4OHTA

Crystal structure of succinic semialdehyde dehydrogenase from streptococcus pyogenes in complex with nadp+ as the cofactor
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
455
structure length
455
Chain Sequence
AYQTIYPYTNEVLHTFDNMTDQGLADVLERAHLLYKKWRKEDHLEERKAQLHQVANILRRDRDKYAEIMTKDMGKLFTEAQGEVDLCADIADYYADKADEFLMSTPLETDSGQAYYLKQSTGVILAVEPWNFPYYQIMRVFAPNFIVGNPMVLKHASICPRSAQSFEELVLEAGAEAGSITNLFISYDQVSQVIADKRVVGVCLTGSERGGASIAEEAGKNLKKTTLELGGDDAFIILDDADWDQLEKVLYFSRLYNAGQVCTSSKRFIVLDKDYDRFKELLTKVFKTAKWGDPMDPETTLAPLSSAQAKADVLDQIKLALDHGAELVYGGEAIDHPGHFVMPTIIAGLTKDNPIYYQEIFGPVGEIYKVSSEEEAIEVANDSNYGLGGTIFSSNQEHAKAVAAKIETGMSFINSGWTSLPELPFGGIKHSGYGRELSELGFTSFVNEHLIYIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Structural Characterization for Cofactor Preference of Succinic Semialdehyde Dehydrogenase from Streptococcus pyogenes.
pubmed doi rcsb
molecule keywords Succinate-semialdehyde dehydrogenase
molecule tags Oxidoreductase
source organism Streptococcus pyogenes mgas1882
total genus 171
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4ohtA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4ohtA01
3ETFA 4LH0A 4IT9A 1QI1A 1EUHA 5F2CA 5EEBA 3JU8A 3VZ0A 4YWEA 2BHQA 4YWVA 1BPWA 2EJDA 4DALA 4ZZ7A 4NPIA 2EIIA 1O02A 2W8NA 4CAZA 3V4CA 4LEMA 3V9HA 4I3UA 2IY6A 4QTOA 1O9JA 5EK6A 5KLNA 4C3SA 3QANA 5EYUA 4ZUKA 5J78A 4LGZA 2HG2A 4I8PA 4NEAA 4OE4A 5L2OA 4DNGA 3K9DA 5ABMA 4OE5A 2EUHA 1EYYA 1A4ZA 4WJ9A 3RHLA 5L13A 4I9BA 4K57A 5KLLA 5L2NA 5KLOA 4QN2A 4ZVYA 1O04A 2BHPA 4X2QA 2WMEA 4E4GA 4KNAA 2W8RA 3B4WA 3RHMA 5A2DD 3RHQA 1O20A 5EUYA 4PXLB 4H80A 4JDCA 4U3WA 3V9LA 3VZ1A 5L2MA 3V9IA 3RHRA 1NZZA 3EK1A 3ZQAA 3SZBA 4F3XA 2ID2A 4MPYA 5AC1A 4I3TA 4X0TA 3INLA 3N83A 4H7NA 2QE0A 1ZUMA 2EITA 2H5GA 2J6LA 4WB9A 4NMJA 2JG7A 4ITBA 4QGKA 4ZWLA 1O01A 2WMEC 4PXNA 4LIHA 2VLEA 4I2RA 3RHOA 1NZWA 4QF6A 2EHQA 4OGDA 5J7IA 5J6BA 1UXPA 5EXFA 2W8PA 1T90A 4LH2A 1UXTA 3I44A 4I3VA 5DBVA 4NMKA 5AC0A 4QETA 2O2PA 3VZ3A 4PXLA 3N81A 3RH9A 4OU2A 4V37A 4GO3A 5A2DC 4I1WA 2ILUA 1KY8A 2ONMA 1UZBA 4IHIA 3V9JA 4L1OA 3RHPA 3RHDA 2Y53A 3SZAA 3TY7A 3U4JA 3V9GA 1UXRA 1UXQA 4A0MA 4IDMA 1O00A 4X4LA 3V9KA 4OUBA 2WOXA 3IWKA 4O6RA 4QJEB 4IYMA 4V3FC 4FR8A 4GO2A 4I3WA 2Y51A 2D4EA 4L2OA 4WPNA 4FQFA 5A2DA 4E3XA 2Y52A 3PRLA 4WP7A 4NU9A 1WNDA 3R64A 2EJ6A 1O05A 5JRYA 3R31A 4LH1A 3N82A 4OE6A 4V3FA 1A4SA 4MPBA 1BI9A 2VROA 4JZ6A 2ESDA 5KJ5A 2IMPA 5EZ4A 1UXVA 2ONOA 3EFVA 4I8QA 4X0UA 3N80A 1BXSA 1CW3A 5KLMA 4QYJA 4GHKA 5DRUA 3JZ4A 4PZ2A 1EZ0A 2O2QA 2ONPA 4ITAA 4QJEA 1QI6A 3IWJA 2W8QA 3SZ9A 4NS3A 4ZVWA 2O2RA 4I3XA 3VZ2A 4OE2A 4GO0A 5EKCA 4O5HA 4KWFA 2EIWA 1AG8A 2EJLA 2ONNA 4GO4A 5KLKA 1UXNA 4CBBA 2BJAA 3K2WA 1AD3A 4OHTA 4Q92A 3ROSA 3RHHA 2J40A 4I25A 1WNBA 2W8OA 4GNZA 2J5NA 2BJKA 1VLUA 3INJA 3PQAA 4H73A 4JBEA 5AC2A 4KWGA 4ZXUA 4LH3A 4ZULA 1NZXA 5KF0A 4YWUA 5DIBA 4IDSA 3RHJA 1UXUA 5FHZA 4I26A 3MY7A 2EHUA 2XDRA 3RJLA 2Y5DA 2OPXA 4ZVXA
chains in the Genus database with same CATH superfamily
3ETFA 4LH0A 4IT9A 1QI1A 1EUHA 5F2CA 5EEBA 3JU8A 3VZ0A 4YWEA 2BHQA 4YWVA 1BPWA 2EJDA 4DALA 4ZZ7A 4NPIA 2EIIA 1O02A 2W8NA 4CAZA 3V4CA 4LEMA 3V9HA 4I3UA 2IY6A 4QTOA 1O9JA 5EK6A 5KLNA 4C3SA 3QANA 5EYUA 4ZUKA 5J78A 4LGZA 2HG2A 4I8PA 4NEAA 4OE4A 5L2OA 4DNGA 3K9DA 5ABMA 4OE5A 2EUHA 1EYYA 1A4ZA 4WJ9A 3RHLA 5L13A 4I9BA 4K57A 5KLLA 5L2NA 5KLOA 4QN2A 4ZVYA 1O04A 2BHPA 4X2QA 2WMEA 4E4GA 4KNAA 2W8RA 3B4WA 3RHMA 5A2DD 3RHQA 1O20A 5EUYA 4PXLB 4H80A 4JDCA 4U3WA 3V9LA 3VZ1A 5L2MA 3V9IA 3RHRA 1NZZA 3EK1A 3ZQAA 3SZBA 4F3XA 2ID2A 4MPYA 5AC1A 4I3TA 4X0TA 3INLA 3N83A 4H7NA 2QE0A 1ZUMA 2EITA 2H5GA 2J6LA 4WB9A 4NMJA 2JG7A 4ITBA 4QGKA 4ZWLA 1O01A 2WMEC 4PXNA 4LIHA 2VLEA 4I2RA 3RHOA 1NZWA 4QF6A 2EHQA 4OGDA 5J7IA 5J6BA 1UXPA 5EXFA 2W8PA 1T90A 4LH2A 1UXTA 3I44A 4I3VA 5DBVA 4NMKA 5AC0A 4QETA 2O2PA 3VZ3A 4PXLA 3N81A 3RH9A 4OU2A 4V37A 4GO3A 5A2DC 4I1WA 2ILUA 1KY8A 2ONMA 1UZBA 4IHIA 3V9JA 4L1OA 3RHPA 3RHDA 2Y53A 3SZAA 3TY7A 3U4JA 3V9GA 1UXRA 1UXQA 4A0MA 4IDMA 1O00A 4X4LA 3V9KA 4OUBA 2WOXA 3IWKA 4O6RA 4QJEB 4IYMA 4V3FC 4FR8A 4GO2A 4I3WA 2Y51A 2D4EA 4L2OA 4WPNA 4FQFA 5A2DA 4E3XA 2Y52A 3PRLA 4WP7A 4NU9A 1WNDA 3R64A 2EJ6A 1O05A 5JRYA 3R31A 4LH1A 3N82A 4OE6A 4V3FA 1A4SA 4MPBA 1BI9A 2VROA 4JZ6A 2ESDA 5KJ5A 2IMPA 5EZ4A 1UXVA 2ONOA 3EFVA 4I8QA 4X0UA 3N80A 1BXSA 1CW3A 5KLMA 4QYJA 4GHKA 5DRUA 3JZ4A 4PZ2A 1EZ0A 2O2QA 2ONPA 4ITAA 4QJEA 1QI6A 3IWJA 2W8QA 3SZ9A 4NS3A 4ZVWA 2O2RA 4I3XA 3VZ2A 4OE2A 4GO0A 5EKCA 4O5HA 4KWFA 2EIWA 1AG8A 2EJLA 2ONNA 4GO4A 5KLKA 1UXNA 4CBBA 2BJAA 3K2WA 1AD3A 4OHTA 4Q92A 3ROSA 3RHHA 2J40A 4I25A 1WNBA 2W8OA 4GNZA 2J5NA 2BJKA 1VLUA 3INJA 3PQAA 4H73A 4JBEA 5AC2A 4KWGA 4ZXUA 4LH3A 4ZULA 1NZXA 5KF0A 4YWUA 5DIBA 4IDSA 3RHJA 1UXUA 5FHZA 4I26A 3MY7A 2EHUA 2XDRA 3RJLA 2Y5DA 2OPXA 4ZVXA
chains in the Genus database with same CATH topology
3ETFA 4LH0A 4IT9A 1QI1A 1EUHA 5F2CA 5EEBA 3JU8A 3VZ0A 4YWEA 2BHQA 4YWVA 1BPWA 2EJDA 4DALA 4ZZ7A 4NPIA 2EIIA 1O02A 2W8NA 4CAZA 3V4CA 4LEMA 3V9HA 4I3UA 2IY6A 4QTOA 1O9JA 5EK6A 5KLNA 4C3SA 3QANA 5EYUA 4ZUKA 5J78A 4LGZA 2HG2A 4I8PA 4NEAA 4OE4A 5L2OA 4DNGA 3K9DA 5ABMA 4OE5A 2EUHA 1EYYA 1A4ZA 4WJ9A 3RHLA 5L13A 4I9BA 4K57A 5KLLA 5L2NA 5KLOA 4QN2A 4ZVYA 1O04A 2BHPA 4X2QA 2WMEA 4E4GA 4KNAA 2W8RA 3B4WA 3RHMA 5A2DD 3RHQA 1O20A 5EUYA 4PXLB 4H80A 4JDCA 4U3WA 3V9LA 3VZ1A 5L2MA 3V9IA 3RHRA 1NZZA 3EK1A 3ZQAA 3SZBA 4F3XA 2ID2A 4MPYA 5AC1A 4I3TA 4X0TA 3INLA 3N83A 4H7NA 2QE0A 1ZUMA 2EITA 2H5GA 2J6LA 4WB9A 4NMJA 2JG7A 4ITBA 4QGKA 4ZWLA 1O01A 2WMEC 4PXNA 4LIHA 2VLEA 4I2RA 3RHOA 1NZWA 4QF6A 2EHQA 4OGDA 5J7IA 5J6BA 1UXPA 5EXFA 2W8PA 1T90A 4LH2A 1UXTA 3I44A 4I3VA 5DBVA 4NMKA 5AC0A 4QETA 2O2PA 3VZ3A 4PXLA 3N81A 3RH9A 4OU2A 4V37A 4GO3A 5A2DC 4I1WA 2ILUA 1KY8A 2ONMA 1UZBA 4IHIA 3V9JA 4L1OA 3RHPA 3RHDA 2Y53A 3SZAA 3TY7A 3U4JA 3V9GA 1UXRA 1UXQA 4A0MA 4IDMA 1O00A 4X4LA 3V9KA 4OUBA 2WOXA 3IWKA 4O6RA 4QJEB 4IYMA 4V3FC 4FR8A 4GO2A 4I3WA 2Y51A 2D4EA 4L2OA 4WPNA 4FQFA 5A2DA 4E3XA 2Y52A 3PRLA 4WP7A 4NU9A 1WNDA 3R64A 2EJ6A 1O05A 5JRYA 3R31A 4LH1A 3N82A 4OE6A 4V3FA 1A4SA 4MPBA 1BI9A 2VROA 4JZ6A 2ESDA 5KJ5A 2IMPA 5EZ4A 1UXVA 2ONOA 3EFVA 4I8QA 4X0UA 3N80A 1BXSA 1CW3A 5KLMA 4QYJA 4GHKA 5DRUA 3JZ4A 4PZ2A 1EZ0A 2O2QA 2ONPA 4ITAA 4QJEA 1QI6A 3IWJA 2W8QA 3SZ9A 4NS3A 4ZVWA 2O2RA 4I3XA 3VZ2A 4OE2A 4GO0A 5EKCA 4O5HA 4KWFA 2EIWA 1AG8A 2EJLA 2ONNA 4GO4A 5KLKA 1UXNA 4CBBA 2BJAA 3K2WA 1AD3A 4OHTA 4Q92A 3ROSA 3RHHA 2J40A 4I25A 1WNBA 2W8OA 4GNZA 2J5NA 2BJKA 1VLUA 3INJA 3PQAA 4H73A 4JBEA 5AC2A 4KWGA 4ZXUA 4LH3A 4ZULA 1NZXA 5KF0A 4YWUA 5DIBA 4IDSA 3RHJA 1UXUA 5FHZA 4I26A 3MY7A 2EHUA 2XDRA 3RJLA 2Y5DA 2OPXA 4ZVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETF A;  4LH0 A;  4IT9 A;  1QI1 A;  1EUH A;  5F2C A;  5EEB A;  3JU8 A;  3VZ0 A;  4YWE A;  2BHQ A;  4YWV A;  1BPW A;  2EJD A;  4DAL A;  4ZZ7 A;  4NPI A;  2EII A;  1O02 A;  2W8N A;  4CAZ A;  3V4C A;  4LEM A;  3V9H A;  4I3U A;  2IY6 A;  4QTO A;  1O9J A;  5EK6 A;  5KLN A;  4C3S A;  3QAN A;  5EYU A;  4ZUK A;  5J78 A;  4LGZ A;  2HG2 A;  4I8P A;  4NEA A;  4OE4 A;  5L2O A;  4DNG A;  3K9D A;  5ABM A;  4OE5 A;  2EUH A;  1EYY A;  1A4Z A;  4WJ9 A;  3RHL A;  5L13 A;  4I9B A;  4K57 A;  5KLL A;  5L2N A;  5KLO A;  4QN2 A;  4ZVY A;  1O04 A;  2BHP A;  4X2Q A;  2WME A;  4E4G A;  4KNA A;  2W8R A;  3B4W A;  3RHM A;  5A2D D;  3RHQ A;  1O20 A;  5EUY A;  4PXL B;  4H80 A;  4JDC A;  4U3W A;  3V9L A;  3VZ1 A;  5L2M A;  3V9I A;  3RHR A;  1NZZ A;  3EK1 A;  3ZQA A;  3SZB A;  4F3X A;  2ID2 A;  4MPY A;  5AC1 A;  4I3T A;  4X0T A;  3INL A;  3N83 A;  4H7N A;  2QE0 A;  1ZUM A;  2EIT A;  2H5G A;  2J6L A;  4WB9 A;  4NMJ A;  2JG7 A;  4ITB A;  4QGK A;  4ZWL A;  1O01 A;  2WME C;  4PXN A;  4LIH A;  2VLE A;  4I2R A;  3RHO A;  1NZW A;  4QF6 A;  2EHQ A;  4OGD A;  5J7I A;  5J6B A;  1UXP A;  5EXF A;  2W8P A;  1T90 A;  4LH2 A;  1UXT A;  3I44 A;  4I3V A;  5DBV A;  4NMK A;  5AC0 A;  4QET A;  2O2P A;  3VZ3 A;  4PXL A;  3N81 A;  3RH9 A;  4OU2 A;  4V37 A;  4GO3 A;  5A2D C;  4I1W A;  2ILU A;  1KY8 A;  2ONM A;  1UZB A;  4IHI A;  3V9J A;  4L1O A;  3RHP A;  3RHD A;  2Y53 A;  3SZA A;  3TY7 A;  3U4J A;  3V9G A;  1UXR A;  1UXQ A;  4A0M A;  4IDM A;  1O00 A;  4X4L A;  3V9K A;  4OUB A;  2WOX A;  3IWK A;  4O6R A;  4QJE B;  4IYM A;  4V3F C;  4FR8 A;  4GO2 A;  4I3W A;  2Y51 A;  2D4E A;  4L2O A;  4WPN A;  4FQF A;  5A2D A;  4E3X A;  2Y52 A;  3PRL A;  4WP7 A;  4NU9 A;  1WND A;  3R64 A;  2EJ6 A;  1O05 A;  5JRY A;  3R31 A;  4LH1 A;  3N82 A;  4OE6 A;  4V3F A;  1A4S A;  4MPB A;  1BI9 A;  2VRO A;  4JZ6 A;  2ESD A;  5KJ5 A;  2IMP A;  5EZ4 A;  1UXV A;  2ONO A;  3EFV A;  4I8Q A;  4X0U A;  3N80 A;  1BXS A;  1CW3 A;  5KLM A;  4QYJ A;  4GHK A;  5DRU A;  3JZ4 A;  4PZ2 A;  1EZ0 A;  2O2Q A;  2ONP A;  4ITA A;  4QJE A;  1QI6 A;  3IWJ A;  2W8Q A;  3SZ9 A;  4NS3 A;  4ZVW A;  2O2R A;  4I3X A;  3VZ2 A;  4OE2 A;  4GO0 A;  5EKC A;  4O5H A;  4KWF A;  2EIW A;  1AG8 A;  2EJL A;  2ONN A;  4GO4 A;  5KLK A;  1UXN A;  4CBB A;  2BJA A;  3K2W A;  1AD3 A;  4OHT A;  4Q92 A;  3ROS A;  3RHH A;  2J40 A;  4I25 A;  1WNB A;  2W8O A;  4GNZ A;  2J5N A;  2BJK A;  1VLU A;  3INJ A;  3PQA A;  4H73 A;  4JBE A;  5AC2 A;  4KWG A;  4ZXU A;  4LH3 A;  4ZUL A;  1NZX A;  5KF0 A;  4YWU A;  5DIB A;  4IDS A;  3RHJ A;  1UXU A;  5FHZ A;  4I26 A;  3MY7 A;  2EHU A;  2XDR A;  3RJL A;  2Y5D A;  2OPX A;  4ZVX A; 
#chains in the Genus database with same CATH topology
 3ETF A;  4LH0 A;  4IT9 A;  1QI1 A;  1EUH A;  5F2C A;  5EEB A;  3JU8 A;  3VZ0 A;  4YWE A;  2BHQ A;  4YWV A;  1BPW A;  2EJD A;  4DAL A;  4ZZ7 A;  4NPI A;  2EII A;  1O02 A;  2W8N A;  4CAZ A;  3V4C A;  4LEM A;  3V9H A;  4I3U A;  2IY6 A;  4QTO A;  1O9J A;  5EK6 A;  5KLN A;  4C3S A;  3QAN A;  5EYU A;  4ZUK A;  5J78 A;  4LGZ A;  2HG2 A;  4I8P A;  4NEA A;  4OE4 A;  5L2O A;  4DNG A;  3K9D A;  5ABM A;  4OE5 A;  2EUH A;  1EYY A;  1A4Z A;  4WJ9 A;  3RHL A;  5L13 A;  4I9B A;  4K57 A;  5KLL A;  5L2N A;  5KLO A;  4QN2 A;  4ZVY A;  1O04 A;  2BHP A;  4X2Q A;  2WME A;  4E4G A;  4KNA A;  2W8R A;  3B4W A;  3RHM A;  5A2D D;  3RHQ A;  1O20 A;  5EUY A;  4PXL B;  4H80 A;  4JDC A;  4U3W A;  3V9L A;  3VZ1 A;  5L2M A;  3V9I A;  3RHR A;  1NZZ A;  3EK1 A;  3ZQA A;  3SZB A;  4F3X A;  2ID2 A;  4MPY A;  5AC1 A;  4I3T A;  4X0T A;  3INL A;  3N83 A;  4H7N A;  2QE0 A;  1ZUM A;  2EIT A;  2H5G A;  2J6L A;  4WB9 A;  4NMJ A;  2JG7 A;  4ITB A;  4QGK A;  4ZWL A;  1O01 A;  2WME C;  4PXN A;  4LIH A;  2VLE A;  4I2R A;  3RHO A;  1NZW A;  4QF6 A;  2EHQ A;  4OGD A;  5J7I A;  5J6B A;  1UXP A;  5EXF A;  2W8P A;  1T90 A;  4LH2 A;  1UXT A;  3I44 A;  4I3V A;  5DBV A;  4NMK A;  5AC0 A;  4QET A;  2O2P A;  3VZ3 A;  4PXL A;  3N81 A;  3RH9 A;  4OU2 A;  4V37 A;  4GO3 A;  5A2D C;  4I1W A;  2ILU A;  1KY8 A;  2ONM A;  1UZB A;  4IHI A;  3V9J A;  4L1O A;  3RHP A;  3RHD A;  2Y53 A;  3SZA A;  3TY7 A;  3U4J A;  3V9G A;  1UXR A;  1UXQ A;  4A0M A;  4IDM A;  1O00 A;  4X4L A;  3V9K A;  4OUB A;  2WOX A;  3IWK A;  4O6R A;  4QJE B;  4IYM A;  4V3F C;  4FR8 A;  4GO2 A;  4I3W A;  2Y51 A;  2D4E A;  4L2O A;  4WPN A;  4FQF A;  5A2D A;  4E3X A;  2Y52 A;  3PRL A;  4WP7 A;  4NU9 A;  1WND A;  3R64 A;  2EJ6 A;  1O05 A;  5JRY A;  3R31 A;  4LH1 A;  3N82 A;  4OE6 A;  4V3F A;  1A4S A;  4MPB A;  1BI9 A;  2VRO A;  4JZ6 A;  2ESD A;  5KJ5 A;  2IMP A;  5EZ4 A;  1UXV A;  2ONO A;  3EFV A;  4I8Q A;  4X0U A;  3N80 A;  1BXS A;  1CW3 A;  5KLM A;  4QYJ A;  4GHK A;  5DRU A;  3JZ4 A;  4PZ2 A;  1EZ0 A;  2O2Q A;  2ONP A;  4ITA A;  4QJE A;  1QI6 A;  3IWJ A;  2W8Q A;  3SZ9 A;  4NS3 A;  4ZVW A;  2O2R A;  4I3X A;  3VZ2 A;  4OE2 A;  4GO0 A;  5EKC A;  4O5H A;  4KWF A;  2EIW A;  1AG8 A;  2EJL A;  2ONN A;  4GO4 A;  5KLK A;  1UXN A;  4CBB A;  2BJA A;  3K2W A;  1AD3 A;  4OHT A;  4Q92 A;  3ROS A;  3RHH A;  2J40 A;  4I25 A;  1WNB A;  2W8O A;  4GNZ A;  2J5N A;  2BJK A;  1VLU A;  3INJ A;  3PQA A;  4H73 A;  4JBE A;  5AC2 A;  4KWG A;  4ZXU A;  4LH3 A;  4ZUL A;  1NZX A;  5KF0 A;  4YWU A;  5DIB A;  4IDS A;  3RHJ A;  1UXU A;  5FHZ A;  4I26 A;  3MY7 A;  2EHU A;  2XDR A;  3RJL A;  2Y5D A;  2OPX A;  4ZVX A; 
#chains in the Genus database with same CATH homology
 3ETF A;  4LH0 A;  4IT9 A;  1QI1 A;  1EUH A;  5F2C A;  5EEB A;  3JU8 A;  3VZ0 A;  4YWE A;  2BHQ A;  4YWV A;  1BPW A;  2EJD A;  4DAL A;  4ZZ7 A;  4NPI A;  2EII A;  1O02 A;  2W8N A;  4CAZ A;  3V4C A;  4LEM A;  3V9H A;  4I3U A;  2IY6 A;  4QTO A;  1O9J A;  5EK6 A;  5KLN A;  4C3S A;  3QAN A;  5EYU A;  4ZUK A;  5J78 A;  4LGZ A;  2HG2 A;  4I8P A;  4NEA A;  4OE4 A;  5L2O A;  4DNG A;  3K9D A;  5ABM A;  4OE5 A;  2EUH A;  1EYY A;  1A4Z A;  4WJ9 A;  3RHL A;  5L13 A;  4I9B A;  4K57 A;  5KLL A;  5L2N A;  5KLO A;  4QN2 A;  4ZVY A;  1O04 A;  2BHP A;  4X2Q A;  2WME A;  4E4G A;  4KNA A;  2W8R A;  3B4W A;  3RHM A;  5A2D D;  3RHQ A;  1O20 A;  5EUY A;  4PXL B;  4H80 A;  4JDC A;  4U3W A;  3V9L A;  3VZ1 A;  5L2M A;  3V9I A;  3RHR A;  1NZZ A;  3EK1 A;  3ZQA A;  3SZB A;  4F3X A;  2ID2 A;  4MPY A;  5AC1 A;  4I3T A;  4X0T A;  3INL A;  3N83 A;  4H7N A;  2QE0 A;  1ZUM A;  2EIT A;  2H5G A;  2J6L A;  4WB9 A;  4NMJ A;  2JG7 A;  4ITB A;  4QGK A;  4ZWL A;  1O01 A;  2WME C;  4PXN A;  4LIH A;  2VLE A;  4I2R A;  3RHO A;  1NZW A;  4QF6 A;  2EHQ A;  4OGD A;  5J7I A;  5J6B A;  1UXP A;  5EXF A;  2W8P A;  1T90 A;  4LH2 A;  1UXT A;  3I44 A;  4I3V A;  5DBV A;  4NMK A;  5AC0 A;  4QET A;  2O2P A;  3VZ3 A;  4PXL A;  3N81 A;  3RH9 A;  4OU2 A;  4V37 A;  4GO3 A;  5A2D C;  4I1W A;  2ILU A;  1KY8 A;  2ONM A;  1UZB A;  4IHI A;  3V9J A;  4L1O A;  3RHP A;  3RHD A;  2Y53 A;  3SZA A;  3TY7 A;  3U4J A;  3V9G A;  1UXR A;  1UXQ A;  4A0M A;  4IDM A;  1O00 A;  4X4L A;  3V9K A;  4OUB A;  2WOX A;  3IWK A;  4O6R A;  4QJE B;  4IYM A;  4V3F C;  4FR8 A;  4GO2 A;  4I3W A;  2Y51 A;  2D4E A;  4L2O A;  4WPN A;  4FQF A;  5A2D A;  4E3X A;  2Y52 A;  3PRL A;  4WP7 A;  4NU9 A;  1WND A;  3R64 A;  2EJ6 A;  1O05 A;  5JRY A;  3R31 A;  4LH1 A;  3N82 A;  4OE6 A;  4V3F A;  1A4S A;  4MPB A;  1BI9 A;  2VRO A;  4JZ6 A;  2ESD A;  5KJ5 A;  2IMP A;  5EZ4 A;  1UXV A;  2ONO A;  3EFV A;  4I8Q A;  4X0U A;  3N80 A;  1BXS A;  1CW3 A;  5KLM A;  4QYJ A;  4GHK A;  5DRU A;  3JZ4 A;  4PZ2 A;  1EZ0 A;  2O2Q A;  2ONP A;  4ITA A;  4QJE A;  1QI6 A;  3IWJ A;  2W8Q A;  3SZ9 A;  4NS3 A;  4ZVW A;  2O2R A;  4I3X A;  3VZ2 A;  4OE2 A;  4GO0 A;  5EKC A;  4O5H A;  4KWF A;  2EIW A;  1AG8 A;  2EJL A;  2ONN A;  4GO4 A;  5KLK A;  1UXN A;  4CBB A;  2BJA A;  3K2W A;  1AD3 A;  4OHT A;  4Q92 A;  3ROS A;  3RHH A;  2J40 A;  4I25 A;  1WNB A;  2W8O A;  4GNZ A;  2J5N A;  2BJK A;  1VLU A;  3INJ A;  3PQA A;  4H73 A;  4JBE A;  5AC2 A;  4KWG A;  4ZXU A;  4LH3 A;  4ZUL A;  1NZX A;  5KF0 A;  4YWU A;  5DIB A;  4IDS A;  3RHJ A;  1UXU A;  5FHZ A;  4I26 A;  3MY7 A;  2EHU A;  2XDR A;  3RJL A;  2Y5D A;  2OPX A;  4ZVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...