4OI4A

Protein complex of clp1 bound to atp and mg2+ with pcf11deltan454deltac563 of s. cerevisiae
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA specificity and regulation of catalysis in the eukaryotic polynucleotide kinase clp1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords mRNA cleavage and polyadenylation factor CLP1
total genus 125
structure length 428
sequence length 428
chains with identical sequence C
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4oi4A01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oi4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oi4A02
2YOFA 5HZKA 3B6EA 1RFLA 2LCFA 3CRW1 5A4JA 1KK2A 1GSIA 3UWOA 5EE5B 4PR0A 2CLSA 2GCPA 1NVWQ 2C78A 4Q9HA 2NOAA 1XPUA 2NMVA 3GEIA 4TLCA 4BEBA 1XMIA 3T12A 1L8QA 5IK2D 4GMXA 3DKVA 2WJJA 4KU4A 2RGGA 1GZSA 3H84A 3AVVA 4UNNA 1HT1E 3AVPA 3DDCA 3QKRA 2TMKA 4HB3A 4D2IA 1C1YA 5JWRA 2GKSA 2GESA 3TK1A 2B92A 3UMFA 2ATXA 1JALA 1TU4A 4LPSA 5J4VA 1E2IA 2ZQ5A 4TT3A 3TUJC 2Q9CA 1TX4B 4JT4A 5J47A 1UM8A 3AQ4A 3KTAA 2A3RA 1G5RA 4PSKA 4C0QC 4Q1CA 4PFSA 1KI9A 3PQCA 4URWR 3SHWA 3ZIAD 2QQEA 2F3TA 5EP3A 5LB4A 4A0GA 4EPTA 5DN6D 3S1AB 4FMCB 4HLQB 1XTQA 1CRQA 1S3SA 1HH4A 4C9BA 2OESA 3ONWA 1OHHA 2AD5A 4CZ2A 1T91A 1M8PA 2AHOA 4Q4JA 4D0NA 3UG7A 3FKQA 2KI5A 2NO0A 2ASEA 3Q7QA 1UDWA 1ZW6A 3UG6A 2P2LA 1RJ9A 4MUBA 4G5OA 2A30A 2I3BA 3EG5A 3SJAA 2PT5A 3PUYA 3AH8A 4LJ9A 1P5ZB 1SVWA 3B1VA 3M6AA 4CYMA 1R10A 1JBKA 2YWHA 2IYUA 4LV6A 4TMVA 2C03A 1OKKA 5F2EA 5C4GB 4KI0A 4OQFA 3K0EA 1NN0A 4QBIA 3RWOA 2ZJ2A 1RRGA 2JIZD 3QKUA 3PEYA 2W6ID 3PR1A 4PSAA 3FMIA 1ELOA 1ETUA 1JAHA 2VP6A 2ZRPA 2VPPA 4FCTA 3KJEA 3J81k 1XXHB 4KFSA 3R20A 4OKSA 1IN8A 5FOTA 4D4JA 4KSCA 1SGWA 1DS6A 4N0DA 3RHFA 4LJ5A 5DYGA 2IEZA 3PENA 1MT0A 4DB4A 1U0HC 1XCMA 1AJEA 4PHFA 4LV8B 1QVRA 4MUAA 1E2MA 3U61B 1PVOA 3N5CA 2C9YA 3UK6A 5TMPA 3LX5A 4B48A 4LYAA 1MRSA 5TXGA 3ZYCA 2YKGA 3NDBB 4OHYA 5JJLA 4TN1A 1AS0A 2VSOA 3T06B 2ZRMA 2GDJA 5JBQA 3FOZA 4M1KA 1IY0A 2XNSA 4YMWA 4DC9A 2FX3A 2UZIR 1A2BA 3H86A 3CZPA 2R65A 2JA1A 1KJWA 2OEPA 5KSOA 2WICA 2QRNA 2BBTA 2PZFA 2ZXUA 4F91B 3FTQA 1KTVA 1NJFA 3KDSE 5B2ZA 4Q1AA 4FCVA 3ZS8A 2IUTA 1Q22A 2NIPA 3P1JA 1ZCAA 5CJ2A 3VQTA 2BBSA 3BFVA 2ZAOA 5AUPB 1YU9A 1Z63A 1CR0A 1EWRA 4P0TA 3LVQE 3T1OA 2V7QD 3RS2A 1T3LA 1WE2A 2MSCB 4BFUA 1UFQA 3U6BA 4D4KA 1FPMA 5IK2A 4ARZA 4P33A 2G6BA 4UKDA 1KHTA 2ZYUX 3PUZA 5JRJA 4NYIR 4V0KA 4AYWA 1XMJA 1F2UB 2QY9A 3UWKA 2OAP1 4DLRA 2JLUA 2H8KA 3VR5A 1ZD8A 3I61A 5EXXA 4QC2A 3U4QB 3K0AA 2XEXA 3FHTA 2XJ9A 3QXCA 1U9IA 3SYKA 4ZI2A 2CCGA 1XEFA 1J8YF 1IJFA 4Z1MA 3RRYA 4BFWA 3GLGB 4OJQA 1EESA 4AI6A 1BYUA 4R2IA 1YZGA 3ZVRA 1KI6A 3UANA 2QTHA 1T8UA 2H16A 4ZDJA 2H18A 2YC4C 2G77B 2BBOA 4M22A 4NZYA 1F6BA 2GHIA 4DLWA 1W4BA 1CBUA 1Z0IA 1H65A 4B32A 2I1QA 2YV5A 1P9WA 4IDOA 2WWIA 3HR8A 1OF1A 1BKDR 2Z5FA 2H57A 5BN3A 1Z6XA 3TH5A 4A2WA 3K70C 1P4SA 4DDWA 1G64A 1SXJD 1Z0AA 4URXR 1EK0A 2REXB 1KZGB 3RWMB 1EFTA 4IDQA 5KNCA 5AUNB 2V9PA 3AGPA 1VPLA 2HT6A 2VEDA 4DWJA 3T15A 4E07A 5H70A 4DDTA 3ASYA 2P6UA 4JVMA 1Z08A 1KGDA 3LRPA 2ZI6A 1MV5A 1VG0B 3OE7A 4JVSB 4LDJA 3CUEF 4I4LA 3P4XA 4WW0A 2GRJA 4NH0A 4LBZA 3TMKA 2FH5B 4ZIRA 5HZHA 2CJWA 1D9ZA 2G0NA 1NSFA 2J0UA 2YOGA 4EDHA 1QHIA 2ORVA 4NYJQ 1OH6A 3REFA 1MO3A 1GM5A 5TY0A 3EARA 3MAAC 1P7CA 3AEZA 3AVOA 3SC3A 4CF7A 1GRQA 2HLDD 4LHVA 2OBMA 1TEXA 4MKHA 3KKOA 5KDOA 1G4AE 1KJYA 1YE8A 1TMKA 3CX7A 2ZU0C 2GJSA 1RRCA 2NPIA 3EW9A 4L8GA 3W8RA 1ZM2A 4MH0R 2IHBA 1BO6A 3LLMA 5JCPA 1W7AA 1LW7A 2C2HA 2VIIA 4DBLC 1E2LA 3QPWA 2ZSDA 4F7WA 2V1UA 4FMDB 4QM6A 1IN5A 3HJNA 3LQQA 1LVGA 3KXIA 2WJIA 1UJ2A 1N0VC 5BWMA 3ZS9A 1DVRA 4DVGA 2QEQA 5UKDA 3WRYC 1ZC4A 4MYTA 4M53A 2BKUA 2XTZA 3PV0A 1Z6GA 2JLSA 1JR6A 621PA 3NVAA 2AKYA 3LW8A 2GILA 3KKMA 3MGCA 3SNHA 3SHFA 3NH9A 4BWYA 5CB8A 3VR1A 2XXAB 4IDNA 3W6NA 4PC7A 4A8JB 4UXHA 3QJYA 5CYPA 2CXXA 1N6NA 2QI9C 3VFDA 2JDIA 1T3HA 1T8TA 4LJAA 4MRPA 4E03A 2VHJA 1P9RA 4HAVA 3CF2A 2EU8A 1E9RA 1HQYE 5L3SA 4A15A 4QJ4A 1Z5ZA 3IKJA 1ZC3A 3SR0A 3WY9A 2DHRA 5G40A 2IX3A 5KDDA 2W00A 1DAGA 1F2TA 1T5LA 1XPRA 2JJ2D 4Y0AA 1COWA 1ANKA 1XEXA 3GJXC 4NCHA 2OO7A 4F93B 1AA9A 1JAIA 3PUVA 4UNSA 4ON9A 4HAUA 1G16A 3TAUA 3THXA 2P65A 4Q03A 3NIBA 3WHKA 1QHXA 1P73A 2ZI7A 1UBCA 4RZUA 5CIWA 1OPXA 5LBIA 4AK9A 1CJVC 2FGJA 5EE0A 3Q72A 1XPOA 4JL8A 2J7KA 2VH5R 4L9SA 1LF5A 4TMTA 2ZR7A 4ASUD 1MABB 4OJKA 2A5YB 4BQSA 4KLZA 1KI3A 2XSZD 2CK3A 5GADl 3RVBA 4Z1MD 1TEVA 5F9FA 2J46A 1VCMA 3NDPA 1FTSA 3IEUA 1LS6A 4RJLA 4XD7D 3T35A 3B2EA 3HU2A 2XNDD 3TAHA 4HB2A 1DG1G 1XU4A 3EPJA 5F3WB 2GXSA 3CO5A 1E9EA 1SZPA 1L2TA 1NN5A 3UMRA 3IPXA 2BC9A 3VX4A 1Z83A 4JLMA 5B58C 4XWKA 3EPKA 1YJ5A 1XTRA 2HXYA 4IVPA 1W2GA 2BM0A 4PZLA 2V3CC 1XRJA 3CW2A 1E2GA 1T0JB 3DM9B 3Q8XB 3UIEA 2CCKA 3CPJB 1EFCA 3O8DA 1C9KA 4U5XA 2EYUA 2ZRLA 4NL4H 3ZD6A 1SXJB 1HEIA 4ZCIA 3AVTA 3BWDD 4B76A 2V1XA 5AR1A 3A4NA 5DI9A 1D2NA 5KSPA 2ZUCA 1SKYE 3ZH9B 3ADDA 4DDVA 3KQHA 1YZQA 3CKLA 4MA4A 4UXJA 2OBLA 1D6JA 3B1XA 5DYIA 1Q3TA 4LRWA 5IT5A 3PIRA 2ZRNA 3NBZC 1HE8B 4KFRA 3E1SA 1GTVA 2R6GA 3WBKA 2F3RA 1PJRA 3X1WA 2AWNA 1M7HA 2JLZA 3U5ZB 1FTNA 4Q5IA 4EPWA 1NMYA 4GNKA 4S35A 2ZUDA 2O8CA 1A82A 4LHXA 1MH1A 4KYUA 3LH5A 3MWYW 1MO5A 4NYIQ 4PTLA 2WZQA 2QE7A 2IUUA 4Q19A 5FOWA 3W5IA 2VP5A 4F4JA 3HWSA 1JXOA 4Q4AA 2ZRCA 4URUR 3EAQA 2VLIA 4PHHA 4ACAA 1JR3D 4HATA 4EUNA 1ZNYA 2JCSA 4DLUA 4FINA 1N5KA 1NIJA 5KUTA 2PX3A 1GAJA 1N25A 4LK2A 3CNOA 2HYIC 1LF0A 1VG8A 4DDUA 1KI7A 5TVKA 4WVFA 2RGEA 2EYQA 1E2DA 4YXWA 5SZIA 3B82A 2XB4A 2ZITA 3KQUA 3QF4B 5G41A 1NBMD 4TLAA 1EFHA 4HAWA 2OFXA 2NO1A 2ZEJA 2IS2A 3AP1A 2ZVPX 3LNCA 5GJCA 4A2PA 3SJCA 2G1KA 2IWHA 8OHMA 2R6AA 3ND9A 2IYRA 4C0AC 4ZCMA 5JHHB 3RC3A 3TBKA 2NPFA 3IDQA 1NNEA 1Q1EA 3PG5A 3VU9B 3I92A 4R98A 2PJZA 3PCRB 4MYCA 4QGGA 3BFKA 2BVNA 2OSBA 3F3YA 1Q0UA 4OK3A 1GWNA 5FBRB 1BIFA 5L8VA 3FDIA 2QP3A 4UNQA 2IK8A 1ZP6A 2D2FA 2X77A 3X2SA 3NC1C 4BLOA 4DJTA 1GNRA 4NU0A 1G5TA 3VMFA 4AIIA 3K0AB 5KSZA 1E4YA 4TT3D 4JVNA 3AM1A 1FMLA 4LJ6A 1SQ5A 4O3MA 2A2ZA 1F2UA 4II7A 3W5JA 4JKIA 3KQLA 1UKVY 4WZ6A 1IJEA 2SHKA 3GJ7A 1EX6A 1RW4A 5BYKA 2YJTD 3OAAD 3QBTA 1P2TA 4JLAA 2FG5A 4ARZB 2OCAA 4NYMQ 4LHZA 1JNYA 3ZDQA 2QQ0A 3B1YA 3FGNA 5GVSA 2ZTSA 1A2KC 3L0PA 4KSBA 1OH7A 2OE2A 2G1JA 4HLUA 5FL7A 1G8PA 2ZSBA 4C2TA 3EZ7A 1KO1A 2FFAA 2GZDA 2PLFA 1JR3A 4URVR 1GRRA 1KDTA 2J3EA 1NN1A 1XD8A 4I1SA 2WPDA 4B2PA 4TZ0A 1X6VA 1GL7A 1P62B 4RCZA 2F7SA 2IA5A 3TRFA 4HDOB 2GCOB 4M9QA 2O8FB 3D7MA 3TSZA 4YXWD 3QXXA 1QVAA 3GLFA 3KJIA 1ZM7A 2QORA 4YDHB 2F1IA 3K1JA 2CL0X 4M1TA 1E9DA 3FKSA 2VF7A 4CEJA 4OBEA 4PC2A 4UQOA 4BFZA 4NCJA 3MCAA 3QKTA 4BUJA 2BOVA 5L3QB 2OZEA 1WB9A 3B8HA 3RDPA 3IPYA 4DSOA 5CJPA 3EPLA 1R0XA 1RKBA 1W5TA 5J4KA 2FSHA 4BFTA 3OIVA 2ZPTX 4DIDA 2CDNA 4AKHA 4MKFA 1FQKA 5CITA 1G3QA 4B43A 1W0JD 2YVUA 4H1VA 4GP6A 1AIPA 2QAGC 3W6PA 4BRUA 4ZDWA 4ZV4A 1NJGA 2C96A 5L3QA 3VKWA 2GEDA 3TLXA 3GJ3A 3K9HA 1NVVR 2LKDA 4PQYA 2WJYA 5DHFA 4MITA 2Z0MA 1CS4C 2IUSA 4BGDA 2QNRA 4GMDA 3U2QA 1X8JA 3ZQJA 4KJZA 2IEYA 5FL7D 1OH5A 2O5VA 4OHVA 2O8FA 4RD4A 1NF3A 2Q3FA 3A37A 1JQJC 3GJ8A 3SJBA 1S9DA 1E79A 4Q4JB 3FPAA 1E9SA 1SHKA 4TYQA 2OFWA 1KMHA 2C8VA 1H8HA 4QRHA 2QMOA 4PO9A 2HF9A 1E2JA 1TQ4A 2W2XA 3UXMA 4EKDA 3GLFE 3TVTA 2WPDD 4IHQA 2FFQA 3ZJYA 1L7VC 2ZSAA 4HAXA 1U2RA 2FFHA 3VR3A 4XTRA 3GJ0A 1E32A 4LSGA 4QHSA 2JLVA 1U0JA 3KB1A 4URYR 2CVHA 1YZTA 4KYIB 1R0ZA 2QM7A 4YMTA 3MJHA 4JL5A 2A7QA 1Z2CA 1QF9A 1TF5A 1KO7A 2FSIA 2MSDB 3BOSA 1S2MA 1ZRHA 2V7QA 3K53A 4E22A 4KITB 1OB5A 3I5XA 3KKNA 2QAJA 3K0CA 1S0UA 3SI7A 1YKSA 4NPHA 3DVLA 5CDFA 1NVUQ 5EE1A 1NMZA 1R5BA 3HR7A 1E0KA 4MRRA 3AF4A 1ZU5A 2J1LA 2C95A 2FSGA 5LB2A 2I4IA 4BZXA 2ZSEA 4DB2A 4FI3C 4Q4HB 1BYIA 3CRMA 3RRMA 1H8HD 3CR8A 1IN6A 3SBEA 1ZYUA 3EZ9A 1E1QA 3T1QA 3TKLA 4RD2A 2QZ4A 3DPUA 4JKYA 4BECA 2P67A 2B8TA 2AWOA 2V6IA 4IOKA 4AWXA 3THWA 3L0OA 4HZIA 4PC3A 4WXRA 3L0IB 2P5TB 4LJ7A 2DY1A 2P5SA 1E3MA 2CNWA 2QMUA 1Q1BA 4LI0A 1KI2A 5FL3A 1V43A 1S8FA 3FVQA 5F98A 4LYHA 4N0EA 4WIAA 4NCKA 1BMFD 2RAPA 4L4UA 2FSFA 3L8ZA 2QMHA 3A4MA 3MSXA 4GFDA 1LNZA 5E7IA 3F0TA 4GSYA 4R71A 1ZD1A 2QA5A 3NG1A 1S96A 4Q02A 2WVJA 2QGZA 1FX0B 5LPNA 3BJIC 5ANRB 3EIHA 2VBCA 4EFMA 4EJSA 1FUUA 1SVLA 1TF7A 2JLQA 1KI8A 2WAYA 1EWQA 3QUSA 4TTQA 4M9ZA 3SU8A 4QM7A 1E96A 1HUQA 3U44B 2GCOA 2IS1A 5JHGB 1Q1QA 1J99A 4PC6A 1J8MF 5DHAA 2DWQA 1CXZA 2BMJA 1XTJA 1ZD9A 5CYOA 4DLVA 4LCBA 4CVNA 2JASA 4IOJA 2L0XA 2ZUBA 5FTJA 2R6FA 3AP2A 1TTTA 1N5LA 1II8A 1F2TB 1GUAA 3TW4A 1AN0A 4MKIA 3HP1A 4B3BA 2NQ2C 1P3JA 3CH5A 3LAWA 2R8RA 1E9BA 1CIPA 1M1YE 1XJ0A 4AD8A 4OI0A 1IQPA 1US8B 1OYWA 3M1IA 1OSNA 1M2OB 2RGCA 1XTSA 5FOVA 2BCGY 5CK4A 3B7GA 3EIEA 2B7CA 2VP0A 3U7GA 4G5QA 3AVUA 2ATVA 2FPMA 3PUXA 1W47A 2D06A 1UEJA 2IBMA 2R2AA 4IDPA 4IFEA 2OM2A 3OE7D 2NZJA 1E4VA 1X8LA 1XD2A 4FCWA 3EZ2A 1GDDA 5CLQA 1XTKA 4JLOA 3KKPA 1CR2A 3NWJA 3OFNA 1E2KA 4DLSA 1U8YA 5AWFC 2A5FA 3U3KA 3K09C 4A36A 2ZJBA 5EXSA 4DCTA 2IL1A 4JZKA 4LJ8A 3ZZTA 3DKPA 3IGFA 4P4SA 121PA 1II9A 4UNRA 2REOA 2Z83A 2OCPA 3C16C 4PHGA 4CEIA 2GK7A 1T6NA 3AVXA 1CJTC 3H2YA 4Q47A 2VYFA 2A78A 1N6IA 2KJQA 4C7OB 3QBVA 2NTYC 4PANA 3T34A 5JWHA 1E94E 1F60A 1IHUA 4K46A 5JECA 3RC8A 1CTQA 2OBNA 1VYVA 5LD2B 2BMFA 3X1ZA 4AKIA 1X1RA 2IT1A 2VTKA 4JLVA 1ZNWA 4TL7A 2KBEA 4G5SA 4PZZA 2ODNA 2HF8A 1NLZA 2FFBA 4Q21A 4GOXA 1F3OA 1AZSC 1KSGA 3RS3A 1YQTA 1CJMA 1AKEA 1KSHA 1AQYA 1VCOA 2J0UB 4NBSA 4B33A 4DSTA 4B73A 2O8DA 3GEHA 4DUGD 2PH1A 2OT3B 1QBKC 4LBWA 1LTQA 1NI3A 4C0LA 4GZMA 4L16A 3O8RA 2ZYVX 2ODBA 4ZPXA 2C98A 2O8DB 2ZYWX 4LV5B 4OI4A 4Z51A 4LJYA 3TIFA 2KSQA 2QTFA 4W5WA 5FPYA 2AFHE 4FXPA 4IVQA 1AS2A 4YC7A 3PUWA 2P6RA 1KAOA 3OIUA 1J70A 4A8JA 4YMSA 4AYTA 3WBJA 1KDRA 3RLFA 1OV4A 2G9NA 3LXRA 1DAKA 4PO8A 5G3YA 2IS6A 4KLNA 4HI0E 2C5LA 1KNXA 4PXAA 3CRQA 4LBYA 1G7TA 3QKSA 2JLRA 3R7WB 2ZE5A 5EE3A 3OIWA 1SKYB 1N5JA 2XJ4A 2HLDA 4ERNA 1IAQA 2Z43A 4EFLA 4C2UA 2VSFA 2FDCA 1KJZA 3KFXA 1T9HA 2V8OA 2HT1A 4A1FA 1O87A 1VIYA 2GA8A 4HAYA 3KB2A 2PMDA 2A5JA 3MFYA 1UKEA 2GTPA 4Q7MB 1KDOA 5CB6A 1N3BA 1NKSA 2H92A 3GPLA 3BERA 2J7PD 2CL7X 3LFUA 2GJ8A 1E9CA 4AY2A 3ZGXA 1ZCBA 4BZPA 1AZTA 2H17A 2XZPA 2YWGA 4HAZA 2CJWB 5DH9A 3ETLA 1KK1A 3U7HB 3AF2A 1ESNA 1Z6YA 3B1ZA 1W0JA 1XBTA 3Q85A 3QG1A 1AGPA 4Z8YA 1DELA 2EW1A 3WNCA 2BCJQ 2CE2X 4G0NA 1ZBDA 5CK5A 5DLQC 4I1OA 3EX7C 3BORA 3I4LA 4EAQA 1II8B 1TL7C 2FEMA 3KKQA 4Q1EA 3RANA 3U3MA 3KL4A 3DHWC 4O2LA 4TZ6A 3SYLA 5H8WA 2YINC 3L8YA 5JMTA 2BDTA 4PZYA 3E2IA 1SKQA 2YYZA 2Q0HA 1P2SA 3GCGA 1N6HA 1ZMXA 4YLGA 1B0UA 2CCJA 2QT0A 1EXMA 3BS4A 2ZRGA 2WBLC 1YZKA 4KBFA 4Q66C 6Q21A 1KK0A 1W1WA 2ZRHA 4NKRA 1OYYA 3CM0A 3U7EB 2XZLA 4Q7JB 1G8FA 2WJHA 4URZR 1N6RA 3U3OA 4A6XA 5JSZB 4Q1DA 4DLYA 3ZVMA 1WXQA 2C9CA 2H7VA 4AYXA 3UPUA 3U3JA 3ZVNA 4JSTA 1SVSA 1KZ7B 4CEIB 3X1YA 1G7SA 3QPVA 1NLYA 2IXGA 2ZI4A 1I4DD 3IHLA 3BAFA 4Q9KA 2F1RA 2D62A 1PV4A 1E2PA 1JECA 2FZ4A 1S3GA 3AKCA 4KFUA 4Q01A 3OEHD 3A58B 2GXAA 4OK6A 3DOFA 1A1VA 1IONA 2OAQ1 1J7KA 3QIAA 4N1AA 4ZKDA 2HV8A 1NG9A 2ZE8A 1G21E 2FWRA 5A0FA 4GDFA 1P61B 1OFHA 3TUIC 2BWJA 3RS4A 4YQFA 5FTKA 2XXAA 4MKGA 1KKMA 1KO4A 3AUXA 4TLEA 2GCNA 5KPJA 1TQ2A 4AKGA 4OHZA 3L43A 3OIYA 1OE0A 3EA0A 3RNLA 4ILEA 5JCZA 1US8A 2CNWD 2GEVA 3QOFA 2Z4RA 3CONA 2YWEA 4NCNA 5E95A 4QOSA 721PA 1UKYA 4V0OA 2F9LA 2WJVA 4IXNA 1NP6A 4EIWA 1OXTA 2AK3A 2ZJ8A 1VG9B 3AVYA 2WV9A 4N3NA 4DHEA 3R9XA 2UKDA 2AFIE 3CNNA 3CH4B 4KODA 3NC0C 4B2IA 1Q21A 2WWGA 3KQKA 1MRNA 4B35A 4ZO4A 4IRUB 1IOZA 3LY5A 3CRVA 2D2EA 4MRVA 1KY3A 3E5HA 4IJMA 4KHZA 3CPEA 2OXRA 5JI2E 4JSYA 4HEJA 4IXMA 3ECCA 1DBSA 4JLBA 1SULA 2W6JD 4EQ6A 4XVRA 3OFND 1FX0A 5FBWB 1FP6A 1LB1B 1PLJA 3R8CA 4FIDA 5AK0A 2X2FA 3LWNA 4OI1A 5E4FA 2ZJAA 3SFZA 4RD6A 1W48A 2AKAB 1Z29A 4GOKA 1XXHA 3GLHE 1U9IC 2F1JA 4RKFA 3KXLA 2J0SA 3K9GA 5FOXA 4A82A 2DWPA 2NZ8A 1NY6A 2ZRKA 2Q6TA 4YMVA 1WCV1 3A1SA 2QAGA 1XDBA 1CJKC 2AXPA 2F55A 3RS5A 1GG2A 4UXIA 5AJXA 1J2JA 4Q4LA 4B47A 1XX6A 5TDHA 1W4CA 2GBLA 3THWB 1WRBA 1W36C 4DZZA 3EPHA 4D4MA 1NSTA 3SZRA 1VCIA 2FPLA 2CHVA 2PBRA 2ZSFA 1CKEA 1HE1C 2YHSA 1ESMA 2ZRAA 2ZJ5A 3F5FA 4P32A 1AM4D 1XWIA 3DMNA 1P72A 4Q4HA 4PSVA 2QTVB 1RYHA 1E79D 1R8SA 2GF0A 5FPKA 2FPKA 1CULC 1G1MA 1RZ3A 3M0EA 5C2JB 1J90A 2RB4A 4HB0A 3FKSD 3W6OA 1WP9A 1KI6B 2E87A 2HCJB 4LBVA 5HCIA 1Z6TA 1T0HB 3O8CA 3IO3A 2Q21A 4IEEA 3C15C 2ZANA 4Z8XA 4HB4A 5B30A 2FV8A 3JZAA 2DB3A 2QL6A 5JRZA 4OQXA 2BEKA 2GETA 2A9KA 4QNMA 2BJVA 3P4YA 4RFSB 2OV2A 3I72A 1OXXK 2FZLA 2WOJA 3GLFB 2RGNC 4JMPA 4GBMA 4IFBA 3WHLA 4AURA 5K8IA 3QNUA 2ZAMA 2EFEB 2ZRJA 2YOHA 3A1TA 4LWZA 2D3WA 1KDPA 2QG6A 1DOAA 5FI0B 1NIPA 2QSZA 2QRZA 5HCNA 2WWFA 3UMSA 4US1R 1D2EA 2ZR0A 4DT1A 5C18A 3K9LA 1JR3E 1JXMA 4RD1A 4C0KA 2NO6A 1G3UA 4NMMA 2JLXA 4WBSA 4BLTA 4QJ3A 1M74A 2JLWA 1KMHB 4XH9B 1D2MA 1D8TA 3BE4A 5EP2A 2FMXA 2YZ2A 2VSXA 3AKYA 3O47A 2V6JA 3BK7A 5FR2A 4YDSA 1JEDA 5FPTA 5IF9A 2IYSA 3LBNA 3OF5A 4NDZA 5DNYB 1EFUA 1GNQA 3EZ6A 4GZLA 1Q3HA 2GK6A 3EC1A 4V0ME 4E09A 4KVAA 3PEVA 5EP1A 5KNDA 1G6OA 2IYWA 3F8TA 3P26A 5EZ6B 1VTKA 2OFOA 4RY2A 3L0SA 3WP1B 4BZQA 1YR8A 5FOSA 2JGNA 1QHYA 3LW7A 4PPGA 1U8ZA 1QRAA 3SJZA 2N46A 3Q5EA 4BASA 4JBYA 1XXHE 3GLHA 1VIAA 1QHSA 3LD9A 4TMZA 4EPVA 5BXQC 3I1FA 2Q9BA 2OHFA 1S4QA 3OAAA 4TL9A 2O8EB 1DAMA 2J45A 1YZLA 2WSMA 4JLDA 5FPSA 1Q12A 1SVMA 1X3SA 2EFHB 3BC1A 3NXSA 3QF7A 2FGKA 3BRWD 3MG9A 5AJZA 3LLUA 3MRSA 4HUQB 4KBGA 3VU9A 5IRCD 2FEOA 1GP2A 1GFIA 1CLUA 1B23P 2FJUA 1EFRD 5H1YA 1SXJC 3X1DA 3QXHA 1Z6AA 5JSZA 3OESA 3WNBA 2W6IA 1OFUX 1Q44A 3QXJA 4BFYA 3SQXA 4PPQA 5GJVC 1DADA 2IF2A 4I81A 3G0HA 1A4RA 3H0KA 1AS3A 2XITA 3U7FB 3RRNA 1CEEA 4FWTA 2QBYB 4J0QA 1TAGA 1W0KD 1Y3AA 3V4FA 4A9AA 5EQTA 1XEXB 1ZUHA 2NO9A 3W3ZB 1DE0A 3LBIA 4LC1A 5A5GA 1G41A 2QPAA 4HLCA 5M04A 1W36B 2HYDA 2VP4A 2WSSD 5EXPA 1OFTA 2N42A 2WAXA 5EXTA 3C41J 3AV0B 5C4MA 3A1WA 3Q5DA 3R9IA 2XGJA 1D9XA 1XJCA 3BB1A 2GJAA 4PQFA 2O0JA 3ZLJA 1G9XA 1VMAA 3REGA 1KK3A 4Q4AB 1CR1A 2D7DA 2BHRA 1G4UR 2R62A 3BIFA 3WYFA 1H8ED 1G20E 3VR6A 4TYYA 1E2EA 4DSUA 5EUMA 4A4DA 5K8LA 1Q57A 2XOKD 2P3SA 4GPTA 4LC0A 1PZNA 1FMJA 3DOEA 3DZ8A 1LV7A 1JQLB 1XCGB 3KQNA 2WSSA 1G19A 2QROA 2BIFA 3CPHA 3LXXA 5HE9A 5CDFE 1UPTA 4A0FA 2PEZA 3QEJA 2EVWX 2DWOA 2MMCA 2IYZA 2OCYC 5HR5A 3RS0A 3BBPA 2QM8A 4C0SA 4A2QA 3D8BA 3PJRA 2PCJA 2REBA 3C14C 4JLKA 4M4SA 3TUZC 3QQ5A 3I3SR 2ODEA 3QENA 4A0RA 1VYUA 3B13B 2J59A 3EXAA 1SXJA 4JIMA 1JJVA 5FH9A 1PUIA 1XEWX 1XB2A 4Q18A 4AKEA 5JZVA 5KO2A 1MR3F 1G18A 1G291 3WNDA 1Z06A 5AJVB 4B2LA 1HA3A 3MUFA 1UAAA 4TL6A 4IOMA 4M0LA 4S2EA 3T1TA 1Z8FA 2EWVA 2WOOA 2WWYA 4D0GA 1JB1A 2AN9A 4KXFB 4BLQA 1T5IA 1E1RA 4HLDA 1EGAA 1KO5A 1KO8A 1YRBA 4Q9JA 2QN6A 2WKPA 2ZR9A 3NEYA 4ZCLA 2O0HA 3P20A 4I1VA 2ZRBA 1OIXA 4ZDKA 4POAA 3GFPA 5CLLA 4F4CA 1DAIA 4HUTA 2N1BA 1HQCA 2G83A 2GZAA 4G5RA 4XTCS 5DISB 3AB3A 3MWJA 1MABA 2W0SA 2VHCA 4OL0A 1FZQA 3IIJA 1HURA 2J87A 2ZI5A 1XF9A 4DLXA 2CVFA 4B74A 5E7MA 2ZI3A 1QZXA 2F9MA 4TL8A 3SYNA 2B6HA 2FNAA 3I8SA 3ADBA 2CK3D 2QPOA 4QGAA 2BJWA 1ZINA 4LX0A 1ZUIA 4US0R 3EIQA 3KX2A 3WP0A 2RGAA 3DZDA 4FMCF 1NLFA 1DO2A 3AVQA 4HSEA 4C7OA 2J0QA 3BD9A 1NG1A 2ZYTX 4PAMA 1YZUA 3ZZ0A 1CP2A 2QENA 1N0UA 1SXJE 5HKKD 2IYTA 2WM9B 4JS0A 1K6MA 4QGHA 2CHGA 4QJ5A 4QBHA 5IDVA 3SBDA 4BFSA 1E0AA 4WZBE 2JJ8A 2V55B 2VO1A 1NL3A 2BEJA 2KE5A 2QT1A 3NHAA 3GLGE 1C4OA 1KYIA 3U4QA 2QP4A 3T5GA 5BW8A 5JS8A 1XD2B 2GBLC 3LQRA 4IVRA 3TSWA 1DAFA 2ZS7A 4UJ5A 4NE2A 3K9NA 1ZJ6A 4HYYA 3CIOA 4BE7B 3QVUA 1R8QA 3IBGA 3NBFA 4OYHA 4F38A 5AJYA 4XIGS 2ZE7A 2DFKB 3QEOA 3K0CC 4U02A 1XD9A 2WIAA 3L82B 1XZPA 3N2IA 2ZREA 3BGWA 3PEWA 3VR4A 3RSOA 4MQBA 1G8GA 4U7DA 1G5PA 5SZKB 1PUJA 4PAOA 3CX6A 5FUYA 4D26A 1RVDA 1SVIA 5P21A 2C04A 3A8TA 1DPFA 3VHLB 4B3DA 3SEAA 2E9SA 2DYKA 4RD3A 2R6DA 2X8AA 3ADKA 1U81A 4A6PA 3FB4A 3C5HA 4ITRC 1UBEA 2CMKA 3C8UA 4X8HA 3TQCA 3NEJA 1CRPA 4DKXA 1UADA 2WIBA 4YONB 3NBXX 1IXRC 1CU1A 2J7PA 4V0NA 1KSJA 4DSNA 1BMFA 2DBYA 3A36A 4M1YA 4XWOA 3CZQA 2EQBA 2NGRA 3THXB 2YC2C 1I2MA 3C7KA 3IBYA 3H1TA 1Q1ZA 2IF0A 2B7BA 4MYUA 4B3FX 4D81A 3U3RA 4EJSB 4WA7A 4P3YA 4Q1FA 1CF4A 4IEIA 4JJKA 1QG2A 3C5CA 3N2EA 1E69A 2J0VA 4RSGA 1YR6A 2ZETA 4JVLA 3SFVA 1NN3A 2WKQA 2ANCA 4GP7A 1XMSA 4FN5A 3SE0A 4ZKEA 4KFTA 2B8WA 2PLRA 3BB3A 1HTWA 2YWFA 3TNFA 3N70A 821PA 1M7GA 3TGPA 3UKDA 1FW6A 1PLKA 4V0LA 5CM9C 2IYLD 3KFVA 1X1SA 4QHTA 2J5XA 2KWIA 5K8TA 5DI3A 1KOFA 2XX3A 3OHMA 1R2QA 3B60A 3HDTA 3AVWA 4TTPA 2FA9A 1DEKA 5BYJA 5KNBA 1KNQA 4QG7A 4NCIA 3VKGA 3FFBA 5KDLA 3EWAA 3VHXA 1U98A 3A1VA 2GVZC 2UZ3A 4QHYA 2IYYA 2CL6X 1E0JA 3NTUA 2D4HA 3AKEA 3VNUA 1W36D 1OXVA 2Y8EA 4R2HA 3M4YA 2PZGA 5BQ5A 4DRZA 5DO9A 4PAQA 3CR7A 3I32A 4HZUA 3NKVA 4MGKR 4PHTA 3AF3A 1UF9A 1OFIA 3GLGA 3MD0A 4GRAA 3I8XA 3MMPA 1XJQA 1ZM9A 3HYTA 3V4RA 4DCSA 4OQLA 4LGMA 3HPRA 4ZDIA 3TQFA 1IY1A 4RCYA 5D3MA 2O0KA 3KTAB 1IN7A 5TV2A 3KXKA 4TWZA 3OEHA 2D7CA 1ZNXA 5FTMA 3G5UA 1E9AA 5JLJA 2AD1A 4G01B 3B9QA 1ONBA 2PMKA 2QPTA 4LZZA 2FF7A 4C4PA 5KOYA 1R4AA 5ELXA 5B64A 5D3QA 2CBZA 1BS1A 2AK2A 4M1SA 3NBYC 1G3MA 3W34A 4RZXA 4F92B 5TARA 1GKUB 4V02A 3U60B 1Z0KA 4B3GA 1NY5A 3PITA 5DSZA 5BN4A 5KHOC 2ZRDA 4I99A 1GILA 4TMWA 1ZIOA 4TQAA 2PCLA 4DLZA 5J4HA 2Z6VA 1MOZA 1A5TA 2A5GA 1IY2A 1LFDB 5L3RA 2VP9A 4TLBA 4Z54A 2Z4SA 2IW3A 3W90A 1P2VA 4BLPA 1Z3IX 1AK2A 1TU3A 4RZ2A 2PEYA 4CIDA 4QXAA 1E99A 3R8FA 2OUKA 3GJ4A 1OB2A 2B21A 4MDFA 4JL6A 2VP2A 1T3SA 3LV8A 2WMNB 2FN4A 4FMDF 3LBHA 1RC8A 3G82C 5FTNA 3WXMA 2QBYA 3WMGA 1XMVA 2ZE6A 4LJ4A 1WQ1R 2ERXA 3RABA 521PA 3T1VA 2GNOA 3FHOA 1F48A 1Z0JA 5FBQB 1UBFA 5HTKA 4EPYA 5IHPA 3IEVA 2HCBA 3MWKA 4KO8A 2EFGA 3CWZA 4Q7LA 1FP7A 1E6CA 1YR9A 1W49A 4MRSA 1N6LA 4FMBB 4P4TA 3A4LA 1JI0A 1FQJA 4CRWB 1WDTA 3R9WA 2JJ1D 1X86B 1N2CE 3ICQB 1Z22A 4A8JC 2XTMA 1GITA 4CEJB 1GKIA 1G8YA 1OIVA 2MSEB 1N5IA 1LY1A 2QMEA 4EPRA 3GD7A 2ORIA 3FMFA 3KUDA 2JEOA 2VQSA 1ZM4A 2F1HA 1QG4A 4I1UA 2RCNA 1E1QD 3TSOA 1M6NA 3GLHB 1RJ9B 2XAUA 5JEEA 3HYRA 2QGNA 5J5CA 3W8NA 4D4LA 4RKEA 2RGDA 5JI3E 4JYBA 4PC1A 1OKKD 4RZ3A 3LX8A 2GXQA 1JPNA 2V4ZA 1HV8A 1DAHA 3Q3JB 1P60A 2BMEA 1UDXA 3RAPR 3GQBA 1FL9A 1KI1A 2C9OA 5GVRA 2ZRIA 5SZJA 2CLCX 5FI1B 3I73A 1RPZA 3S1AA 4KV9A 3FFAA 1Z0FA 2P6NA 2GJ9A 5KSYA 3CLVA 3PVSA 4ZI3A 1W4AA 1ZM3A 2HUPA 3K8YA 3CF6R 3WMEA 3ZZUA 4L5BA 3QG5A 4DLTA 2HJVA 1ZIPA 1P2UA 4R7ZA 5KTYA 3I5YA 1FUKA 3EASA 1S1CA 2F43A 3HU1A 1R5NA 3IIKA 4DT1B 4DEXA 3DMDA 4EFNA 2JJ1A 5DN6A 1A7JA 3H4MA 1N6OA 2ONKA 4H9GA 4XJXA 3KJHA 3SN6A 3VNVA 2WWHA 1GOTA 1FNNA 4TQ9A 3RS7A 5K8UA 1Z2AA 5J4LA 3ICEA 2J9RA 5FBVB 2O8BB 3DEFA 2AXNA 4RFSA 1R5OA 3QVVA 4WAUA 1L4UA 2JLYA 3FYHA 5FBLB 3KUCA 1Z0DA 4LY6A 4G3XA 2BMDA 1T4GA 2G0TA 4NP6A 4BFXA 3K70D 1XZQA 1KI4A 2IYVA 5HE8A 1E2QA 2IHYA 5FUWA 4B75A 2ECKA 3GP8A 5KYKA 2GJKA 2H5EA 3UATA 2OLKA 3FWYA 2W83A 4GT1A 2PX0A 4JBXA 4DCVA 3LA6A 4CEHA 1P75A 1TADA 1W5SA 2ZJZA 3SQWA 2ANBA 3QF4A 2GXUA 4H1UA 1JJ7A 1IN4A 1KAGA 1TUEA 2Q3HA 1ZVQA 1AGRA 1MO6A 2DFTA 4MRNA 2FOLA 1QHNA 2X19A 2YNMA 3DM5A 3VTKA 4XVUA 4ESVA 4C3ZA 2VRWA 5CIQA 1GVNB 2RH5A 1O3YA 4IDHA 4QBFA 1SVKA 1HT2E 1P6XA 1R0YA 4MGZR 3TJZA 3OEED 4EJSC 3QSYA 3B78A 2XZOA 1OIWA 4RD0A 3ZD7A 3Q7PA 4GOJA 4K81B 2QAGB 1EFRA 2GF9A 2R44A 4TQUS 3FMPB 3THOA 4HDCA 3AP3A 3IQWA 2QU8A 1WF3A 5E3HA 421PA 3AGQA 4XD7A 2O8BA 1H8EA 3EC2A 3VX3A 5SZHB 4TYWA 2QSYA 2Q3MA 1QHHA 3PFIA 1HYQA 3QKRB 4PQRA 3IO5A 1SVOA 3TVDA 5KU1A 1JEEA 2PJRA 4AC9A 1IXZA 4UNPA 4LYJA 2O8CB 1XTIA 1NKTA 1U90A 4QL3A 4EPXA 2ZS8A 4PX9A 2X1VA 4EQ6B 2P0EA 3O8BA 3JVUA 4P4UA 2F43B 1ZAKA 2UVQA 4B44A 3ADCA 3V00A 2H1LA 4LYFA 1YRAA 4QNRA 2DFLA 4ESHA 5D3MB 1FFHA 3TW8B 1U0LA 2VHQA 2JATA 2NG1A 4M21A 5BN5A 4W9MC 2VA8A 1W46A 1NMXA 3VR2A 1W0KA 2QP9X 2JAQA 1E98A 4V0MA 1Y63A 2ZVQX 3CB4A 3PXGA 4M1OA 4ABYA 3SDZA 2E1RA 3KZ1E 1GL6A 1TF2A 3BH7A 4XWAA 3K0FB 1OH8A 4MDEA 2WJGA 5EJEA 1OT3A 2ODWA 5LDDC 1G7RA 1W4RA 4IOLA 4ASUA 4TMXA 4LHWA 3EZFA 3RRZA 2G3YA 2Q9AA 3VAAA 4CGZA 4IW3B 1LS1A 3WYGA 1NBME 2W2VA 4QKQA 2BM1A 2CLDX 2BBWA 1WMSA 4OQMA 3AF1A 1IXSB 1G3IA 4BEJA 1VHLA 3THYB 1FOEB 1KSFX 5DGXA 3KJGA 4K8OA 4G1UC 5CM8B 2W0MA 2OXCA 1OW3B 4L9WA 4M2LA 3GLIB 1GL9B 4JYCA 3W9YA 1UBGA 3BXZA 4DUGA 4Y0VA 1U8AA 5F9HA 5FR1A 3AF0A 3IUYA 2JDID 5C1BA 5JEDA 4FWIB 1E0SA 1R0WA 2IYXA 4B6FA 2XOKA 3GFOA 2DPXA 1DARA 4TTRA 1VCNA 3IIMA 1DAEA 1ODFA 1ZUNB 3QE0A 4M8NE 5FFMA 5G3ZA 3D31A 2OLJA 3ZQ6A 2DFNA 3HPQA 1FNMA 2CE7A 1QDEA 3OZXA 4QFMA 4X8OA 4D6PA 4B6EA 4JT2A 3K70B 5L3SB 2RHMA 4E5UA 1W2HA 3HU3A 1YZNA 1KY2A 5KPDA 4D0LB 3B5JA 4NONA 4X8LA 4US2R 4Q9LA 1G17A 1NVVQ 3RYTC 5JWOA 3AKDA 4MYHA 2HEIA 2QE7D 1AKYA 1MO4A 1ZU4A 4CT5A 1W44A 3CBQA 1GRNA 2EFDB 1UKZA 1RRFA 2WMOB 1NBMA 4B3CA 3CRRA 3GFTA 5FUXA 5JJIA 3LDAA 1TNDA 4XSGA 2HXSA 4V03A 4B3XA 4PO1A 3QY0A 1HY3A 4R9UC 3P32A 1BOFA 4PPNA 5EP4A 4O0MA 4DEYA 4GL2A 1XCPA 1XNJA 4W5HA 1IM2A 3A6PC 1Z47A 3CNLA 4P31A 2C77A 4L15A 1DO0A 4BRWA 1K8RA 2WWXA 1X8KA 2GAAA 4WZAE 2EFCB 1TPZA 3E70C 1N0WA 1IBRA 3IILA 4B71A 1U99A 3B85A 4GI7A 4HZUB 5TB5A 3TR5A 4Q9IA 3K0SA 1G3RA 4TSFA 4XSHA 3B1WA 4FW9A 5FTLA 1OHHD 2GEUA 2WWWA 3PEUA 2ONJA 1YR7A 3WMFA 1DG3A 4C0JA 3R7WA 2KBFA 3QKSB 4M9SA 4NTZA 1WBBA 1N6KA 2LWIA 5H68A 2IXEA 1GNPA 2O52A 3RSLA 4YMUA 4ZIRB 5HKKA 2GWHA 3U6KA 3JVVA 3L2OB 4JBWA 1GKYA 4ACBA 4RVCA 4C0HA 1SHZA 3MWLA 1M34E 1NVXQ 2W58A 4CT4B 3MJRA 2BKEA 3P27A 3QPUA 4D25A 2LKCA 5AUOB 3AUYA 3CX8A 4M1MA 5DI3B 3FMOB 3T5DA 1E2HA 2JIZA 1I2DA 3DO6A 1E1RD 2R9VA 5GJWC 2RKOA 3LO5A 2ZM5A 1Q20A 2FE4A 1XEWY 2GAOA 2WKRA 1MKYA 3K09A 4OHWA 4C30A 3CF0A 1XFAA 2F6RA 4PPFA 1P9NA 4MGIR 4BLRA 2R6CA 1S1MA 4W7SA 1JPJA 3TR0A 1ZNZA 2AX4A 2K5UA 4OHXA 3ASZA 4DXAA 3VKHA 1VG1A 3QXSA 4AG5A 4DCUA 1COWD 1L4YA 2W2TA 2NO7A 5G53C 1RIFA 1DTSA 4O2RA 1S9HA 1R7RA 2XNDA 1VYTA 2EWWA 3BH0A 4LHYA 4TMKA 1M7BA 3D3QA 4OQNA 1U94A 5AJWA 5DIFA 1V5WA 4D80A 1YVDA 4CEHB 2JJ2A 2WHXA 2XSZA 5FPHA 3CWQA 1GIAA 4LOAA 4WXPA 2G88A 3BFXA 1CJUC 4RFVA 2XB2A 3ZIAA 4M1WA 4CDGA 1OXUA 3I62A 1N6PA 3D6TB 4NYMR 4TLDA 2HJGA 4BFVA 2D74A 2ZJOA 4Q00A 5DE3A 5FOUA 3GLIE 4LUCA 3MLEA 3THYA 4NHOA 1E2NA 3W3AA 4QGFA 2IXFA 4P4SB 3B9PA 2X2EA 3SS8A 4TYNA 4A0HA 2C99A 2XTNA 4G5GA 3GJ6A 4KCGA 1TUIA 4AG6A 3X1XA 2GZHA 3EA5A 4FD2A 4WOPA 1K5GA 2GVDC 2AR7A 2MMGA 1F5NA 5B57C 5FUVA 1E9FA 221PA 4NYJR 1OLOA 3GEEA 1TQDA 4IKEA 2RHDA 5C46F 5JJKA 3K0FA 3GJ5A 2IWRA 5GJBA 2A5DA 4JLPA 1G6HA 4F4IA 1YHNA 5EE9A 5J40A 5LD2C 5J4YA 1KKLA 4QBGB 3V9PA 1KMQA 4LPKA 5EZ5A 3ND8A 4Q1BA 1EX7A 2BV3A 4JLNA 4A92A 1I4LD 1E2FA 2AL7A 2IC5A 4TYPA 3IHWA 2ZS9A 3GMTA 4TSFD 1CR4A 1QHGA 1NRJB 2ZROA 1EG7A 1OXSC 2CHQA 4M9XA 2ORWA 1AQUA 2CEAA 2OCBA 1WA5A 1Z28A 4C0BA 2ZJYA 3C4JA 4BPBA 1WBDA 1G8HA 4CW7A 4OI2A 2DR3A 4KVGA 4O25A 4XOIA 1II0A 5JS7A 4JJZA 2VHTA 3U44A 3LVRE 4HLUC 4DIEA 5JFGA 2VL7A 1QHHB 3NHBA 3FHCB 2PL3A 3ZVLA 1I4TD 3GLIA 4UJ3A 1RRPA 2IYQA 1VHTA 2PZEA 4XVQA 3A1UA 3T61A 3TE6A 3EWSA 1XP8A 2ZU6A 2RMKA 1PLLA 4KAXA 4MGYR 2ZRFA 2IS4A 1TQ6A 2OG2A 2ZIAA 3BB4A 3BH6A 4HUQA 1OJLA 2V54A 1VDZA 2VHUA 4OK5A 3Q9LA 1KIMA 3NH6A 3WYAA 2W6JA 2PT7A 1Z07A 2I1VB 4B34A 5AUQA 4U00A 2O8EA 2OILA 2HDNB 1D5CA 5E7JA 2FU5C 2QUZA 5HPYB 2ZI9A 4Q48A 5EUQB 1BH2A 1R6BX 1UEIA 4Q7KA 2DCUA 4W5JA 4HDQB 4JLJA 3SOPA 1VKJA 1VECA 1G7CA 3JZMA 3OEEA 1RE0A 4BLSA 4DCNA 2J41A 3DL0A 4X8MA 2KB0A 2ERYA 2RGBA 4D82A 3FE2A 2RGNA 2VF8A 2WTUA 2RGXA 1K5DA 3WRXC 3QI2A 1RYFA 3IQXA 5L3VA
chains in the Genus database with same CATH superfamily
4LT5A 2QJFA 3GIRA 3ITDA 2VBIA 1JF8A 1AKVA 2LCFA 3Q2IA 3UWOA 1AH2A 2NOAA 1XMIA 3R6LA 4WX2B 2D7JA 3BGLA 1BXRA 2B8JA 2H7CA 5C8VA 2CGOA 2J08A 4AXXA 3TS1A 3M3DA 3PQ6A 4AVBA 2I2SA 4QJVA 2DQZA 2C82A 3GRVA 2QQEA 3A0NA 5DN6D 1D07A 4YFVA 2QTRA 2CXHA 3LPNA 4YP5A 3ZDEA 1T91A 4XJWA 3TEMA 1OQDA 4TMYA 4Q4JA 3NORA 3CJIB 2YKNB 1SG0A 3ENVA 1R0CA 1Z7GA 3AL2A 1UEKA 1LJ7A 4X66J 2PT5A 5JXWA 3M6AA 3NQHA 1U25A 5LXTA 2K6GA 2J3LA 1MXFA 4NDNE 2SICE 2Z98A 1BE6A 5JAUA 4IEUA 1UAGA 4ISQA 1Z4LA 5G0TA 4HADA 4JBNA 1JKHB 2ZJ2A 1RRGA 3RWOA 4H59A 4U96A 1VBB3 1RKVA 1E6VB 4WU3A 4YVSC 2UUPA 3FJYA 3DE4X 1PIV2 3I4PA 2J6SA 5LEKA 4PXBA 1NEEA 1J42A 1KDZA 5EUHA 2QR3A 3GB0A 1MRSA 3ZFGB 1BY9A 1FJEB 1AS0A 2VSOA 2ZRMA 4JI3F 5L1KA 2EJCA 2N0SA 2C29D 3DFMA 1QIIA 2LUWA 2I4NA 2FX3A 2X9NA 1TT7A 2R65A 2XR1A 2WICA 2VYND 3KT0A 3PM9A 1YHQS 1K6EA 1WGPA 2NIPA 4WOJA 1Q7LB 2WF9A 2EFPA 4GR4A 5I91A 2OECA 2ZAOA 1YU9A 5KFBA 2CFOA 4BVJA 3ZNNA 4FPEA 5A8KA 4LX8A 2EK6A 1KHTA 4Z4CA 1QO9A 2Y1CA 4DG1A 1PD0A 5CNIA 1O5TA 4QPGB 2MINB 4WVLA 1RBLA 4CIWA 1HHTP 2WIDA 2DWUA 4DYDA 1EESA 4KUEA 1UWBB 2R7WA 3K8VA 1BH6A 4EZEA 4W1RA 4RETA 4I0AA 1FDNA 2W0XA 2HSZA 1IZ8A 4CKEB 4RUKA 3DMFA 3FKBA 1OSCA 1EP2B 5BN3A 4IPTA 4HEQA 3NWOA 1NNI1 1P4SA 1EXWA 2E32A 4LYEA 5AT1B 3I4CA 4DNYA 3BGFA 1QJU2 1CY4A 4AFBA 5AICA 1KGDA 1MV5A 4R2JA 4RM3A 2RS31 3IN9A 2A0UA 1JQBA 2PUGA 2RC5A 3EARA 4INAA 2X3UA 2H1IA 5L9AA 3KKOA 3J8F2 1MDFA 3NCHA 1RRCA 3IP7A 1A0OA 2PTGA 4MH0R 2IHBA 4FYJA 3MGBA 5KYWB 4H31A 3LCJA 1UJ2A 3WX8A 2I2YA 4Y67A 2V63A 3WRYC 1PS8A 4K2HA 4AJNA 3E6BA 1Z6GA 621PA 4E11A 2XMCA 2R48A 3RYFA 4MWGA 2YFQA 1ISPA 2EFNA 1EFPA 3JASB 5TE9A 2WSYB 2QI9C 2GD1O 4HNAB 1HDOA 2VOPA 2CG4A 1NBOA 2Q1ZB 3O7OA 4GC6A 3UVJA 1YE3A 5G40A 3HCDA 5CFRA 1V1MB 2ZHBA 2PZKA 1ZOOA 4Z53A 5LA0A 4O1IA 3RUPA 4PTZA 4MYRA 5AXBA 5EXEA 1S1VA 5ESRA 2R7MA 1H38A 3UJNA 1FDOA 1OPXA 3DBLB 2J7KA 4K5RA 1OU0A 1LF5A 1H0BA 4MWBA 4KDRA 2YMLA 3W0LB 4IYJA 3HGTA 3S99A 3GJQB 4IGKA 4DGSA 4Z1MD 4AGGA 2P6OA 3CGGA 1MQTA 3LF2A 1BWQA 1QNYA 5LIRA 2WQ4A 2A6OA 3IPXA 1W3VA 2PI5A 4JLMA 3WG9A 1KHWA 3W9AA 5EHIA 2BM0A 3PC7A 3O8DA 5IVHA 5AK3A 1OA2A 4YR9A 2D3PA 3WNPA 4L4YA 3KK3A 3AHIA 5K0EA 3R7AA 2LZ0A 4GI1A 3WK8A 2PK3A 3PIRA 2HGNA 3QJJA 2VJMA 4B3TF 2R6GA 2WJPA 1KBOA 3RVNA 1C7QA 4EPWA 1QH1A 1YJLA 4Q7EA 4B9UA 5GZ3A 3VKUA 3CCBA 4IWNA 2V7UA 2B4PA 1RHKB 2BR4A 2KZZA 3ZDXB 1MVQA 2VT6A 4B6GA 4DF4A 2DECA 3DXYA 1U7WA 2UXBJ 1VKZA 4ZKTB 1BJTA 1TD9A 2GZ2A 4AXIA 3LIHA 1NBMD 2PJUA 2Q4RA 4NHYA 4RVDA 1V4VA 2OFXA 4DL6A 1O8BA 2NO4A 3RG0A 2IWHA 2PUVA 1EBUA 1P0CA 3IOYA 2N7YA 1P2GA 1J8VA 1QO0A 5HS6A 4WV8A 3J81Y 2AJBA 2X3YA 4UNQA 3NC1C 1K88A 2XL9A 2I8EA 3OY8B 2DCZA 4BQYA 3VDDC 1BFUA 2A2ZA 1W59A 1VB5A 4OSEA 2LMIA 1JHQA 1NVFA 3HP6A 4JLAA 2XYHB 2Q43A 3DYVA 2VTBA 1O3QA 2EX0A 5U47A 2Q49A 3JQDA 1XC9A 3CIMA 3VYWA 2D0IA 2VDNB 3ZQ4A 5COAA 2CF5A 3CCTA 1LRJA 3IG1A 3KSCA 4B4OA 3LJKA 5I9IA 2WPDA 2R1VA 4R41A 3IZOA 1BXNA 4L92A 5BY5A 1SVUA 4L02A 4TRNA 2XGSA 4KYTA 4U8YA 3NTOA 4OX6A 3LC7O 4YXWD 1QVAA 4O2BF 4UEQA 3IOCA 2DGOA 3TYXA 3OT9A 4RGAA 4JJEA 1S8OA 4DRYA 2IQ5A 1E7YA 4E70A 4JR0A 1NFRA 1B3RA 3U17A 1FQKA 4F5WA 2CV1A 3Q8BA 3Q8AA 1X7XA 4H1VA 3NTLA 2GEDA 1G63A 1LVHA 3VR4H 2Z0MA 1CY1A 2IUSA 3D8HA 4Q3AA 1I3MA 4GMDA 2J9GA 4IJUA 1HEYA 4EO9A 2PDAA 1JQJC 3GJ8A 1S9DA 1E79A 5LA1A 3ZTYA 4GH4A 1LQUA 2VTFA 1FKOB 3NOCA 1FUIA 1KMHA 4A3ZA 4LBPA 4CL8A 4TS4A 1T1SA 4Q4CA 4MS4B 3GLFE 2B5JA 2EW8A 2JL1A 1QIQA 4QHSA 5KFOA 3KKEA 2HY7A 3OY8A 4IHJB 4P53A 3TFWA 1GG5A 3VTAA 1A04A 1H4QA 1KU0A 1VIMA 2JIDA 4RW4B 2HIMA 1R66A 3W3AH 2HIAA 3RFXA 1S0UA 3TDMA 2PKWA 5AXCA 4AN1A 2ZGUA 2GAGC 1B8OA 1VMIA 2J1LA 5IQ6A 2BFEA 4Q4HB 4RJKA 1WKJA 1H8HD 3LM8A 4RD2A 1W73A 4IS2A 2GN8A 4I46A 5CYGA 3O4RA 2V6IA 1ONOA 2IA6A 1C9EA 1U11A 3UV6A 1Z39A 4UFOA 3MBWA 2QDRA 1PG2A 2XPCA 5F7UA 4KQEA 2MCFA 2EF0A 5KG3A 5LMNF 1LCLA 3OA2A 1L1QA 3HRIA 1JHYA 2D6MA 3L8ZA 3MSXA 3NS7B 2HIHA 1GFWA 2QGZA 4HEA9 2VCCA 3TM5A 1YJVA 2VBCA 4EFMA 5CB4B 2JCXA 3SC6A 1K3TA 2JFWA 1C5HA 4TTQA 4M9ZA 2GCOA 4PDWB 1E5TA 1Q1QA 2QJOA 4USHA 3PQ4A 3IA0A 3ZXWA 3RV4A 2ZUBA 1X0FA 3AG6A 4CDXA 3VVUA 1TCUA 4CVUA 3N9MA 1D2HA 6FDRA 2NQ2C 2YG0A 3LA8A 2ES3A 3I01M 1T43A 4AT1A 4BO9A 3Q9UA 4XDGA 5BYAA 4Y2HA 3PIIA 2XYHA 3B7GA 3RVSA 2ZOEB 3DNCA 4LGCA 1D2RA 4O2AF 2YWCA 5M29A 3KKPA 4ZVOB 4BX9A 2RM23 1AL23 3HB4X 3GJQA 4XTPA 1EFKA 3HL4A 4EZBA 1HWUA 1RLIA 4RYLA 3IQEA 3ETQA 3KHRA 2F8HA 4BC1A 3DLHA 2UWAA 5JXSA 4RLEA 1RUF2 2XSFA 4MLDA 1XMOB 5HQ8A 4PZZA 4PQGA 1PF7E 3T1HB 1CJMA 3NLCA 1KSHA 2ZH1A 3WDVA 3GEHA 1U31A 3AYZB 4YP0A 5BMOA 3GFQA 4FDAA 2Z56A 2QTFA 3NNGA 5EMNA 4Z1VA 3IV7A 3VZRA 3WGMA 1FC0A 2Q4EA 1KGYA 2XOXA 1V45E 1ZH6A 4WXHA 4FXVA 3U49A 2MEV3 4ZQEA 2NLWA 2B69A 3VR0A 1HN0A 3QH6A 2WR8A 3FQLA 2X0KA 3KOYA 5REQA 2KHZA 2O54A 4ER3A 4GBED 2VY0A 1ISSA 3BOPA 4TTTS 4GSLA 3N6LA 5JPCA 2VZ1A 1A0OB 5FNVA 1VJ0A 3PUSA 2R8GA 3OE4A 5CB6A 3KXPA 3OTDA 3MFQA 3SVTA 4ZVHA 2Y0OA 4QTXA 4F4AA 3HDJA 5DDJ3 8RUCA 3I49A 2CL7X 2MT9A 4KWCA 3GAZA 4P52A 4P7TA 1NYLA 3ZGXA 4ES2A 3HQXA 4WWSA 4WLEA 3FSEA 4WCVA 1A8UA 4LUKA 2X05A 4CLYA 2R7AA 3BORA 2IW1A 4C11A 3U3MA 3IWNC 1M2JA 4TXSA 5SY6A 1EE1A 4KSYA 4PZYA 4CL2A 1MSWD 3GCGA 4JB8B 1RXGA 4DOUA 3C7CB 3X44A 2JI9A 2WBLC 4MVYA 2ZRHA 5KFQA 3TQRA 1W2IA 2R1DA 2WHOA 3TVYA 1NW4A 5HOQA 1R15A 4Y1FA 2HRDA 4GKXA 5IKEA 1KZ7B 1V1MA 1I0LA 1RLUA 5DO2A 2E6UX 2C57A 4USJC 2HDWA 4Q01A 5ETSA 2YX1A 4GLBA 2FD8A 3TAPA 3SMVA 1V16B 3QIAA 2W8KA 1MWQA 1PYSB 4J16C 1A71A 1Z2ZA 4GDFA 1PO6A 1HDRA 2XI2A 4Y6OA 4NJEB 3O7WA 4AVAA 4M1ZA 1KO4A 1TZKA 4TV8B 3VH4A 2ODAA 3L43A 2DXIA 3QE2A 1K8QA 1PQWA 3RRKA 4NBNA 4AHWA 3HT3A 3FLMA 1C3LA 4GE0A 4PG4A 4OEHA 4B9EA 2ZYAA 3S2ZA 3DLGB 3H6KA 4K05A 1NP7A 1VHIA 3C5WP 3VKFC 1MRNA 2IXIA 1BFKA 2K3IA 1K5MC 2HHHF 4NH4A 4MR7B 2PT6A 1XHEA 2DR9A 4UOFA 4OFXA 5K4AA 1WPRA 2WFLA 4LIWA 1KONA 5ELLA 4RKFA 4C8ZA 5F77A 1W75A 4J7CA 4C1BA 3CINA 2AXPA 3DRSA 2I34A 1VL0A 4DS3A 2IYGA 3NGKA 4IEOA 2DSNA 2ZUSA 3HN6A 1E6LA 4MGHA 4AHXA 2WZDA 2GF0A 3LGSA 3VMMA 3KYCB 2KPOA 1ZOTA 5YASA 4K0KF 5FDLA 4UDNA 2ZANA 1BGVA 3A4VA 1P0PA 2P79A 2B2CA 1K1EA 2ZIZA 4QOJA 3WC2A 1ADYA 1W34A 2XECA 1HTBA 4GBGA 3WIEA 3LPDA 3DHEA 4LMAA 3LE8A 5D4LA 4IDEA 1RIIA 5K8IA 1JLKA 2YOHA 1KDPA 4I9GA 5GONB 2KXLA 4PEVA 5HCNA 5C32A 3K9LA 1GOFA 2Y99A 1FA0A 3KP1A 4CFSA 1Y7IA 1JLAB 1J25A 3UJHA 2N47A 5G02A 4EFAC 2V6JA 5IJ9B 5IF9A 2EKLA 5F2KA 5BN1A 4GZLA 1RT4B 3O8OA 4IJ6A 4KIGA 4KVAA 4E09A 3E1KA 3OTGA 4AFCA 1HNNA 3HDGA 2GC8A 1T4BA 3R7NB 2MQLA 4ENVA 4YB1P 3PXEA 1QTNA 2C9ZA 1M2VB 4EX7A 5D2AA 4JUAA 2Q9BA 5DW3A 1E1DA 4RVUA 3KLVA 2AIRA 2RF2A 5FPSA 1SVMA 4X66B 2FGKA 4R05A 4E3WA 1DRZA 1NUUA 3QMPA 4KXQA 2W2PA 4KN6A 1FNZA 1NQJA 3O5TB 3QXJA 2XBO2 3H5AA 3OEAA 4WQMA 2LCWA 3IRVA 1ECPA 1C5KA 2RB5A 2GU9A 2DUOA 4KR6A 4AQDA 3HFJA 1MU2B 2PA7A 1G41A 5FJ4A 1THMA 1YLLA 2HYDA 1IM8A 1BOOA 1VJTA 2FDRA 3A1WA 4JDPA 3MS4A 3A21A 2Q29A 4LZLA 3AM4A 5AKGA 5C5EA 2WSSA 4BMVA 3GYGA 3E61A 2CLIB 1KH3A 1TL4A 2QL5A 2D6FA 4F3OA 2A94A 5C5TA 3QKWA 4MHOA 1CUDA 4QPGC 1F9EB 4PWWA 5HX7A 4KWKA 1H69A 1N34J 3B69A 3BGIA 3AMHA 3BILA 1Y00A 5EL0A 4OM8A 4GR9A 1S97A 3WDUA 2KM1A 3AU9A 3O3LA 2MYUA 1P4RA 3AHGA 3SQNA 3QZ7A 2FCUA 1JG1A 3MIIA 4AL9A 1SJQA 4ZYXA 1MVOA 1CR6A 3AEUB 4QGNA 3V81B 2DBBA 2G83A 3BMNA 1NQOA 2PGNA 1TZ2A 3EFOB 1F5SA 4CN8A 1CY0A 4EO8A 3AL0C 4XPIB 4Y1RB 4EZHA 3ZCVA 1QKQA 2K06A 2H0VA 3RIEA 3A22A 2G8LA 5KXEA 1QJHA 4JC4A 1PSDA 3TA0A 1YI0A 2H3EB 3DM2A 1C1CA 4JHTA 1SJ3P 1IKPA 3GLGE 1JHAA 2RHQB 2JIMA 3CCCA 2PMWB 1RCFA 1RUH1 4UJ5A 3NQ41 1ZJ6A 4HYYA 2H65B 4OI6A 1KEPA 4W9RA 3A8EA 5L7YA 2RD2A 4AJKA 3U14A 2YR0A 2RG4A 3BE6A 4MJXA 4FEEA 4JI7J 5CD4H 1NXD1 5CVDA 4P82A 4KQZA 3B38A 4EN7B 5IFTA 3VO8A 1GICA 1HT3A 2JH8A 4ITRC 1P6QA 3NNJA 2Y9PB 2H59A 2FZGA 4DL5A 4Q3EA 4BDVB 3T5KA 4DQLA 2RHRA 1JLBB 1K3UB 1DJ0A 4MIOA 4Q1FA 3ZN5A 4LQDA 3ZCSA 1DGRN 3MA0A 1MXHA 4JVLA 3JXSA 1XMSA 4M55A 1EVYA 1VSVA 3GRCA 1JJ4A 4RS5B 4K7QA 4OB8A 4V0LA 4HXYA 3RASA 4ER0A 1ILWA 4EY7A 1RWNA 5BSHA 1MPXA 1KOFA 3RIMA 4LXHA 5BYJA 1XBWA 3GR6A 1WWYA 1YNOA 4NCIA 3FFBA 3VR5H 4TTGA 5K3FB 4HDGA 3FYDA 4JOCA 4ZGBA 3WOHA 3TEZA 3DMJA 5DLDA 3GP5A 5HEKA 2DITA 1RXEA 1RTIA 1UMDA 1GZ6A 1ZI6A 3PNBA 4MQEB 3EF3A 3IDEA 1BGWA 3BO2A 4GXRA 4RCYA 1HLCA 3FTFA 3WWPA 1GZDA 3OEHA 1GCOA 3UICA 3KVRA 4HR7A 5FTMA 3R7SA 4QDOA 2Q1WA 3CY6A 5KR7A 3UGJA 4ND8B 3E5UA 2RS51 4RZXA 3S70A 1Q16A 4V02A 4C8MA 4I6GA 1NNUA 5DMXA 4YIHA 2OL4A 3FPJA 4M0MA 3UAVA 3AIKA 3QSYB 2XY6A 4P2MA 2BZ0A 1P2VA 4C2AA 1AK2A 2UXBB 1D1PA 2B21A 2X1LA 2QW8A 4GH4C 3FRZA 2QBYA 3WMGA 3WLIA 5EY5B 3HN7A 5U4QA 5KNDH 1D7PM 2BRUA 2BEVB 5FPBA 3UJAA 3BJEA 2XA1A 1HMYA 4W82A 4UBIA 3RQ0A 3E5RA 3A14A 4LYYA 3WC4A 2TSYB 4C20A 1OIVA 5DJ5A 4NXNJ 2ORIA 3AX6A 4JYAJ 1Q7BA 1JKJA 2HBZA 1UP7A 4J0CA 4N7IA 1F7UA 5HSPA 2G72A 3CJQA 2FCRA 3OIGA 2XMPA 3RVMA 3IWXA 2XBO1 2CZVC 4MUKA 5L38A 5I3UB 4DV2F 4XHXA 3ZPYA 3S1AA 2VPXA 1H3FA 4SBVA 3PUIA 2QXTA 4ZU3A 1KDMA 3ZZRA 1PW7A 2VTXJ 1RJJA 4YMHA 1VRTB 1EZZB 1FDIA 3AM3A 2YKQA 4B9NA 5M0TA 1MBZA 2WWHA 4BNTA 1RJEA 4PYDA 5G0SA 1T1GA 2YWKA 1H1DA 5K8UA 1Z2AA 3T3PB 4PRFA 4RFSA 3R41A 4WTOA 4WAUA 2CFRA 4NENA 5DIZA 2XJUA 3WYCA 1JDJA 2BEVA 3EYWA 2ZYRA 4B08A 1K7EB 1UWLA 2GAUA 3KETA 1NVBA 4Z7CA 4H1UA 1IN4A 5I6DA 2Q3HA 1MO6A 3D8SA 3WGZA 1K5MB 1GVNB 4QBFA 2X5KO 3RB8A 2I74A 3QSYA 5E41A 1O6GA 3UGHA 3N74A 4JCCA 1L8OA 3N05A 5LW9A 1EAH2 2VMHA 1KAQA 3EJWA 3AP3A 1V9LA 1RBOB 3V5RA 1IKYA 2QSYA 1XCOA 3D43A 4ND8A 1O6ZA 3GZNA 4AC9A 3IHTA 1UIMA 4BEVA 5FO8B 4ENTA 1RTJB 5C5CA 4EQ6B 2IAJB 4N6GA 4G1QB 1U2EA 1AF7A 3I9LA 1RXOB 4BUCA 5IC4B 2JD4A 1T34A 4TRRA 4YG3A 2VA8A 3RT7A 4W50A 3GARA 3FGOA 2DR6A 3LT5A 5TPZA 1STOA 1SD5A 4XX1A 3LY7A 1OURA 2Y0IA 5DDPC 4GKKJ 5BNPA 1PQUA 3RRZA 3AHJA 4AIRA 3NCRA 4GMP3 3HZOA 4Z4EA 1C7FA 3L7YA 4DANA 2BM1A 2C54A 5LCWL 4N82A 4XF1A 3QVJA 2GHWA 4JBCA 4BO7A 3THYB 3TKAA 2BN4A 1KSFX 4YQEA 4OZJA 4ETXA 5DGXA 1AF4A 5IWAF 4MUNA 3L04A 3W8PA 1U02A 3FA2A 5IKXA 3OCVA 5IUNC 1U47A 2N7GA 2HWXA 1N2GA 2HGLA 3ON5A 2P9BA 3M83A 4UVGA 5JRDS 5ISLA 3GRUA 1S5PA 5I4CA 1F8FA 3K7RA 1X5OA 1KY2A 5A2QA 2BI7A 3II6X 3KWFA 4OH7A 1VPHA 1Q3EA 2JD9A 3R3HA 4GAEA 5IVDA 4LNAA 3VTZA 3HI9A 2VPWB 3DMRA 1GNYA 3KNZA 1Y5MA 1QRSA 5BVGA 4K6MA 1PR5A 2XSJB 4HN2A 4NE9C 1O8CA 2VONA 3M32B 1U99A 4GI7A 3V6DB 1CS4B 1TYAE 1Z3CA 2OYCA 4QQOA 5HVFA 5EFUA 2XT6A 2GEUA 1YKWA 3EGOA 4BAUA 2XWBF 1O6FA 3VTFA 1B4SA 3K35A 4RADA 1NI5A 2RAFA 3URMA 1T5OA 3LWLA 3P27A 4RV5A 3EXUA 2HHCA 3TWIA 2JIZA 4BKQA 4TWRA 2ZM5A 1Q20A 5ADHA 1N32B 2QR2A 2HBTA 3DLKB 3GVPA 2F4VB 5DX1A 3DKIA 2XNDA 4A45A 4MYDA 1V5WA 5D5QA 1OA0A 3VGUA 5FPHA 3VA7A 4OAPA 4OYUA 2VZUA 2OZ6A 2FGOA 4YP3A 3GLRA 1YA6A 1DGWX 2RR13 4GWJA 3VKFA 1GTZA 4I9FA 4FFIA 3X1XA 5I4KA 4IDDA 3JQPA 5K2MA 2GN4A 4BMYA 1P45A 2ZYHA 1GP4A 3B48A 4EGCB 4G07A 1UVKA 3L1UA 1W26A 2ZBCA 3KAPA 1W0OA 3F44A 3GN1A 4W6YA 4DL4A 5E0KB 3BG5A 3TW8A 1AX0A 4JYMA 3NS6A 4B82A 1MU2A 4PLVA 1JI3A 3T4PA 5KWEA 3CD7A 3CJ2A 1S0BA 4DV5B 1W6PA 3W5UA 2IU6A 4IR7A 1OAOA 2H6BA 4KR2A 1DP4A 3NHBA 1N7GA 1RJDA 1Q0RA 2X13A 3TJMA 1MTZA 3TE6A 2QSUA 1RT3A 4AY4A 1O6UA 4OXQA 4ZJQA 3K72B 4I5FA 2W4QA 4BVEA 2Y0CA 3V34A 1YQHA 1Z07A 5JNTA 4JV4A 2HF2A 5FDFA 3PW2A 4UM9B 3U1NA 4Q7KA 1R0AA 4FVMA 1KFDA 2MQMA 2WAOA 3C5EA 5ITSA 3QGPA 3AD9C 3ONNA 4FQ5A 4RH3A 4ZEMA 1TKXB 2LM3A 4YJGA 3IQXA 2DCTA 4AY6A 2CLSA 3BWVA 5A1AA 2X09A 1UKAA 2O5CA 3FTEA 1HQKA 3RVJA 2AZTA 4CMJA 5JZ9A 3DMHA 4AB1A 3I1JA 1UL3A 1RLTA 1ZITA 1VQOS 3UVEA 4HACB 1S9GA 1Y3FE 4PFSA 2WNEA 4TVKA 4EPTA 5LB4A 5BMVB 3W5CA 1FYFA 4F84A 4ZT6A 2PI4A 1EP3B 1AL22 5JXHA 4G09A 1KOHA 3EG5A 2PHXA 3SJAA 3JTEA 1R64A 3JW8A 5DCYA 1JBKA 5EQDA 4LV6A 2D97A 2WWSA 3D0GE 1BW9A 3SMQA 4JI3J 3DJYA 3W8DA 4LF4F 1CQIA 1JAHA 3WDSA 1QMJA 1ONPA 3IGNA 5LA6B 1DS6A 2BU9A 4OU4A 4G0UA 2AW0A 3V5NA 1GNZA 4WGGA 3UK6A 3OPQA 5LMUJ 4HSJA 1KY4A 4IVNA 5HIMA 2EARA 2GDJA 2X76A 4KE9A 1V6MA 2BKPA 1KVKA 1SB6A 3UCFA 2JOQA 3ML1A 2MQ8A 4QYIB 4QYXA 3HUDA 2CLHB 2I7DA 4N18A 1IQTA 5I8SA 5A62A 4RKUC 3D02A 2WVGA 3OM9A 1UU6A 4GX5A 4XZPA 1JRLA 3BO4A 3QWIA 1UFQA 3U6BA 4BAZA 2FSPA 4GWGA 2YNIB 4ARZA 2ZYUX 4ED8A 3TTSA 1DOHA 1F3FA 1S89A 4EKNB 5H0IA 2V34A 1XOIA 2K1RA 2PGXA 2CVPA 3W79A 5A06A 4QC2A 4YV7A 1G9DA 2PQ0A 4F56A 4NMLA 3W5NA 3G17A 3PWKA 3W2WB 3GLGB 1HWJA 4IIJF 3P2YA 3OLZA 4U0KA 3MEDA 2X5IA 2PFWA 4LMBA 1VMBA 2QAIA 4ZJPA 4P92A 3TN91 1Y3HA 3FQKA 3M2RA 2AZ3A 4M94A 4NK5A 1J07A 2VCAA 4ZCQA 4DUVA 5I3CA 2HBYB 3TH5A 2P9HA 4NI2B 1KZGB 4DUTA 2VQ6A 3R7BA 1W8TA 5KKNB 5LT5A 3LRPA 2W4CA 2CFSA 3OE7A 4JVSB 4LDJA 4M1EA 4HGQA 1VQMS 2FH5B 3CVVA 2Z2LA 4EDHA 4G1FA 4QUAA 4J03A 1VK8A 3H18A 4MV2A 4XIYA 1MHPA 4BBPA 1KJYA 5F7JA 1UIJA 1UX6A 5IBCA 4O4IF 3EW9A 1LW7A 1ZK0A 1C3OB 3DONA 2ZSDA 2V1UA 5KIAA 5FAXA 4RWZA 1JQAA 1QVVA 3OBRA 3T6KA 5A1JA 1N8TA 3INRA 2DO4A 2QEQA 3OGJA 5HIKA 1NH7A 1NDUA 1O91A 1QYCA 1CYEA 3MEKA 2JC1A 4TKVA 4XYLA 4P4GA 3KPVA 4M60A 1PBAA 4FFWA 4B3SF 3DH0A 1A3CA 5CYPA 2CXXA 3BCRA 2A5LA 4CPDA 3TEYA 4KQ1A 3BK1A 2XHWA 1EXDA 5LASA 4YS2A 3TRJA 1D8AA 2R1UA 4YXFA 4Y6PA 3I4IA 2D0OB 4HGZA 2FMUA 3DEHA 5ITVA 1PJLA 1NRIA 4ESOA 3T1HF 3DUFA 4KAJA 5JCTA 4F3RA 2OO7A 4UNSA 2D2IA 1N5MA 3THXA 3KHLA 3BIWA 4MG2A 1JIQA 1SKBA 4YRGA 4MKRA 1CERA 2RHCA 1AX1A 1GXUA 3NETA 4IIHA 4Q0MA 2LALA 3GNEA 4OLHA 3TR6A 1MABB 3AT1A 4NCGA 4OX8A 4KLZA 3V3TA 4DFDA 3K32A 2I3AA 1TEVA 2WP0A 2H4HA 3UMRA 1PKUA 1YJ5A 3PPIA 3SDBA 4WYWA 4PZLA 3CW2A 4QDZA 2IM0A 4GMHA 1GR1A 3K9QO 2QZPA 2UYAA 1CJKB 3VZHA 5AR1A 4S24A 1YL7A 1GTVA 5JSRA 3FFTA 2XJSA 4I4BA 1QIFA 2MXYA 3ZGLA 2ZUDA 3I9V1 2H9ZA 4KBYA 4X00A 4DMIA 4E5MA 2WD8A 2XC9A 3EXG1 3VHOA 2FCVA 5C7OO 2BBAA 4FSJA 1N88A 1SFPA 2AEMA 3KLFA 3EPPA 3F5QA 3REOA 2B37A 3CUUA 2OFHX 4B79A 3QLHA 3QLTA 4KO0B 3SM3A 2BEFA 3KQUA 2YXNA 5ER6A 1EAYA 2IS2A 3KAQA 5LATA 4JRAA 1YVFA 4RW7A 4ZS2A 2R6AA 3ND9A 5BPHA 3DRYA 4C0AC 3R9KA 3LECA 1QDLB 4EYEA 3C1UA 3UDLA 3D2AA 4P7KA 3ZYZA 3PCRB 2BBEA 3R0XA 4QX2A 4B8ZA 3HCRA 2B8MA 3X2SA 3BMQB 4R01A 1GNRA 1HQDA 1GV1A 4HWKA 4XI9A 3RB0A 2WT9A 2YC0A 2OQ6A 4WZ6A 5BYKA 2VZOA 3N0TA 3N9UC 3NBKA 2VHVA 2AZXA 1SLCA 1NJ6A 5DCUA 1WMDA 2YH0A 3VR2D 3CV3A 5CGQB 2M2IA 4C2TA 2NZWA 3HVIA 1ZVFA 2Z3VA 1KDTA 1BCXA 4IXLA 4JI0F 5DBFA 1B64A 2C1EA 4IV0A 2ASYA 1NC1A 3OJUA 1V48A 2YU2A 3EDMA 4WT7A 3B4DA 1H9AA 2CL0X 3K77A 4UQOA 2V8VA 3MCAA 4PQAA 3ZBQA 2CAJA 4HBNA 1XZMA 2VPVA 2RRAA 1CUSA 1M5UA 4DV0J 2OQRA 2K7JA 3SQOP 4RJTA 4KPYA 1CZLA 3L9JT 1SPBP 3A4IA 2LKDA 1YE5A 4XUGB 5LP6B 2QSWA 1XN1A 1X8JA 2IEYA 4OHVA 4AVVA 1JP7A 3WAGA 1F7VA 4A7ZA 1KOJA 3JQFA 2O0OA 3FZYA 1AMUA 2XUJA 1NR7A 4WK4B 1QH9A 1WLWA 3JQEA 2C8VA 1GSOA 4LYGA 4EG7A 3CO2A 3C7DB 2DYCA 1E2JA 2WS93 2WSCC 1LJ8A 4L0MA 5BNPC 3WLKX 2VXYA 5IH3A 3WYBA 2ATCA 2HRZA 3JD0A 4XTRA 2UUCJ 1YHZA 2V6BA 3HCOA 3TVKA 3JV7A 2A9PA 3NGLA 1YZTA 5HMLA 5JOYA 4YCCA 2Z4FA 5LM3A 5J1NA 1NJYA 1QF9A 2FSIA 4ZQHA 2V7QA 1OB5A 1PZFA 3ISND 1I6XA 1R5BA 1IS5A 3H5SA 5P8WA 3UNYA 3ZE1B 4H4KC 1WKCA 4BZXA 4P14A 2GIFA 3ROTA 2PAAA 5JXGA 1QE3A 3ZJVA 4INPA 4RA6B 3JAMY 3SEOA 5K3AA 3KG1A 3THWA 2PLV1 1R8AA 4PC3A 4O0NA 4LJ7A 1BE8A 1R27B 2VF5X 1ZBA3 1U9JA 4YAWA 1B6TA 1JZ4A 1YNAA 5C42A 2R8PA 4AM8A 3I05A 1N1EA 3BYWA 5A4FS 4OFWA 3CXUA 1CYDA 5KVSA 1I3OB 2AHRA 5BUZA 2WONA 5F9LA 4FI3F 1PI3A 4DLVA 2RDIA 2A92A 4CVNA 2JASA 3GB9A 3TBFA 4NECA 4BQPA 4C9DA 1C1XA 4X64F 2ZX2A 4WBXC 3OZSA 4HT1T 3VHRA 1RHUA 4DV4B 2DFDA 3OBIA 1J97A 4E1AA 5L4NA 2PM8A 1UMCA 1VR6A 4G5QA 2C7OA 4N53A 1RC1A 2D06A 1OZFA 2ZOMA 3RU0A 2EERA 1ZZ6A 5LWQA 4X2BA 2DX7A 3R2DJ 4JBHA 1EQMA 4J3JA 4AJ1A 1ZR2A 5BVHA 3F71A 2QHXA 3OP4A 2IL1A 5CZKA 3IGFA 1EV11 2ZEWA 4UNRA 4IX9A 3SSNA 1ZNQO 1VBD2 3AZYA 1JEJA 1YX2A 3DOLB 3IB6A 3CZAA 3H2YA 1Y89A 1TKRA 5JD6A 5JWHA 2AV5A 1E94E 4IJVA 1YRTA 4OOEA 1S0EA 1KZHA 1K68A 2AI2A 2QRUA 3N7MA 4EWAA 2JFQA 1SPPA 3H65A 1NO8A 2YCLA 1NLZA 1AZSC 3T52A 1YQTA 1FERA 4OVEA 5E8AA 3U0VA 3S6PA 5B2EA 1S77D 2CDPA 3COZA 3DXUA 4LJSA 5B09A 4O4JB 4DSEA 1CB0A 1US3A 2G5CA 5C8DA 2C7QA 5D78A 1N2XA 2CWKA 4ZPXA 2DT8A 4DLKA 4NK4A 2O1SA 1T8YA 3GG1A 4QJBA 4WLOA 5KOJB 2O3SA 4TYAA 1A8SA 1N8RT 4EUHA 9ATCA 4QEZA 3PWSA 2WO7A 4AKTA 1JUHA 1FBNA 3LE0A 4OLAA 5AE3A 4NEGA 2MYNA 2DUUA 1AOXA 2QLFA 4YP9A 1WV0A 2HLDA 2VYVD 2PX2A 4EFLA 1YTYA 1E5SA 4PONA 4QXBA 3N8GA 3GEMA 2CDCA 1VIYA 1I3NA 4HAYA 4ZJZA 4KO3S 4MP3A 3U4MA 3BWYA 2RG1A 5B3JA 4QDSA 2R5NA 3ILHA 3RKUA 2PXXA 2VMCA 2UWBA 4FJ0A 5CVCA 4XETA 3WWZA 5KFKA 2GJ8A 4QYWA 3BCSA 2OAEA 3Q8CA 4I5EA 2PA0A 4O3FA 1OFNA 1LKNA 5DX8A 2V4QA 4P5DA 4DY4A 2VAUA 2CE2X 2Y6VA 3OECA 3O9MA 3LA7A 5DLQC 5DM7Q 2NAFA 2O0MA 4TWJA 2VO5A 3PDUA 4HC4A 2AOUB 1TR0A 5AOVA 4BVGA 2Q0HA 1N6HA 1B0UA 2CCJA 1EXMA 6Q21A 4KBFA 3BCWA 3F90A 4FTSA 3EJKA 1F6WA 3UPUA 2OT7A 1G7SA 3OUIA 1CUIA 4WKNA 2IXGA 1N33B 4IV1A 3W2FA 2B20A 1FKPA 1X14A 4JBLA 4OTZA 2MSWA 5B0EA 3NGDA 4ZODA 1WC3A 5J09A 1E6VA 3L7IA 2VYVA 1IONA 2MINA 4BCBA 1PEYA 1Q0LA 4M7OA 3N8KA 2VJLA 2BJ1A 1JJCB 5IWAB 1RADB 1TQ2A 1M2OA 1VKOA 1T2EA 3NAMA 3O91A 1IY9A 3FSRA 3FEYB 5EWFA 4DV5J 1UKYA 2PKCA 3MIZA 2JI8A 1FS5A 2GH2A 1I3HA 4Y9TA 1N3LA 4I6WA 1Q77A 1YA4A 2F40A 1UVJA 3FCEA 3KFLA 3E5HA 4IJMA 3UTCA 3SDEB 4H4EA 4Q2MA 3P4UB 2EGUA 2DIVA 2ATCB 2PH7A 1LB1B 2Q8PA 1ADJA 4F8AA 1D1QA 1KORA 5MFZA 1PO13 2J9XB 1XRRA 4ILLA 2IVYA 4I64A 2QAGA 1CJKC 2F55A 3S0MA 5AJXA 1ENYA 4N7MA 5A7SA 1DDLA 2Q8QA 1EV12 2HU2A 1W36C 4X6XA 1NSTA 3ZHOA 3STHA 4UW4A 2NN3C 1T5BA 1O0CA 1XWIA 3ZGYA 1QYDA 3MIBA 3WWOA 2QTVB 5HRCA 3MZIA 1Q14A 2BUNA 3EWNA 1R1DA 4P1ZA 4B3TJ 2C3YA 3HO1A 3UQSA 4TN7A 3IO3A 2XKBA 4Y2PA 1O95C 5CA1F 1FCAA 5JRZA 1J3QA 2BGWA 4PYQA 4KWIA 2E7TA 4B09A 2A58A 4V1CI 3UDCA 4NXNB 2ZWPA 3LLCA 5JNUA 2WOJA 4IFBA 1FFWA 2GMJA 3ENKA 4LMFA 1NIPA 3HNBM 3P9NA 3FZEA 1R082 2OZVA 1MIHA 3SYRA 1DUIA 4LO8A 1XN9A 2J9EA 3JWEA 4P5PA 1D8TA 2JG8A 2IFTA 2KG0A 3RZHA 1Y5NB 1X4HA 1EFUA 4UD6A 1HL3A 3EC1A 3PDCA 3PEVA 3CEHA 4ARXA 3P26A 3GF6A 4DF3A 4YJKA 2RS53 5LNK1 7YASA 4JP2A 4R1TA 4JKKA 3E8SA 1J5PA 2C0QA 5M3BA 3V6LA 5IEJA 1Q12A 2SECE 2ZHKA 1ZVKA 1UZAA 5TSWA 4C6TA 4UU7A 1WWHA