 3SKJL 3TA3B 2ARJA 3AS2A 4OCWH 5D7KD 1I7RB 4Y4HD 1INDL 4CVXB 4FTVB 2WMPA 2F8VA 2E3VA 1KIRA 5KG9A 3W39B 1DCLA 2IAMA 2FX7H 4X5LA 4JRYD 1MOEA 3MRKB 2XTJB 1QKZH 2DLEA 1OP3H 4EIZC 5GSRA 5DRZB 3U7AA 4WW2C 2AJUH 1KNOB 5KSVB 3FB7A 3UC0L 3MR9A 2H2PD 5IJKA 5ITFB 4LSTH 2DJ4A 5D1XB 5H94A 3G5XB 1YDPA 1YPZB 4U6HB 5FEBA 3QA3B 3MYJB 3JWDL 3KPQA 1K4DB 1YQVH 2WQRA 1EAPA 1PSKL 2VXTH 15C8L 1QLFB 4NYLB 1EO8H 5F9OH 5GZND 1LDPH 1ND0A 3CFBA 2Q76A 1HWHB 3R06B 3CFEB 3CU1A 4GKSB 5SWZA 2F5AH 4XP4H 3PE9A 1T6WA 5A3ID 1NCNA 5MEND 2DM2A 3K80A 2BZDA 4ODSH 3O45A 4HC1A 3MV7A 4Y19A 4MJ5B 5H37H 4LRNH 1XMWA 4RBPK 4DZBA 2NR6C 1KTDB 3V4UH 2BCKB 4AMKL 4DEPC 1OWRM 5CINL 2A6JB 4R0LC 4LAQH 4O9HL 2OM5A 1CF8L 3J8F7 1ZLSH 4P3CL 1AXIB 5DI8A 1E27A 2DQCL 2A9NH 4MHHI 4XP6H 2P43B 3QCUL 1FYTE 5ISZE 4ERSH 1I1AC 1ZHBA 4JLRB 1S78D 1OY3B 1ZSDA 1QHPA 1ZT7A 3JUYA 2LAAA 5HPMA 3OF6D 2Y6SD 1IQDA 4JO1H 1P53A 3RGVB 5F93C 5HYSB 5EZIH 5GS2H 4MNGA 1Q94A 4X9BA 4X7SL 1NCBH 4WW2B 1UXSB 5EULV 1EGJH 1BEYL 1H8OA 4HFUH 3PHOB 3DRTB 3CGTA 5JLZB 4D0BB 1LVEA 1Y6NR 2O5XL 2D4DA 4S0TD 2M2DA 1LEIA 1KB5L 3KPSE 1OVZA 1S7WB 3GMMB 3MNZB 1CE1L 3EGSB 4MD4B 2CJUL 4KK5C 4NO3A 4ONFL 1N59B 5CIPB 5DD5H 3GSRB 3U30B 3C5ZA 1T0MB 1UM6H 4EXPX 3RJQB 1ZT1B 5GRJH 5DK0A 3D48R 2Y06L 1GH7A 5D72L 2QQQA 2DQIL 3EJZC 3S3JA 4MXVF 4N5UA 4JRYE 5C0AD 1GGBH 1ZLWK 4KV5E 2R23B 5J6GA 2R4RH 1JWSB 3D39D 4UZGA 3LQAC 2A74B 2IGFH 1FNEB 1UFUA 4WJ5B 1WC7B 1F4HA 3U7WL 4GW4A 4XVSH 1JZ4A 3U9PH 1FIEA 5KS9F 5E8DL 4DEPB 5MEOB 3L5IA 5D8JL 3VI3E 4PJXE 5GGRA 3RA7L 5IVXE 3UJJH 3WKML 4LSQL 4CJ1A 3QUKB 4NPYA 2HKHL 2OL3A 3I3DA 2R9HC 1M1SA 1WWBX 4X7TB 5F1NB 1I1AB 2OTUA 4IRSA 5C08A 1UEMA 4M93B 3H9SA 2Z91A 3LD8C 4EIGB 1YC7A 2N7AA 1AQDA 3KLHD 3DVIA 1OW0C 2XPGA 1MRFH 4EI6B 3ARVA 4K94C 3FONA 3ZT6A 1P1ZA 2R1WA 2D2OA 3MO1B 3QIUD 4JKKA 2NXZB 4PJ9A 5IMOA 4YXKH 1WFOA 3BI9X 1EVTC 5EUOE 4HMDA 4Z7WB 2HT2C 4FXGB 2QHRL 3W11C 3FKUS 1P7HL 4NN5C 3TZVC 4N5ED 3WL9B 4A6YA 4RAVB 3VXPB 4UUJB 3VFMA 4POZC 5FHBH 3BQUA 1RZJL 1H9VA 2HN7A 3IVKB 1WBZA 4K3EH 1NJ9B 1AD0A 1ZLUK 1C12A 1JVKA 3BMWA 1SJEA 5KS9A 3I9GL 4ZTPH 1ZLVK 4OLXH 2P46B 4UT6H 3HC3H 3T04D 1CDIA 3QQ4B 3V2AR 4WI9A 1JI1A 2LAGB 1XR8B 3VGAB 5D9SB 4BSVA 3OAUH 4EZMA 1TVBA 5DTFA 3ARXA 3TV3L 4HKJA 5B38A 1OTUC 5D6DA 1H3XA 3ZT5A 3GMOA 4J4PC 3J7HA 4G5ZL 2E7CA 3WFHA 1DVFD 2JE8A 3HI6H 1HHIB 3BP6A 3DRQA 3LHPL 4K3HA 4NQCA 4ZFGL 3I2CL 1OQXA 1DQTA 1CICB 4IRJD 1RJYB 3BJLA 4Z5RA 5H37G 5FGBC 3LN9A 1BFVH 1FN4A 1OTTD 1PVHA 1P4BL 4NJ9H 4KJPC 3PV6B 1TJHL 5FYJU 3UBXA 4XMKL 3X3GL 2VDOL 4KDWA 1E4WL 2BOBA 3EHBD 1E4KC 3GRWL 3LD8B 5DWUH 1YEGL 5L2KA 5DD3H 4H8WH 1KJ2H 2G9HB 5BVPH 2APWA 3EYUH 1CT8A 1NC2D 3A6OA 3NCEB 4NQSA 3QXDB 3B9KD 1U8KB 1FL3B 1XGRB 4NQVA 3D39E 3FMGH 3LRHA 3IJHA 5C6WH 4JRWA 3JV0A 4J3XA 3MJ8B 3U6RA 3B9DA 2EXWC 4NN5B 3RWGA 1DUZB 4BK5A 1IKFL 1K3ZA 5GSVB 2D7TH 4BFEA 4OF8A 1SJXA 1R3HA 2R2BA 4HQQH 4NFBA 4YXLH 1A0QH 1KIQA 2H32A 1MI5B 1Y0LA 2Q8AL 3WLWC 4Z7VA 2ZG2A 3D2UB 5IHZA 4FXKA 3KAAA 5HHOB 4K7FA 5F21B 1MLCA 4L4TB 2GY5A 4HS8L 4NM8H 4XH2A 3RI5F 2YSSB 1T6VN 1S7TA 3CZFA 4RIRA 3C5SB 1HOCA 4I18C 5GZOC 4BZ2L 3GMQB 3Q6FA 5FYLL 1ORQB 3MZTA 1VFOA 4X8XA 2FEEI 5D7IE 4HH9B 1CXIA 3O0RH 3B43A 2DS4A 1UA6L 2X4QA 5I30H 2H45A 3QEQD 5GJTH 1YZZA 5DT1H 4WO4D 3UTQA 4XCYB 2EH7H 1ZHNB 3W0WA 4JANB 4U05A 2CKNA 1AHWB 3O8XD 5JXED 4K07A 5DHVB 4N90E 2WBJD 4PRIB 5F1IA 2ADGB 4OLWH 5CD3B 4DFHA 5E95B 3BP5B 4ODUA 4ZUWA 4LVNC 4O58L 4GUPB 5HI5D 4KKCC 3RNQA 3GUTB 5L2JA 2YUXA 3MRLB 5CEYB 3UTTE 1GAFL 3WFBH 4P99A 2QQNH 2NY1D 3K1KC 2ORBH 4I48A 5HY9A 1LE5A 5JA8B 2A9ML 4X5XA 2IALA 1H0DA 4P9HH 1BWWA 3ZKNC 2VJXA 2X4SB 4L3ED 4WV1A 1MJUH 4LARL 3BDYH 4JR9H 5DA4A 4IIQB 2ESVB 1CZ8H 1A5FL 4Y88A 3U0TB 4PRPB 4JM2C 4CADB 1YEFL 3ILPB 1PW3A 4KK6C 4X4XA 4HF5H 2YD2A 4PJCB 5I1JL 2BVTA 1KELH 4JPIA 4P2OA 3B3IA 2X4OB 3WFCH 4HT1H 5GHWH 3LKQA 4XVUD 2DQFA 2R2EA 4I18B 2A73B 5DMJB 5KBNC 1KOAA 4H88H 3HCVB 2F9BT 5I1EH 3WJJC 3MV9E 5AD0A 3MBEA 3CMGA 4UTBL 2YA0A 5MEQB 3KXFD 2MHAA 3GSOA 4UINH 2ITDB 4XWGL 1AGBA 3K4ZA 5EBWB 5L9DL 4V2BA 4POUB 2AABH 5HYJD 3FQTB 4JQIH 4DKDC 3BP4B 1AO7D 5B21A 5DJDA 5CD5C 2ZSVA 3REWA 1UYWH 3VXMD 2Y7QB 4QXGL 3NCJH 4TOYH 2NY7H 4P46A 5DURD 4PJ5E 5DVMA 1MJJB 4FQXD 1YY8A 3QHFL 1MJ8L 4OZHE 5LGJB 1L6XA 2FZ3B 1HH9A 2RHEA 1EUTA 4PRBB 1UWXH 1MQKL 4CJ0A 3DVGB 5L6YL 2HTLD 1S9XB 3DWTA 3FZUD 4OZGB 3EW3B 2OI9C 3GBML 3O6ML 1O5DT 5TDNB 1T80A 1TZGH 3TN0A 3LZFH 5ADPL 1H15B 4HUXA 3DMMD 1Q0YL 5EU5B 1OGAA 2YPVL 4RFEB 5JORB 3EBAA 4Y16A 4S1SH 2GAZA 1XH3A 4GAJH 1TVHB 2FLRT 3PP3H 1MEXH 4MA8L 1TETL 1LP9E 4JPWH 1ZANL 2VXUL 4U1MB 3TA3D 1IGFL 1HXMB 1CS6A 5IB1A 4ZNEE 4ZODA 3FB6A 2QV2A 1N0XL 3MXWL 1NBQA 3B8SA 1BLNB 2HRPH 1I7TA 4JKLA 3JZ7A 4MAYC 1K3IA 2H41A 1IAIM 1RHFA 4YHYB 2O61A 5GRYA 4HIJA 1R3IL 1OCWH 1NC4B 5AEAA 3V6FB 1WTLA 3V0VB 1JJUA 4I0KA 6FABL 5FXCH 3HAEH 5D5MA 2CDGA 3TBYA 1HH6B 3P0GB 1V7NH 3VD7A 3BKCL 1HSAA 4OUOA 2GHWB 3FAWA 5C0RH 5DJCA 3G6AB 5I1DA 1RUMH 2IAMC 2ZG1A 4LCYA 3PIQB 3ARBC 3TJEL 3EO1A 3VFTB 3VFNA 3ALWA 1BJ8A 1S7QB 2HVKB 1WJ3A 4PJIF 3SGEI 3HNSL 4WI8A 3PG2A 3RWJB 4XZUA 4PRAB 3GKWH 3JXAA 5IJKC 4OUUB 4HJJL 5C0BA 3IDXL 1MPAH 1CFNB 5MI0B 4HULB 5D6CA 1MCDA 4FQLL 3PXJA 2DDQH 1LE9B 3RUGB 1P2CB 2F54D 3BX7C 4UT9H 5HHNB 5KVEH 2CO7B 2DQJL 3NZHL 1U8OA 3MRBB 3SO3B 1MNUL 4HS3A 5CIPH 3BW9A 4FQ2L 3S36H 3KXFE 4HPYH 1FNHA 3G6JE 4OLYL 4P4RB 5LXGL 5BVJB 2OQJA 1ORSA 4C59B 1AP2A 3IJYB 4DAGH 4DK3A 3F7VA 4Q6YA 3QUZA 3IF1B 1NLDH 2E27H 4PRDA 5JPNA 4AG4L 2BNRB 3TJHC 3QRGH 1JPTH 2AK4D 1Z2KA 3DOSA 4JFZL 2WWMD 1UEYA 4DUVA 5C0IB 3RGVD 1I9JL 4PTUB 5EH1A 2HJFB 2EDHA 3E6FB 5E2WL 1E4XH 4XCEA 4YHOL 3S3PA 3GBNH 4BELD 3SDCC 5HHXL 3T2OA 2ARJB 4WI6A 3IFNL 3G6DH 4RISL 3I85A 3FL7A 2VLJA 3OQ3B 1KIRB 5DMIL 5KG9B 5C7XL 4XPGL 2IAMB 4ODHL 4KQ4H 2Y23A 2P5WA 4NKOA 2H6PB 1PKQE 1JYWA 4YLQT 2VKXA 5ALCH 1OAUL 4JGJA 2R1YA 4LSVH 3SJVE 3FB7B 1PDKA 1ZKAA 3OKNA 3PGCB 5DZLA 2IQ9H 3MR9B 4FTVE 4MX7A 1KCUL 5H94B 2G60H 1YDPB 4X6CF 1Z9LA 3V6ZB 4D9QE 2XTJE 4QNPE 1MELA 4LNRA 3FT4A 4YZFF 1HHGA