4OI3A

Crystal structure analysis of sco4226 from streptomyces coelicolor a3(2)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
AHFMDVHRGMHGITSDQLHQAHQADLAVEKDENVHFEQAWADPASGTIYCLSEGPSAEAVQRVHERAGHKADEIHEVPLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Streptomyces coelicolor SCO4226 Is a Nickel Binding Protein.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Metal binding protein
molecule keywords Nickel responsive protein
total genus 21
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14026 DUF4242 Protein of unknown function (DUF4242)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3090 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oi3A00
4OI6A 4OI3A
chains in the Genus database with same CATH superfamily
4RLEA 4YFUA 2HQCA 2MKJA 4M5MA 2XO7A 1SC6A 4F4ZA 1JLCA 2XYPB 3FK4A 3D28A 1N36J 1AROP 2DNLA 2VICA 2K1RA 2E9RX 4OX9F 2PMHA 4IO1A 4TLQA 5ETLA 2BQUA 4MIAA 1GMWD 1BXNA 3VAIA 3ZXWA 2YKNB 3UCUP 2HHQA 1H2UX 5M2RA 2J7KA 1M0SA 4OJ3A 3IP0A 1QAIA 2CXEA 1HA1A 3IMQJ 5DRKA 4NYPA 5IFMA 4LIRA 3UDCA 2GVZB 3MPWA 1YJ7A 2C22A 3ITHB 2BYCA 3IM8A 2P9CA 2Y1RI 3QAEA 5K14A 3TZYA 1TL7A 1WSVA 3F41A 4CLZA 1N34J 4BS2A 2J5AA 3IR7B 1M5PC 1UVNA 2Q66A 3VAGA 3MPYA 5B08A 1L5UA 2GNKA 1FA0A 1RLDA 2F3JA 3PFEA 2RUSA 2R7WA 2BQ3A 3QJJA 1HBOB 1NK8A 4LFBF 5E41A 1IVZA 2IBOA 4AXIA 2UV8G 3O6QA 3US5A 2HG4A 4R25A 3UCZP 3K5PA 2AV5A 1RA7A 2J7UA 1UA0A 1X5SA 1TL5A 3JSBA 4K5RA 2Z2LA 2R9LA 4W92B 3K89A 3MURP 4EEYA 4LF6J 4N41A 1NRKA 2RKIB 5JUMA 2JOQA 4HI1A 4U7UK 2R8GA 1Q8KA 5LSOA 4CT9A 1R0CB 4I2QA 2W8KA 1HBMA 1Y7PA 2OPQB 2QE5A 1WKKA 1E6YB 2QYCA 3K5OA 3NS6A 5C7PA 2W2MP 3PIOQ 2OUGA 4DCPB 5J2MB 4KC5A 4NCGA 1WOSA 1REVB 1VLYA 5I3PA 1AUSL 4MFBB 4XK8C 2LDYA 4RR5A 5F0UA 2QV6A 4ELVA 1IKVA 2YVSA 3W2VB 1U0SA 4IOCQ 3VGTA 3U1MA 1AYEA 2DY9A 2R42A 4BLGA 1H98A 5KG2A 3DHXA 2VQFJ 3OL9A 2W2PP 1DTTA 3M1VA 1TL1B 2CQ2A 4Y2KA 2OLWA 1YBTA 2VG6B 5IM0B 1CPZA 1NSQA 1SH3A 3GV7B 1RT4B 3DXSX 3AODA 3HPOA 3R5CA 3VQTA 2DR5A 2Z2YB 5T41A 1ZM3A 1FRKA 3K58A 4YB1P 1R7IA 4X4NA 1FTRA 1VQ4S 2ILZA 2XCAA 3GJSB 5IOLA 2HBRB 2QLXA 3U27A 2H1YA 2WTFA 2RIJA 2R7RA 2EK1A 1RBLA 2BX6A 2HLUA 3V4MA 1NDPA 2ZBRA 5HBMA 2FIUA 3V6JA 3JTNA 1ZZNA 3UVJA 1IUJA 1RI7A 3BSAA 3GE9A 2HIYA 4IFYB 2HWTA 4MJKA 3TA2A 2HRYA 1J2VA 1K8AT 3NCPA 1SJ1A 1N5VA 2H48B 3FZBA 4DR5J 1RAHB 2V8VA 5HK4A 1S6OA 6FD1A 2VJUA 1SKSA 2PI4A 3Q86A 3B54A 2RHQB 3HSJA 2LQJA 2R2RA 1BQXA 1UWAA 4RW7A 2RQKA 3K8VA 2DRDA 2XZTB 4ES1A 3HKZD 3FBCA 1YQHA 4TNOA 4CYUA 2W9BB 4D3GA 4C8KA 4X4QA 3CCTA 3PRDA 1FNMA 1NPKA 3IFEA 1GNKA 2LDIA 3MEKA 2AHOB 2BANA 3J7YI 1YHQS 1LFPA 3J7A1 2V68A 4FXVA 1WHWA 4ZPTR 3W2WB 2O67A 2QLWA 2F8MA 2K3IA 2UXBJ 2X1FA 5ETVA 4K4ZA 1IBLF 4PEOA 1CJTA 5KFLA 1MG7A 2JLFA 2O66A 1C1CA 5KFTA 1UFLA 2LECA 4DQPA 4FBTA 2DRBA 2V94A 3CC4S 1T03B 2VOOA 1KFDA 4U95A 2ZZTA 3ZZYA 5LMUJ 1UFWA 2ZHAA 4EWTA 4O3OA 3OLAA 1RAAB 3M32B 1U1LA 2VZ9A 2C2MB 4HI2A 5M2UA 1HHTP 4OZLA 4ZVRB 1UW4A 1AXQA 5BJRA 4OZ2A 3JS9A 3PACA 4LJMA 1K44A 3V81B 4PPZA 1NK0A 3L4BC 5L9XA 3KK3B 1JNRB 2DR9A 1QUPA 1S7IA 2AEFA 2DTJA 3FGVA 4O4GB 4DCOB 1KD1T 4LF4F 2DHAA 4C3MA 3VAJA 3MM5B 4F4KA 4I2PA 3ZTQA 3DNCA 3UDLA 2GJFA 4O3PA 1SL1A 1WEXA 1JLCB 2A2CA 2DXDA 2HFZA 3SMZA 2E5GA 2VJVA 4YY3J 3ZTOA 3PY8A 2E1CA 1N33J 2GIFA 2U2FA 3M2VB 4KHRA 4LRDA 3RU0A 5J2NB 4F3QA 3TJ9A 1F0XA 4ZJQA 5H9EJ 1AT1B 1J5EF 4RO0A 2MZRA 3N6LA 4OZ5A 2OPRA 5HP1B 1HYSB 1OQ3A 1XR5A 2WBMA 3HZGA 3GSIA 3HVWA 4OYWA 5K8MA 3BN7A 3I87A 4PG7A 1N5YB 3IN5A 4HACB 5H9EK 3SDEA 1VS3A 2M2BA 5E3RA 4QU7A 4ATNA 2ZH6A 2EBGA 1VQ5S 3ZFVA 2B4PA 3DOMB 2UZAA 4G1QB 4NRTA 1TV6B 4JI6F 5B0BA 3M6UA 2H9ZA 3GTYX 3JAMU 4O0IA 3BQ1A 2M70A 5HQLA 1DTQB 3QJPA 2AQ4A 1M5VC 2CJ9A 3DRPB 2UU9J 3NMAA 3GCXP 4WFAQ 2DKOB 2WB1D 5EX3A 5F8GA 4L3NA 3J81Y 2ALZA 3PHEA 5J2QA 2ATLA 3NMRA 1KVIA 1VLOA 2Q79A 2WONA 5LOQA 4N76A 4CM2A 3TQEA 1VBXA 4LQ3A 2R7XA 2IYIA 1UMJA 2W1BA 2J0XA 5FLXU 3KLEA 3V4IB 5IT9U 4RU2A 1RU2A 3DN9A 1GMVA 3M2RB 5ETNA 4WXOA 5IXUA 4IQMA 5ETPA 5L9NA 1T11A 2KG1A 3NGSA 2IDLA 2Z58B 2K8GA 3ENQA 3MPVA 1IWGA 1HBNB 1RT6B 1ZA1B 1GQEA 1FFSB 2Z56B 4AL7A 2BRKA 1HNWJ 1FCAA 5LMNF 3AA9A 4QQBA 2YKPA 4B3MF 1REVA 4YHHF 5HROA 4B3OA 2RNEA 1N6QA 3CMQA 2C3YA 1KONA 1A0OB 3SQOP 1B7FA 1SIWB 4JI7F 3QMQA 4DV5J 2AJ1A 1LWEA 3ADAC 2V8HA 3TEGA 3TUIC 1BMQB 3WIUA 2XZDB 6AT1B 4YR2A 4J9MA 1RKIA 2E7XA 1JLEA 3P4UB 1IWAA 1RADB 2B5JB 3TRGA 3KJQB 3FCVA 4DR3F 4R0EA 2CNNB 3CCZA 2HVZA 1S7HA 1S57A 1WF1A 1YZ6A 3PYDA 1RAOA 2NSCA 5KAKA 1FJCA 1JJ2R 2KFNA 1X60A 2ZH8A 4QR1A 1KR4A 1NH7A 1JJCB 2CQGA 3AOAA 3DRYA 4KAIA 4MK8A 4QPTA 1ZH5A 3RG6A 2HQ3A 3UR0A 2PFDA 2XYHB 4DCJB 3QSYB 2CVEA 1RE1B 3D0HE 1GFWB 1UJ5A 2KVQE 3I96A 1YBUA 1JLQB 4X4TA 1U1OA 1MWYA 1KFSA 3QT6A 2CZ4A 5AE3A 4FNIA 4LVNP 2YWHA 4I6AA 3MUVP 2C3UA 4ECTA 3GV8B 3H5XA 2AD9A 4DUZF 1TMJA 2BKNA 1PJ5A 2ZEJA 3UD5A 1BC6A 3IA0A 4NX9A 4NLRA 2JVOA 3H2UB 5GVQA 3W64A 5LSRA 4ZN1A 2QA2A 2DNKA 3DDNA 2YKMB 4TU8A 1JKHA 1MROA 2HFNA 4RW8A 1C0TB 2ZVSA 3ITHA 5GAEU 1Q86T 4C97A 5AT1B 1M5KC 1EETB 3KOAA 2HHTA 1T95A 3TJAA 1Q1KA 4IR9A 3QWPA 2DR6A 2B56A 3ONQA 1WHVA 4O3QA 2HHUA 3ZZRA 1D09B 2VPYB 1GAOA 2VFRA 1Q5YA 5D78A 4DV1F 3UPFA 1WOPA 4PWDB 1JLBA 2V4RA 1VQLS 1QE1A 1IKWA 2DGUA 3G86A 3LP1A 3ZZUA 3EMTA 4DUZJ 5THWA 4UQGA 1EB0A 4YMEA 4Q44A 1C4CA 2EEYA 2QL9B 1W25A 4OYBA 4CLKA 5MAOA 3Q2TC 3W5ZA 3MPDA 2QJ3A 2VQEF 3NGKA 1H3DA 3QGPA 4NA2A 3KJVB 2ZHOA 3Q23A 2CAJA 1RHQB 1ZM2A 3OPKA 4I2QB 3CDWA 2OTLS 2L9NA 4ANDA 5J1PA 3M9NB 3TANA 1TP7A 2OP5A 5B7WA 1NSAA 2CQ4A 2G0CA 3OVSA 2E44A 2AYBA 2XQCA 3LWMA 3SXLA 4C6AA 4CI0B 2HWIA 4TYBA 1FO1A 1U26A 2H5IB 4F02A 4ECZA 2G2YA 5F3TA 1VQKS 2CG8A 1FEHA 2HMIB 1EARA 3CXCR 3B82A 3KWMA 3CEDA 1G7CB 3BJYA 2M9KA 2XTJP 4NLOA 1SC4B 5B0DA 5C5JA 1Q8IA 4TLRA 2LMIA 2YKOA 4M5DA 4JI7J 4I2PB 3BO2A 2FLNA 3HMJG 1R8AA 2IMWP 4CLTA 1H6KX 1E6VB 3M30B 4PUOB 3KMQA 1BQMA 1S49A 5E5NA 2GVDB 2XI2A 2OPRB 5DDPC 1HMVA 1RHJB 3OJSA 1HW9A 4U7UD 2ERRA 2KFZA 2QTWA 2BRLA 5GMEA 1FXLA 4QWDA 1Q0NA 1NZ8A 4IKAA 5KFWA 2RDIA 4NE9C 2HHHJ 3S1TA 3MD1A 3EXCX 2YY3A 1OIAA 5EHHA 2E7WA 2XWYA 4X4RA 1A6LA 1PYOB 3CDAA 4C2MA 4DR3J 3D1HA 3T1YF 3M6WA 2PEBA 3C19A 1YIJS 4KGMA 3C2PA 1ZBTA 4WYWA 2A1BA 1U24A 2D3ZA 4CH7A 3G96A 4XAKA 1Y10A 4OQJA 3KLHB 3W7BA 3MEGB 4M5KA 5KFVA 5HLFA 4RPFA 2A0FB 3KLHA 3KNAA 3FBEA 2XMJA 4P2SA 2QC3A 3VR1A 3K17A 2BVZA 2HHPA 5D77A 3M8WA 3NLCA 4ZVHA 3ENVA 5CD4H 1X0FA 3CD6S 2V9WA 1FWLA 3NBPB 1HNZJ 2J0WA 1RT3A 3L7PA 4UTGA 4EI2A 2JEJA 3D4JA 2RU3A 4USTA 4IOBA 2X1BA 2UXDJ 3G9CA 3T1YJ 1FK9B 1I51B 3W63A 2EC0A 1CJUA 2V67A 1RWPB 1FESA 4XPCA 3B4DA 4B02A 4WPAA 5KFEA 4IFVA 5A2QY 4DR6J 1D9AA 3GWCA 5C2CA 5JVHQ 1S4EA 1RB0A 3JSYA 3G2XA 3EVWA 2GGPB 1HFEL 1HHSA 1SJRA 1FFWB 2FQQB 2IRYA 5U47A 3AQPA 5KT5A 1NSPA 1LFWA 5LXYA 1YJRA 1UVKA 1RWKB 2OFHX 3W62A 4FBUA 2N4DA 3O2IA 3LGNA 3J7AN 2WZ1A 3C16B 3IWLA 1EHWA 4S0MA 1TELA 5KFSA 2COLA 3DOKA 5DM7Q 3THTA 2FVQA 3D1QA 2ZITA 3KXDA 4IG3B 3D6HB 3GPAA 3KUHA 2CQIA 3OBIA 1JX4A 1U1MA 4JYAF 1YJUA 2G0IA 2H51B 2MY7A 1ITPA 4F25A 1FXDA 2E1MC 2B4OA 1D9DA 3M6VA 4IH7A 2R3VA 1VRQC 3PYEA 5D0EA 1KQKA 4L73A 4DEZA 3TI0A 1S6QB 2OMLA 3MR7A 2W2NP 4ZA1A 2FVRA 3BYPA 5KFZA 1MMDA 4GVBB 3GONA 1TAQA 3GFHA 3NOGA 4MMOA 3CJKA 2G1DA 2JSXA 3PFOA 3H5SA 4DV0F 4BWJA 3W8GA 2E5LF 4MKBA 5BR8J 1MWZA 4H4MA 4JYAJ 3HHLC 4N77A 2DEIA 1NZAA 2DBBA 2W7OA 1OWXA 1FWPA 2HGMA 2XSJB 2J0QD 4QR0A 4LF7F 1S1XB 3VAKA 1KHWA 3HF5A 4ALZA 1UL3A 3TNVA 2WBRA 3F0NA 2FZKB 4C8ZA 1HQEA 1RZMA 4LR8A 3T19A 1GMUA 2Q43A 3NKYA 5HMXA 2HRUA 3H4DA 1RK8A 4ZVFA 5DGAA 1K0TA 2KZMA 5CD4A 2I1RA 2WAQD 3GILA 1JK9B 4HR2A 3W65A 2OTJS 4WU2A 1BUXA 5A76A 3M8YA 1X31C 4UQTA 4YEAA 4A46A 3GV5B 4N47A 2BJ1A 2LKZA 3K8WA 2CQCA 5ETRA 1YJ9S 3TUPA 4PWDA 1KN6A 4PCQA 4JI4F 1T9XA 4G65A 4DZ6A 3Q8SB 3L7UA 2EWHA 2R2UA 2ZBPA 5D6GA 1C2PA 1RBOB 1PJ6A 1U6ZA 2CG4A 2GW8A 3DM2A 3BGRA 3V2UC 4RNOA 4RNMA 1SL0A 4RWXA 4PXEA 3M8PB 1WKJA 3NG8A 5AE1A 2XGPA 4RW9B 4CQ1A 1NK9A 4DSIA 2OPQA 4QYZK 2EFGA 2V50A 2VDIA 5KG4A 3MCMA 4EFAC 3UR3C 4A8FA 1LK7A 2ACMA 3PM9A 1U7LA 3BPDA 3DDKA 2MGZB 2W25A 3RAXA 4H4KC 1ZYQA 2UXCF 3WX8A 4HLBA 4URSA 3FSIA 3BQ0A 3LPYA 5EWFA 4DR1F 1VQ7S 5F0WA 3RBEA 3W2VA 1TZ0A 4OV1A 3R5GA 2BABA 2DNRA 4DPXA 3G8SA 3JYTB 3T5KA 1ULRA 5EUHA 3TARA 2PO4A 4U96A 2Y8WA 2A6MA 1VCTA 2JZ5A 3KNGA 2IYGA 4PXCA 4WFYA 1XMOJ 2ZUAA 1RT4A 5AE2A 5KOWA 4I69A 1D1UA 3LO3A 3PHTA 2ZH4A 4UT4A 3NEKA 4CNYA 4WP8A 1BWEA 1HL6A 2R8JA 3H4BA 1YJTA 2GAHC 4P2FA 5KFBA 1HI8A 1KQGB 2QFJA 2G1HA 2ZDOA 1NNDA 3SQGA 4IO9Q 2VA3A 4WZMA 2B8QA 1ELOA 3A3NB 3N79A 3EZOA 2XHCA 4U7CA 2XG8A 4OYIA 1OYDA 4B08A 2V4JA 4G1IA 4LQ9A 4Z7CA 1OO0B 1TKXA 1IBMF 1OJ4A 1NJWA 1FRIA 2PEHA 4Y2MA 3UI3A 1TL7B 3RTVA 3CMAS 3QRRA 2JFKA 3A1YG 2HNDB 4JB8B 2XGQA 4FS1A 4DU7A 3H42A 3VV2B 2LEBA 3D0IE 4OZJA 2DJWA 1SB6A 4DPYA 4J9OA 2GAGC 4L72B 5BR8F 1S9EB 2IFXA 4USMA 2ZH2A 4HEA9 2HURA 4ERDA 3MEGA 1JLGA 2JLEA 3OLBA 1QVFR 2RQMA 3AOCA 2UUBJ 4JI0J 3H20A 4X64F 1TR0A 2RKIA 1N34F 5G4DA 3NWGA 4NMXA 2CIMA 2FHOB 3G6ES 1BHNA 2IIHA 2HNYA 3ZZPA 5A8WA 2YNIB 4NLXA 1FDDA 1TKTA 4ZLNA 3CCES 3PW0A 1H74A 1RTZA 1WI6A 1WG5A 3RB4A 5GAHU 2P6SA 3UN2A 1SQGA 4AYBD 4PYDA 2ASDA 4O23A 1HBNA 3QO9A 1WDTA 5KT2A 3D68A 1QJHA 2W2OP 2KFYA 3C14B 1O51A 4I64A 4TYAA 2CA9A 2KXNB 4K2JA 5HROB 3OUYB 1BQNB 4K4VA 2DPJA 2MQMA 2SXLA 5F8MA 2GGPA 3PTWA 2HVDA 3M8QA 3RR7A 5JVGQ 2Y8YA 4UOHA 3CDBA 3M8QB 3W60A 3OL6A 5DDOC 1R0AB 4FYDA 4FZVA 1OMSA 5F8JA 4G1PA 2FY1A 1J27A 4OJGA 1TVRA 2B9WA 2CPZA 4E8UA 3DLLQ 2N3OA 3K0JA 1TUWA 4Y00A 3QJLA 3PR5B 1NHKL 2HIQA 3BEGB 5HJXA 4RW6A 3TUZC 2VQFF 1FKOB 3PO5A 2XMWA 2HFUA 4P2MA 2CPJA 3M8ZA 2YQ3A 2LU1A 3QZ7A 1PGZA 3ET6A 5KG3A 1F5CA 2W9CA 3EXYA 4QPXA 4KO0A 4IDKB 3K5NA 2C2RA 4LF4J 3H8YA 3JXOA 3LTOA 4HT5A 2D9PA 2YX7A 2RQCA 3NL0A 5ITHA 3KLFA 4GC6A 1N0VC 3NOCA 3K7RA 4YB6A 4CTAA 2FC8A 5F8IA 1BQMB 1FRLA 1P1LA 2APOA 2KL8A 1W2BR 3GMGA 4B9SA 1CJKB 1FRXA 3I9V9 1S5ZA 1Y0HA 2WSFC 3H98A 2JLGA 3QAUA 4N5SA 4GKKJ 1SH2A 2AKWB 4DV7F 1DHMA 4K7QA 1KLMA 2ASJA 2Z57B 4FVMA 2KJWA 2ZKTA 2B6AB 4TXSA 3BBFA 2F9JA 4ZDNA 1RT5B 1CBKA 1VYAA 2KVIA 1F6TA 3MD3A 2CFXA 1S1VA 4NOHA 4K50A 2C42A 3EYZA 1S59A 2KT2A 4DX8H 3BO4A 2MJNA 3M9MB 2E9ZA 1TUVA 2MMYA 4IYQA 2R8IA 1N5SA 4ZVUB 2D7SA 4C0OC 5DQHA 1W7WA 2R7SA 2BE2B 2BJ3A 2IM2A 5D8HB 4JI6J 3QIPB 4LFCJ 3CT9A 2ZH7A 4WFXA 4PAAA 4JI3F 3LP2B 5F8LA 5KFQA 2PC6A 4UZBA 1MSWD 5B0AA 4W4MA 1C0UA 5E3PA 2CQ0A 2VFTA 1U02A 3EJMA 1T03A 5A8RA 1S0VA 4LREA 2QA4G 3NGUA 2NUUG 1PSDA 3JB9k 2KHDA 1VI7A 5IZHA 4RBTA 2Y1JA 4DV4F 3ZZ0A 1I94F 1JJHA 4DUYJ 4DI6A 2A18A 3KLIB 5FJ4A 4XIUA 2GCFA 1M1HA 3KUEA 2QFIA 4KGZB 4O44A 2OFGX 2VU5A 3VCDA 4DR2J 4DV0J 4PQAA 3WZ0A 2V0NA 1SKWA 3J80U 1QSLA 2KZZA 1RHUB 3RGIA 5LMNJ 4UZCA 1U2RA 1F9FA 2DGQA 4ZVQB 5KFXA 1Q81T 3PNIA 1U8SA 2HQFA 4ZVEA 4DV3J 2HFOA 2DVIA 2KXHA 4ILRA 2KN4A 4NCAA 4RW4A 2HVHA 3MZIA 3FKBA 3JSRA 2EVZA 2V2KA 1ICEB 1RWWB 4LR9A 5D4NA 3MWBA 3ZTPA 2VBYA 1Q82T 3QRQA 3PCOB 1KQFB 3NNHA 2X51A 1S97A 3CCLS 2BM0A 2F9DA 2OPPB 1XNRF 2M88A 3FMBA 4HACA 1WEZA 4RNNA 2D3O1 1H72C 3KFWX 2RUGA 4DL2A 2JEIA 4URQU 1B7YB 3I4HX 3MM9B 4DUTA 2W7AA 3E01A 4JI8F 1B3TA 2Y0BB 3KHGA 1LWFB 1TU0B 2GHVC 2DK2A 2FJDB 4DR4F 3QZ8A 4A8SA 4J9SA 1H7WA 4M5IA 4W98A 2R8HA 3P3DA 1Q8LA 2DH8A 4ED4A 3ZNUA 1VBKA 1KBRA 4LF6F 9ATCB 4PQUB 2CQPA 1MROB 4RW8B 1R8HA 2RSQA 1DY3A 1Y5LB 1HQEB 4WBFA 5D15A 4F4YA 5LT5A 2MQ8A 3WIVA 1KEKA 5J2QB 2JL9A 2XY7A 1VK8A 5KFHA 2IBKA 2IAJA 2C3MA 5D0RA 2D41A 3C15A 4XDDA 4CH0S 2HHHF 4OHYA 1YK9A 1GTHA 3UNYA 1XMQF 2JEFA 1U1RA 3IRXB 1SPBP 4LRAA 3RB0A 2WHOA 4USJC 1LW0B 1VOMA 4C8OA 3Q24A 4X64J 3FDSA 4NCGB 2CPEA 2B9XA 1NLKL 2GMLA 2J6SA 4F2SA 5CXTA 2R8KA 2PIIA 1X4HA 4QWBA 1IKVB 1R3NA 1S1WB 3KDOA 3MCOA 3SBMA 1S10A 4IFVB 2CJXB 4OX7A 2JJ4D 1RTHA 2FHMA 4X4PA 2NYIA 2Q6BA 1XMOF 1FI4A 5HQMA 2VG6A 1LW2B 3DKDA 3GIMA 1D0EA 2CQDA 4KGKA 3C66A 3G6VA 5E3CA 5HMYA 4WP3A 4DSFA 2DGSA 2MQNA 4CZCA 1VFJA 2QSWA 3KK3A 3DCAA 5D3GB 1Y00A 2VFSA 2F40A 2CADA 5EX0A 2VFUA 2VPWB 4ED6A 2X1GA 3N6NA 4WIIA 3OQ2A 1L3SA 1MWQA 2AZ1A 4ZOSA 4DSEA 2VKRA 4CNZA 2CQ1A 2VDHA 5KT3A 4LUBA 1C4AA 1UVLA 1I94J 3BGFA 4HTJA 1UEKA 1TKZA 2X1AA 4NLPA 4DUYF 2M4MA 4H4KA 2GVDA 1X4EA 1YITS 3QGHA 1TKZB 2ZJQQ 3W3SA 3SV4A 2RD5C 1RACB 1Q79A 1W26A 1YJVA 2DHSA 2E5HA 1WC3A 3NCRA 3R6LB 2HBYB 3N28A 4AE5A 1DBDA 1FTCA 1HYSA 1M5HA 5E33A 3BGOP 4RUHA 5LJ3Y 4OYAA 4J9PA 3I0RB 2YNHB 1ZM4A 1XTZA 2CWKA 2FZGB 2Q1LA 3VGUA 5C42A 4X62J 2YXLA 3EWGA 3FBFA 1TMMA 5KFKA 2BANB 2ILYA 1KDNA 3C6TA 1PILA 2P2CB 2QO3A 5CZXA 3D1OA 4ICLA 3R5JB 3T9NA 5EWEA 4K4WA 3MM7B 1F9EB 4ZLPA 1QTMA 1EIYB 3HDSA 1JLFB 5ADZA 4ICLB 3MR6A 1F5AA 1ZPVA 3PW4A 4F3OA 1S9EA 3X3UA 3SSSA 3CUNA 1RAEB 2QL5B 2XO6A 2RRAA 4KRWA 3PKMA 2HNZB 2GQCA 3LAMA 7FDRA 3GR1A 4RL1A 5CCMA 2M8DB 4B9VA 2MHNA 1UP1A 3KK1B 1RA6A 2ZHBA 5L1LA 1G3OA 3MMAB 4C4WA 4NLGA 1SVDA 3DM2B 2KHCA 2W4PA 3VALA 1UA1A 1YBAA 1M1KT 2LP4A 3MEEB 4ANCA 1U6FA 3FMWA 1FK9A 3ZZZA 2FUG9 1Y5IB 2GX8A 2M3DA 3QO9B 4MT1A 4TU7A 3NWRA 1QTNB 4QIWD 1SI9A 2A3JA 1L3TA 2YTCA 1SV5B 3F56A 3MMCA 2NQPA 3CJTA 1P1TA 4AUKA 1S0OA 2FTRA 4NZ6A 3KLGA 4G3IA 3KKFA 3PW5A 4QYZJ 3MM5A 3R2DJ 2MLXA 3GJRB 3HLUA 3CD7A 1HWKA 1J5OA 4DV2F 1XERA 5CYQA 1FDAA 3RW7A 3LP0B 4DPUA 5IM0A 2B5JA 3HHKA 5KG1A 2NSBA 4ZVGA 3SCKE 2G4BA 4Y28C 3CJ5A 5E2QA 4LSNB 3DLEA 4OHZA 2CDQA 2MSTA 4CM0A 1VIOA 5GAGI 3GSDA 2QA4S 3UQSA 2I8EA 3PIPQ 3M8RA 5J2NA 2CJYB 3BO3A 4MTPA 2BJEA 4JV0A 4RW4B 5ETTA 4IQXA 4B9UA 2YQ0A 3IG1B 3WBZA 4BHQA 4K4TA 2DH7A 5DG7A 5JXSA 4DPOA 3LWLA 1X9MA 4DX6A 2V4JB 2A2DA 2CQBA 5IT4A 5KFCA 1F60B 2AX0A 5A2QU 1Z2LA 3FQKA 4ZP6A 3TUJC 1NAQA 1OQ6A 3HJVA 2OD4A 4ZPDA 3I31A 3QT7A 1WNEA 4DFPA 4UOFA 3CIZA 3AB2B 2DO0A 4ZPVR 3EICA 2ZH3A 4JI3J 2HS3A 3PZPA 4LF2A 4WXWA 1F3VA 5KG6A 4IG0A 5KFUA 1XNQJ 2QMUB 4WZQA 1QY7A 3Q2SC 4M95A 5F9NA 3HHEA 4C7QA 4RW7B 4DL3A 1RT5A 3I56S 2IJRA 5A6PA 2HHVA 4LFAJ 4DLEA 4PQUA 3DDIA 3CD5A 1NMEB 1Q78A 2XSFA 3BV8A 3CE8A 3DLJA 3VF0B 1KS2A 1HIYA 4HKQA 2Z30B 3QQCD 3Q8VA 2O1PA 3KG4A 2IM1A 3K57A 3CCRS 2P9GA 4EUVA 1O5JA 3TO8A 2Y1IA 1KWMA 3GIJA 4Y2IA 3HD1A 1YG0A 2Z2MA 1HNIB 2E7VA 2Z0GA 1Z4UA 4WP9A 2QX0A 3FQLA 3T5JA 1LEOA 1XMBA 2ALYB 3EGNA 5L1JA 3VQSA 1FFGB 5A8RB 1CVJA 3GJQB 2JC1A 2EFOA 2LQ9A 1HKAA 3ILOA 4J9LA 5KFOA 2AIRB 4DL5A 2HZAA 1RSCA 1FX4A 4KY3A 1UFKA 1SC1B 5MLCV 4J9KA 1S72S 4EO8A 1V5IB 2E1AA 3M32A 4WIQA 1RHRB 2BE7D 2FHJA 5ETKA 3UE2A 3DOKB 3FSXA 2XB2D 3ICLA 5CHCB 1Y9OA 1YRUA 1UJ4A 3I6PA 4PYAA 3R97A 3PV8A 4V1Ak 2ZH5A 3QRPA 4X4VA 4RW6B 2MZ1A 4P7TA 5AXLA 2AP6A 2P9EA 2X7IA 4Z7YA 2VG7A 1JLAB 1U25A 4RUBA 3V6DB 4B3TJ 1TAUA 5CABA 3TR5A 2MKHA 1FNOA 3HT3A 2ABYA 4DS5A 3DI6B 5HI7A 1FKPA 4NEZA 4IDKA 2WK4A 5KTQA 4ZP7A 3PVXA 1FNXH 2DNPA 4IOAQ 4ZVSB 1AB8A 1FKPB 1GXTA 2MZSA 2UXCJ 2AJ4A 4DSKA 2XMTA 2PMZD 3PYFA 2PT0A 4Y0FA 2DNQA 3AJDA 3ZZTA 2WW4A 3AJ1A 4M63A 3O44A 4F8RA 2DXFA 2YKNA 4USVA 2GVZA 1M5SA 2HSEB 4CIOA 2GJIA 3CVKA 1I5OB 3BYRA 3KJFB 4L3KA 4USUA 3M2UB 2BA9A 5CA5A 2ASLA 3GIRA 2YWKA 2PSZA 2LVWA 1WF2A 3R1LA 2XMMA 2EW9A 1MNEA 1U0HA 2DGTA 2EKNA 2P8IA 3T1HJ 3PX0A 1XMQJ 3CMES 4DOZA 4IH6A 1S1VB 3KG0A 1XEZA 2HNDA 3UFCX 4CDIA 4FF3A 3MFIA 1GT8A 2V2ZA 4BC9A 1A7GE 4OYXA 4OMFG 1X5PA 3JQJA 4YOEA 1DTQA 3MM7A 1FKAF 2H4WB 1X5TA 1HBOA 1KHVA 2RE1A 3CO9A 1NSKL 3QIPA 2J0SD 3BKTA 3TX0A 3KK1A 3HJFA 1PAEX 4DU8A 1Q8BA 4USHA 3EGZA 3TW0A 4HH0A 3MECB 5SZTA 3I5CA 4FF2A 2VF3A 4EO6A 3X1LB 2LXUA 3FCHA 3V6KA 2RT3A 4F50A 1LWCA 1URRA 3V4IA 3ETMA 4FPIA 2JDJA 4PKDB 4QW8A 4LF8F 3EDQB 3G8QA 1QAXA 3FVYA 5KFIA 4OFZA 4DF4A 2CWXA 1CJUB 1UZHA 1M1GA 4PZVA 4KV8A 1JMTA 2CJBA 2M8HA 1GX5A 4YB7A 3VGVA 4A47A 1B64A 2V2QA 3PW7A 3M05A 4ZVPB 2DHHA 3W9IA 4F0MA 2KU7A 4O4RA 2H65B 3IGVA 3BH7B 3OTCA 3FRZA 4FPRA 2CPYA 2NUHA 2ZD1B 2H5EA 2E9TA 4X66F 3DYAB 1NJZA 1YZ7A 4FKXA 4DJBA 2IM0A 3A8EA 5I3QA 3OXFA 2KM8B 5G0RB 2GIQA 5LMUF 4WJBA 2KH9A 3N5BA 4LF9F 4NLVA 2XS5A 4OI1A 3LALA 3H90A 1HQUA 2GZOA 9RUBA 2LA6A 2HQIA 1BD6A 2J8AA 4B3SJ 3NGDA 2G13A 2RB7A 1NJIT 1ZAWA 4OZNA 4A8OA 4ECVA 5HP1A 4LVOP 3EZ5A 3MAQA 4DWIA 1T9UA 1B4SA 1N5YA 2HWHA 1R31A 1D8ZA 1XK8A 3AT1B 3IBFB 2UVRA 3RW6A 1TKXB 2LXIA 1UKUA 3QPIA 4TY8B 3RRGA 4DQIA 3OVBA 2AMCB 2DGWA 3JTPA 4U8VA 3GJTB 1CJKA 4MKVA 4A8YA 3IR5B 4OL8A 2CPIA 4NASA 1VQOS 4P7VA 4YUDA 5H9FK 2GHWA 2AF6A 2B9EA 2BZ2A 4CLWA 3OFHA 1SQEA 4ZPBA 2K7KA 3S01A 1S9FA 1RTIB 1UEUA 2AJ0A 2F5GA 3W9JA 1ZTTA 4CYUB 3MGJA 1WWHA 2AEJA 3NRBA 1PCAA 3VGSA 3LGMA 2K3KA 1C1BB 1SC3B 1F3FA 2ZM6F 1QVGR 4OYZA 1H2VZ 5IV4A 4USKA 5A8WB 3CCVS 2DNHA 4MK9A 1LNQA 2KRBA 5DDRC 5FDLA 5A6WA 3O8WA 2OEMA 1ZPWX 2N7CA 3A8KA 2MKCA 1HNIA 1U1PA 1YJNS 2H54B 4FXDA 1B0TA 1Y4ZB 3GYXB 1FT8A 4I67A 2XMKA 4B9NA 1CSJA 1AFIA 2YNGA 2HS0A 1MU2B 5DLFA 2QA1A 4PG5A 3PEHA 1CC8A 2MKYA 4OI6A 3KJVA 3GR0A 1S1WA 1CULA 2EFNA 4OI2A 3W66A 4AQYF 5LL6d 5I3UB 2CUYA 1RAIB 2CJQA 2MEWA 4ID8A 4NPOA 4KR0B 3OXLA 1ZTWA 3MAAB 1YI2S 3NY0A 3CNQP 5HSPA 4B9LA 5A8KB 1FE4A 3N6MA 2DIUA 1WOOA 2ACYA 2V8GA 3B4MA 4X4OA 4O44B 4U8YA 4XPEA 3H5YA 4BBYA 2RU9A 1T94A 4AFFA 3EE3A 2BOPA 1FJGF 1J5OB 1FRMA 3IAM9 4FYXB 1RDRA 2YNFB 4PG4A 3BSCA 3LPEA 3KLFB 1RT7A 3G87A 1H2TZ 3D6FB 1RTJA 1KRPA 5DM6Q 1Q5VA 1L3KA 2GJ2A 1F1BB 2EFVA 3QBCA 2DHXA 3RRKA 1T3NA 2ZDPA 4BWMA 4NLDA 1RAJA 2OI2A 1YDLA 4PR6A 5K8PA 2LXFA 3RYLA 4D3HA 1XR6A 3RUBL 3BR8A 3TOQA 3T1AA 3SCLE 2HZVA 1XN9A 2FGCA 2NXJA 4X66J 5C42B 1UEVA 2AGOA 2D3UA 4LMZA 2I0XA 1U0HB 3AY0A 3U1NA 2IA0A 2BW2A 4A8WA 3D67A 2V5HG 3CJQA 1WSRA 2P5VA 4JI4J 1IN0A 2W4DA 3LANA 3DOMA 4LSZB 5K9FA 1JQGA 1RWUA 5J1EA 4O3SA 1NHVA 2NCKL 3C6TB 4WK1A 3J80Y 2ZC3A 3DRPA 4MAKA 1UPPA 4TQSA 5DO2A 2FJVA 2K7JA 3E2EA 1NU4A 4X65J 3LP2A 1JLFA 3CC2S 2HHWA 2HAIA 2QYGA 1UW9A 3TVYA 1IR0A 2OPSB 2BKOA 4KB7A 4C11B 3TZXA 1I1GA 4FS2A 2J6UA 4I0WA 1HR0F 1RP5A 4KIAA 4C11A 3MDFA 1F9HA 2ZH9A 1NKBA 4YDXA 1FJEB 5K8OA 4M5GA 3NBPA 4A4JA 4NMLA 2YNIA 3QGGA 1VRUB 4DV6F 3LF0A 3MECA 2NREA 2UUCF 2EKYA 1T9YA 2R7TA 3BKUA 3SSRA 1RT6A 2IHR1 1I6JA 1YVFA 2ZM6J 1E6YA 1OPZA 1IM4A 3CULA 4CLUA 4KBIA 5K5MA 4WFBQ 3UD3P 2LEPA 5DG9A 4DQQA 3DC2A 4DSJA 3R2CJ 1FWKA 4F2RA 4HVZA 3LW5C 1X0PA 1N56A 2W2QP 3RBZA 2JRSA 4EYHB 1VQ9S 1R8CA 1EP4A 3AA8A 4EYIB 5J1NA 2UUAF 3WHIA 4FYVB 4BC7A 5L1KA 3Q89A 1JLEB 2KT3A 1IXKA 2D69A 2I9SA 5G0RA 1S0MA 5CYQB 3N5FA 3ILIA 3OXGA 2G0JA 2I5JA 3CJSA 3SSQA 1ROFA 3THPA 1HMVB 4MK7A 3AAWB 3T9ZA 1NXIA 3Q22A 4U67Q 4KO0B 4KPCA 2OHDA 4JBCA 3M9OB 4DR2F 3KG1A 3B6BA 5BYRA 1UVMA 4UW2A 1UTAA 5HBMB 3EPGA 3HVTB 3PX4A 2DGOA 4H4MB 4FYWB 1G2EA 2OSRA 1QUVA 4KKOB 2IJNA 4TU9A 1G1XA 4JI0F 4I7FA 3H25A 2C3OA 2CZVC 1UWBA 2B4UA 2RF2B 2KI2A 2FB0A 1JXLA 2LQBA 1WC6A 2CZ9A 2ZUGA 3AJ2A 4HDGA 1C0TA 5KFYA 3R5DA 2HZCA 2OJ3A 4OI0A 2B3TB 5KFGA 2JEGA 2H4YB 4OI4A 5CAAA 2XULA 4CH1A 3RZAA 4ILMA 4ZP9A 1IJFB 1AZSB 2IA6A 4LBPA 3BREA 4F0KA 1TK5A 2R7OA 3TWZA 2IRUA 4UUXA 4RUAA 4FF4A 3R6GB 3ISNC 2ADCA 3ENAA 2FVCA 1XWLA 4DR4J 4FNHA 1WDDA 1NDCA 5H1SV 3N4WA 4KTQA 1X4DA 1LW0A 3RBXA 2J76E 1LWXA 2DNNA 2LQ5A 1JLBB 4QIGA 2YBVA 3J81j 1VQPS 3Q8UA 2FD2A 1P8GA 4WK3A 1RYSA 3CGIA 4I6YA 3D6TB 3PJXA 1DARA 2EG2A 3ZNJ1 4A8QA 4KE5A 5HN0A 1X4AA 5L46A 3BGRB 1KTQA 4DQRA 2F7VA 3SV3A 2B51A 1EQMA 4ZMMA 4URGA 1NK7A 1BLUA 1CLFA 4LFAF 3QIDA 3TA0A 4ER8A 4J9QA 4B3TF 5HATA 3HI9A 2DYAA 2W4CA 3L3CA 2Y1LB 1X5OA 2BEFA 2AYEA 2MZTA 2ZOMA 5HVHA 1NKCA 1IR2A 1QLNA 4O0NA 4ZCLA 1WTFA 1HWLA 3MAHA 4QBUA 2PA8D 4E0DA 1VBZA 3GP9A 2MPUA 1K9MT 1JLAA 3LOUA 1VQ8S 2FJEB 2GFFA 1WG1A 3MM8B 3FNNA 2ZE2A 2HW3A 1YRXA 3DU5A 2FVPA 3BR9A 3VAHA 1RT7B 4UOCA 3TVZA 1U8WA 2BW7A 2HFSA 2X3GA 3FEZA 1X4CA 2VPZB 4WCEQ 3GIKA 4EBCA 2CDRB 2J9DA 1P6TA 2FHJD 2WSEC 1WJ9A 3OD2A 5AXKA 5GMDA 4OIXA 4N7TA 4CT8A 1RTJB 1TK8A 1O6XA 3FFIA 2GA7A 3L09A 3TZWA 3G8TA 1SCJB 1Z1ZA 4DV1J 2BJDA 2HKEA 2DHGA 1YLXA 3DRXA 4DR7J 1JB0C 1PKUA 2HQGA 3FFIB 3D3CJ 3TP2A 4ZKAA 4JI5F 2BBEA 4OYOA 1K1QA 2EFQA 2FC9A 4DV2J 2CQ3A 4JOUA 3MM9A 4TY8A 3GIIA 1QAYA 4C0BA 1NB2A 1M5OC 2MQLA 3MM6B 4L76A 2BXJA 1V6HA 1V3ZA 2EC2A 1LWFA 2R4FA 3C8YA 3POTA 3R7NB 2F65A 4K4SA 1KVKA 2MKSA 1XC9A 1HNZF 4F4AA 1IKYA 1S9GB 5IWAJ 2C2EA 3ZZOA 4GO7X 1OSDA 4O3NA 3UW1A 3ZTRA 4K8RA 5F8NA 4TQRA 1EQ0A 1YGYA 2BUNA 3WC0A 5T7LA 4DHVA 2J9CA 4DG1B 2OEJA 1SQFA 3E51A 3HSGA 4X62F 3G82A 3OVAA 1RQ0A 3K59A 2O01C 4DN9A 1SKUB 3CSKA 4WFNQ 3W9HA 2IY5B 2UVWA 3DOLB 3ULHA 1FDBA 2NZ4A 1DLOB 3GFYA 4ILLA 5CYJA 2ZZNA 3NS5A 4DDFA 3M2RA 1ZOTA 1U09A 3EDRB 1X7VA 2CKWA 3BGUA 4QJVA 2J6TA 2HHSA 3OR1B 3EGVA 4J9UE 3OW2R 3PR4A 2AU0A 1MU2A 2QZ8A 4Q2MA 2D1CA 1NJXA 1TKDA 1N6QB 3CCWA 3OTDA 2HFVA 5ETMA 4RWWA 1S1TA 2XMAA 4K4XA 3FSYA 1LWEB 2UUTA 2B9YA 3IAS9 4PABA 1NM2A 3TVKA 3R7BB 4DQSA 4LF1A 4BCAA 3T6JA 1O0PA 3H2VE 4F26A 4F36A 4CO4A 2QEXS 1DQ8A 4JV1A 3DYAA 4ETZA 5IQ6A 3GYNA 5GAHI 1QD1A 4ZCIA 1DQAA 1G4CA 2DCLA 3A4TA 3KHHA 3CW2C 2V8DA 2OH2A 1TFYA 4GVBA 4HTIA 1R6YA 5JJBA 3V6DA 2V2VA 1MW7A 2JC0A 1DAXA 3B78A 3HD2A 3P5TL 2KO1A 2MLYA 4NZ0A 1LOUA 2BKPA 2VFVA 2VASA 2DGXA 1X4GA 3D66A 1D3WA 3HVTA 4J9NA 3OTBA 4NYOA 1T0TV 3MMBB 4DR1J 1U4BA 4PUOA 2IC3B 4RNFA 1DZ5A 1GMWA 2IJFA 3CJ3A 2WB4A 2XHWA 1UJ6A 4KKOA 4B17A 3UD4P 3U7JA 4B9MA 4ED8A 4K0KJ 1N5QA 5DLGA 1S4FA 5B0EA 3UO0A 1QDUB 2MJUA 1UZDA 3FUYA 3AD8C 3TAMB 3RB3A 2VHGA 5L8RC 5LXRA 2MY8A 3KHLA 1KLMB 3WX4A 1S76D 3FEYB 1IKXA 1RWVB 3CB4A 3MEDA 1JLGB 4K59A 4ZVOB 4DR6F 3D9BA 1B0VA 2DNZA 1RJJA 3BDEA 3I4PA 5HMWA 4DMZA 4YR3A 1XIQA 4RNHA 1PYTA 5C25B 4R5PA 4MYTA 1AA1B 1B99A 1WKLA 2BV3A 3MPUB 5L39A 2P6TA 1V3RA 1L3VA 1IR1A 4NA3A 5F9LA 1CJTB 4ECWA 2WVFA 3OHBA 2C2OB 4TKTA 3EPIA 3BBCA 3ELHA 2AEMA 2ZNYA 1HNVB 1IKWB 3D5MA 4PG8A 3C14A 1RXOB 4WKYA 5KOXA 1IQZA 2CPXA 3PYGA 3T5HA 4R8UB 1HNVA 2MKKA 2R7UA 1RGVA 1VMBA 4WYLA 1WD6A 4ECXA 1FF2A 1HPZB 1RTHB 1U1KA 3T5LA 5C2GA 1VRUA 2DR7A 1LWCB 2DH9A 2RAQA 4E2FB 3DMJB 1VIXA 5J2PB 2WSCC 1QM9A 2XS7A 2VBXA 2VODA 4CO2A 4P75A 2W01A 4R0JA 3ILJA 4LRFA 3OTOF 5K8NA 1R0BG 3QLHB 3MCSA 1R6VA 2YX4A 4USWA 2GHPA 4JI2F 4GMKA 4NRUA 1Q53A 5C24B 3PEJA 3V81A 1H7XA 2HQDA 3WC2A 3Q83A 2GQQA 4UOGA 1T02A 1TFWA 4K4UA 3BS9A 1CG2A 1EP4B 4HHHA 4NXMJ 1NHUA 2YWGA 5JMNA 3H40A 1QSSA 3M30A 2VA2A 3NNCA 3VWSA 1MN9A 2G2OA 4KSEB 1RYRA 4QCLA 1NK4A 3VZHA 5HANA 2LLZA 3SQGB 2MXYA 4BDPA 2LU2A 4ZPWR 1VR6A 2DO4A 2L9DA 2UUWA 4YHHJ 1RUSA 3R9LA 3TZZA 3SI8A 4KPYA 1YX2A 4LBIA 5RUBA 1UVIA 1APSA 4LT6A 4ZN3A 1KNZA 1SXLA 5KFNA 1WUUA 1N32J 4M5HA 2QIFA 1GXLA 3R27A 3BN4A 4IFYA 2C2NA 3HKWA 4OHWA 2I6WA 3MR3A 3SCIE 5DQGA 4NCBA 3TQ1A 2ZBCA 2UP1A 4QU6A 1F2GA 2ZBIA 4PPDA 4FVCA 2KYZA 3MM6A 4Y2AA 3OSNA 3BDPA 5BXIA 1U45A 2L48A 5KT6A 1PAUB 1WHYA 3HVAA 3R8YA 2C28A 2K2PA 2ATCB 3DGPA 3DRRA 4MKAA 1IKYB 1S9GA 3MFHA 3C3LA 3IWNC 3UDVA 2O3DA 2W9BA 3VTIA 1C0UB 2HBQB 2ZH1A 1ZS6A 5LJ5Y 3C15B 3G82B 2EPIA 2OPSA 4JI8J 2E29A 4YB5A 2NS1B 3ISZA 4NZ7A 2JH3A 4P2XA 4TN2A 4WU3A 5BYQA 4C0HA 5I42B 1L3UA 1VDHA 1KKHA 2R7QA 3P6YC 4ZJOA 4OJHA 4W90B 4C8LA 4OLOA 4AL5A 2RDJA 2K06A 3CD0A 4KJIA 2NPIA 4WE1B 3L9ZA 3CCJS 2OKQA 4MFBA 4ZPAA 4P72A 3Q8PB 2UVVA 4EMDA 1Q7LB 4U9RA 2PD1A 2NXUA 5F3ZA 4J9RA 5J2MA 2JHEA 1Y5NB 4FP9A 3TA1A 4DS4A 3HFZB 1WC5A 1U1NA 1N32F 4X4UA 1VJWA 2VBZA 4ENOA 4B3OB 5IC4B 2KB2A 1DRZA 3WDOA 1J5EJ 2GMJA 3HHLA 4QOTA 3D6MB 2B8PA 1PIEA 5LM7E 4IG3A 4YY3F 4L75A 5FD1A 3EX7B 1K47A 3IS9B 2EK6A 2JWNA 2DGVA 3KK2A 5D4PA 2Y9HA 3BQ2A 3GQCA 1UAWA 3PJWA 2V4QA 1JNZB 2PA3A 2RILA 3HT0A 4U6PA 1U48A 4NYZA 1S79A 2W9CB 1NUEA 2VQEJ 3JTOA 2FHKA 3DLGB 2R2TA 4J90A 5B0GA 5EWGA 2BQRA 1FKOA 3IR6B 2MLZA 3QSIA 3W8PA 3DLGA 2B43A 1QSYA 3H59A 3TAMA 4OX9J 3PRVA 4PG6A 4FYYB 2ASYA 1HI0P 1MLAA 4QIFA 1T05B 3PXGa 3V5RA 3GFXA 3EUNA 3Q8YA 4RU9A 2J7WA 3I55S 5EDWA 3A8JA 3BSOA 3G6XA 3P5BP 1LV5A 2RS2A 3MXHP 4X2BA 3IRWP 2RF2A 4MIBA 4RBVA 4EU0A 1HWJA 1NB7A 1GEHA 1HWIA 4IG0B 1JJ4A 1RBAA 2QLJB 2KRRA 2VD3A 4I7FB 2F1FA 5GAEI 2MKIA 3OSPA 2CJKA 2AWZA 1KLNA 5CZVA 4KH1B 4LFCF 1BY9A 1IBLJ 1C1BA 1SUQA 4NI2A 1XJWB 1DQ9A 1TUGB 1TV6A 1VQYA 4LRCA 4NI2B 5ETSA 4CCHA 2BOAA 1T3OA 4H54A 1S77D 5D0GA 5HMZA 4M94A 2F63A 4C8MA 2HNZA 3RAQA 3AXKA 3VVUA 1EKRA 5DZ7A 1JWWA 1C1CB 2DISA 1T9VA 3ILLA 2XS2A 3W5YA 2VBWA 3GYGA 2BE9B 3BGLA 3GU0A 4P9SA 4CWBA 5DETA 3M8PA 3TAPA 1HI1A 3C6UA 2VOPA 3KTQA 2L08A 3MEEA 3DLKB 3KLEB 2HRTA 2ZBQA 2MZQA 1R43A 1S12A 2L9WA 2L41A 3G4SS 1SV5A 3MMCB 1ZAVA 5AJ3F 2X3DA 2IVMA 1X4BA 3OT9A 4ZP8A 3TAQA 1RWXB 1VRTB 3QFWA 3CTRA 1ZA2B 2DNOA 2JX2A 4CO3A 4NXNJ 4MH8A 2HEKA 4GKKF 4NWBA 2PDAA 2CRLA 2HMIA 2VG7B 5CYMA 5HVFA 4JI5J 4WFZA 3BSNA 4CLFA 3R3TA 1U49A 4C8NA 1S6PA 3HM9A 1K73T 4JI2J 4IUFA 3QT8A 4M5DB 3UDEA 1CS4A 3P45B 3RJMB 2ZWOA 2E5JA 2GV1A 3M8SA 2M0GB 2HGNA 3DRSA 5HAOA 4DPTA 1N5TA 3DLBA 2V9KA 1GH8A 1RT2A 4NEYA 2GIRA 1KOOA 1Q16B 3A3OB 4XDCA 5KFFA 5AJ3J 1UPMB 3U02A 3LGHA 3CPWR 1EAYC 2KXFA 3ZC4A 1N8RT 1Y11A 2ZOFA 2MTLA 3HHDA 3DFEA 4DF8A 2DY1A 3M2UA 1IJEB 1YKWA 3FZ2A 3MMBA 3NS7B 2XY6A 1LQ9A 4OX8A 2YPZA 2OAUA 1RCXB 1T8EA 2DRAA 4DN0A 2OO4A 3QATA 3K5MA 2QLBB 2FY8A 2XI3A 3N9UC 4DLGA 5DZ6A 1RTDA 1OSCA 2CYYA 1UWBB 4F7VA 2VC0A 4KGXB 4OX6A 2RS8A 4DX7A 1HLWA 3FRYA 3ENWA 4M1KA 4LF8J 1I3OB 1U2FA 1X9SA 3PDNA 2ZZMA 1RISA 1O8BA 3HSZA 3DLHA 1TL3A 3QYYA 2WVDA 5E0OA 2HNYB 1HNXJ 1KTVA 2HGLA 4DX5A 3ETOA 2N82B 2H5JB 1LXNA 1NO8A 2HPUA 2KDOA 2IAJB 4DG1A 1WTBA 3D54A 2MSSA 1TK0A 2GQ2A 1NDLA 3I82A 1TKTB 1WG4A 3KMSA 4MIWA 5I42A 1QE1B 3GG0A 2WW8A 2XY5A 1IQTA 2RVJA 1EJ7L 3DOLA 1FRHA 2DD8S 2IVYA 2LCWA 1U47A 3E3XA 4J91A 5D4LA 4DFKA 2Z2ZA 2VONA 3Q8RB 5CH7B 5B0CA 3CJ8A 2XLIA 5KG0A 3BBBA 4X4SA 3HFVA 2LYVA 3KLVA 1S1TB 4CLYA 1NCLA 3GB0A 3MCNA 1FJGJ 4QWCA 4I56A 4QW9A 3KUGA 4P10A 2EFPA 3CJ2A 5KFJA 4AXJA 2XLJA 1B70B 3HHLB 3I9ZA 4JI1F 1B0PA 2EG1A 2AT1B 2XCPA 1SJ3P 4EBEA 2OIHA 2VUGA 3HSDA 4DPWA 3H2LA 1WI8A 5AXNA 1VJQA 2NXNA 1XBWA 5C24A 4CLSA 1VGYA 1VHFA 4ZIWA 2DR8A 3Q0AA 3I0SB 4Y6IA 2MB0B 3OL8A 1WELA 4WKRA 2D3OR 1KSPA 3MM8A 3IGNA 1WEYA 3OTEA 1VQNS 2W24A 1F2HA 4ID5A 1SL2A 1CQNA 2UVUA 1PYSB 3VAMA 1JXVA 2FVSA 4ID5B 3MMJA 3QWUA 2KKHA 2LFVA 4CLLA 3S6EA 5A0YB 1JLQA 2BMBA 4F4WA 1HBUA 2FGOA 3CJKB 3J7Z5 3LA0A 2RH3A 2VV5A 3D0GE 3IWXA 4Y34A 2PI5A 1HQ2A 1RAGB 2B0GA 2GC8A 3BKFA 1FVQA 3R5AA 1PJ7A 4P6QA 4CO1A 3SYZA 5B0FA 4KFBA 5D4OA 2XSJA 2CNOB 3SDEB 1EZZB 3SIPB 3UWTA 2B6AA 2AGQA 1AZSA 3R5BA 1FX2A 2MQPA 4DR7F 3GLJA 1SJFA 3FC9A 2NPFA 2HYIB 1SKRA 5K14B 2YKQA 4I4BA 4O3RA 3HVRA 4HHUA 3I5AA 1TTHB 3P96A 2FDNA 3RB6A 1BE4A 2YWEA 4LF7J 4C98A 4ED5A 2BACA 1VC0A 2FLPA 3DGPB 2ZNZA 1XQIA 3DRRB 1LK5A 2ZC4A 5H9FJ 2M52A 2GS8A 3FBBA 1REGX 2IVFB 3PG9A 4I1TA 1SJQA 2PGCA 4RKUC 4R8UA 5KG5A 4ECSA 3IXQA 2DCUB 4ED0A 5IT0A 4OV6A 4GO5X 3DMJA 4K4YA 4ZPCA 1OY8A 3MMAA 3BB5A 3CCUS 1GX6A 5J2PA 3AH6A 2C2DA 4LF5J 2NR0A 4FN5A 5HO4A 2V69A 4RUCA 4B3SF 4KV8B 5F41A 2DB1A 1IM6A 3MUTP 1HHQA 3UNGC 3PJ9A 3TX8A 2ZWPA 1V5VA 2ZOGA 3B8HA 2MZJA 4LIWA 1ZM9A 4OYMA 2Q3PA 1RAFB 4WTOB 4Q45A 2PE8A 5GADU 3EGWB 4OZ1A 3Q8QB 1KVJA 1N36F 2JFDA 2VPXB 2OD6A 2ZD1A 2UV8A 4M5LA 2N7YA 3IS9A 4K5SA 4NLUA 3KK2B 1JIHA 5L1IA 4ZCMA 1E6VA 1FDNA 3R7SB 4ES2A 5IS2A 4B3MJ 4UY8T 2R7VA 2AX1A 4QWEA 3AXMA 2MQQA 3CJRA 3HULA 2AJQA 2N3LA 3IG1A 4QWAA 4CO0A 3LQVA 3DGVA 2DITA 4QYRA 3OTOJ 4KQZA 1AFJA 4I6WA 4C9DA 2F8EX 3MI7X 3D2WA 3GCWP 4GC7A 3CF5Q 3IM9A 4YP3A 3O1LA 3U1LA 4G1QA 2UUCJ 4L74A 4P71A 3A12A 2E66A 4J5OA 4JV5F 3EM1A 5J1EB 1U2CA 5T14A 1RABB 4IRDA 1K0VA 5HLFB 1SBRA 3VZIA 4FKYA 1X4FA 6FDRA 2OEKA 3S8SA 1N52B 4ECRA 4P73A 4K0KF 1MMLA 4PRFA 2VC1A 2B4VA 1D9FA 2KYXA 2CNLB 3KJNB 2OELA 3GG1A 1SUQB 3QGIA 8ATCB 1S6UA 2POKA 1NK5A 2VL1A 4WF9Q 3RAMA 4DL0C 3W1YC 1NH8A 4ZITA 2H3EB 2JNJA 1VISA 1CC7A 4OHXA 3PX6A 4EZ9A 2XNRA 1HBMB 4C3KA 2OMOA 2LEAA 3A8IA 1DLOA 1FEEA 2D74B 1Q95G 2AJ2A 5HVGA 2UU9F 1N33F 4Y2CA 4USIA 3IRXA 1BWVA 4A8KA 4FF1A 1Y3JA 5ETQA 3AD7C 3OR1A 2ROPA 1V9OA 1M90T 5K20B 4V19X 4DV5F 5HQ8A 2Y0SD 1R8PA 2BJ8A 3C6UB 1P9QC 4ECQA 3QT5A 4C3LA 1OY6A 1RHKB 4NA1A 3OUYA 3RBDA 1JXEA 2RRNA 5I3UA 4L6V3 2XLKA 3P49B 1PG5B 2CJAA 1FD8A 2E1RA 8AT1B 2YWWA 1CULB 4ZS6A 4YS2A 3MAAA 2XEXA 3CJ4A 5FIIA 2XZWA 3HX9A 4OZ0A 3EZUA 2PFFB 3FEXB 1TVRB 1K1SA 1UVJA 3NGTA 2XM3A 1S0NA 3R1HA 2VG5B 1RWMB 4ZHRA 1IBKJ 4EK2A 3CCSS 1Y3KA 4N56A 4KGVB 1WORA 1YWXA 3CDEA 3ZTSA 2UXDF 3JYTA 4KYZA 2J9EA 1S6QA 1UCNA 4OHVA 3I0SA 4J9VA 5M2PA 2ZE2B 1GK8A 2MYFA 1VK3A 3BF4A 3OJUA 3HHLD 3OR2B 4CP5A 4GVLA 2YNFA 2K1RB 2M7SA 5A0YA 3CO0P 5LSLA 3VAFA 1YTYA 2WVBA 2YX1A 5CQGA 3O3LA 1RLCL 3GZ7A 1RT2B 1HD0A 1CJVB 4ZIVA 5IWAF 2V63A 2ZFHA 2C2KB 1HBUB 4PXDA 4NLWA 1CJVA 4NLTA 5ETOA 2UUBF 3T6BA 1DURA 4KFBB 4DV6J 4NLSA 2YKMA 2BJ9A 2NXCA 3UN5A 1OYEA 2VIHA 1HNXF 2U1AA 4RBUA 4B9TA 4ES3A 3W61A 5GAGU 1EETA 1S1XA 2FZCB 4UF4A 2CNKB 3OFFA 1S48A 3POTB 4N8OA 4ZK7M 3W2WA 1RWNB 1GXUA 2BE2A 4EBDA 2RRBA 4IH5A 3KHRA 3RRHA 2BDPA 4HT7A 1NKEA 2IMOA 2HK3A 2JVRA 3SFGA 4OJ1A 1RT1A 1WC4A 1HWUA 1YRTA 2QLFB 4AT1B 3JQKA 3THVA 1VBYA 3MUMP 3CCQS 5DDQC 1H0HB 2E1PA 3AQOA 1PBAA 4LBHA 4JV5J 4M8LA 4XTTA 5KT4A 5T7LB 3J7YU 2ADBA 3HHNB 2KM8C 3DLKA 4ANEA 1S99A 2BM1A 3IO1A 4KHMA 4QIEA 3UCGA 3PKYA 4ETXA 4JI1J 5DQIA 1Q7YT 1S1UB 1NPRA 3D3BJ 4ED1A 3MOZA 1S1UA 2AW0A 4X65F 3AOBA 1XNRJ 3DU6A 2C1EB 2RQ4A 3H7HB 4A8XA 3MR5A 1SH0A 3KLGB 2MGZA 3EVOA 1VQSA 3SFUA 5BYSA 2C2ZB 3KLIA 2KG0A 2HVEA 4IR1A 3JAMY 2DEJA 5GMKa 3HXMA 1OPIA 3W5XA 3MOJB 3N01A 4B3RJ 2VKZG 2QRRA 1KOHA 4A8MP 4ED2A 4YR0A 3JQMA 4RJVA 1Z2ZA 2PMWA 4LSNA 5CYMB 4CO5A 1PBUA 4OYPA 3LP0A 2ZVIA 4ED7A 1HARA 3K2YA 3J81U 3M4XA 2YH0A 2G9OA 1ACMB 2LQ8A 1R8BA 3DLEB 4F3MA 3G6YA 1CS4B 4OI3A 4P74A 2Z4PA 5KG7A 3DRSB 2DXEA 2IRXA 3OFGA 5FLXY 1KQSR 3TYTA 1VQ6S 5IT9Y 4P52A 1EX8A 3CCMS 4N8NA 3S7RA 2ZJPQ 1VQMS 2EXUA 4DL4A 1IBCB 2KT5A 2FPHX 3M6XA 2HHXA 5KT7A 4M5JA 1ZAXA 3BH6B 1NBEB 2FYXA 1PO6A 3NXZA 2FLLA 3MF5A 1NDKA 1H38A 4QR2A 1TQLA 2E5IA 1MMNA 3P8BB 4EZ6A 4Q2LA 3L95X 1IKXB 3MEDB 4KHPF 2HLTA 3OL7A 1D8YA 1FE0A 1N88A 4ELTA 4LF5F 2WONB 4DBQA 2XNQA 3LH2S 2FLOA 1CEZA 1RT3B 4Q0BB 1TL3B 1NK6A 2OGUA 2J9DE 4C48A 4Q0BA 3IBWA 4PXBA 4YDDB 2EBEA 1WHXA 2R2SA 2QGFB 2HVIA 1DFDA 2YWFA 3HK2A 3CJ0A 4WE1A 3IBCB 2UXBF 2RHSB 4JUZA 7FD1A 1P27B 4G6VB 2FJAB 2A10A 1BQNA 3ISND 4LR7A 3OV7A 1ZETA 2XMVA 1FD2A 4DV3F 1H73A 2YNGB 2ZJRQ 4MYUA 1OS5A 2WCXA 3FJ2A 2W8LA 1TL1A 1FVSA 4H4OA 2FJXA 2CPDA 2QT7A 3G71S 1NJYA 4HHJA 2ZKUA 2BJ7A 4NXMF 3QFHA 1LKZA 5B09A 1LW2A 2Y3YA 2RJZA 2B7BB 4WWSA 2XYGB 4HYKA 4MKYA 5IC6B 5KFDA 2I5JB 5A8KA 2EI5A 3FCWA 2ROGA 3N0VA 1U1QA 2MHEA 4GKJF 3H5UA 4Q8FA 5D3GA 1R89A 1LXJA 2M5YA 2NYHA 4ZCKA 4HL9A 1URNA 3DI6A 4NXNF 4DFJA 1T9WA 2AZ3A 2CPFA 1N48A 3H0PA 3M2VA 4ECYA 1T05A 3UVJB 1IBKF 2UUAJ 3NNAA 2IC3A 1YJWS 3OR2A 4FDFA 3T3FA 3HO1A 2DNGA 3CDUA 4Q7AA 4DFMA 1AUDA 1WACA 3MTJA 3OHAA 1KC8T 1P9YA 5L38A 2DNYA 2GMHA 4HDHA 2BR0A 1T7PA 1N4LA 4UY85 4YN3B 3PO4A 3LAKA 4DL6A 1VHIA 2F4FA 2IPOB 3GFZA 5E7OB 5SUHA 7AT1B 4ZLJA 3AB4B 1RU1A 4LFBJ 1N54B 3E01B 5DJBA 2RMLA 1RCOB 1GTEA 2YNHA 8RUCA 3KDNA 2IM3A 2FJBB 4KT0C 1PC4A 3SEOA 2B7CB 2N4CA 2W9AA 2KJVA 4E98A 4XO0A 2E5LJ 5KFRA 2F4VJ 5E3QA 2MDAA 1RT1B 3VVTA 1MN7A 2L3MA 3ZO7A 5D0HA 4AD6A 4DSLA 1WC1A 3NGRA 2WRMA 1CQMA 3DHWC 3LP1B 5IQQA 1HD1A 4WTYA 5GADI 1PC5A 4ZVTB 4DR5F 1HW8A 2DIVA 4ECUA 2V6AA 4K2XA 4KHPJ 2XBPA 2Q6CA 3QNWB 4DXLA 2DNMA 5F8HA 1FJ7A 1AW0A 1ZZFA 1HPZA 4RW9A 2QN6B 2WOMB 4OLPA 1RKJA 2J8SA 3CWJA 1FXRA 4LF9J 3PRBA 3WQPA 2D9OA 2WOMA 2FJWA 2CVIA 3MHYA 4JP8A 2KTQA 3HP6A 2HS4A 1R27B 5DS7A 5KFPA 2V34A 4JV2A 3T1HF 2VH7A 4IRCA 1NPPA 1FHTA 4NLYA 2OSQA 2AJFE 1EKSA 2I38A 1TL4A 4Q5VA 4LRBA 2XMUA 4IRKA 3A3PB 3M7VA 2QG9B 3AHPA 1X9WA 5I4MA 4ED3A 4PWUA 1DTTB 3M1VB 3CC7S 4AL6A 1S6PB 1SIZA 5KFMA 2LA4A 4TVAB 3HFKA 1RHMB 2C3PA 4A48A 3LUYA 2VG5A 4J37A 3AD9C 4ZHRB 2YPYA 5IV3A 3KYLA 2F8HA 4Z37A 1KP6A 4ELUA 1G6BA 3CIMA 1YSJA 4AQYJ 4B3RF 4J7CA 2HAFA 4DV4J 1HQUB 2OPPA 3ET6B 3MR2A 3K5LA 2QMWA 2RDDA 3JSMA 2QMXA 4GKJJ 4HH1A 3AFGA 4QIVA 1F5BA 2IDEA 5AXMA 2ROEA 1W2IA 3JSMB 2HK2A 5HJYA 2NZCA 1HR0J 1N0UA 2WVEA 4CTAB 4GRSA 5EN1A 3D7SB 1A9NB 5EGYA 3J7ZT 1RTDB 1DJ0A 3C46A 3F44A 4DZDA 1T9TA 2CPHA 3NCQA 4F04B 3HCXA 2W7PA 4FXWA 2WVCA 4QZVB 5DGBA 5E3AA 1FRJA 1XR7A 3EVMA 1RTIA 1Q4RA 3I0RA 3BM7A 4M5NA 1QAJA 2QL7B 4Q43A 1BGXT 2GO8A 1JKHB 2CQHA 3A13A 3IC1A 3MTKA 3NAHA 2YQ1A 4F67A 3TEHB 3BPSP 4ZLLA 3UN3A 2YKAA 3SZ2A 1NEEA 1IBMJ 2I2YA 1XNQF 1U6BA 4X84A 3L7OA 2MQOA 4RX6A 3OFEA 1UETA 2AYMA 2VB6A 5C25A 4R5PB 4F4XA 2DPIA 4I68A 4ITSA 2XWXA 5FDLB 4CRJA 5KFAA 2PN6A 1RWOB 5HL7Q 3I5BA 4DV7J 3RR8A 3VHQA 2F4VF 2NLWA 1V3SA 3NP5A 1WC0A 2G2ZA 4Y65A 3V6HA 3E8OA 2GO9A 4EGLA 3SCJE 4F0HA 3NAIA 4YQWA 4NLQA 5CCLA 1X8DA 3BZQA 1VC5A 2AGPA 1OY9A 3O5TB 2Z8QA 2NXEA 3T41A 1SJ4P 2QSFA 3C16A 3I32A 3DXBA 3QLHA 2XC9A 2V8PA 3PW2A 1R0AA 4V19J 4PWWA 4DL7A 4H4OB 4ZJLA 4Q8EA 4KH0B 2AYGA 4C8YA 3HZEA 4RZRA 1FERA 1VC6A 2O5DA 4O4GA 4OZ3A 3F73A 1WF0A 4Y3CA 1VRTA 4Z2XA 4UUWA 3TJ8A 4TY9A 5DG8A 2A6OA 4NL5A 4LSLB 1HNWF 4CLPA 2YH1A 4LSLA 2DT9A 2HBZB
chains in the Genus database with same CATH topology
4RLEA 4YFUA 2XO7A 2MKJA 4F4ZA 1SC6A 1JLCA 3D28A 1AROP 2DNLA 2K1RA 2E9RX 4OX9F 2PMHA 4IO1A 4TLQA 2BQUA 4MIAA 2YKNB 3UCUP 2HHQA 1H2UX 5M2RA 2J7KA 1M0SA 4OJ3A 1HA1A 5DRKA 4NYPA 5IFMA 4LIRA 3UDCA 3MPWA 2C22A 3ITHB 2BYCA 2P9CA 2Y1RI 3QAEA 5K14A 3C46A 3F41A 4BS2A 2Q66A 2J5AA 3IR7B 1M5PC 1UVNA 3VAGA 3MPYA 5B08A 1L5UA 2GNKA 1FA0A 2F3JA 3PFEA 4LFBF 2BQ3A 2R7WA 3QJJA 1HBOB 1NK8A 5E41A 2IBOA 4AXIA 2UV8G 3O6QA 3US5A 2HG4A 4R25A 3UCZP 3K5PA 2AV5A 1RA7A 2J7UA 1UA0A 1X5SA 1TL5A 3JSBA 4K5RA 2Z2LA 2R9LA 4W92B 3MURP 2J0SD 4EEYA 4N41A 1NRKA 2RKIB 5JUMA 2JOQA 4HI1A 4U7UK 2R8GA 5LSOA 4CT9A 4I2QA 2W8KA 1HBMA 1Y7PA 2OPQB 2QE5A 1E6YB 2QYCA 3K5OA 3NS6A 3PIOQ 5J2MB 4KC5A 4NCGA 1REVB 1VLYA 5I3PA 4XK8C 4MFBB 2LDYA 5F0UA 2QV6A 4ELVA 1IKVA 2YVSA 3W2VB 4IOCQ 3U1MA 3OL9A 1H98A 5KG2A 3DHXA 1DTTA 3M1VA 1TL1B 2CQ2A 4Y2KA 2OLWA 2VG6B 5IM0B 1CPZA 1SH3A 3GV7B 1RT4B 3DXSX 3HPOA 3R5CA 3VQTA 2DR5A 4X4NA 5T41A 1ZM3A 1FRKA 3K58A 4YB1P 1R7IA 1FTRA 1VQ4S 2ILZA 2XCAA 3U27A 2QLXA 2WTFA 2R7RA 2RIJA 2EK1A 2HLUA 3V4MA 5HBMA 3V6JA 2FIUA 3JTNA 1ZZNA 1IUJA 1RI7A 3BSAA 3GE9A 4IFYB 2HWTA 4MJKA 3TA2A 2HRYA 1J2VA 1K8AT 3NCPA 1SJ1A 1N5VA 4DF8A 3FZBA 2V8VA 6FD1A 2PI4A 1S6OA 1SKSA 2LQJA 2R2RA 1BQXA 4RW7A 2RQKA 3K8VA 4ES1A 3HKZD 4TNOA 1YQHA 2W9BB 4C8KA 4D3GA 4X4QA 3CCTA 3PRDA 1FNMA 3IFEA 3J7YI 1GNKA 2LDIA 3MEKA 2BANA 1YHQS 3WC2A 1LFPA 3J7A1 4FXVA 1WHWA 4ZPTR 3W2WB 2O67A 2QLWA 2F8MA 2K3IA 2X1FA 4K4ZA 1IBLF 5KFLA 2O66A 2JLFA 1C1CA 5KFTA 1UFLA 2LECA 4DQPA 4FBTA 2DRBA 2V94A 3CC4S 1T03B 2VOOA 1KFDA 3ZZYA 1UFWA 2ZHAA 4EWTA 4O3OA 3OLAA 1U1LA 3M32B 2VZ9A 4HI2A 5M2UA 1HHTP 4OZLA 1UW4A 1AXQA 5BJRA 3PACA 4LJMA 3V81B 1NK0A 4PPZA 5L9XA 3KK3B 1JNRB 2DR9A 1QUPA 3FGVA 2DTJA 4LF4F 4O4GB 1KD1T 2DHAA 4C3MA 3VAJA 3MM5B 4F4KA 4I2PA 3DNCA 3UDLA 4O3PA 1SL1A 1WEXA 1JLCB 2A2CA 2HFZA 3SMZA 2E5GA 3PY8A 2E1CA 3M2VB 2U2FA 4KHRA 3RU0A 5J2NB 5H9EJ 1XNRF 4F3QA 1J5EF 1F0XA 4K50A 2MZRA 3N6LA 4OZ5A 2OPRA 5HP1B 1HYSB 1OQ3A 1XR5A 2WBMA 3HZGA 3HVWA 5K8MA 3BN7A 3I87A 4PG7A 1N5YB 3IN5A 3SDEA 1VS3A 2M2BA 5E3RA 4QU7A 4ATNA 2EBGA 1VQ5S 3ZFVA 2B4PA 2UZAA 4G1QB 4NRTA 1TV6B 4JI6F 5B0BA 3M6UA 2H9ZA 3BQ1A 4O0IA 2M70A 1DTQB 3QJPA 2AQ4A 1M5VC 2CJ9A 3DRPB 3NMAA 4WFAQ 2WB1D 5EX3A 5F8GA 3J81Y 4L3NA 2ALZA 2ATLA 3PHEA 5J2QA 3NMRA 1KVIA 2Q79A 4N76A 2WONA 1VBXA 4LQ3A 2R7XA 2IYIA 1UMJA 3KLEA 2J0XA 3V4IB 4RU2A 3DN9A 3M2RB 4WXOA 5IXUA 4IQMA 5L9NA 2KG1A 3ENQA 2K8GA 3MPVA 1HBNB 1RT6B 1GQEA 4AL7A 2BRKA 1FCAA 5LMNF 3AA9A 4QQBA 2YKPA 4B3MF 1REVA 4YHHF 5HROA 4B3OA 2RNEA 1N6QA 2C3YA 1KONA 1B7FA 1SIWB 4JI7F 3QMQA 2AJ1A 1LWEA 4YR2A 2V8HA 3TUIC 4J9MA 1RKIA 2E7XA 1JLEA 2B5JB 3TRGA 4DR3F 4R0EA 3CCZA 2HVZA 1S7HA 1WF1A 2NSCA 5KAKA 1FJCA 1JJ2R 2KFNA 2ZH8A 4QR1A 1KR4A 1NH7A 2CQGA 4KAIA 3DRYA 4MK8A 1ZH5A 4QPTA 2HQ3A 3UR0A 2CVEA 3D0HE 1UJ5A 3I96A 1JLQB 4X4TA 1U1OA 1MWYA 1KFSA 2CZ4A 5AE3A 4FNIA 4LVNP 2YWHA 4I6AA 3MUVP 2C3UA 4ECTA 3H5XA 2AD9A 4DUZF 1BC6A 3IA0A 4NX9A 4NLRA 2JVOA 3H2UB 5GVQA 5LSRA 2QA2A 2DNKA 3DDNA 2YKMB 4TU8A 1JKHA 1MROA 2HFNA 4RW8A 1C0TB 2ZVSA 3ITHA 5GAEU 1Q86T 4C97A 1M5KC 3KOAA 1EETB 2HHTA 1T95A 4IR9A 1Q1KA 3QWPA 2HHUA 2B56A 3ONQA 1WHVA 4O3QA 3ZZRA 2VPYB 1GAOA 2VFRA 5D78A 4DV1F 3UPFA 4PWDB 1JLBA 2V4RA 1VQLS 1QE1A 1IKWA 2DGUA 3G86A 3LP1A 3ZZUA 5THWA 4UQGA 4Q44A 4YMEA 1QAIA 1C4CA 5MAOA 1W25A 3Q2TC 2VQEF 3NGKA 1H3DA 3QGPA 4NA2A 3KJVB 2ZHOA 3Q23A 2OTLS 3OPKA 1ZM2A 4I2QB 3CDWA 2L9NA 5J1PA 3M9NB 3TANA 2OP5A 1TP7A 5B7WA 2G0CA 2CQ4A 3OVSA 2E44A 2AYBA 3LWMA 3SXLA 4CI0B 2HWIA 4TYBA 1FO1A 1U26A 4ECZA 5F3TA 1VQKS 1FEHA 2HMIB 3CXCR 3B82A 3KWMA 3CEDA 1G7CB 3BJYA 2M9KA 4NLOA 5B0DA 5C5JA 1Q8IA 4TLRA 2LMIA 2YKOA 4M5DA 4I2PB 3BO2A 2FLNA 3HMJG 1R8AA 2IMWP 1H6KX 1E6VB 3M30B 4PUOB 3KMQA 1BQMA 1S49A 5E5NA 2XI2A 2OPRB 5DDPC 1HMVA 3OJSA 1HW9A 2KFZA 2ERRA 2BRLA 1FXLA 4QWDA 4IKAA 5KFWA 2RDIA 3S1TA 3MD1A 3EXCX 2YY3A 1OIAA 5EHHA 2E7WA 2XWYA 4X4RA 1A6LA 3CDAA 4C2MA 3D1HA 3T1YF 3M6WA 4KGMA 3C2PA 1ZBTA 4WYWA 2A1BA 1U24A 2D3ZA 4CH7A 3G96A 4XAKA 4OQJA 3KLHB 3W7BA 3MEGB 5KFVA 5HLFA 3KLHA 3KNAA 2XMJA 4P2SA 3VR1A 2BVZA 2HHPA 5D77A 3NLCA 4ZVHA 3ENVA 5CD4H 1X0FA 3CD6S 2V9WA 3NBPB 2J0WA 1RT3A 3L7PA 2JEJA 2RU3A 4IOBA 2X1BA 3G9CA 1FK9B 2EC0A 1FESA 4XPCA 3B4DA 4B02A 5KFEA 5A2QY 4IFVA 1D9AA 3GWCA 5JVHQ 3JSYA 2GGPB 1HFEL 1HHSA 1SJRA 3CCVS 2IRYA 5U47A 5KT5A 3AQPA 3OSPA 5LXYA 1LFWA 1YJRA 1UVKA 2OFHX 4FBUA 2N4DA 3O2IA 3LGNA 3IWLA 5DM7Q 5KFSA 2COLA 3DOKA 3THTA 2FVQA 3D1QA 2ZITA 4IG3B 2CQIA 3OBIA 1JX4A 1U1MA 4JYAF 1YJUA 2MY7A 4F25A 1FXDA 2E1MC 2B4OA 1D9DA 3M6VA 4IH7A 4DEZA 1KQKA 3TI0A 1S6QB 2OMLA 4ZA1A 2FVRA 5KFZA 1MMDA 1TAQA 3GFHA 4MMOA 3CJKA 2G1DA 2JSXA 3PFOA 3H5SA 4DV0F 4BWJA 2E5LF 4MKBA 1MWZA 4H4MA 3HHLC 4N77A 1NZAA 2DBBA 2W7OA 1OWXA 2HGMA 2XSJB 2J0QD 4QR0A 4LF7F 1S1XB 3VAKA 1KHWA 3HF5A 4ALZA 1UL3A 3TNVA 2WBRA 4C8ZA 1HQEA 3T19A 5HMXA 2Q43A 3NKYA 3H4DA 2HRUA 5DGAA 1RK8A 4ZVFA 1K0TA 2KZMA 2I1RA 2WAQD 3GILA 1JK9B 2OTJS 4WU2A 4UQTA 4YEAA 4A46A 3GV5B 4N47A 2LKZA 3K8WA 1YJ9S 2CQCA 4PWDA 1KN6A 4PCQA 4JI4F 3Q8SB 2EWHA 2R2UA 5D6GA 1C2PA 1U6ZA 2CG4A 3DM2A 2GW8A 3V2UC 3BGRA 4RNOA 1SL0A 4RNMA 4RWXA 4PXEA 3M8PB 2XGPA 3NG8A 5AE1A 1NK9A 4RW9B 4CQ1A 4DSIA 2OPQA 2EFGA 5KG4A 4EFAC 3UR3C 4A8FA 1LK7A 3PM9A 2MGZB 1U7LA 3DDKA 3RAXA 1ZYQA 2W25A 2UXCF 4H4KC 4HLBA 4URSA 3FSIA 3BQ0A 3LPYA 5EWFA 4DR1F 1VQ7S 5F0WA 3RBEA 3W2VA 1TZ0A 4OV1A 2BABA 2DNRA 3G8SA 3JYTB 3T5KA 1ULRA 5EUHA 3TARA 2PO4A 2JZ5A 3KNGA 2IYGA 4PXCA 4WFYA 1RT4A 5AE2A 5KOWA 4I69A 1D1UA 3LO3A 2ZH4A 4CNYA 1BWEA 1HL6A 2R8JA 3H4BA 1YJTA 5KFBA 1HI8A 1KQGB 2QFJA 2ZDOA 1NNDA 3SQGA 4IO9Q 2VA3A 4WZMA 1ELOA 3N79A 4U7CA 2XG8A 4B08A 2V4JA 4G1IA 4LQ9A 1OO0B 1TKXA 1IBMF 1NJWA 1FRIA 2PEHA 4Y2MA 3UI3A 3RTVA 3CMAS 2JFKA 3A1YG 2HNDB 2XGQA 4FS1A 2LEBA 3D0IE 4OZJA 2DJWA 1SB6A 4J9OA 5BR8F 4L72B 1S9EB 2IFXA 2ZH2A 4HEA9 4ERDA 3MEGA 1JLGA 2JLEA 3OLBA 1QVFR 2RQMA 3H20A 4X64F 1TR0A 2RKIA 1N34F 5G4DA 3NWGA 2CIMA 2FHOB 3G6ES 2HNYA 3ZZPA 5A8WA 2YNIB 4NLXA 1FDDA 1TKTA 3CCES 3PW0A 1WI6A 1WG5A 3RB4A 5GAHU 2P6SA 4AYBD 2ASDA 4O23A 1HBNA 3QO9A 5KT2A 1QJHA 2KFYA 1O51A 4I64A 4TYAA 2KXNB 3OUYB 5HROB 1BQNB 4K4VA 2MQMA 2SXLA 5F8MA 2GGPA 3M8QA 3RR7A 5JVGQ 3CDBA 3M8QB 3OL6A 1R0AB 5DDOC 4FYDA 4FZVA 5F8JA 4G1PA 2FY1A 4E8UA 4OJGA 1TVRA 2B9WA 2CPZA 3DLLQ 2N3OA 3K0JA 4Y00A 3QJLA 3PR5B 3BEGB 2HIQA 2VQFF 3PO5A 4RW6A 3TUZC 1FKOB 2XMWA 3QZ7A 2CPJA 1PGZA 2YQ3A 2LU1A 2IBKA 5KG3A 1F5CA 2W9CA 3EXYA 4QPXA 4KO0A 4IDKB 3K5NA 2C2RA 3H8YA 4HT5A 2D9PA 2YX7A 2RQCA 3NL0A 5ITHA 3KLFA 4GC6A 1N0VC 5F8IA 3K7RA 4YB6A 4CTAA 2FC8A 1BQMB 1FRLA 1P1LA 2APOA 1W2BR 3GMGA 4B9SA 3I9V9 1FRXA 1Y0HA 2WSFC 3H98A 2JLGA 3QAUA 4N5SA 1SH2A 4DV7F 1DHMA 1KLMA 2ASJA 4FVMA 2KJWA 2ZKTA 2B6AB 4TXSA 3TAMA 2F9JA 4ZDNA 1RT5B 2KVIA 1VC0A 3MD3A 2DPJA 2CFXA 1S1VA 4NOHA 2C42A 3EYZA 2KT2A 4DX8H 3BO4A 2MJNA 3M9MB 2E9ZA 1TUVA 2MMYA 4IYQA 2R8IA 1N5SA 2D7SA 4C0OC 5DQHA 5D8HB 2R7SA 2BE2B 2IM2A 3QIPB 3CT9A 2ZH7A 4WFXA 4JI3F 3LP2B 5F8LA 5KFQA 2PC6A 1MSWD 5B0AA 1C0UA 5E3PA 2CQ0A 2VFTA 1T03A 5A8RA 1S0VA 2QA4G 2NUUG 1PSDA 3JB9k 2KHDA 1VI7A 5IZHA 4RBTA 2Y1JA 4DV4F 3ZZ0A 1I94F 1JJHA 2A18A 3KLIB 5FJ4A 4XIUA 2GCFA 4O44A 2OFGX 3VCDA 1QSLA 4PQAA 3WZ0A 2V0NA 1SKWA 2KZZA 1U2RA 1F9FA 2DGQA 5KFXA 1Q81T 3PNIA 1U8SA 4ZVEA 2HFOA 2DVIA 2KXHA 4ILRA 2KN4A 4NCAA 4RW4A 2HVHA 3MZIA 3JSRA 2EVZA 2V2KA 5D4NA 1Q82T 3MWBA 2VBYA 1KQFB 3NNHA 2X51A 1S97A 3CCLS 2BM0A 2F9DA 2OPPB 2M88A 3FMBA 1WEZA 4RNNA 3KFWX 2RUGA 4DL2A 2JEIA 4URQU 3I4HX 3MM9B 2W7AA 3E01A 4JI8F 3KHGA 1LWFB 2GHVC 2DK2A 2FJDB 4DR4F 3QZ8A 4A8SA 4J9SA 1H7WA 2R8HA 3P3DA 1Q8LA 2DH8A 4LF6F 4PQUB 2CQPA 1MROB 4RW8B 1R8HA 2RSQA 1Y5LB 4F4YA 1HQEB 1YIJS 5J2QB 5LT5A 2XY7A 1KEKA 2JL9A 1VK8A 5KFHA 2IAJA 2C3MA 2D41A 4XDDA 4CH0S 4OHYA 2HHHF 1XMQF 1GTHA 2JEFA 1U1RA 3IRXB 3RB0A 2WHOA 4USJC 1LW0B 1VOMA 4C8OA 3Q24A 3FDSA 4NCGB 2CPEA 2B9XA 2GMLA 2J6SA 4F2SA 5CXTA 2R8KA 2PIIA 1X4HA 4QWBA 1IKVB 1R3NA 1S1WB 1S10A 4IFVB 4OX7A 2JJ4D 1RTHA 2FHMA 4X4PA 2NYIA 2Q6BA 1XMOF 3GIMA 2VG6A 1LW2B 1D0EA 2CQDA 4KGKA 3C66A 3G6VA 5E3CA 5HMYA 4DSFA 2DGSA 2MQNA 4CZCA 1VFJA 2QSWA 3KK3A 3DCAA 5D3GB 1Y00A 2VFSA 2F40A 5EX0A 2VFUA 2VPWB 4ED6A 2X1GA 3N6NA 4WIIA 3OQ2A 1L3SA 4ZOSA 4DSEA 2VKRA 4CNZA 2CQ1A 5KT3A 4LUBA 1C4AA 1UVLA 3BGFA 4HTJA 2X1AA 1TKZA 4DUYF 4NLPA 2M4MA 4H4KA 1X4EA 1YITS 3QGHA 1TKZB 2ZJQQ 3W3SA 3SV4A 2RD5C 1Q79A 1YJVA 2DHSA 2E5HA 1HYSA 3NCRA 3N28A 4AE5A 1DBDA 1FTCA 1M5HA 5E33A 4RUHA 5LJ3Y 4J9PA 3I0RB 2YNHB 1ZM4A 1XTZA 3CC7S 2Q1LA 5C42A 5KFKA 2BANB 3C6TA 2ILYA 5CZXA 1PILA 3T9NA 2QO3A 5EWEA 3D1OA 4ICLA 4K4WA 3MM7B 4ZLPA 1QTMA 3HDSA 1JLFB 5ADZA 4ICLB 3MR6A 1F5AA 1ZPVA 3PW4A 4F3OA 1S9EA 3X3UA 3SSSA 3CUNA 2RRAA 4KRWA 3PKMA 2HNZB 2GQCA 3LAMA 7FDRA 3GR1A 5CCMA 2M8DB 4B9VA 2MHNA 1UP1A 3KK1B 1RA6A 2ZHBA 5L1LA 1G3OA