4OI4A

Protein complex of clp1 bound to atp and mg2+ with pcf11deltan454deltac563 of s. cerevisiae
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
428
structure length
428
Chain Sequence
b'TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cleavage and polyadenylation factor CLP1
publication title RNA specificity and regulation of catalysis in the eukaryotic polynucleotide kinase clp1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 125
structure length 428
sequence length 428
chains with identical sequence C
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4oi4A01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oi4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oi4A02
3EA5A 2H5EA 4DIDA 2QUZA 5FPKA 1UEIA 5CIQA 1E94E 3OE7A 2OILA 1D5CA 5HPYB 2DBYA 1TU3A 1DBSA 4Q9HA 1ZNWA 1KHTA 1CJTC 2ZRPA 1NRJB 2X2EA 2GCPA 5KYKA 4LV5B 3RSLA 4LPKA 3WNDA 4KU4A 1KAOA 1T3HA 4RFSB 3A4MA 4HB4A 5EUMA 4UQOA 2DPXA 2BJVA 3EWAA 4XTCS 3KXLA 1SXJD 3GFPA 2GBLC 1G19A 3ICEA 3W8NA 5JRZA 2A30A 3WMGA 1M7HA 4IDQA 2QAGB 1FP6A 2CXXA 2I1QA 4ARZA 1J2JA 1H8HA 4XOIA 3CWZA 1OIWA 1OLOA 3LQRA 4HZIA 1A2KC 5DN6A 3GJ4A 3QEOA 2J3EA 5JS7A 1ZC4A 2XZPA 4LJYA 2D2FA 1KI8A 4PSVA 2ZSFA 3E70C 1BMFD 3IILA 2ZPTX 4NYIQ 2MSCB 4LJ6A 2MMCA 5DISB 1Q21A 1E9BA 2HEIA 4A2QA 4UXHA 2CLCX 3FDIA 2QT1A 1U2RA 2Q6TA 4URYR 5FUWA 4G5SA 3QPUA 1OHHA 4N0EA 3C5CA 3ZVNA 1JB1A 1ZVQA 2IS6A 4LC0A 4D2IA 4OI1A 1G7TA 3NG1A 5EE3A 2GJKA 1E2FA 2WMOB 3TAUA 1TL7C 2IYWA 2KSQA 3KQLA 4LDJA 1BIFA 4YLGA 1N25A 2C96A 3WXMA 2HLDA 2IC5A 1N2CE 5GJBA 2OV2A 5J4HA 1T8TA 4DUGA 3ZZTA 1R0ZA 2BJWA 2PT5A 5G3YA 2G83A 4Q18A 4TL6A 3OIVA 5JRJA 2G3YA 2GJAA 5CITA 2CNWD 3KJHA 4KYIB 1FW6A 1W36C 1ZUNB 2R6DA 3HPRA 4B3GA 4AKGA 3R9WA 2E1RA 3ND9A 1CR1A 4C0QC 2BCJQ 4OYHA 2REXB 3QUSA 5BN5A 4AI6A 3ZH9B 1Z83A 2BMEA 3PEVA 4AD8A 2IUSA 4EJSC 1KZ7B 2IYRA 5KSZA 1V43A 3GLHA 1Q44A 1E1RA 4LHWA 4PSKA 3BB3A 4M53A 1P61B 4LJAA 4URXR 1VKJA 5FTNA 5JCZA 1I4TD 5KNBA 2P3SA 1W2GA 3EIQA 5KOYA 5JI3E 2B92A 1KI4A 2WKRA 1IQPA 4PSAA 1DO2A 4JVMA 4BPBA 2VF8A 4LYHA 3UXMA 3K0CA 5AUPB 2NPIA 1JR6A 3LDAA 1XFAA 4CDGA 3LW8A 3L82B 4CYMA 4BFYA 1B0UA 2OG2A 4RSGA 3CB4A 2MMGA 2ZI6A 5LD2B 3EPLA 4ZKDA 1W4BA 4PHFA 2J0UB 3NTUA 4BLPA 5KPDA 3VKHA 1YR6A 4OK3A 3B13B 3EA0A 2PMKA 1XXHB 4IJMA 2XZOA 1P72A 3QENA 4AG6A 4P33A 4C0HA 4BFWA 2OBNA 4EPVA 2GXAA 1P9RA 4MH0R 4PXAA 3RRNA 1KK0A 4US0R 5FTKA 1E0JA 4BGDA 3NEYA 2B6HA 2WSMA 4JLMA 2J5XA 5F9FA 3SYKA 2PLFA 3B85A 4D0LB 221PA 2IBMA 3IEUA 3HJNA 2VHTA 5JS8A 2YZ2A 1XEWY 2EWVA 2QSYA 2HYDA 3GFTA 3TUZC 1DELA 4DHEA 4M4SA 1G3QA 2DWOA 1NVWQ 5FOTA 1EX6A 2XSZA 1YQTA 4RFSA 3X1DA 3QQ5A 3L0PA 1L8QA 4QM6A 5KTYA 3E5HA 2IS1A 2ZVQX 1DARA 2NG1A 4LSGA 4FINA 1CP2A 2QAGA 2IA5A 2AL7A 2NGRA 3QNUA 4TMVA 5D3QA 3ZVMA 3K70D 1G4UR 5K8LA 2ZEJA 1ZM7A 1QHHB 2ZE7A 3ND8A 3M4YA 3Q3JB 4II7A 2IXEA 5KDDA 1MRNA 1T9HA 4QBIA 1EFUA 1DG3A 2ZJZA 1N6KA 1G9XA 2ZRAA 1G3IA 2ZRJA 2V6JA 1Q12A 5FPYA 5C4MA 2RH5A 3MWKA 4GP6A 4Q4AA 4X8LA 3LRPA 4BE7B 1G3RA 3QBTA 1VG8A 2Z4SA 3GJXC 4A92A 1Z6AA 1ZCAA 3I8XA 3IBYA 4NMMA 3W9YA 3R9XA 1GOTA 1KSJA 2X8AA 1UF9A 1SXJB 2QI9C 2WSSD 4AURA 4YMTA 2PZGA 2C5LA 2ZSDA 3CNNA 1U8ZA 3O8CA 2W2TA 5FH9A 2ZJ5A 3LX8A 2HCBA 5FOUA 2O0HA 4JKYA 1TADA 5FOWA 3ZD7A 2EFCB 1G6OA 2C78A 1R7RA 2HYIC 2ONKA 4DDTA 3PUYA 4EPYA 1FQJA 3BB4A 3TQFA 2G6BA 2Q21A 3OIUA 4FCTA 1QG4A 2I3BA 1IY0A 2KWIA 4JVLA 3EZ7A 4JJKA 3CRW1 1QHIA 2RMKA 1SKYB 1GVNB 1XTQA 2IYZA 1IM2A 4YDHB 4V0OA 2CLDX 1HT1E 4BLRA 5EP2A 3ZZ0A 2JIZD 3NH6A 2VF7A 1GITA 4Q4JB 4Q9JA 3WHKA 1UBCA 3W34A 3QI2A 1BKDR 1LW7A 4MYTA 1DAEA 2FF7A 1A7JA 1LS6A 4QBHA 1W5SA 3LH5A 4G01B 3QXSA 1NJFA 1NMXA 3DZDA 4HLCA 2QMHA 4Z8XA 4DRZA 3OFND 3TNFA 5F98A 2AXPA 2QU8A 1JQLB 1N6HA 1U98A 4KFTA 4UJ5A 3IPXA 1P75A 1KDRA 1II0A 1J8MF 3TVTA 4ERNA 5SZKB 2RGXA 3CNOA 4IXNA 2BDTA 3GJ5A 2GF0A 1SVMA 3AP3A 3EC2A 3PITA 1R0WA 4IOLA 1Q3TA 2RB4A 3WMFA 4DWJA 1ZAKA 2CHVA 3LVRE 1D2EA 2VP6A 4LYAA 1CJKC 1NBMD 3H86A 2FWRA 3CF2A 3SNHA 3VR6A 2X2FA 2JJ1A 3BXZA 4V0MA 1W47A 2GTPA 2JLYA 1FOEB 4B43A 4MUBA 4TQ9A 2VL7A 2IYLD 2HJVA 1XU4A 3B9QA 3U3MA 1SVWA 5FTLA 4Q02A 2AWOA 1E2NA 1CRPA 4D4MA 4QFMA 1DTSA 3U3KA 4F91B 1BS1A 2W6IA 4GMXA 2JJ2A 4LJ9A 3ADCA 1KNXA 5EQTA 2KBEA 2FN4A 2OESA 1D9ZA 4OI0A 1RW4A 1VPLA 1NG9A 4BLOA 4KFSA 1KSHA 4PPFA 4B76A 1XZQA 3B1YA 1VYUA 5TMPA 1JECA 1OPXA 2AD5A 5D3MB 2HF9A 2KI5A 3MLEA 3ADBA 3QG1A 1OH7A 4Q47A 1FTNA 1R8SA 2ORVA 1SVOA 1W0KA 2BHRA 5B58C 4JMPA 1VG9B 3SDZA 1A5TA 1P4SA 2A5YB 4Q1BA 2XZLA 5JHGB 1S9DA 3FYHA 2ZJYA 4LJ8A 2QROA 5EP4A 1GL9B 1ZW6A 4NH0A 4BEJA 1UDXA 1E2LA 1P5ZB 1QHHA 2ORIA 3KUCA 4B2LA 4A2PA 3GLIE 1HURA 2ZS9A 1T8UA 1EWQA 3VX4A 1D8TA 2VTKA 1XTJA 4QHTA 4DT1B 1XWIA 5J40A 2IWRA 1U0JA 1IXSB 2WWXA 2ZYTX 2ZE5A 4PTLA 1YZUA 4DXAA 1TF7A 1CU1A 2RAPA 1YZKA 4LZZA 1H8ED 4DLYA 1XX6A 2ZS7A 4LY6A 4YMSA 5JJLA 1KO4A 1OT3A 1FPMA 1NSFA 1E2DA 2A2ZA 1GKIA 3BH7A 5CM8B 3SQXA 2GAAA 4URVR 2OLKA 4U7DA 1NVXQ 2IS2A 3LA6A 4QOSA 3QE0A 1SXJA 3SC3A 3LWNA 2VSOA 4JL6A 1D9XA 2EFDB 3TE6A 4QGAA 3T1TA 4PHGA 5KNCA 1F2TB 3KX2A 2HT6A 3K70B 4FCVA 3VKWA 1Z6XA 1E69A 2ZJ2A 2IYQA 3Q7QA 2H8KA 3X1ZA 3UATA 1BMFA 4QJ4A 2A9KA 3FB4A 4L15A 2HDNB 2CJWB 1HA3A 3KKQA 2GHIA 2IUTA 3KB1A 2GXQA 3V9PA 2OO7A 4C0KA 1R2QA 1XJQA 1W4AA 4DCVA 2GF9A 3NDBB 2ZJBA 4Q1DA 3THWB 4QBGB 4PC3A 1TEVA 2C99A 3TUJC 1VCOA 1OYWA 3T12A 2AXNA 5IHPA 2WAXA 5E7JA 1TTTA 3P4YA 3DMNA 4A9AA 3KQNA 4BFUA 2ZJAA 1E1QD 5DGXA 2PZEA 4P4TA 2WHXA 3BBPA 3C7KA 1TQDA 1CJUC 1XD9A 3TAHA 3P20A 2IYYA 1JR3D 3U7EB 3Q9LA 2ERXA 3RSOA 3TVDA 3NBZC 2ZROA 3SJAA 1Q20A 3UK6A 2BKEA 4GT1A 1VDZA 2CNWA 5KU1A 4UNNA 2OSBA 4B75A 3C14C 3PEWA 1OW3B 1OF1A 2VSFA 4YDSA 5JBQA 3RANA 3K09A 4U00A 5JJIA 5ELXA 2QBYB 1Z47A 3BERA 1G8PA 3DHWC 4HB2A 3KUDA 3T1QA 2IYSA 1W4RA 3UG6A 5L3RA 1VCNA 2CHGA 5JFGA 5A5GA 4M1TA 4C7OB 1KI7A 2NOAA 4H9GA 4NCIA 4FWIB 4R71A 1N6IA 4A0HA 2A3RA 3CX8A 1RPZA 3K0CC 3P32A 3GLHE 3VU9B 4KHZA 1U90A 3MCAA 4MRVA 3U6BA 4WXRA 5D3MA 2JDIA 2WIAA 4HDOB 5AJYA 2P67A 2F1RA 4IRUB 1GL6A 1NNEA 4NE2A 3U61B 3KQKA 5DHAA 5AJWA 3A8TA 3LV8A 1OXUA 1KKMA 3NBFA 4LHXA 2BEKA 2YOHA 4TSFD 3U3OA 4WIAA 3VQTA 1XCPA 3K1JA 2ERYA 3I92A 3EW9A 3T35A 4ZIRB 1Z06A 1ZUIA 2RGDA 4M9QA 1IBRA 1FUUA 3NHBA 4Q7KA 2WJIA 4TYPA 5CDFE 4D26A 1N6NA 1XMSA 1CS4C 2VEDA 3WRYC 2DCUA 1VCIA 2CL0X 2XEXA 1T0HB 4TZ6A 2ZI9A 4O3MA 4DSNA 4PO9A 1UM8A 3RLFA 1CR4A 2FE4A 4B3BA 3N2IA 1TQ4A 2VHQA 4S2EA 4DBLC 3O8RA 2B7BA 2WZQA 4FI3C 4HZUB 3RVBA 2VH5R 3A37A 1U99A 4LX0A 3IEVA 1G4AE 3HYTA 3LQQA 2OAQ1 4ILEA 3VHLB 3K8YA 3RRMA 2JLRA 3OAAD 4Q01A 4MDEA 3VNVA 1KY3A 3EX7C 2R6FA 3MJHA 4FXPA 2FDCA 1XJCA 1NMZA 2AR7A 3CZQA 1WB9A 3RS4A 2V54A 4DVGA 4A15A 2W0SA 1NVUQ 2RGNC 1TPZA 3BE4A 1EWRA 1SKQA 1DAKA 4Q7LA 4LUCA 1Z0IA 4MGIR 3RS5A 1DOAA 4MKIA 5EZ6B 4NU0A 1TNDA 1KK3A 2PBRA 1OXSC 2WVJA 1F2TA 5DYGA 2VO1A 3FVQA 5AUOB 3EPKA 2E9SA 2IL1A 2HV8A 5DO9A 5HCNA 4F38A 1D6JA 1G1MA 1VTKA 4TYNA 4ZV4A 1VECA 4I4LA 1KI1A 3ZZUA 1LTQA 2GJ9A 3CLVA 4EUNA 1TEXA 3SU8A 2CJWA 1SVLA 5HZKA 3MFYA 2XX3A 1KSGA 2ZU0C 5BWMA 4OJQA 3SJBA 1HEIA 4B73A 1MKYA 4JBYA 4C0AC 1Z2AA 3F3YA 2ZRHA 4R2IA 2AKYA 2IHYA 3QVUA 4TMWA 3K9GA 1EFTA 1TF5A 3W6NA 2RCNA 4PANA 3HDTA 1AS3A 2HXYA 5L8VA 3G0HA 4A1FA 2WSSA 1WDTA 1W1WA 4NKRA 5CYOA 3ZGXA 1KO7A 2BVNA 3PG5A 2WICA 4B44A 3MD0A 3S1AB 3KDSE 3P1JA 4PO1A 1GSIA 5JLJA 3DKPA 3NBYC 2NZJA 2IF2A 1N6PA 1B23P 1L7VC 2JJ1D 3AQ4A 4PR0A 3MUFA 4A2WA 4I1UA 4HAXA 1XEFA 4Q1CA 1KOFA 3F8TA 1US8A 5CJ2A 3A6PC 4GOXA 3PIRA 3A4LA 5AR1A 4AY2A 3BORA 5DSZA 421PA 4ABYA 3CUEF 4MGKR 3TKLA 2JIZA 2QTFA 2W6ID 4JS0A 3B9PA 5E7IA 4DCNA 2CK3D 4WXPA 3PFIA 1R0XA 3QOFA 5IDVA 3SYLA 1C9KA 5IT5A 4NZYA 4FIDA 4MKHA 5EE5B 2R6CA 5BYJA 5J4VA 1N0UA 5EXSA 1HH4A 2PLRA 4BRWA 1ESMA 3OFNA 4TLBA 1D2MA 4A6PA 3IO5A 2BM0A 4EKDA 4M9XA 2C95A 4DKXA 1RVDA 3CBQA 5LD2C 3UMRA 1ZM2A 2ZITA 2WWHA 4KODA 2FJUA 3AM1A 3I4LA 4W5WA 1U8YA 1QHSA 2ZANA 2X77A 1P60A 3GJ3A 5FR2A 5CLQA 4CVNA 4M1OA 3RAPR 4ZIRA 1Z2CA 4IXMA 1NBMA 2ANCA 4GFDA 2VP9A 1G5PA 4E09A 4KJZA 2D2EA 2D3WA 4LBWA 4YMVA 1Q57A 1EFHA 2CVFA 1K6MA 2H57A 4L16A 3WRXC 3CRRA 2R6GA 3RS7A 1XJ0A 1YZLA 3L0OA 1XXHE 2G9NA 4WZBE 1ZIOA 5JMTA 1DE0A 3RS2A 3GJ7A 4HZUA 1PJRA 4BLQA 1FP7A 1CLUA 4V0ME 2ZRBA 1G6HA 3I1FA 5AUNB 2VLIA 2YWFA 4MGZR 5FL3A 1AQUA 4P4UA 2GCNA 4M0LA 1Z0AA 2F43A 2R44A 3OIWA 4O0MA 3CNLA 1XCMA 2OBMA 3W5JA 2FFBA 1E2QA 4PAMA 4TMZA 2MSEB 1TUIA 4B2PA 3GLGA 3FMFA 4PQRA 5HR5A 3AF3A 1OKKD 3QSYA 2VHCA 3IUYA 4K46A 3AVPA 1NL3A 2OCAA 4HEJA 1FTSA 2FGJA 3B82A 5DNYB 3DM5A 2IT1A 4OQMA 3I62A 4HLUA 4TMTA 2ZVPX 4TYYA 4GBMA 1BYIA 4AG5A 4PAQA 1VMAA 4CZ2A 2MSDB 5AJZA 4PAOA 3W3AA 2Q9AA 2AWNA 2J0VA 5TXGA 3WBJA 1VCMA 4QNRA 1QHYA 2RGBA 3QKSB 4XJXA 4DSTA 3KQUA 4Q4AB 1H8EA 1KTVA 4Q66C 4LOAA 1YVDA 1NKTA 1Q0UA 5TARA 1E4YA 1DPFA 2GJ8A 1OFTA 1AS2A 4TWZA 2ASEA 3FHCB 1F60A 4URWR 3SE0A 2YV5A 2PMDA 4ZCMA 2XJ4A 5B30A 5FOVA 3UWOA 4LHZA 4JLKA 1AGPA 3SN6A 1JQJC 1QHXA 2HXSA 1XEXA 2FGKA 4UKDA 2YWEA 2HF8A 1ZD9A 4WA7A 1HTWA 1M74A 4TTRA 3S1AA 4OBEA 4QM7A 5FR1A 4NYIR 5DH9A 2ZUBA 4DDWA 1WXQA 2P5TB 1LY1A 4OQXA 3JVVA 4Y0VA 1SXJE 4KCGA 1UKEA 2GZAA 1X3SA 4NP6A 3AH8A 4N0DA 1Q1ZA 2YVUA 3FKSD 1WA5A 1GILA 2OEPA 5TDHA 1KMQA 1XPRA 4MYHA 1N6LA 3MWLA 4C0LA 3EIEA 3CKLA 4YMUA 4A8JA 3OZXA 4E07A 3BD9A 2NZ8A 4OHYA 4E22A 1FL9A 1XP8A 1T5IA 1JAIA 3K9HA 2QPOA 2PCJA 4PC6A 3ZJYA 1PUIA 2TMKA 3BB1A 4G3XA 1SKYE 2XJ9A 2LKCA 4BUJA 2JDID 4CF7A 3SJCA 1P9WA 1E1QA 5H70A 3B6EA 1FNMA 2ZRMA 1JR3A 4HSEA 1MV5A 1Z0JA 1G3UA 2EQBA 3QF7A 4RCZA 1HT2E 5ANRB 1EX7A 5KDLA 4HYYA 4KLNA 5K8IA 2BCGY 2QP3A 4Z8YA 1NI3A 3D7MA 4QHSA 4MGYR 4Q1AA 3GEHA 3LX5A 3TGPA 4RD6A 2ZSBA 4R2HA 3PVSA 1T0JB 2ZYVX 4ITRC 4G5GA 1KGDA 4DB4A 1L4YA 2CBZA 1Q22A 1WE2A 2OCYC 4TL9A 1ANKA 2WTUA 3EZ2A 3GEIA 3LY5A 2CMKA 4B3FX 2V3CC 2QGZA 2F1HA 4RD1A 1DAFA 5A0FA 1YR8A 3LLUA 3B7GA 2BOVA 2GETA 5E7MA 5DLQC 1R10A 1WP9A 3AP2A 3KXIA 4PQYA 4LPSA 3CPHA 3UWKA 1R5OA 4C0JA 1G5RA 3QEJA 3BGWA 1DAIA 3TLXA 4B35A 4ZPXA 2DHRA 4EPTA 4A0RA 5CB6A 2EFGA 4DCTA 4B6EA 1Z0FA 1FX0A 4M1KA 1E2PA 3LD9A 1S9HA 1X8LA 5LB4A 5IK2D 2W0MA 4DDUA 2QORA 3I3SR 1YZTA 3N5CA 1CF4A 1F6BA 4TSFA 4UNPA 2ZAOA 3K9LA 4UNQA 1Z28A 2QGNA 1W2HA 1W44A 1FZQA 2Z5FA 3LXRA 3I5YA 5E95A 3HP1A 1VYTA 1EESA 1CIPA 1M2OB 1OFIA 2C2HA 1E4VA 4AKIA 3IPYA 3OF5A 5JCPA 2FMXA 2VP4A 2ZYUX 3VAAA 3ZD6A 2P2LA 2A5DA 4TT3D 2EU8A 3FHOA 4DEXA 4IKEA 2UZ3A 1Z5ZA 3QKSA 1DO0A 2AFHE 4AWXA 2IS4A 3LBIA 2BBOA 2B7CA 2GJSA 3B1ZA 3I72A 3LFUA 3C4JA 4RZ2A 3X1YA 3B1WA 3OAAA 4ESVA 4AKEA 4JLNA 3GLFA 1M6NA 3R7WA 4KSCA 1GKUB 1T3LA 3QXJA 4Z1MD 3AKYA 1Y3AA 3EG5A 4TZ0A 1YJ5A 2G1JA 2W2XA 2BBWA 4JBWA 4PC7A 5J4YA 1RRFA 2ZRFA 4HI0E 4GOKA 4B3XA 1BOFA 1KI9A 1KSFX 2QP4A 5C2JB 4GSYA 2EWWA 3M0EA 5EZ5A 4NBSA 4FMDB 2WJYA 5EXTA 3ZVRA 4B34A 5FBQB 4F7WA 3R8FA 1OIVA 3D6TB 4JYBA 1N5KA 4OQLA 4LRWA 2OT3B 4EAQA 2NO9A 2C03A 3GQBA 2GA8A 3LW7A 4TMKA 4AKHA 4HUTA 3D8BA 2IF0A 1MOZA 4GZMA 3KB2A 1ZNZA 2XOKA 1UAAA 3MWJA 4EFNA 1TX4B 2RGAA 1YKSA 1HUQA 3GP8A 5TVKA 4DLRA 4X8MA 5DHFA 1NG1A 4QNMA 2YWHA 3QPWA 3QXXA 2BC9A 2LCFA 2LKDA 1NIJA 3RDPA 2OCBA 1A4RA 1HYQA 4PHTA 3SBEA 4B74A 3TUIC 1DS6A 5G41A 2YKGA 4CT4B 3A1UA 3FMPB 5GJCA 4HAYA 5IRCD 4LI0A 2JLSA 5DE3A 1U9IA 4C2UA 4LHYA 5JWOA 2CHQA 3DO6A 2J7KA 1AJEA 2NO7A 4TTQA 3C41J 3E1SA 2JLQA 1R8QA 3M1IA 4IFEA 1FUKA 3GJ6A 1OB2A 1UBEA 4D4KA 4KXFB 4OQFA 3SEAA 1E98A 4K81B 5FBRB 3MWYW 1BH2A 1TAGA 3BFKA 4OI4A 5FTJA 2CVHA 2CEAA 4E5UA 5C46F 3BOSA 5DI3B 1P73A 2D7CA 1XTKA 1Z3IX 2NO0A 4N3NA 1MO3A 2CK3A 2B8WA 4PQFA 3SQWA 2GNOA 4B47A 3CX6A 4JYCA 2N46A 4RJLA 3NH9A 1E9SA 2NMVA 1RJ9A 2OCPA 3EPHA 3PQCA 1K5DA 3B1VA 3B5JA 4HLDA 4PC1A 1AN0A 3NC1C 3Q5EA 2P5SA 4QKQA 3TR0A 5JI2E 3Q7PA 4V0NA 3RYTC 3ZIAD 4BFSA 2JCSA 1G291 4URZR 1A2BA 5BW8A 1GWNA 2P65A 1KDOA 4R9UC 1YU9A 2O0JA 4AIIA 5BYKA 4V0KA 1G41A 5G3ZA 5JWHA 3P27A 4BFZA 4GPTA 2R6AA 4MITA 3JZAA 5HZHA 4MRPA 1RFLA 5TB5A 1NP6A 1XB2A 5GVRA 2G88A 4OJKA 4CEIB 4MRSA 2EVWX 3TSOA 1BYUA 1XD2A 1IN6A 3TR5A 2IXFA 1Z22A 1K5GA 4HDCA 3DOFA 1AIPA 4LHVA 1NBME 1ZINA 3ZDQA 5BN3A 2QSZA 2ZJ8A 1H65A 5EP3A 4P4SA 3NC0C 1X8KA 2DR3A 5FL7D 2ZS8A 2VBCA 1NN3A 3CRQA 4P32A 3TK1A 4DLTA 2DFTA 1E2JA 2JA1A 1VIAA 3TH5A 1OH6A 1BO6A 1W4CA 2G0TA 4DB2A 4ZCIA 3Q5DA 2QTHA 1NN1A 4MUAA 4I81A 4WOPA 2J9RA 2K5UA 1P2TA 4LV6A 4PPQA 2QMEA 1OKKA 3IO3A 4Q4LA 1F3OA 1G16A 4D0GA 1EFCA 3Q8XB 3P4XA 4G1UC 4JLDA 4D0NA 4R98A 4U02A 821PA 1TQ2A 4F4JA 1C4OA 1A82A 1G17A 2FFHA 4G5RA 1ZU5A 4YQFA 4CRWB 1TQ6A 4TLAA 2B8TA 4D25A 2GZHA 3AGQA 4PZYA 4QC2A 2Z6VA 1QG2A 2FU5C 1GDDA 1W49A 3AF2A 1XZPA 1T3SA 1GRQA 1G18A 1ZNYA 1E6CA 2W83A 1YR7A 3ZS9A 5EJEA 2O8DB 2ZE6A 2ZRLA 3JZMA 1YHNA 4UXIA 3WNCA 3FKQA 1N6OA 1OSNA 1SHZA 1VHLA 2B21A 3U60B 1WBDA 2IYUA 1NIPA 3L0SA 3W5IA 3AUXA 4EJSA 1W0JA 3A4NA 2GILA 2ZRDA 3O8BA 1KO1A 4C4PA 2O8EB 1P2UA 3PEYA 1FMLA 2ZXUA 3BAFA 4KFUA 1IN7A 2J7PD 2ZI7A 3UANA 4CT5A 1J8YF 1P7CA 3CWQA 1MABA 1Z29A 5JSZA 2DY1A 2GK7A 2PL3A 3KJEA 2P6RA 3KKPA 3RC3A 3SHFA 8OHMA 1OH5A 3RC8A 1QDEA 4FMDF 4TTPA 1MT0A 2W58A 2JLZA 621PA 2VQSA 2XB2A 3FKSA 2HJGA 3RNLA 4JLBA 4V02A 1R5NA 3L8YA 4QGFA 2R65A 1US8B 3IBGA 1Y63A 4JL8A 5KSYA 3NIBA 4BLTA 4POAA 4UJ3A 1QZXA 3CW2A 5DI3A 1KJWA 3GJ8A 5FUXA 3J81k 2Z0MA 1WBBA 2JEOA 1OJLA 1UBFA 3VR5A 1KIMA 1Q1BA 4XWKA 3FHTA 2PT7A 2R8RA 3T5DA 3EAQA 1ZD8A 5A4JA 4X8OA 1P9NA 1I2MA 1ZJ6A 2BMDA 5J47A 4IOMA 1OXXK 4JLVA 4F92B 2WPDD 4DJTA 2NQ2C 3HU3A 1KMHB 2VPPA 3B8HA 3P26A 1S1MA 1KNQA 1Z07A 2IWHA 3RRYA 2O0KA 3RRZA 3E2IA 4BFVA 2YWGA 2ATXA 3AVVA 4Q48A 2J45A 1UFQA 4EQ6A 3DVLA 1VIYA 2H92A 4O25A 5EP1A 2PEZA 2ZRIA 1JR3E 2FZ4A 2W00A 1W48A 3JVUA 2REBA 4KLZA 3F5FA 2FEMA 4IOKA 4US1R 4CEIA 5HKKD 3T15A 3UMSA 1OXVA 1XNJA 2W6JD 4OQNA 3EZ9A 1PLKA 3G82C 4DLVA 1XPUA 5C1BA 5K8UA 5HE9A 5DIFA 1UKZA 4XSHA 1WQ1R 3PUXA 5CM9C 3AV0B 4C30A 4KI0A 4A82A 2CDNA 1E0AA 4V03A 4NCJA 4GI7A 2F43B 2ZRCA 1I4LD 1KKLA 4KBGA 4LYFA 4DEYA 3DL0A 4RD2A 1YZQA 2DB3A 4ACBA 5IK2A 2W2VA 3LLMA 3SI7A 2QAGC 3HYRA 4XH9B 2I1VB 3GLGB 2ZRNA 121PA 3LXXA 4WAUA 3N2EA 4LJ4A 3AVTA 1Z6TA 2BV3A 4AC9A 1E9EA 3DZ8A 4C9BA 3AF4A 4HAVA 4YXWD 3SHWA 2XGJA 2R62A 1ZP6A 3UKDA 2QA5A 3KKOA 3RWMB 5CB8A 5KO2A 3KJIA 2CCGA 4FCWA 1UPTA 1Z8FA 2YJTD 4NL4H 3WY9A 4TT3A 2ZAMA 3H0KA 1G8HA 4DLXA 1S3SA 2O8DA 2XOKD 4A36A 3QG5A 2GDJA 1S2MA 3N70A 4CW7A 2QM7A 4FMBB 4ACAA 5B57C 2ZR7A 2X1VA 4RCYA 1XRJA 3IIMA 3R20A 3W90A 2IYVA 2FA9A 3C8UA 1Q1EA 3ETLA 5M04A 3BS4A 4WW0A 2XXAA 3HPQA 1I4DD 2C77A 1E79D 3IHLA 3THXA 1WRBA 3QKRA 4Z1MA 3T06B 2O8EA 3EWSA 1QVRA 1XEXB 4HB0A 1OYYA 1ZM4A 1YRBA 1U0LA 3LBHA 4TYQA 2F1IA 3GEEA 2CLSA 2ECKA 4G5OA 5KNDA 2QN6A 2BWJA 1CJVC 2QPAA 3QF4B 2GVZC 2HT1A 1PLJA 2V4ZA 3GCGA 2WWGA 1QHNA 3DPUA 4P3YA 2ZTSA 2J41A 1XMIA 1XTSA 1S8FA 2P0EA 1OIXA 1R6BX 1G20E 1HE1C 1M34E 2QZ4A 2REOA 3A1VA 3HR7A 1ELOA 3KFXA 3T61A 4BFXA 1P3JA 3WP1B 1L4UA 2PH1A 2WOOA 2WWWA 4NCNA 4MRRA 2BKUA 4A8JB 3THYB 5C18A 3WYFA 3LNCA 3SS8A 1N5IA 3U4QB 4LJ5A 1IN4A 1CRQA 4XVRA 4BLSA 2OZEA 2H18A 4G5QA 2AN9A 4KV9A 1EFRD 4ESHA 3I61A 4Z54A 3KFVA 5JHHB 1RYFA 3U3JA 4C0BA 2ZYWX 5AJXA 4RKEA 1CEEA 4XD7A 1ZD1A 2ZUDA 1PUJA 4GP7A 3VMFA 2GXSA 1KMHA 2FV8A 3QVVA 4B3CA 2QPTA 1RE0A 3ADKA 2FEOA 3CH5A 4F93B 1JEEA 4Q21A 1P62B 2GCOA 4KITB 2DWQA 5KDOA 3W6OA 1SQ5A 4RD3A 3FFBA 2WV9A 2VP5A 1XBTA 3QY0A 3SR0A 1TUEA 2NPFA 4KBFA 3TSZA 4Z51A 5EUQB 5L3VA 3U7GA 2WOJA 4AYWA 4KFRA 3WBKA 4KYUA 2YHSA 4JKIA 3FPAA 4QJ5A 2QRZA 4IEIA 1UEJA 1NKSA 3X2SA 1Z0DA 4A0FA 2A5GA 3AKDA 2L0XA 2NO1A 1HQYE 1NN0A 1IJEA 4OHXA 4J0QA 5C4GB 1XF9A 3WNBA 1VYVA 1JNYA 3REGA 1D2NA 2D7DA 4BWYA 4LBZA 1FX0B 4PPGA 1AS0A 1NLFA 3CM0A 5J4LA 1COWD 1QHGA 1N5JA 4HUQB 1ONBA 3ZIAA 3QBVA 2FPMA 2QM8A 4PPNA 1FMJA 1ZCBA 2FSGA 3IQXA 3PR1A 1Q1QA 3EZFA 1S0UA 2Q3MA 4B48A 1RRGA 4PX9A 4MKFA 2WWYA 1W7AA 2JLUA 4LWZA 5B64A 3T1OA 1MH1A 4Q5IA 4FMCB 1S1CA 1RC8A 5HE8A 3X1WA 3DEFA 4QL3A 3C5HA 2ZRKA 2AKAB 2WWFA 1W36D 3BIFA 4P0TA 4WBSA 2EYUA 5TV2A 3PUWA 4W5JA 4OHVA 4DIEA 4NDZA 3MRSA 3GPLA 5FL7A 4JIMA 1Z6GA 2IXGA 1XPOA 3Q85A 4JL5A 2RHMA 1KK2A 3GLFB 3U3RA 4NYJQ 3ZQ6A 4OL0A 4TL8A 5CLLA 3R7WB 1W0JD 4IVPA 1SXJC 4RD4A 5FUYA 4JVSB 2V7QD 2AK3A 3V4FA 4KSBA 3TQCA 2C9CA 1SGWA 5F3WB 4OHZA 1DVRA 3EPJA 2Q3FA 3OEED 2SHKA 1ODFA 3CONA 2QRNA 5SZHB 4AYXA 4MQBA 3EC1A 3QF4A 2H7VA 4YMWA 3SFVA 4TLCA 3VR2A 2FX3A 1RRCA 5G40A 1V5WA 4JSYA 3TJZA 3I32A 3KKNA 3DDCA 2VRWA 3RABA 4I1OA 2QP9X 3NWJA 1GUAA 2FG5A 2PJZA 3SBDA 4ZI3A 4US2R 2D62A 3VR4A 3A58B 3THYA 3ECCA 1JALA 2JASA 2FNAA 1JJVA 3U4QA 1UADA 1LB1B 2ZE8A 3QIAA 1XTIA 4NYJR 1YZGA 5IF9A 2V1UA 2F6RA 1E9CA 4BFTA 1DAGA 4QGHA 2GRJA 3QKTA 2VIIA 1X1RA 4I99A 3IKJA 4O2RA 5JZVA 1G3MA 2A7QA 1I2DA 4HB3A 4O2LA 1G5TA 1KDTA 4M8NE 1OFUX 1R5BA 2BMFA 2WIBA 3WP0A 4Q03A 4D4JA 4TQUS 5F2EA 1MO4A 1NLZA 1MO5A 3RS0A 1OH8A 3AB3A 1TF2A 4DSOA 4CEHA 1E0SA 5GADl 2J7PA 4B3DA 1M1YE 1J99A 2GWHA 2PEYA 5JEDA 1KY2A 2QEQA 3NBXX 2KBFA 3VKGA 1UDWA 5GJVC 4JJZA 4ZDWA 4QJ3A 1CXZA 3PEUA 4GRAA 1K8RA 2ZI4A 4ZO4A 1KI3A 3FMIA 2YYZA 1T6NA 3K09C 4OK5A 1X86B 2XNDD 4GMDA 4IDOA 4C0SA 1J70A 4EDHA 4NCHA 2VP0A 1ZYUA 5FFMA 5FUVA 5CDFA 5BXQC 2OFWA 2F3TA 3H1TA 2ZUCA 4PZZA 1E2MA 2AX4A 1VG1A 5KSPA 3F0TA 3OEHD 1GFIA 4BEBA 4Q1FA 2A5JA 2VA8A 2YINC 3D31A 1SZPA 2FSFA 1PLLA 4JLOA 1WCV1 4LC1A 4ON9A 4MKGA 5FPHA 2N1BA 4B2IA 1NJGA 4B6FA 1N0WA 3B2EA 5AJVB 3VR3A 3AKEA 1P2VA 1M7BA 1RJ9B 3IIKA 3CR7A 4Q1EA 4W7SA 2OFOA 2IUUA 1RRPA 1II8B 4JBXA 2OHFA 4Y0AA 1IY1A 2Z4RA 2IEYA 2WPDA 1KAGA 1LVGA 3KZ1E 5FI1B 4NCKA 2XB4A 4HUQA 4TLEA 4RFVA 4W5HA 1NY6A 1XD8A 2FOLA 4DLZA 2BEJA 3O47A 1XTRA 1UBGA 1AGRA 4B33A 4ZI2A 5LB2A 3HU1A 3MJRA 2CL7X 3EARA 3H4MA 1Z63A 1GNRA 3DKVA 1FQKA 2BMJA 3A36A 3L2OB 4M21A 1NLYA 4ASUD 4IW3B 5KSOA 1LF5A 2ZR0A 3GMTA 1GRNA 1JBKA 2RGNA 2ATVA 1YR9A 2WJJA 2ZSEA 5HKKA 1R4AA 1XD2B 2RKOA 3U7HB 5J5CA 1HE8B 3W6PA 2W6JA 2FSIA 5P21A 4A0GA 2WMNB 4URUR 1AK2A 4JZKA 2O8CB 4B71A 4UNSA 3WYAA 4P4SB 3UIEA 3ADDA 3TSWA 2OE2A 2Z43A 3DMDA 2E87A 2QE7D 5H1YA 2OLJA 3AF0A 5KHOC 4MRNA 5JECA 1KO8A 2JLVA 3IDQA 1F2UB 2RGCA 2Q0HA 1IXRC 1RIFA 1S4QA 1L2TA 2NIPA 1E2IA 4OI2A 2GXUA 4GOJA 4MDFA 2H17A 3VHXA 5BQ5A 3B1XA 1X8JA 2WM9B 1AKYA 2CE7A 2VSXA 5E3HA 3C16C 4I1VA 3K70C 3CRVA 1UKVY 3CH4B 3FFAA 3A1WA 1DADA 4IDHA 3UMFA 3TW4A 2JLXA 4YXWA 2C98A 2ODEA 2JGNA 1E0KA 1Z08A 2OBLA 4QRHA 2G0NA 1QBKC 1XDBA 4G0NA 1HY3A 4A6XA 4W9MC 2WJGA 4IDNA 4JT2A 1MRSA 4M2LA 3AVWA 1G7CA 2G77B 3NDPA 4FMCF 2J46A 4RD0A 1N6RA 4JSTA 2OM2A 2VHJA 1TMKA 2CCJA 2ZI3A 4H1VA 4LV8B 2ZIAA 4TN1A 3NHAA 4EFLA 5L3QB 1W36B 3U7FB 4ZCLA 1IXZA 2GEVA 1ZC3A 3Q72A 1MR3F 2HCJB 2AFIE 2QL6A 5SZIA 2XXAB 4HAWA 3K0AB 4CIDA 4BZXA 4XD7D 1JEDA 3K0FB 4EJSB 4KVAA 3SOPA 2QAJA 1NN5A 3ZS8A 1E79A 2CL6X 1DAHA 3C15C 1SVIA 6Q21A 1S96A 2C9YA 5EE1A 1U94A 3EIHA 2OFXA 4M1MA 4L4UA 1PV4A 1NSTA 4GZLA 1MABB 1KDPA 2ODNA 4JLAA 5JSZB 1GNQA 3SYNA 2PJRA 5FBLB 4L8GA 4V0LA 4DC9A 2PX0A 1IY2A 5JJKA 5J4KA 1KYIA 1ETUA 1MO6A 4K8OA 3AKCA 4WVFA 3TRFA 2C04A 5FPTA 4D81A 1A1VA 1E9RA 3PV0A 4LYJA 3CRMA 1YE8A 3W8RA 1YZNA 3FMOB 2OXCA 1KI2A 2WJHA 3CZPA 2J0UA 3ICQB 1OB5A 2GESA 1E2EA 4JVNA 2ZREA 5LBIA 1OE0A 3NKVA 4UXJA 5CYPA 2GK6A 1FNNA 1XXHA 2XAUA 1EFRA 1OFHA 2ZJOA 5H68A 2J59A 4BASA 3IIJA 2WJVA 3KJGA 5LPNA 1NF3A 1LNZA 2F7SA 4M9SA 2AD1A 2CCKA 4YONB 1QVAA 1T5LA 2ODWA 1CR0A 3ZQJA 5CK5A 4EPWA 4MYUA 1II8A 3OE7D 1NVVQ 2EW1A 2J1LA 3L8ZA 3BC1A 4DLWA 4FW9A 4QHYA 1U0HC 3RHFA 4LBVA 5H8WA 1P2SA 4N1AA 4RZ3A 4ZKEA 4FN5A 5FOXA 2ODBA 4L5BA 3CIOA 4EQ6B 3CX7A 2QT0A 3AF1A 4XVUA 4BZPA 1CBUA 4XVQA 3R8CA 1EG7A 2FFQA 1J90A 3AUYA 4QG7A 4PC2A 2DYKA 2GBLA 2YOGA 3BJIC 3BRWD 3X1XA 1PZNA 2GAOA 2PX3A 4RVCA 4Q4HB 2VYFA 3REFA 4XTRA 4HLQB 4PO8A 5AK0A 3MGCA 2XTMA 1M7GA 2QQ0A 4GNKA 3EASA 4ZDKA 3AP1A 2O8CA 1H8HD 4GL2A 5FOSA 3BH0A 5DN6D 5GJWC 2ZETA 1ZM9A 1J7KA 4H1UA 3GFOA 1XMJA 2RGEA 2X19A 1KZGB 1NVVR 3DOEA 5EXPA 5JEEA 2YC4C 3I5XA 5KUTA 3U2QA 1U81A 3RS3A 2ZR9A 3OESA 2P6NA 1F2UA 1X6VA 1W46A 3LAWA 3L43A 2O8BB 1OHHD 4NONA 2GEUA 4DLUA 3V4RA 1COWA 2XNSA 4A4DA 3BWDD 5EXXA 3SFZA 4DLSA 4QGGA 2IYXA 2QTVB 1SVKA 1IN8A 2BM1A 3B60A 1IJFA 2J0QA 3BFXA 1G8YA 2HLDD 2EFHB 2I4IA 4HLUC 1X1SA 1CJMA 4KO8A 4M9ZA 1YRAA 2ZSAA 4DUGD 3GLGE 5CIWA 4HATA 4MA4A 3U6KA 1E3MA 5LDDC 4Q9KA 1JPNA 1NMYA 5L3SB 2YC2C 2QY9A 2GKSA 4DSUA 1ZNXA 3KTAB 3I8SA 1U8AA 5EE0A 721PA 4TL7A 3ZLJA 3FWYA 1G8GA 4HDQB 4IFBA 4LCBA 5L3QA 4CEJB 3PCRB 5BN4A 3AVXA 5EE9A 3MG9A 5FI0B 1G7SA 2YNMA 1CR2A 2KJQA 3TBKA 3QJYA 2IK8A 3LVQE 4XSGA 2XTZA 3K0AA 3K0FA 4IVRA 2N42A 1O3YA 4U5XA 1WMSA 4QBFA 1E99A 4NPHA 2ONJA 3RWOA 3GD7A 3QKRB 4D6PA 3THXB 4D82A 2AHOA 5CJPA 1F48A 1E1RD 2V7QA 3OHMA 4XWAA 4PZLA 3U44B 4RZUA 1XMVA 2A78A 3EZ6A 4FD2A 2BBTA 5CK4A 5K8TA 2OAP1 3OEEA 4IVQA 4Q4JA 2IEZA 4DCSA 4IOJA 1EXMA 4RKFA 1WF3A 3VFDA 2FFAA 2V6IA 3AEZA 4MYCA 521PA 3V00A 1IONA 1IAQA 3AVQA 3BH6A 3CPJB 1JAHA 3PENA 2RGGA 2D06A 4TLDA 3TMKA 3G5UA 3QPVA 4TQAA 3CPEA 1E9AA 3AVOA 4E03A 2R9VA 3O8DA 2OUKA 1DG1G 3BFVA 1GZSA 1XEWX 4A8JC 4LBYA 2C8VA 4YC7A 3KXKA 1OV4A 2O8FB 2VP2A 2IYTA 1N3BA 1AM4D 2QENA 1GAJA 1O87A 1SVSA 2JJ8A 3CF0A 3D3QA 2NTYC 3K53A 4XIGS 2H1LA 4AK9A 1PVOA 1E2HA 1N5LA 3U5ZB 4M1SA 5SZJA 1E2GA 1KI6B 3T1VA 1M8PA 4DCUA 2F3RA 3PJRA 1W5TA 4KAXA 3T34A 5AUQA 3IQWA 3KKMA 3FOZA 2DFNA 4B32A 4ZDJA 2Q9BA 4HAUA 1QF9A 3H84A 1AA9A 1DAMA 1ZIPA 2GCOB 2WKPA 3B78A 3NEJA 1E2KA 3BK7A 2XSZD 1KO5A 4BECA 4IEEA 1R0YA 2ZU6A 4Q7JB 1AZTA 3SZRA 3AVUA 2UVQA 3W3ZB 2XITA 1F5NA 5HTKA 1AKEA 2Z83A 3PUZA 2PZFA 3LO5A 2ZRGA 4S35A 4Q4HA 2FPLA 2XNDA 1OXTA 3GLIB 3FGNA 3WMEA 1E9DA 1NY5A 1UKYA 2QQEA 1Z6YA 3PUVA 2V55B 3K0SA 2VHUA 3HWSA 4EIWA 2V9PA 1LS1A 2D74A 2O52A 3OEHA 2FSHA 2QMUA 2ZM5A 4GDFA 3IGFA 3FTQA 1XCGB 1EK0A 2ZI5A 5DYIA 2WWIA 2V8OA 3VR1A 1GM5A 5JWRA 4C3ZA 2IX3A 3AVYA 3L0IB 1TU4A 1HV8A 5F9HA 4WZAE 4DT1A 4NYMQ 4Q7MB 3M6AA 2O8BA 1GNPA 3MAAC 1GIAA 5FPSA 4L9WA 1ZU4A 3PXGA 1KJYA 3GJ0A 2BIFA 1T4GA 1SULA 1LFDB 2EFEB 4EFMA 4X8HA 4TYWA 3ASYA 3UG7A 5GVSA 4DZZA 2PCLA 2A5FA 3CF6R 5HCIA 4AYTA 2IW3A 1E32A 3I73A 3VX3A 4F4IA 4ASUA 1GRRA 4RZXA 2KB0A 2WAYA 2UZIR 5FBWB 1HQCA 4D4LA 4C2TA 1JPJA 4FWTA 5E4FA 1JI0A 1IHUA 2O5VA 4DDVA 5G53C 3THOA 4ARZB 4ZDIA 3KTAA 4LGMA 5L3SA 1GG2A 4OKSA 4EPRA 1ZBDA 1SHKA 3T5GA 2DWPA 4NTZA 1ZM3A 1VG0B 3A1TA 2UKDA 4CEJA 1II9A 4NYMR 4Q9IA 1E96A 1G21E 1IN5A 4F4CA 5DI9A 2QE7A 2D4HA 2Q9CA 2WBLC 1G64A 1JXMA 4CGZA 1KJZA 2IHBA 1S3GA 3IHWA 1P6XA 2AK2A 1RZ3A 2QG6A 2KE5A 3WHLA 5B2ZA 3U44A 2QMOA 2V1XA 4KVGA 1CKEA 4OHWA 3THWA 2G1KA 4I1SA 1AQYA 4WZ6A 1ZUHA 3ONWA 3GLFE 4M1WA 4BRUA 4Q00A 2GEDA 2J87A 1QRAA 2F1JA 3SJZA 4IDPA 1RKBA 2JAQA 4JLJA 1EGAA 4M1YA 1G7RA 2F55A 3KQHA 2JATA 3QXCA 1ZMXA 1GP2A 3A1SA 5FBVB 2HUPA 3QKUA 2F9MA 3QXHA 5KPJA 2J0SA 1JJ7A 5AWFC 2O8FA 2RHDA 4JT4A 3ZYCA 1Q3HA 2OXRA 3NVAA 1CULC 1LV7A 5UKDA 3ASZA 2F9LA 1Z0KA 4JLPA 4D80A 2P6UA 4Q19A 2YOFA 2WKQA 3LBNA 4PFSA 2Q3HA 1AZSC 4LK2A 2QBYA 3K0EA 3GLHB 4TMXA 2DFKB 3UPUA 1KI6A 3FE2A 3K9NA 3MMPA 5TY0A 4NHOA 4CEHB 2ORWA 2NO6A 2FZLA 3MSXA 2JJ2D 4C7OA 2Y8EA 3EXAA 3H2YA 1U9IC 4Q9LA 1GTVA 4HAZA 1ZRHA 4UNRA 4R7ZA 4RY2A 2BBSA 1FFHA 3VTKA 2LWIA 4XWOA 4L9SA 4BQSA 3KL4A 1GL7A 1GKYA 3VU9A 2FH5B 1IOZA 3NXSA 2GZDA 4LJ7A 2CE2X 2DFLA 4P31A 4QXAA 3VNUA 3AGPA 1VHTA 3TW8B 1ESNA 2EYQA 3HU2A 1W0KD 4OK6A 3ZVLA 3GLIA 2JLWA 2QNRA 4M22A 2XTNA 1RYHA 2H16A 1T91A 2ZQ5A 4EPXA 1CTQA 2R2AA 3DM9B 2C9OA 1KK1A 2FPKA 4IHQA 3HR8A 3TIFA 1C1YA 1JXOA 1DEKA 1N0VC 1UJ2A 4BZQA 2ANBA 3WYGA 3CO5A 3CR8A 3R9IA 1G8FA 1E9FA 5FTMA 4PHHA 1LF0A 3OIYA 2GVDC
chains in the Genus database with same CATH superfamily
1I1OA 1RWBA 5LOQA 2I2AA 2OMOA 2GC3A 4IMPA 5EHNA 3W05A 4ZCRA 3FUWA 4JI8B 4P08A 2CXUA 4UHBA 4HFMA 3R3SA 5EWJB 4ARXA 3WEZA 1PQYA 3NAPB 4M5GA 2PR2A 5CX1B 3GNTA 2I1QA 1WW4A 3IJPA 1J09A 5KNCD 2ARXA 1YJTA 1OLOA 1U1CA 4NQZA 3KE8A 3LK6A 4Q0MA 3E70C 4Q0BA 4BO5A 5TIIA 3R7AA 1FBNA 4YLEA 2TMYA 2Q6TA 4DRVA 5FDLA 4S0ZA 1RTVA 1Q0HA 4LDJA 3DTVD 2BRTA 3HULA 1T8TA 3POJA 1S9EA 5IQ6A 2E1PA 2B99A 2MHNA 2G83A 5CAZA 1RI7A 2WUFA 2W94A 3MCSA 3REQB 5K0EA 1VI7A 2ROQA 4HWTA 3HPRA 1O0CA 4B3GA 2B3DA 2PLNA 4BNVA 1DBNA 4WVWA 3DFKA 3OTOB 4ZOQI 3IC5A 1AQLA 3WIEA 4DNXA 3JQ7A 3IR5B 1XEZA 3CZ9A 2YNIA 3H8YA 1UYXA 3DVSX 2X0NA 2XY4A 3UXMA 4PF5A 3P7MA 2YRFA 4BFYA 1FA9A 3W2TA 3RJMA 4QAWA 3OFKA 1S1WB 5ETQA 1ZXBA 4MMXB 3EOAI 3MAGA 4OJTA 4QIHA 3U9SA 1A95A 1ZDMA 4QNNA 3RYIA 2C24A 3ANXA 2AW5A 4G97A 4DJBA 2C9KA 1E0JA 5K3CA 5IAXA 1MQAA 1UZYA 1QFSA 3OVAA 3TQEA 2YC0A 5F1PA 5HX7A 2HJSA 5FCCA 1SM4A 3CO2A 1Q17A 4LREA 4MR9A 1FFSA 5CD9A 5L9NA 2R8EA 3VJRA 3H0OA 1VOMA 1NDQA 3L6EA 3PPXA 2MGZA 3V8MA 2DTXA 4S1VA 3HGMA 3JRNA 4JI5B 4KDCA 2XEDA 3H5AA 4MADA 4ISRA 2FZKB 3FGZA 4B4VA 3LZ6A 3WLRA 1X94A 3E6CC 4EGQA 1D4AA 2E49A 3JQ8A 3LD8A 5ENZA 5K5MA 3R1HA 1FJHA 1CE8A 3KHUA 3KYBA 4UFNA 1PNGA 1Q4RA 1PFUA 2BW7A 4EDFA 1TE2A 3ESAA 2C7QA 1GFZA 4GBJA 1VP9A 1A71A 4OFBA 4LC9A 4GZ5A 3PE4A 3DM2A 3MCVA 4C6SA 1RWVB 1WCUA 1QCZA 1I6XA 2G4LA 3BQ1A 3VZIA 4YDHB 3PM9A 3LC0A 2WAQD 1SR8A 1VJGA 3RWBA 3VZRA 4Q4JB 1ZMTA 1CX1A 5HNKA 1A7JA 4QBHA 3GYXB 2J5AA 2WG0A 1NMXA 1R00A 3PDWA 3I4HX 1D04A 1DC7A 4S2GA 2QAIA 4ZODA 1ZKMA 3GR6A 3KETA 2M5YA 5REQB 3AP3A 3B6KA 3WMFA 1Q2XA 3FOFC 3ACHA 2FWRA 3CF2A 1UK7A 1FOEB 4MUBA 2MYTA 4X7RA 4ETXA 3V5NA 1YT5A 2O3SA 2YUIA 4HSJA 2ASJA 3W8FA 5KG6A 3WV4A 1KNXA 3ADCA 4GUDA 1HNXJ 5K0NA 2VHXA 2JAXA 4K0KF 3O2QB 2HF9A 3QG1A 3O5SA 4RXTA 4JQTA 2ADOA 2VC0A 2H48B 5L9BA 3PC8A 3DRXA 2PZ8A 2E5IA 3DI6B 1LLQA 1B2RA 3E7WA 3VD3A 1E2LA 3CCLS 1HURA 1T8PA 2VTKA 1TYEB 5CD1A 4YHHF 2IWRA 3ZY5A 1DJPA 4PINA 4YI5A 2VTDA 3NHZA 3MS2A 3BM7A 2IFTA 4MGZE 1U9JA 4U7DA 1PG2A 4F0MA 4QOSA 1ZXLA 1D9XA 3RTBA 4IIEA 2RBEA 1LOFA 2FPGA 1VZ3A 4LO7A 3JQMA 3LO3A 2FLKA 2P11A 2ZJ2A 3BSNA 4QEKA 3FB4A 3W2VA 1YCFA 3V9PA 4ZARA 5ADVA 1K4YA 5DHSA 2A3JA 5LASA 3KZKA 1W35A 5J2QA 2JEMA 4ZYWA 1BC5A 1QQ5A 4G65A 2K46A 1TQDA 3QYYA 2ZROA 3UUWA 2GM3A 2POKA 5EWMB 1DNPA 5A6XA 4FQ8A 3O4VA 4F2PA 3X2EA 4BISA 2W9CB 4PZEA 4YDSA 4PAGA 4FFIA 3D0IE 2YMLA 3M3EA 3ENNA 3HP6A 1M2EA 1W96A 6ABPA 3U19A 1TJYA 4UWDA 3ZGYA 4USJC 1RUH1 4LBKA 2NOAA 3P9PA 4ZOLB 3WGZA 3RR2A 4L5YA 4NLGA 1HQKA 4X44A 1E6YA 1WTBA 3KHBA 4O5OA 3U27A 4CQLA 1UJNA 1JP7A 2PAFA 5D3MA 3TWOA 1NNEA 1GL6A 3CO0S 4YJGB 3U3OA 3W5VA 4J0IA 4A8SA 3T35A 2JFVA 1W8FA 4L5AA 1ORWA 4TMYA 2RGDA 4M9QA 3ZC3A 4TXLA 5HUHA 5DOZA 5FXMA 1GRVA 4HVAA 3KSBC 3A3KA 3RVBA 1ZH5A 2IEIA 1QF7A 1YL7A 4D92A 1QMGA 3OAAD 5EIAA 1KY3A 3QAUA 4D3ZA 2KHZA 2H65B 1HDYA 3JATB 4KN9S 2V54A 1XSRA 5F5NA 1YZ3A 5CLIA 2JDPA 2VH2A 4KR2A 3PSAA 5EZ6B 4RR3A 4LNVA 3FVQA 3HLUA 1WIWA 4U2CA 1R5JA 2ZEXA 4Q4DA 4I4LA 4HHEA 1KI1A 2DGVA 1QLJA 2Y4NA 3SU8A 2D0OB 2QFIA 1GG5A 5GONA 5H9SA 3W9IA 1DKLA 4M00A 1Z2AA 1UC4B 2VFTA 2HHJA 3TFWA 3RI8A 4KE8A 1Z4UA 4BMZA 4NKRA 2ZWAA 3ZGXA 1A1SA 4OMDA 1CUCA 2RG1A 4RIFA 4XTMA 2PO4A 2E4AA 1N6PA 2JJ1D 4LSMA 1L9XA 2MZQA 1U1RA 1KZ1A 5AM5A 1CVJA 1US8A 3OZDA 4ABYA 3PIIA 5FUPA 5C4WA 1EUDA 4IZ6A 3BSYA 3TRJA 2UVUA 4E32A 1ZRFA 1ONOA 1POV3 2KMLA 2FHOB 2OG1A 4GC6A 2R6CA 1C2YA 2PLRA 4Q9AA 1XR6A 4DZGA 1Z5GA 3G6VA 2ZITA 5BR8J 4KODA 4NR0A 2ZXQA 3I4LA 3AM1A 5J9FA 3WUCA 2JHCA 4FVVA 1Z3CA 4EA7A 2VP3A 1N5MA 3URFA 4URSA 3B53X 3RQSA 4LBWA 2A58A 2VZRA 5KJCA 3P5BP 1A96A 4LSZA 2KHDA 1XJ0A 3L0OA 4EX6A 1CT9A 4BLQA 1G6HA 2QT7A 3LKDA 5LM7E 1JJ2R 1OROA 3Q8UA 2VKRA 5KG5A 3OIWA 3PXEA 1XCMA 3AC0A 2UXCJ 3M3IA 3AOAA 3A6LA 1LJ7A 1J1ZA 2Z3ZA 2F9DA 2OK8A 5BYNA 3EF3A 1VAKA 5DNYB 1RQPA 1O96A 4YGXB 3TTXA 3BWEA 3H75A 3N5BA 1QCDA 3I1YA 4EO6A 3WHUA 5HKOA 5DW3A 2IV2X 3VH3A 4AMBA 3KCQA 3S99A 1W59A 1JDBB 1OOPB 2E55A 2XGOA 5FOVA 1CFJA 5IYZF 3UTDA 2JH3A 3ETEA 2HL6A 3WR5A 4ECYA 4DR7F 2CLIB 3BJMA 1SUWA 4W6YA 4EBFA 1W0OA 4E15A 2HMVA 5CFPA 3ZLVA 1DINA 3OH8A 2KQUA 3GIDA 2UUPA 4OX9J 3OKFA 1BZWA 2PGOA 2FRDC 5INTA 3D3EA 3OFGA 3DAFA 1QZTA 4NEGA 4LR4A 2VKQA 4UFHA 1XO1A 2YMZA 4CDUA 3JQDA 2DKNA 3FVVA 1K12A 1ZVJA 3WIBA 3BBLA 5LZ7A 4HSEA 3IZOA 4MGTA 3QT6A 2G9FA 2A9FA 2IYFA 4QHSA 3ZU5A 2B9EA 1CC8A 3GEHA 4LO8A 5A3TA 2MZTA 1SKRA 4DB4A 1L4YA 4H77A 4P80A 1YV9A 3KLMX 3ZIXA 1ADBA 4L0PA 3DGPB 4B3FX 4W9RA 3N79A 3LLUA 1W4LA 1DJQA 3VNAA 1DJLA 2JFPA 4FJ1A 1OZFA 3LK7A 1T5DX 3T7TA 4YPJA 2WTMA 2PAKA 1ZAWA 1YUBA 1R5OA 5BSHA 1Z7S2 2F8MA 5IJWA 1YA6A 1DBWA 3RVDA 4LO5B 1PBAA 2OZLB 3D54D 3QGMA 4M1KA 3BGLA 3O73A 4UUQA 4TMFA 3ZWWA 1HNZF 1Z7S3 3RYCA 4DYDA 1L7BA 1UEXC 3UUEA 3GGLA 1W2HA 3PYFA 4EL0A 1FZQA 1EESA 2HKXA 1J1TA 1M2OB 4O0LA 1UP6A 1YOBA 4ZITA 3VAAA 2ZYUX 4M9RA 4NCXA 2FCRA 2I67A 4OZNA 3QEBZ 3QE3A 2HMIA 3MMAA 3NOVA 3OQVA 5HQLA 1MX5A 2PXXA 3PJEA 1L7RA 3DNMA 4RH0A 1P1RA 1CDOA 2VJVA 3RVRA 1DGRN 1HJFA 5DAVA 3O1TA 4YAWA 4XOGA 2PMFA 2W3JA 5D6OA 2W2IA 5LEKA 3UN1A 4MQFA 3M0EA 4CR6A 4NBSA 1V6OA 2OKXA 1SBZA 2Q2WA 1QRSA 1DRWA 2NO9A 2IELA 5CJJA 4DV5J 1KJNA 1JHYA 4XDGA 1PKXA 4YWHA 4DC1A 5AOAA 4E2SA 3MV01 4ZO7A 5DHFA 3HV0A 1O97D 4QAJA 4WD3A 3A05A 1RQ2A 3DE7X 3RCBA 2XCUA 2C58A 2YDEA 4AR2A 2Q1FA 2JX2A 1FRIA 1XFDA 5JWOA 2CHQA 4YREA 3UA3A 3NPAA 3DYBA 2DH8A 2NS1B 4R5PA 1VLOA 4DMRA 3O8WA 2Q28A 3VPGA 2HA6A 4DRRA 1P1LA 16PKA 1H9AA 1X7WB 2HI0A 4HFJA 3POIA 2EKDA 3FZ2A 2RDSA 2A1UA 3MM5B 1UMJA 5J2MB 2QX4A 2JCSA 2WJWA 1GGVA 2IXIA 4RM2A 1RA6A 1YQ9A 4V0KA 1D7AA 3V4VB 3FGOA 3JZAA 3KU4A 1NZJA 1XB2A 2G88A 4DV5F 1Y7IA 3NG8A 3M34A 1AIPA 5D15A 2JJ6A 4L0QA 2JH9A 4PIXA 4RMIA 3ZTOA 1K6EA 3NGLA 5FL7D 4BC7A 5IJ9B 3Q1LA 3RAEC 3A1NA 2CQBA 4P32A 3FZNA 3I0RA 1FDVA 4HN4B 2KM2A 3CTRA 4PPQA 1MZPA 4U1RA 5DB4A 3EEBA 2AV5A 1B35A 1GTL1 1NSQA 1OI4A 1GDDA 1CSEE 3AVRA 1G18A 4O3NA 3LWCA 4QTUB 1KIFA 3CMES 2H54A 1DZTA 1BGXT 4AY3A 4CO4A 1Y3CE 3QNWA 4B7EA 5FPBA 5EUCA 2HA0A 3WDTA 5C1DA 2VDWB 3O8BA 1PJ7A 3OLAA 3UANA 4V1PA 1U47A 4Y2KA 3BBFA 1HWLA 4Q8FA 5HZMA 2FQPA 1YGPA 4CUKA 4CMHA 2P6SA 2Z3VA 1S6YA 3DJFA 4F83A 3L8YA 4GLFA 3QLHB 3NIBA 3FPFA 1IR1A 1CQIA 3GJ8A 5K1ZA 2LCIA 2H4XA 4QXMA 3HTXA 1A6LA 1Y4UA 3MXTA 4LK3A 3PYMA 5JZGB 1DGWX 2QZ9A 1VGRA 3RJ5A 1H9PA 4XDHA 1HG1A 1FNSA 2VPPA 3H1EA 4XGQA 3RRZA 4BFVA 3VU1A 4C1BA 2QSUA 1KD1T 4ONUA 4LZOA 1YD7A 1Z56C 3WP3A 4J3FA 2FZ4A 1VQSA 5KINB 1ZN9A 1BD6A 5HKKD 3UMSA 3FVTA 3IDOA 3N7LA 1SZCA 3FOWA 2VL4A 4KI0A 4F4KA 4BO6A 1OLUB 4LJRA 3PC2A 1BU8A 2ZRCA 5ALFA 3H3UA 4RD2A 1IY8A 1MS8A 1OGJA 1V3RA 1ZRSA 3WKEA 1B93A 4OFGA 4X1KB 5B3LA 1BU5A 5EEHA 3H5TA 3V1MA 2UXBJ 4M1QA 4CODB 1EB0A 4JV2A 2YXDA 2PDAA 4QJBA 2GFHA 4ER6A 1KWGA 1I5ZA 1VLHA 1XCLA 1P5HA 1XRQA 2X4IA 3TMAA 2ZR7A 1DTQB 4GWMA 1W90A 3BSSA 2A2DA 4RF4A 1H0KA 4CXMA 5IH3A 3R5DA 3KV4A 5ABPA 2JVJA 2V2VA 4UTXA 1YRBA 4H4DA 5TLSA 4BX8A 4FF2A 3WLOA 3D66A 4ZYVA 1HXS2 1QHNA 1OIXA 2REOA 1W9SA 2GUWA 2CQ4A 1GR3A 2NMOA 2QZ3A 2XPCA 3Q3IA 3GIKA 5C18A 3HCXA 1HXS3 5CVDA 1CRQA 2B4QA 2C54A 5EGYA 4OP3A 3CLUC 1IQRA 5HWSA 3MT0A 1FX1A 4BB3A 5T3UA 3V32A 3PW4A 2W43A 5A7SA 3VMFA 3ZHRA 2VD7A 4QWNA 4Y67A 2ZX4A 1KORA 3AETB 4EZIA 1CY6A 3SLGA 1VRH2 1PM4A 3GV7B 1JMKC 3G8TA 1DQ0A 1SQ5A 1UPUA 1MP0A 3AOCA 3MWFA 3SR0A 2OXFA 4CO1A 4ER7A 2ZGLA 1BW9A 3KLNA 1VRH3 5C3RA 4KFRA 2YMQA 3PQ6A 2GN3A 2VCHA 4A0FA 1JB9A 4V19X 3AKDA 2W37A 5FAKA 3RFTA 4XMAA 1OFGA 1V70A 3EMTA 1EUZA 1RISA 1GICA 3W59A 2YHBA 4QDKA 2OV3A 2AYGA 3K92A 5C8WA 3L8HA 3L9WA 4BCDA 4R7TA 5KBFA 1FK9A 2V8GA 3S55A 2CYYA 3PR1A 2QL5B 8GPBA 4QXOA 4UAUA 2AN3A 1GK8A 1SPBP 3WBFA 3EISA 1S1CA 3UVEA 5HXAA 4ARYA 2EYUA 4QEDA 4OHVA 2C2NA 2YNMD 2JAUA 4JB2A 4X4SA 3QWIA 2W2MA 2OAEA 1GZ4A 4LKOA 4XVHA 2FR1A 1JE1A 2ZRQA 3DBOB 4OHZA 4EYGA 2Y1EA 3O8OB 1ZN2A 5MGNA 1APBA 4O23A 4E11A 5G40A 4K03A 4JQZA 1XDDA 5CLGA 1FTYA 2HRYA 5HBMB 4HXCA 4K1ZA 3QVLA 4NYJR 4L7VA 1YZGA 3U37A 3MPVA 4NXNB 1VKRA 5CGZA 1T5HX 2WSFC 2A10A 4IHJB 3JQ9C 3V8PA 1GR1A 1AR72 3FM9A 1WHVA 1KBQA 1VIDA 4U0KA 1MO5A 3PFCA 2WRZA 4CYDA 1WXWA 4QODA 2BE7D 4ZHRA 1QJX2 1Y3TA 1HNWB 1AR73 2VJYA 3KB6A 4LZJA 4A8MP 2H1CA 4QJ3A 4AFBA 1YLLA 4XYLA 2XVLA 5BQOA 3P4UA 1J0DA 3ONQA 1QJX3 1NQVA 3CMQA 1POV1 1WG5A 4FS1A 2FWNA 3I9MA 5I7SA 3D31A 2DHQA 3IVMA 1NJGA 4B6FA 3RR8A 3WLHA 5BNPC 4RNFA 1GUBA 5FT9A 4BUZA 1BQPA 4YPFA 1QJY2 4NS4A 4XHXA 4XFDA 1ENPA 4MVJM 4Z9FA 3O47A 5DYWA 3MMSA 3S29A 4O3SA 4KR0B 3A36A 1QJY3 4ASUD 4TXWA 2HA2A 4IEYA 4AUKA 3LX6A 4B46A 4ZIWA 1VI6A 2HMTA 2YMPA 4GMGA 1XD2B 4A0GA 4EHDA 5FMBA 4X1IA 4Y2YA 3EGOA 3ZYHA 2ZEWA 3PB3A 4CP2A 3EHKA 1T9GR 4M4RA 1V6NA 4IWNA 1DEAA 3L77A 4E98A 3H7IA 1Q95A 1KEXA 3RUEA 2O2HA 3KHRA 1H2BA 1YDMA 2XQKA 2CE7A 5CA0A 5A0VA 5LK5A 2C5AA 4KIGA 2MY7A 4G84A 2YDXA 3FCOA 1XYOA 4F3YA 4IDNA 1KKUA 4W6WA 4M2LA 1OY8A 1G7CA 1G66A 2BGIA 4QU0A 4LV8B 5BN4B 4OYIA 3BG5A 1RIRA 4JSRA 2OGZA 2G63A 3EUFA 3W7AA 3JQEA 4HNQA 3RGIA 5B58T 3FA2A 3NTVA 2KTQA 1YJXA 3KQPA 2FR8C 1NSTA 4DPYA 4NLXA 2PJRA 2AW0A 5FBLB 4DARA 1JMTA 4OLLA 4WVFA 3DD1A 2UXDJ 5EQJB 1YQEA 4MWOA 4UQGA 3CZPA 2XJSA 3EHEA 5LJLA 1I6WA 2X0DA 1RYEA 4AJEA 3GRKA 1RXCA 5JSHA 2CRLA 3AL0C 3ROTA 3DU5A 1S1UA 2WYHA 4CYUB 5FYSA 4Z4EA 3IT3A 1XQVA 5HCAA 1UEUA 1YCIA 1P2SA 2FN9A 1K8ZB 4WBNA 1YQHA 4XVUA 4X65F 2HK7A 3ONVA 1W4ZA 4DNYA 4LF5J 3DXUA 4Q24A 5AW8A 1JXAA 1LBSA 4HLQB 5AK0A 3MGCA 2QQ0A 3L6CA 3AP1A 3RVOA 1CERA 5JXSA 2V4MA 1XN9A 4KPEC 5E7QA 4D46A 5JW6A 1BCSB 1WXIA 1NZIA 3L09A 3JTOA 1DMSA 3I59A 3MR2A 4R3UC 2JAOA 4PYMA 2WR9A 3ZDRA 4UUNA 4QGGA 3NGKA 1DJOA 4FLMA 3GFYA 1G8YA 4LK7A 1J0XO 2UXDF 4HNAA 3EOBI 1AXQA 4JDNA 1RC6A 2CXNA 1TAQA 4HHHA 4GKAA 5C25B 1V7QA 4ZO8A 3PHHA 3TLMA 3FWPA 1S6PA 4OUKX 3WWOA 3HMYA 3DRSB 3TBKA 4U5XA 2WVDA 4ZVLA 4OV6B 3DQZA 2BBTA 2J31A 2OAP1 2IEZA 5L7YA 1N92A 1U24A 4CIWA 4NOHA 3C7GA 3UGGA 4AFDA 2P2SA 1XMPA 2RK3A 5AHRA 5LA6F 3I09A 1WG4A 1GPWB 1B6RA 4OM8A 2W6OA 3UJ8A 3I5MA 3H1GA 4FFHA 3PMEA 1RPNA 4FKXA 2O8FB 2C4XA 1ND2A 3WDYA 1GAJA 2F64A 2PY6A 2PZLA 3C8MA 5KAPA 2GJIA 1N5LA 4KIFA 2LP4Y 2BEUA 4JI3J 3T1VA 1V8DA 2I71A 1EUUA 3FOZA 4HAUA 2F8EX 3GN2A 4I2PA 3NEJA 1P1KA 3D6AA 2Y99A 2HQCA 4BECA 1QPZA 1G9FA 2YQ0A 1OWPA 3SEZA 1SB9A 1F9AA 2OEKA 1MJNA 3OU7A 1A9ZA 4WERA 3FW1A 3HWSA 3NIFB 4Q7AA 2PHDA 2QMUA 4F84A 2X5XA 3G8AA 4IIUA 1LCIA 1RWPA 3LSEA 2P8SA 4LHSA 4L78A 4NYMQ 1E3WB 4OGGA 3Q22A 2W6QA 3IMMA 1BE8A 2G1UA 3AHEA 3RU3A 3PYEA 5KX5F 1NCQC 3COWA 5DJ5A 5WRFA 4LT5A 3X44A 2IW3A 3CJXA 1RVF2 2BR3A 4NBNA 1XVUA 1NU8A 3PWKA 1JPJA 4ZDIA 3PUHA 3R7SA 3AFGA 2JLCA 2EF1A 1AMNA 3HZOA 2X8KA 3KSDO 1RVF3 2DPJA 4MAMA 1VBC1 4WDRA 3WTCA 2ZOEB 4O44B 4S1OA 2D4HA 4BNGA 5K6RA 1JXMA 4S2FA 4R69A 1MFPA 1R89A 1AR82 1LRKA 1P6XA 4JI3F 2QG6A 2CSGA 4LF9J 2R061 3THWA 4UMDA 4BPZA 4DU7A 4AO8A 1OPOA 5DJBA 3NW9A 1W6NA 3ZBPA 3S44A 5HYVA 1G7RA 5EWFA 5KFFA 1XNHA 4E88A 4F21A 1E77A 5UKDA 3L92A 2NPOA 2P6UA 4IO9Q 2HHVA 2O1EA 2QBYA 4IFYA 4FJ0A 1J9GA 3WQ0A 1LR5A 1B0ZA 3MLAA 1GPH1 1U9IC 5ANNA 1C1BB 1FFHA 3MQFA 2BOJA 3PD0A 1Q8SA 2DITA 1W0KD 4M22A 1W0PA 4K40A 4RA6A 2YH0A 3DM9B 2K2SA 3K15A 5FV3A 3TIFA 4EG4A 5IH7A 5CPFA 2E4VA 4QDXA 4BZQA 2Y26A 3NJVA 3CO5A 4NWBA 2K87A 1MSWD 2H5EA 2G82A 1DBSA 2GBFA 4Q9HA 3K2QA 3P2MA 1NRJB 2WPNA 3HVUA 1CVNA 2QFJA 3OC6A 3ICEA 1LXNA 3S28A 5EDWA 4UF4A 1Y9GA 4C1NA 3V55A 3H4BA 1F1BA 3HQRA 3ZUPA 1SOVA 2HPVA 4BV3A 5JS7A 2FUEA 4KXWA 4TKLA 1T34A 3EGVA 2MMCA 2WYFA 2WOMB 1EMDA 4ZCTA 4Z7NB 1YMVA 1IIRA 3G96A 4X84A 1GTMA 4J1TA 1CUXA 4NDAA 4POOA 3CBGA 3BFPA 1AF7A 1WUVA 1C1XA 3M7AA 2P1ZA 2ZB4A 3HPOA 1TQLA 1GCGA 4FVTA 3IP6A 2YPYA 4M3NA 5AI9A 2M88A 4KWKA 2K4MA 4XQ4A 4YAJA 1FW6A 1MOPA 4MO3M 4AKGA 2NV2B 3O1UA 5IV3A 3ETCA 1Q44A 3QIVA 2PN5A 3G79A 1FDNA 1XERA 2EK1A 4ILLA 1WHSB 3U4IA 1TUVA 2VBXA 4ZVQB 2P3SA 2Q6VA 3DE0X 1KI4A 1IQPA 1L5FA 1ZESA 2R7SA 3KV3O 4TN5A 2FQXA 2OD6A 1URXA 1HXS1 4AE2A 3ZHCA 2PS9A 5F7XA 1XTZA 1NRWA 1SQ6A 4MV6A 3TIXB 1RZRA 9LDBA 3FNFA 3I96A 5KQGA 3N9QA 1NZCA 4GVBB 2YZ7A 3VO8A 4YM1A 3IUMA 1HV0A 3I3EA 4K2HA 4RNNA 2G9UA 4J5OA 3AKTA 2WF6A 2XSZA 1HMVB 1FUIA 1VRH1 1L8QA 4ENQA 4LSGA 1Z2NX 3IP9A 5FMOL 1V41E 3HFRA 4EECA 5TSDA 5ETPA 3LSDA 4Z3DA 3MGBA 3D8RA 2QR5A 4DS5A 2R4TA 3UAOA 3OCXA 1DUIA 3IT2A 3IBMA 4N39A 3NKFA 3LUYA 4TS4A 2GARA 5K0SA 3MWKA 3SZOA 1JXNA 4FT8A 1Z6AA 4NMMA 3W9YA 1KSJA 5DRKA 5ALOA 2ZSDA 4JB0A 2VDMB 4U2AA 5F8IA 5JAMA 3JXSA 1WELA 3HJHA 3KQYA 1M2GA 3O3OB 1D5WA 2Q21A 3QRWA 1QHIA 4UVEA 5EP2A 3ZZ0A 2XTJP 3FR8A 1N32F 4L8FA 3BOPA 1BKDR 2C0PA 3RK4A 4D9HA 2HREA 3ZTRA 2NU6B 3VKVA 4DINB 4J43A 3H9CA 5TQVA 4KFTA 3SHOA 5ER6A 1RL3A 4DWJA 1U12A 5I9IA 4WZBA 2VCCA 3D5TA 4USUA 1W6PB 2RMLA 1G1AA 3GVHA 1R092 2XMKA 1SB8A 4DF3A 2DECA 2IODA 4B9UA 4RM3A 3PFGA 1CEQA 2EP7A 5BMVB 5DX8A 3MLLA 1R093 4XTPA 1QJX1 4RSRA 5AXBA 3K4QA 3CJRA 4Y98A 5C24A 5MN6A 4JMPA 5GVQA 1A5SB 4LJ8A 4QFCA 4L02A 3UCEA 2HQFA 5IATA 2C84A 4DT1B 4ZU1X 1ZONA 1XWIA 2IXKA 4IG9A 4MP6A 4V39A 5K6AA 2B7BB 1H8ED 4YMSA 4MQEA 1NNLA 2OCXA 3FUCA 4NLPA 1KO4A 2DUUA 3SZUA 1L1RA 1LWNA 3B3AA 3N6XA 2IS2A 4CUCA 5KYUB 4BOWA 3GZ7A 1CUWA 3LWNA 1GG9A 4LX8A 4ZQFA 3EQ9A 2EFDB 1B6SA 3TP2A 1A69A 2W7OA 4RS4A 4GM1A 4Y26A 2GBPA 3EY9A 1U0NA 3DKRA 4L6CA 1GTSA 1E6MA 2FEPA 1H2EA 4L15A 1O5LA 4ZY9A 4HEHA 3IP0A 3IPRA 3KPYA 4B3RF 3Q6IA 5LMUB 4Y5SA 3PLRA 2YKNB 1X7ZA 1TELA 3P2EA 4XCBA 3BMOB 2VJUA 1E1QD 4YRSA 2CV2A 1XUOA 3VJKA 4G1PA 1ODKA 3LUPA 4PRFA 2ERXA 5CT4A 1VBA2 3ZN6A 2BGGA 3UK6A 3WLIA 5JOQA 2BKEA 1FMD2 3BTSA 3NJ4A 4F5EA 4H17A 3MWDA 3MINA 2LROA 4GO1A 1SLLA 3FLEA 3T5BA 1K6IA 1MTOA 1YZ6A 2ZCUA 3NV4A 1Y43B 3E0QA 5L7OA 2IYSA 4OZXA 1GEHA 5A5GA 5HIAA 3PNVA 4BDVB 5B0BA 5LBEA 1WOYA 1QVVA 3OFVA 2VU5A 5AMXA 2M6RA 5LXYA 1XCPA 3EYPA 2P69A 4Q4X1 1VL1A 4L97A 4B8EA 1PYOA 3ZYPA 3H3JA 4TYPA 5CDFE 3ED1A 3WRYC 5E3JA 2DCUA 3LCJA 1ISPA 5LXTB 4FMPA 2FE4A 4DBLC 1M2FA 3ZU4A 4HZUB 2M8DB 3F6YA 3IEVA 4LX0A 2XGXA 5A4KA 1KE2A 5A33B 2YGLA 5ILGA 1X8EA 3L0YA 1FP2A 3ERCA 1EQUA 3USZA 4LHKA 3T6JA 3EPKA 2E9SA 3GY0A 5AXCA 3NQHA 1L3UA 1JZ5A 4N5DA 2WG2A 3CCMS 4FTSA 3WFZA 1TEXA 2EXJA 3ZXWA 1XC7A 1QWOA 4JI6J 4OP1A 5FP3A 4X24A 4YDDB 3BDAA 4R8UB 2BR4A 2ZRHA 3R41A 1TAUA 2GT1A 2X5NA 3EZLA 1EFTA 1TF5A 3W6NA 2BEVA 3G0HA 4AQYB 3C15A 1WVGA 2Q5EA 4I1YA 2BVNA 2N47A 2WV7A 5HKAA 1SJ1A 2C4MA 2WF7A 5KWJA 2WY2D 5EERA 3D6EA 1ZS6A 3KB8A 3RTVA 2RDIA 3FHQA 2NUPA 2IAJB 4CCNA 2F3JA 3EBOA 1MB0A 3PIRA 4PAWA 3BORA 3ITQA 3HP7A 4DCNA 3L4JA 3DECA 3PFIA 4NA1A 4FSDA 2ORYA 4W7IA 5IDVA 5BYJA 1U8SA 3IUPA 1N0UA 3E6AA 2WTXA 1JBEA 3CBQA 4Q27A 1FXZA 3N8HA 2FJUA 4Q1RA 5ES4B 3KBBA 3GJ3A 1P60A 1I6MA 5DM4A 1L4MA 4DV1F 2QUIA 5IDWA 1NUQA 4WOKA 4MWBA 3PXAA 4XXHA 3RZLA 4EW3A 1EIZA 4R84A 2PELA 3UGFA 4JIGA 1PIEA 1MJ5A 1O6UA 1NKGA 2FG7C 3JTPA 3CMMA 3VO1A 2ZRBA 1OREA 4XVCA 4MGZR 5IJZA 2GNBA 2HPHA 1PVVA 2OBMA 3C6UA 4MIEA 4LE4A 2IVMA 4UUBA 3FEZA 1OKKD 3JSMB 1HKAA 3VYRB 3MM7B 3V4ZA 3M6WA 1FTSA 2CWSA 3V2IA 1Z7BA 1W8DA 3PHCA 3E9RA 3PG9A 2WAOA 5E5NA 4QNRA 1QHYA 4Q4AB 5FYBA 3KUXA 1Q0UA 3D0HE 4TWZA 1RHUB 2L9NA 5A70A 1A9NB 4LLFA 4FQ4A 2XJ4A 1IUJA 1BCRB 2G0AA 1KJLA 2D2IA 5BSVA 1YL6A 1HTWA 4TTRA 1DFGA 1LY1A 4OQXA 3S7EA 4DUVA 4ZXFA 4N0DA 1ODNA 2NN3C 1LOCA 3AONB 1CB7A 1N6LA 3MWLA 4YV7A 3CIZA 3GQBB 4IRKA 3V4IB 3MCWA 4OHYA 1XP8A 5JNLA 3MUMP 3ZVKA 3BN6A 2R2RA 5A7GA 2JI9A 1S1TA 1XCJA 5JH7F 3F4KA 3R2JA 3NXKA 2GEJA 2DGSA 2YKMA 2LKCA 2ACWA 5CD4A 3VDNB 4YAEA 1VB3A 4RCZA 4ORFA 5JXJA 5IAEA 3D5MA 3QQPA 2ZSBA 2Q3JA 3H97A 4CP9A 4JCCA 3H0EA 4DG1A 1JSLA 5EESA 5EJZB 3K35A 2CMKA 4L2NA 1C7EA 2ODAA 1SL0A 1L1EA 1VA4A 3F9RA 2P27A 1P74A 3CPHA 1EP9A 1Q7YT 5CCXA 4R83A 4LK6A 5F5LA 2G6TA 1NKVA 2XMQA 4DDUA 2BISA 2BONA 3N9NA 3DOKB 1Y1SA 5LZ8A 3IIEA 3LXRA 4XLTA 3BN7A 5F7UA 4TZTA 1GPYA 5D01A 4J0FA 4HH1A 2A5DA 5H9VA 1WU7A 2IVZA 3AY7A 5KNDH 4E5YA 3I6BA 1C9JA 3U3XA 1N5QA 3OBIA 1NXXA 2WC1A 1Y6FA 4X6LA 1LW0B 1SV5A 3L79A 2ZNZA 1Z73A 3QXJA 3N8KA 4UBMA 4JBWA 1PK8A 4UOZA 4JLWA 4RBUA 2JIGA 1IXKA 3N2KB 3MDFA 5M29A 5AJ3J 5ETOA 1NCLA 3B70A 3SHQA 2NO5A 1MU2B 2WJYA 2OZJA 1JMUB 1JBQA 1X7HA 5CA5A 4JAAA 3D6TB 4JYBA 3W4JA 3WJ1A 4K9NA 4UM7A 2G9OA 1U7WA 4AKHA 2XF8A 3AR3A 2Q2VA 2RGAA 1RI4A 5FY4A 3BMNB 2GN4A 1M1YB 2YWHA 5IZHA 3OZEA 3RTDA 3FQKA 4E4SA 2MMYA 5D51S 3HHLC 2OCIA 5IRCD 2J0WA 2C5DA 3WLNA 4DX7A 4Q1PA 1X5SA 3JWGA 4RY9A 4LF6J 3DVQX 1AJEA 2JLQA 3ZE8A 1D8YA 3BO3A 3OZWA 1IKWA 1WACA 5FY7A 4A16A 2CVHA 3G9CA 1K8QA 3RV4A 1VIXA 4NNJA 1JH9A 1VQPS 4I50A 1NW8A 2IOFK 3MT7A 2UUCF 2B8QA 2BRUC 4WFYA 3UE2A 3CHXA 3NH9A 3HCWA 1G7YA 1Q15A 4G0XA 1H7XA 4UHEA 4WEQA 3R5AA 2J6BA 4AS1A 3DMTC 3ME2A 4BJ3A 4YHBA 1R0AA 2BFFA 2ZZJA 5CKQA 4GM0A 4NLTA 3W5YA 4R9UC 3PIPQ 4PBSA 3UT6A 4BFZA 2BSQA 4B3TB 4LJSA 5GVRA 1BYUA 2PGCA 2WEKA 4Y9TA 1PUXA 1R9GA 2E82A 4GOLD 3MI7X 2ZFUA 4E2XA 4N8DA 5CG9A 2AZXA 5FY8A 4RXUA 4X3OA 1EAH1 3CRQA 2HWB1 1DRJA 1OH6A 2JA1A 1T6BX 3QBCA 2WT9A 1NN1A 2ZJ7A 2ADMA 2ATEA 4N5LA 3Q8XB 1C5IA 3KLFA 2F4VF 5G0WA 4ARIA 5JDCA 3MAHA 4E6EA 2X1GA 1C57A 3IALA 3CCTA 5H9FJ 4OLJA 1NBEB 4DUPA 1N1TA 3VRHA 5A02A 4O29A 3AUXA 4RW9B 4O3FA 1J22A 1FS6A 4X3PA 1M73E 4GB32 4DDKA 2PD6A 6ADHA 2KVIA 1RJEA 4PYQA 4CP5A 2ZI7A 4AI0A 2C3OA 5K5EA 2ZULA 1CY1A 2PL3A 2P6RA 1AYN1 3GLJA 1HLDA 2Z6UA 3JSBA 1CLFA 3OTGA 3NP9A 3H2HA 5AVKA 1OBNA 2XSJA 1WBBA 2J6HA 2WDZA 4KY3A 2PT7A 2EXXA 3F7OA 3DRYA 2VFAA 3ZQUA 3VR3D 1YASA 3SXWA 1JDZA 2Y1KA 1GKKA 2WPDD 2J09A 4HQNA 2J1SA 4JN6B 3GYBA 4QX6A 4UTNA 4Y4RA 3L7NA 2XBO1 3ZYGA 5M7EA 1TD9A 3DO8A 1PSDA 2NSLA 2DTYA 5T5PA 1F5JA 2MZJA 1LNSA 1OXVA 1CF2O 3T52A 1R091 1FD8A 4FZ3A 4KWTA 2XKAA 3LFHA 5BN1A 2A9RA 5DIFA 3BEOA 4P1ZA 1E0AA 4Y20B 3U0VA 4CFZA 4CI9A 2QA4G 2FY8A 1YZQA 3RSGA 3NVDA 4EUKA 2GK4A 4G24A 5A5FA 3E7DA 5EPAA 1FDWA 1XVVA 4GKBA 2JICA 2K2QB 1VKZA 2IVFB 3KJIA 4FCWA 1E5IA 2EATA 2ZAAA 4DFMA 1PZGA 4IETA 4CCDA 1SVUA 4B82A 1UOQA 2YYSA 2WA1A 3L4SO 3V7WA 1BBT2 1PWHA 1E63A 3CQ9A 2PAEA 1FVOA 2EIBA 4LCEA 5DM7Q 5EJGA 2OA0A 2JD0A 2WF8A 3SK0A 2UYQA 2WNVC 1BBT3 1H73A 2F1KA 4Q3BA 1FXWF 2FCVA 1XV5A 3DZGA