4OI4A

Protein complex of clp1 bound to atp and mg2+ with pcf11deltan454deltac563 of s. cerevisiae
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA specificity and regulation of catalysis in the eukaryotic polynucleotide kinase clp1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords mRNA cleavage and polyadenylation factor CLP1
total genus 125
structure length 428
sequence length 428
chains with identical sequence C
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4oi4A01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oi4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oi4A02
2WWWA 4Q66C 4B76A 5C18A 4V0MA 3A1TA 2HXYA 3MFYA 3W6OA 4F4CA 2H7VA 4FINA 4QGGA 4GI7A 1LB1B 1IBRA 3VR4A 1ESNA 1KO5A 1HY3A 4LV8B 1RJ9A 3I62A 1SHZA 2ZXUA 1Z0AA 4PHFA 3UATA 4D4MA 3CRRA 2OO7A 4HATA 4F92B 2RGAA 2CHQA 1A2BA 4RFVA 3BH7A 3CRQA 3H84A 4KVAA 4LOAA 1CJMA 4M1OA 5AUNB 4U00A 1E0AA 2ZSDA 4HUQB 2G1KA 2IYTA 4Q4AA 1XXHE 1NBMD 2KSQA 3ZQ6A 2BC9A 4TQUS 1UM8A 4Q1FA 4LJ5A 2NTYC 3ZD6A 1RC8A 4JT2A 3TNFA 3THXA 3RS0A 2R6DA 1OH7A 3R7WA 4C9BA 4F93B 4BRUA 2QQ0A 5KDDA 3LLMA 4JLDA 3VKGA 4RSGA 3O8RA 1ANKA 1SQ5A 1XTQA 2QG6A 1WB9A 3AKEA 2FGKA 5FI0B 2IC5A 1P62B 1YRBA 1ZRHA 3PEYA 2CK3A 4TLAA 4L4UA 4D6PA 4NU0A 1PV4A 2BCGY 2X8AA 1BIFA 4M8NE 2GTPA 3CNNA 2FPLA 4OK5A 5FBQB 1W36C 2J46A 4LRWA 2NG1A 3KXIA 5DLQC 1W2HA 1XF9A 2QA5A 1N6LA 3N2IA 4LBZA 2I4IA 4ERNA 4TMVA 1OJLA 4LCBA 5CB8A 1TNDA 2FOLA 4G5QA 3IEVA 3RRMA 4FWTA 2XZLA 2ZS9A 3GMTA 3QXHA 1NIPA 1NSFA 4F38A 1CR1A 2ZJ2A 3C15C 1T5IA 2XEXA 3RNLA 1GZSA 2ZR9A 1IXSB 3PUVA 4MGZR 3EPLA 4OL0A 2FNAA 4D4KA 4F91B 1FL9A 4OQNA 5G3ZA 4B2IA 1G3UA 4D80A 2C2HA 4ZIRB 1TQ4A 2RGNA 1E9SA 5CDFA 3ZVNA 3CRVA 3DMNA 3Q7QA 1E9AA 1OW3B 2Q3FA 3FVQA 4NYJQ 1ZCAA 2XJ9A 1HURA 1MOZA 2O8CA 5JZVA 1G8YA 1P61B 1E2EA 3A1SA 3FKQA 3LBNA 5EE3A 3SU8A 3UPUA 5AJVB 2FEMA 2WKQA 3CH5A 1SVKA 4URXR 4I1VA 2GEUA 2F1IA 5BN5A 1SVMA 4XSGA 4E09A 2QM8A 1DAKA 2HLDA 2ZSBA 3S1AB 1XEWX 2OM2A 5EXXA 2B21A 2ZSFA 4DIDA 4FMBB 1RZ3A 2C96A 2G3YA 3EIEA 5KNDA 2N42A 3GLFE 2IW3A 3GFOA 4QJ4A 2O8EB 1LF5A 4LYFA 4MYCA 2Z0MA 1MABB 4QM7A 4HLUA 4BPBA 1L4YA 4NH0A 2AFHE 1KO8A 3K70D 1DARA 1IN4A 2WOOA 3QXXA 1FQJA 2HJVA 4KU4A 1UADA 1YZUA 2GCOB 2RAPA 2VL7A 2V9PA 1ZD8A 1OXUA 1KSHA 2ZI4A 5F3WB 4JLAA 4Z54A 3TBKA 2ZRDA 2ZVQX 1GL6A 4M4SA 3FOZA 2AD5A 5EP4A 1XP8A 1ZD9A 2YC4C 1DOAA 2GXUA 1XPOA 2H8KA 2LKDA 2JIZA 5TDHA 2LWIA 1BKDR 4A1FA 1IXRC 1VCMA 4B2PA 2WWHA 2O8FB 4DT1B 2Q0HA 4P0TA 2B8TA 2BOVA 3KUCA 4LJ9A 5FI1B 2XTZA 3VR5A 1NJGA 3SFVA 2W00A 3SNHA 4WZBE 4H1VA 3K53A 1XU4A 1NVXQ 2C99A 3H4MA 1DO0A 4TTQA 5JRJA 4CGZA 4PTLA 4L8GA 3ZZUA 1KDPA 1E9BA 3RS4A 1IXZA 3IO5A 3O8BA 4EQ6B 3GJ0A 1XXHB 1KDTA 4YDSA 5EUMA 5L3QA 4A2WA 2VSOA 1ZJ6A 1GL7A 4EPXA 2DFKB 2XITA 1V5WA 3Q72A 2QT1A 2DHRA 2WJJA 2ZRIA 4LBYA 1P73A 1ZYUA 2ZRHA 1W0JD 2AR7A 4LY6A 1Z6TA 1G4UR 1L7VC 4M9ZA 4TL9A 4MH0R 2VH5R 2KWIA 4NE2A 1G20E 2PCLA 2XJ4A 4JLMA 3C5CA 2O8DA 1QHGA 1H65A 4Q01A 1NF3A 4RD3A 1NVUQ 3X1YA 4GL2A 2D2EA 2FSFA 2CMKA 3RDPA 2XOKD 2O8BA 4WW0A 4B3BA 1M1YE 2XTMA 1XMJA 3B8HA 4BFZA 2ZI3A 3THYB 1P7CA 2FX3A 5CIQA 1NY5A 1MV5A 1RPZA 1G41A 3FDIA 3ONWA 3AEZA 3GLHA 1ZNXA 1UKYA 1KKMA 1KKLA 3ADCA 1COWA 1W4RA 5TY0A 3RS7A 3PEWA 2GXSA 3KTAA 4DLTA 2BKEA 2YYZA 1NVVQ 5CB6A 2AKAB 2NZJA 5FOUA 3R7WB 2O8FA 1HYQA 3KL4A 1FUUA 2PJZA 2WJYA 3AKYA 3DEFA 4P32A 4C3ZA 1FP6A 2C04A 2D74A 4IDOA 3THWB 1G7SA 4S35A 2EWWA 1UPTA 1D5CA 5J40A 2JJ8A 1RVDA 2CJWA 3IILA 5P21A 1EX6A 5C4GB 4CVNA 4UNSA 1X1RA 3ZZ0A 2OFWA 3LLUA 5JCPA 5B2ZA 1ETUA 4JMPA 2ZE6A 4LJ4A 1YVDA 1E2MA 2G77B 4WZAE 4IEEA 4OHZA 2PJRA 4V0ME 2NO0A 3TGPA 1ZNWA 1CR4A 3MJRA 4HAVA 4MGKR 2J87A 5CK4A 1MH1A 3LO5A 2GK6A 2IF0A 4A82A 2PLRA 1L4UA 4DLUA 3U2QA 2GILA 3FYHA 1FFHA 3RSLA 4WVFA 1ODFA 1W5SA 1WF3A 3BFVA 3EA5A 1XDBA 4PPFA 2WWIA 1WE2A 2Z6VA 3QVVA 4EPTA 1FMJA 3OEHD 2QT0A 1G18A 4A8JC 4DT1A 3BXZA 1NMXA 2FPMA 4NHOA 1AKEA 4ZKDA 3W90A 4KXFB 2PEYA 2IYVA 2ZJAA 4B71A 1ZINA 1Q12A 5LD2B 3CB4A 3BIFA 5BN4A 1GAJA 3SC3A 1YJ5A 1Z5ZA 3KTAB 4EJSA 4FWIB 4EFMA 1TEVA 3L8ZA 4MA4A 1ZIOA 1XD9A 3CPHA 4PQRA 5FUWA 3RRZA 5C46F 1CEEA 4HAUA 1HA3A 2ZETA 1KMHB 1EGAA 3GLIE 5AJWA 3UMSA 3UMRA 1BYUA 1ZBDA 2G0TA 3EC1A 2JAQA 2BBWA 2IF2A 2B8WA 3EPJA 3MJHA 5FOXA 1T5LA 3GPLA 3X1ZA 3UWOA 3AKDA 4WZ6A 1XMIA 3P4XA 1GWNA 4EAQA 1ZMXA 2NOAA 1KI1A 4HZUA 3VR6A 2AXNA 1XEFA 3EAQA 1QHIA 1DAMA 3M4YA 3T35A 1X8JA 2GCOA 4JLJA 4QRHA 2WHXA 1OE0A 2OCYC 2XSZA 3KJHA 3ADBA 4IW3B 1IJFA 3SZRA 3AGPA 2WJVA 1OKKA 3W9YA 4PSKA 1SXJA 1DAFA 2F6RA 3K8YA 5BN3A 5KNBA 3Q5DA 2QTHA 1FPMA 2P6UA 4PAQA 3NBYC 3WP1B 4A2QA 1N6OA 2IUTA 2EU8A 3NXSA 2HCJB 4NBSA 5KSZA 1CJUC 4XWAA 3SJAA 1OHHA 3LY5A 4DKXA 4DCSA 1COWD 1XTRA 3QJYA 2C8VA 2RHMA 3BC1A 1KDOA 3MG9A 4BECA 3AVYA 4ZI3A 3G82C 2IX3A 2BJVA 1N5IA 2GEDA 4W5HA 3VMFA 4NDZA 5DGXA 4XH9B 1GRNA 5FBRB 5TXGA 2OEPA 2QP3A 1ZU5A 1VTKA 4FIDA 4NL4H 3PG5A 1S9HA 1U9IC 5JRZA 2O8DB 4RJLA 1E99A 3OEEA 4A4DA 1G7TA 2O8BB 3NIBA 4OI1A 3PVSA 4GBMA 3B1XA 2ZPTX 2XXAA 1F2UB 2W6ID 4UJ3A 5IT5A 2WIBA 2WOJA 2QRNA 1RRFA 2MSEB 4MKGA 5G53C 2ZRKA 3I92A 4P33A 3B9QA 4AIIA 4DEYA 4IXMA 3F5FA 1YHNA 4IDNA 4IDHA 4HB4A 1QF9A 3GCGA 3I73A 3LRPA 4MYUA 4QNRA 3HR8A 1PLKA 3BERA 4Q4LA 5EZ5A 2V1UA 4QG7A 3NEYA 3WNCA 1RKBA 3RS3A 2A5JA 1JALA 3AVTA 4KO8A 3ASYA 4TYYA 5F9FA 3EARA 2CVFA 4ZIRA 5CDFE 4AWXA 4WOPA 1UEJA 3MUFA 2VHTA 4JL6A 2EFEB 2VBCA 4C0KA 3MSXA 1W44A 4KLZA 4MQBA 2NPIA 2BEJA 1J99A 2CE7A 3QNUA 2ERYA 1J70A 5DN6A 1OFIA 1DADA 2E1RA 1E4YA 4LHXA 2PMDA 2JATA 3W3AA 3BH6A 2ONKA 3DZDA 4A36A 1E0KA 4OK3A 1N0VC 4LI0A 2C5LA 2CCKA 2REOA 1N2CE 1N5LA 5D3MA 4CIDA 4JBYA 4NP6A 5BWMA 1T8TA 4II7A 4XWKA 2QN6A 5JWOA 2ZS7A 2IYLD 5JJKA 1XZQA 1Q21A 5EE1A 1KJWA 1SULA 3K0CC 3P4YA 3T34A 4BZXA 5GVSA 1ZU4A 2YNMA 1KJYA 4ZDJA 2OAQ1 5J4YA 1KI9A 4IXNA 3ADDA 3CZPA 2ATVA 3I61A 1JEEA 1XEWY 4L9WA 4NCJA 4WAUA 5J5CA 3R8FA 2FF7A 5EXPA 1AN0A 4HEJA 4URUR 2OXRA 3SN6A 4KHZA 3ICQB 5ANRB 3G0HA 1N6KA 3UKDA 1TQDA 2GJAA 1OHHD 4WA7A 5EUQB 1E0SA 4P31A 2QZ4A 3REFA 3P32A 2V7QA 1N6IA 1YKSA 3LDAA 4OKSA 4I81A 4C2TA 1CJKC 2H17A 2J0SA 1E9RA 2P0EA 2RGXA 4PC1A 3SI7A 1XXHA 1UBCA 5AUQA 5IHPA 4KFTA 1E2HA 1ZP6A 4TLDA 1QHHA 1JAIA 4JL8A 1VYVA 1CXZA 5FH9A 2F1RA 1P9RA 3QPUA 4ZO4A 721PA 2O0JA 3N70A 4A2PA 2Y8EA 4W5WA 3NHBA 2B7BA 4M1MA 2Z5FA 3CIOA 1E9EA 1GVNB 1GRRA 1OFTA 3U6BA 5JHHB 3QG1A 1FW6A 1Z0FA 3W8RA 4XVRA 1DG1G 3ZZTA 1VDZA 2H1LA 2P2LA 1TPZA 1P4SA 2A5FA 4PO8A 1II9A 2PCJA 3KKOA 3WYFA 3SBEA 2OCAA 2ZUBA 1KI6A 1KY3A 2HT6A 2GF0A 2WKPA 2G88A 3LXXA 4TMWA 1YZNA 3EZ6A 4EPVA 4PPNA 1Z0IA 1OFHA 4ITRC 2WAYA 1O87A 1OYWA 3HPQA 4BUJA 3I5XA 4DXAA 1Z83A 3THWA 3RABA 2ANCA 4B2LA 2AD1A 2QROA 2J0UB 1WP9A 2X2EA 1F6BA 2DYKA 2WJHA 4BFTA 1NG9A 1MABA 2OE2A 3NWJA 1TEXA 4IOKA 4NTZA 3TK1A 3A4MA 3ZYCA 4JIMA 3P27A 2DB3A 1LV7A 1Z0JA 4KJZA 4ZPXA 3U5ZB 1G3IA 2XNDA 4ZCIA 3Q9LA 3TE6A 2WSSD 1NVWQ 2VHQA 4M53A 2GETA 2HDNB 4PSVA 4Q7JB 1FX0A 2VIIA 1DBSA 1R5NA 4LPSA 5FOSA 3B5JA 4KSCA 2GF9A 2ZUDA 2HUPA 2YOHA 1GNQA 5C2JB 2X2FA 4HAWA 4URWR 3TVTA 5FPKA 4IOMA 2RGGA 4ON9A 1SZPA 5LD2C 1G3QA 1SXJD 4GOKA 3K0CA 2JASA 4A0GA 1KK0A 2W0MA 5EP2A 4Q1BA 5KPDA 1GFIA 2A9KA 3GQBA 4UJ5A 2XB4A 4C2UA 4G01B 4LZZA 5DIFA 3U61B 2OFXA 2Z4SA 4D4JA 3CX6A 3BH0A 1Q1ZA 4OBEA 1YZTA 4HUQA 3AV0B 2JLRA 3R9XA 4DSOA 4CZ2A 1XTSA 4FN5A 1IHUA 5GVRA 1DVRA 2I1QA 2FGJA 4MRSA 2JLUA 2P6NA 3AVVA 4BFVA 4GZMA 4DVGA 4PPGA 2OSBA 1MRNA 5JECA 1KK3A 2YWHA 3IIKA 5GADl 1ONBA 5AUOB 4AYTA 5JEDA 2X19A 3MWKA 4YMWA 2GVZC 3EG5A 3FFBA 4NONA 4NYJR 4LSGA 5M04A 5BQ5A 1QHXA 3GLIB 3OEED 4HAYA 3U44A 1J8YF 1Z47A 4TMKA 3QXSA 2OILA 5FPSA 1JR3E 2H5EA 3CRW1 1EFRA 4HUTA 4HZUB 3UWKA 1KDRA 3C14C 1YZGA 4C0SA 1KK2A 2ZANA 2QM7A 3IPXA 4MYTA 2ZROA 3TUZC 4KFUA 2W6IA 4JJKA 3K70C 4LDJA 4A6PA 5BYKA 4LYAA 3MAAC 1JNYA 4Z8YA 5B64A 3IBGA 4MUBA 5KNCA 4LPKA 4O2RA 3KFXA 1UKVY 1RYHA 2J45A 3EPKA 2R2AA 5CJPA 2F3TA 3RC3A 4MGYR 4TN1A 2QUZA 5JFGA 2JCSA 5FTMA 1IJEA 1NIJA 2FH5B 4FCVA 1MR3F 4ARZA 4IJMA 1YZLA 3CONA 1VYUA 4B3XA 3AH8A 3IIMA 1OT3A 2ZRPA 4BRWA 3D8BA 4RZ3A 2ZI5A 1OYYA 4X8LA 2D7DA 1JEDA 4LC1A 4PO9A 3QF4B 1DAHA 1E2PA 2NIPA 2BEKA 2YWGA 3C4JA 1CS4C 3LX5A 4G5OA 3RSOA 3T1VA 4DB2A 1L2TA 5JWHA 1YRAA 5DI9A 4Q1AA 1F2TA 4AURA 1Q1QA 1E9CA 4B43A 2FFQA 1MKYA 1RFLA 2BKUA 3AVXA 4AKHA 1KO7A 2DWQA 3TW4A 2GDJA 2WJGA 4WBSA 5F2EA 4YMUA 4IDPA 5B58C 3C41J 5K8IA 2K5UA 1SVWA 1GNRA 4TQ9A 1KY2A 3AP1A 2CLSA 2CK3D 1VG1A 5FUXA 2NQ2C 3A6PC 3L0PA 3K1JA 1M74A 3HU2A 5ELXA 2R6AA 3PV0A 2O8EA 1PUIA 3EC2A 3TSOA 2D06A 2ORWA 2I1VB 2QP9X 2YV5A 1FP7A 1G5RA 2Q21A 1P2TA 2QPTA 1QHSA 2C95A 4JLNA 1E0JA 3KJGA 2GCNA 4MDEA 2G9NA 5K8TA 3HP1A 4MRPA 4O25A 3SJCA 1R0ZA 1W0KA 2WWGA 4XVUA 1N0UA 2ZYVX 5KYKA 1T0JB 4BLTA 1RE0A 2FSHA 1GRQA 1XJQA 3IKJA 4BFYA 5CM8B 1A1VA 3LD9A 4U5XA 5SZHB 1BMFA 3K09C 4ZI2A 4GMDA 5HZHA 4UQOA 2XAUA 1ZC4A 2Q3MA 1AZSC 3BOSA 4MITA 5DO9A 3U3OA 1H8HA 4NCNA 1GSIA 1XZPA 2GXAA 2LKCA 1Z0DA 2ZI7A 2F1HA 4I1OA 1M6NA 1W2GA 521PA 3TRFA 4PZZA 1Q3TA 4U7DA 4EQ6A 5E7JA 3E5HA 4TMZA 2CVHA 5TB5A 4B73A 4D2IA 4XTCS 2QAGC 4UKDA 2BV3A 3VX3A 3A1WA 1S1MA 3QVUA 3X1XA 2OUKA 1SVOA 4QBIA 2BIFA 2N1BA 4K8OA 3LVRE 4DJTA 1KIMA 1S9DA 3AQ4A 3OAAA 2QEQA 2DWOA 2RHDA 3HYRA 5F9HA 3NDBB 3BBPA 4FCTA 1M7GA 3ICEA 4JYBA 1OXVA 2G1JA 2QBYA 1OSNA 1SKQA 4NCKA 4QL3A 4DCVA 1YR8A 1E4VA 1JECA 4JKYA 2N46A 4HLUC 5A0FA 4JKIA 2JLXA 2E87A 2Q9AA 3VQTA 1VCIA 2VYFA 4YMTA 1OH6A 2OESA 3VR3A 4M9XA 2ZRMA 2QORA 2A5YB 2G0NA 3W5JA 1RRGA 4KFSA 4KBFA 4D81A 2FFBA 3Q8XB 4KVGA 4FD2A 1W47A 4JSYA 4G5RA 5IDVA 2R44A 4BFXA 1CIPA 4EUNA 2CNWA 2F7SA 4KAXA 4B74A 1AIPA 5JEEA 2PLFA 3QQ5A 5FPTA 4RFSA 1XBTA 2UKDA 3NC1C 2WPDD 4FMCF 3I8SA 1R8SA 2LCFA 3THOA 4KSBA 1JR3D 4ZKEA 2XB2A 1JB1A 3E70C 1R4AA 4UNNA 5FFMA 4TZ6A 1RYFA 4JLBA 4QXAA 3KQKA 1S4QA 2WSSA 5AUPB 4YLGA 5DI3B 5E95A 4AKGA 1DG3A 2VF8A 5JI2E 4TMTA 4E03A 3FKSA 4AK9A 4O0MA 3FMIA 1IN6A 4RKFA 2AXPA 2FMXA 3CX7A 5DSZA 2BWJA 2R9VA 5JMTA 1II8A 1OIWA 2J9RA 2MMCA 5E7MA 2CL6X 3U7GA 3ASZA 3OF5A 4G0NA 5DHFA 2RGNC 3G5UA 2AHOA 1Z6XA 3HU1A 4TYWA 3Q3JB 1CJTC 1LVGA 1CJVC 3B85A 4R71A 2CHVA 2QMHA 2YJTD 3T06B 5FTKA 4CT5A 2QQEA 3KXLA 3SS8A 5L3VA 4M1WA 1NP6A 3BE4A 3B82A 4PHTA 3FHOA 5JJIA 3REGA 1CRPA 2HF8A 2IYXA 1ESMA 2FSIA 1E2LA 2FU5C 2C9YA 3D3QA 5FR2A 5LDDC 2ONJA 3TR5A 1G64A 2QGNA 4C0HA 2VP9A 1KGDA 1TTTA 2DFTA 4B47A 1W5TA 4R2IA 3QE0A 2OHFA 3LX8A 4BEJA 3RWOA 1JJVA 1WDTA 4BFWA 1OH8A 4DLSA 1KSFX 1E94E 4KV9A 4JBXA 3CW2A 1EFHA 1TAGA 4RFSB 1MO4A 4ZCLA 3B13B 3KJEA 4EIWA 2V54A 5GJBA 1NMYA 2QAJA 2J0UA 2J7PA 4LJ8A 1KI3A 3IUYA 3K0AB 4B44A 3NTUA 2R6CA 3LAWA 3RS2A 3QEJA 2C98A 3RVBA 1C1YA 4BLPA 5KHOC 4EFLA 3L82B 4Q4HA 3LVQE 3QSYA 2BBTA 1ZUIA 3THYA 2B6HA 2V6IA 3NBFA 3QBTA 5EZ6B 1G291 2QP4A 4XTRA 4C0JA 1N6PA 4P4SA 1B0UA 4QHTA 1VCOA 3TSWA 5E3HA 2WZQA 5HPYB 2IYWA 4JSTA 5DNYB 3CR8A 2GJKA 2IS4A 2A5DA 2ZE8A 1T9HA 4TLBA 3QPVA 4JVMA 2IK8A 3DOFA 2ZU6A 3L43A 4KODA 2JIZD 4W9MC 4A0RA 1KYIA 2ZRJA 2GXQA 4MYHA 1S8FA 1AS3A 5LPNA 2W83A 3C8UA 4C4PA 2WTUA 1ZM3A 1SGWA 3WMFA 3CO5A 2CJWB 2XZPA 2IS2A 3BORA 5TARA 2WWXA 3NH6A 3CNLA 2O8CB 3T12A 2FSGA 4ILEA 1MRSA 1U8ZA 1GKIA 2JLZA 5DE3A 4DCNA 2J1LA 3K9LA 1M2OB 4RCZA 1ZIPA 1FTSA 1ZNYA 2VP5A 3LW7A 1UEIA 1GITA 2AK3A 1XWIA 3E2IA 4LYHA 2WV9A 1E79A 2QSZA 1U99A 3CKLA 4DUGA 1W7AA 1RRPA 2XNSA 4KYUA 4NCIA 3LBHA 3I5YA 2XNDD 2WBLC 1DO2A 3U3JA 1QHNA 3WBJA 1JPJA 2D62A 3KKQA 1QDEA 3TR0A 2V4ZA 4KFRA 4AG5A 3K70B 2IHBA 1G6HA 3FKSD 3O47A 2JDID 3L8YA 4ASUD 3GJ8A 3BRWD 4I1UA 3R9IA 2IXFA 3AF2A 1KZGB 1YZQA 2DCUA 4V0LA 3HDTA 4Y0VA 1NLFA 1AZTA 4HLQB 3CF2A 3PUXA 4P4SB 2NO1A 4DDTA 3RHFA 4LYJA 2WWYA 2B7CA 4DWJA 3N2EA 5FBWB 2RGEA 3KX2A 2KB0A 4NMMA 1BMFD 1NL3A 3A1UA 4M1TA 5GJWC 3PR1A 1P2VA 5HTKA 1GP2A 4M2LA 3TUJC 2VHCA 3WRXC 1DPFA 3VAAA 3U4QB 4CT4B 4IOLA 4D0LB 3CWZA 2C03A 1W36B 1XCGB 2D2FA 4CYMA 1H8HD 5FL7D 2RB4A 3E1SA 4NYIQ 4TLCA 3T1QA 4Q21A 5G41A 2WJIA 3KB1A 3ZS9A 5EP3A 4GNKA 5LB2A 1QVAA 3SOPA 1CR2A 1I4TD 3LQRA 4JVSB 1YR9A 4RVCA 3LA6A 3NVAA 2ZRBA 2IYYA 2RKOA 5EJEA 2WSMA 1R5OA 1X6VA 1VCNA 3EW9A 1N6NA 1D9XA 1NG1A 3KKNA 4RCYA 4S2EA 5TVKA 4AI6A 1P9WA 5LB4A 2FV8A 4BLRA 1TADA 1ZNZA 3CF0A 1BYIA 4URYR 4PC6A 2CL0X 4CF7A 4J0QA 3T5DA 2C9CA 1LY1A 2CE2X 2ZYTX 1JQLB 3AKCA 3B2EA 3DO6A 4B34A 3TVDA 5HKKD 4QNMA 4JZKA 1S96A 3IIJA 2KJQA 4RD6A 5B30A 4Q1DA 3ADKA 1XB2A 4D0GA 3W6PA 2OCPA 4OI2A 3SYLA 1E1RD 2BBOA 1IQPA 4TYQA 2ZSEA 1VHTA 2ZRNA 4P3YA 2SHKA 3GP8A 1TQ2A 4A92A 3T1OA 2IBMA 2YOGA 3A1VA 3AUYA 2WPDA 3BWDD 2OBLA 3KKMA 2HCBA 4M1SA 3QEOA 3WYAA 1XJ0A 4HYYA 2AFIE 4BE7B 2BMFA 1FNNA 2CXXA 3GLIA 2YOFA 4BFSA 4I99A 2FZ4A 4Q4JA 4V02A 3LNCA 3D7MA 3PUWA 1P2SA 3D6TB 4QKQA 4PAOA 5HR5A 1QVRA 3V4RA 1U98A 1TMKA 5H8WA 2R65A 1X8KA 1SVIA 1S2MA 4M9SA 1KSJA 2F43B 1T0HB 2MSDB 3IHWA 4XD7A 2YWFA 2UZIR 1N6RA 1GDDA 3IEUA 4LX0A 1KI4A 3I8XA 3MGCA 4OI0A 1IY0A 2GEVA 4JS0A 3N5CA 2P67A 2P6RA 1G6OA 3B60A 3DM5A 3UK6A 3M6AA 1IY2A 4DDUA 3CR7A 4FMCB 4N0EA 4WIAA 2O52A 4B48A 4RZUA 5EE5B 3PEUA 1AA9A 3FGNA 3CZQA 2NZ8A 2ZJOA 3IGFA 3SYKA 1Y3AA 3SR0A 4DCUA 1T3SA 2DPXA 4EPRA 2YWEA 1IONA 4Q9HA 2Z43A 3HWSA 2OXCA 3VU9B 1TF7A 1KI8A 3QKTA 4R2HA 4EPWA 1KMHA 1SHKA 4JLOA 1R10A 4CW7A 1J7KA 1P6XA 4OQMA 1UBFA 4Q1EA 5DYIA 1TX4B 3X1WA 1OIVA 1XPUA 1HE1C 1XTIA 2QPOA 4V03A 3V9PA 5GJVC 4F4IA 2YKGA 2DY1A 1X86B 2IT1A 3V00A 5DHAA 3VR1A 2IS1A 3QPWA 4PO1A 3BAFA 4A9AA 5DI3A 3ZVRA 3VNUA 1LW7A 2Q9CA 3T61A 2GRJA 3SJBA 5J4KA 1K8RA 1N5KA 3K9NA 2OZEA 2XZOA 4BLSA 1A82A 4M0LA 3PIRA 1J8MF 3OIVA 1XCMA 4C0QC 4AY2A 4IVPA 1HE8B 1BS1A 3AF3A 4Z51A 2FA9A 2ZIAA 1U81A 2WVJA 1F60A 2ORVA 2BMDA 1GL9B 3VKWA 3FHTA 1N6HA 1CTQA 2ZJ8A 4C0AC 1Z6GA 2QTFA 2IYSA 1X1SA 4EPYA 2AX4A 1LTQA 3VHLB 2NMVA 1WBBA 3K0FA 3GEIA 1DAIA 1HV8A 2REXB 4QM6A 4L9SA 5JJLA 2ZYWX 3JZAA 2ZSAA 3GLGA 4KYIB 4TL7A 1J2JA 3ZD7A 1YR7A 1IM2A 5HE8A 1Q20A 5BW8A 3UG7A 1U2RA 1OIXA 3LV8A 2KI5A 2GNOA 3GD7A 1OXXK 1U0HC 3VFDA 2ZU0C 4QJ3A 4KITB 1UAAA 1MT0A 5L8VA 3R8CA 621PA 1G5TA 1JR3A 1VPLA 3R20A 2DWPA 5SZJA 4DLZA 1HH4A 1TL7C 4DB4A 2IUSA 4ZDWA 4HDQB 3A58B 2QE7A 1TUEA 3H2YA 3MD0A 2GZHA 2JLQA 2JJ2A 1ZM7A 3A8TA 2IWHA 2I3BA 3WHLA 2CEAA 4B3CA 2XSZD 2IYQA 2J0VA 3OIYA 1AS2A 1XTJA 3QBVA 1US8A 421PA 2VTKA 1VYTA 1ZVQA 1Q3HA 1H8EA 3WYGA 1DAEA 1FQKA 4IEIA 1LNZA 4G5SA 4LHZA 4B35A 2VLIA 1YR6A 2XXAB 1GKYA 4PSAA 4UNQA 3IHLA 4X8HA 1N25A 2JDIA 2P5TB 4CDGA 3CH4B 4L15A 2JLWA 4V0OA 4BFUA 4FW9A 5JBQA 3CPJB 1RW4A 4QOSA 1ZCBA 3VNVA 2W2TA 4BEBA 2WAXA 2ZRCA 4Q9LA 4B33A 4R9UC 3NH9A 1T3HA 4L5BA 1UBGA 4E22A 1E2IA 1JQJC 2YZ2A 4V0KA 3THXB 3ZVLA 5CYPA 2J5XA 5CITA 1II0A 4QHYA 5J4HA 8OHMA 1ZUNB 3FB4A 5DISB 2PT7A 1CP2A 4EDHA 2VF7A 3AF0A 1SKYE 3X1DA 2BHRA 1K5GA 1KAGA 3K09A 4Q5IA 1Z06A 2YC2C 3C16C 1F2TB 4M9QA 4NZYA 5FL7A 2ZJ5A 4K81B 3U3RA 1KMQA 2JLYA 1K5DA 5L3QB 1NN0A 3DPUA 1DEKA 3QIAA 1VG8A 2DFNA 2QMUA 3FMFA 4DSNA 2VSFA 4HDCA 1NN5A 5KSPA 1I4LD 2IXGA 4BQSA 2IYZA 4HB2A 3CRMA 4M1YA 4Q47A 4B3DA 2PMKA 2QAGA 1AK2A 3GJXC 4TYPA 5JWRA 1A7JA 1XD2A 4C7OA 3CPEA 1IN5A 3TQCA 4DZZA 1M8PA 4AG6A 2X1VA 4IFBA 5FUVA 5F98A 4FXPA 4OQLA 4HI0E 1OF1A 4DEXA 4JVLA 1FNMA 3NDPA 2EVWX 1JAHA 5CK5A 4XOIA 3LW8A 3NKVA 4RD4A 3FE2A 1WXQA 1NBMA 1Z2CA 3DZ8A 2O0HA 1CU1A 1M34E 3HYTA 1U94A 4LJAA 4N3NA 3AVUA 1Z29A 3NBZC 1Z22A 1E2DA 2RGDA 2VP0A 3F3YA 4NCHA 4LUCA 2ZJZA 4PFSA 2OAP1 4AKIA 5L3RA 1R5BA 5BXQC 4MDFA 1NBME 1HEIA 4A0HA 5JCZA 1E2JA 3FFAA 4GPTA 4URZR 4Z1MA 4HDOB 4BGDA 1OPXA 1UJ2A 3EZ2A 5BYJA 4OHWA 1O3YA 1NMZA 1AJEA 4TSFA 3UANA 4BLOA 1HQYE 2GWHA 2RH5A 4YMSA 3BFKA 1GILA 5FTNA 4RZ2A 1Z08A 3AGQA 1Z28A 4IHQA 1DELA 2Q3HA 2ODEA 4PC7A 5J47A 3NC0C 1EFUA 5EE9A 3UIEA 1W0JA 4UNRA 1CLUA 1QHHB 1ZM2A 4RKEA 4ASUA 1IN7A 2ZEJA 4JT4A 2VQSA 5G3YA 1BH2A 1U0LA 1XX6A 3ZLJA 4BZQA 2GK7A 3WMGA 4MRNA 1HUQA 3SFZA 2F9LA 2ZM5A 2H57A 2ZR7A 2GBLA 3I4LA 3PITA 4QC2A 3UXMA 4XWOA 3NEJA 4A15A 4KI0A 2BM1A 1CF4A 4JBWA 1L8QA 4TTPA 2NPFA 4Q02A 1AGRA 1G8GA 2ZRFA 1G21E 1E3MA 1D9ZA 1AQYA 5LBIA 4ARZB 821PA 4FCWA 1NN3A 3GJ5A 3KFVA 4P4TA 3GLGE 1AGPA 3GFPA 1GKUB 4H1UA 3IBYA 4BZPA 2KBEA 3WHKA 4YQFA 4Q03A 4A8JB 2PZFA 1UKZA 1I4DD 4CRWB 4OQXA 1I2DA 1G8HA 2FWRA 3CNOA 4PZYA 5GJCA 3HR7A 2O5VA 3LXRA 4W7SA 3ECCA 5H1YA 4Q9IA 3ZJYA 1XMVA 3EZFA 1XJCA 2R6FA 3SEAA 1G17A 3SYNA 3QENA 1HQCA 5D3MB 1KNQA 4R98A 2GHIA 3BD9A 5H70A 4DDWA 3BB4A 1XCPA 3AP2A 3PUZA 5HE9A 3PXGA 1OXTA 3OE7A 2B92A 1JXOA 3QY0A 3T5GA 4ABYA 5CJ2A 4X8OA 5J4VA 1V43A 2VHUA 3DL0A 5KSOA 3EIQA 2EFCB 1A5TA 3K0SA 4TZ0A 2F43A 4A6XA 2R8RA 1GTVA 4TT3A 3A36A 3BB3A 2DBYA 1P60A 5HKKA 2OBMA 2IUUA 4A0FA 4LJ6A 4R7ZA 4ESVA 1SXJB 2QI9C 3DM9B 4M1KA 1GOTA 1SVSA 2D3WA 2A78A 2GZDA 2JA1A 3WBKA 3C5HA 3K9GA 4JLVA 4NPHA 1G1MA 4B6EA 5KUTA 5KPJA 2CCJA 1E2FA 5FL3A 4WXPA 4PR0A 1YZKA 1KSGA 2REBA 2ZRAA 4TMXA 1S0UA 4PC3A 4Y0AA 5TV2A 4BLQA 1TQ6A 1VKJA 1I2MA 4C0LA 1Q0UA 1W36D 2J41A 4HZIA 4GRAA 4GDFA 1FTNA 2CHGA 1JXMA 2BJWA 2ZRLA 2WKRA 1JPNA 4TSFD 3PQCA 1PVOA 2JJ1A 1CR0A 2W2XA 5FBVB 5AWFC 4CEHA 1GUAA 2OBNA 1PLLA 2JGNA 2QE7D 3H1TA 3AF4A 4TL6A 2VSXA 4TTRA 4LK2A 2H18A 2W2VA 4C7OB 3K0AA 1BOFA 3RYTC 1UKEA 3U7HB 3PEVA 3NG1A 1AM4D 3DKVA 1Z07A 1H8ED 3H86A 1KK1A 5CM9C 2TMKA 5TMPA 4DIEA 4DSTA 4CEJA 5DH9A 3AF1A 2RMKA 4Q00A 4GSYA 5A5GA 1Z8FA 1EFTA 3Q5EA 1M7HA 4YXWA 3L2OB 2ZAOA 1CKEA 3TH5A 1G7RA 2PZEA 4WXRA 1NJFA 4IKEA 1GG2A 3K0FB 1RIFA 5FBLB 1XPRA 2KBFA 1R7RA 2QENA 2BBSA 4HAXA 2V6JA 4JYCA 5KTYA 2YINC 2G83A 3UG6A 2XTNA 3T1TA 3AVWA 4MGIR 2PL3A 3ND9A 4AYXA 2GKSA 3EXAA 4C0BA 3VHXA 1N3BA 2OFOA 3B6EA 4LWZA 5CLQA 3B1WA 4QBFA 3U7EB 2PZGA 1ZUHA 3IO3A 1M7BA 5JS7A 3GLFB 1PUJA 4F7WA 4LC0A 3ZS8A 3I72A 1KHTA 1T3LA 3VR2A 3L0IB 2JLSA 4OYHA 5EQTA 3B78A 2EWVA 5K8UA 3ZDQA 4DSUA 5L3SA 3O8CA 1HTWA 1DAGA 3BB1A 4AYWA 3VKHA 5E7IA 2GJ9A 4MUAA 4AKEA 5H68A 1KI2A 4BASA 2FE4A 2ZE5A 3VTKA 4G3XA 2ZI9A 4RZXA 3U3MA 3Q7PA 3W8NA 2EYUA 3LH5A 4N0DA 3JVVA 2Z4RA 5AJYA 1D2EA 1Q44A 2MSCB 1F3OA 2HF9A 4LV5B 3B7GA 2HEIA 3CWQA 2P3SA 2IWRA 1P9NA 3MCAA 3WRYC 4IFEA 1R6BX 4NYIR 4GP6A 4A8JA 2V55B 1KO4A 2W6JD 1KZ7B 5J4LA 1T8UA 2AN9A 1W49A 3O8DA 5KU1A 2CLCX 2GESA 4HB3A 2OLJA 3FMPB 4PQFA 1WBDA 3GJ6A 3D31A 1EFCA 5KO2A 1KOFA 1P3JA 2VO1A 2AWNA 4LHYA 4B32A 2HT1A 4D26A 2F55A 5CYOA 4QFMA 3M1IA 3LWNA 6Q21A 3QKRB 1YQTA 3A37A 1XEXA 2IL1A 4UXJA 1HT2E 2ODBA 5KDLA 1G5PA 2RGBA 4OJKA 4TQAA 3KDSE 1E32A 2WM9B 2IYRA 4UXHA 2ZJBA 5IRCD 3ZH9B 2JEOA 1X3SA 2AL7A 1KAOA 1DTSA 4FI3C 5FTLA 4OHVA 2MMGA 1E1QD 3OFNA 2XGJA 4GT1A 1G4AE 2DR3A 1A2KC 1F5NA 1E9DA 1CBUA 1VIYA 2BM0A 4KCGA 3WY9A 4DLXA 3ZQJA 5CIWA 5AJXA 2P65A 1S3GA 5G40A 4IVQA 2QNRA 1Q22A 2DFLA 3P1JA 4ACBA 5IK2A 3WMEA 2ATXA 4US0R 2GZAA 2ZQ5A 1KJZA 1KI6B 3AP3A 3NHAA 1GIAA 5B57C 2XX3A 4EKDA 2ASEA 3A4LA 1Z6AA 3TUIC 5JS8A 2F1JA 4EJSB 2H92A 1TF2A 2ANBA 4AD8A 1U90A 2EQBA 2F3RA 2VA8A 1ZD1A 1F48A 1LF0A 3PENA 4NKRA 2ODNA 3NBXX 1QBKC 3EASA 2EYQA 1ZAKA 1D2MA 1LS1A 2L0XA 2WMOB 4Q19A 2NO9A 3U3KA 4OQFA 5KOYA 2VRWA 3OE7D 1R0YA 1WMSA 4LHVA 1R0WA 1QZXA 1ZC3A 4PHHA 1P75A 2A3RA 2UZ3A 3AVQA 2YVUA 3QXJA 2C77A 2ZR0A 3GJ3A 5FOTA 4YC7A 3KKPA 2W0SA 5KDOA 5A4JA 2KE5A 1JI0A 3OEHA 4CEJB 1IAQA 1W4CA 4LBVA 1U8YA 1S3SA 4PANA 1LS6A 3C7KA 4ESHA 3GLHB 1XRJA 1ZM4A 5KSYA 4XIGS 1W4AA 1W46A 5FUYA 2E9SA 3OIUA 1FMLA 1NKTA 2AKYA 1EWRA 1G19A 2BDTA 1WRBA 1EX7A 3A4NA 1VMAA 4L16A 1E96A 2RGCA 1U0JA 1Z63A 4LJ7A 3U4QA 3CX8A 3OHMA 3BFXA 3DVLA 4P4UA 5HCNA 4QGAA 3SQWA 2QMEA 2CBZA 2IEYA 2CNWD 3ETLA 3ZVMA 3B1VA 3KJIA 1P72A 3EX7C 3GJ7A 1OB5A 3U7FB 3Q85A 4Q7MB 2ZYUX 4DLWA 3K0EA 4EJSC 1FOEB 1OH5A 1G3MA 2GAOA 2W58A 4CEIA 1SKYB 1W1WA 3DOEA 4XVQA 1W48A 3QKUA 2CL7X 1JBKA 2ODWA 4G5GA 1B23P 4RY2A 5D3QA 3BGWA 1E79D 3MWLA 2JJ1D 3AM1A 4EFNA 3BK7A 2ORIA 4N1AA 1NLZA 2C78A 1OKKD 2ZS8A 5C4MA 2BVNA 3HU3A 4LHWA 3TIFA 4D25A 1E9FA 2WIAA 3V4FA 4ZDIA 1VHLA 1DE0A 1KI7A 1S1CA 3TW8B 3OFND 3QG5A 3QKSA 3SHWA 4B75A 4MRRA 1G7CA 4PZLA 1N0WA 3HPRA 5EE0A 4URVR 4QHSA 2QTVB 1E2NA 4DLRA 2EFDB 5SZKB 1YE8A 1MO5A 4W5JA 4YXWD 3KQHA 1MO3A 3KQNA 2V7QD 1SXJE 2OV2A 2A5GA 2ZE7A 5FOWA 4OK6A 2IEZA 2QPAA 3B1ZA 3WNDA 4AC9A 3ZIAD 5IK2D 4MRVA 4E5UA 1VG9B 5JHGB 2F9MA 1E69A 2A30A 1E2GA 1NY6A 1OV4A 1G16A 4GOXA 1WQ1R 1U9IA 4XJXA 2PT5A 3DDCA 4GZLA 2FG5A 3QXCA 3GFTA 2GCPA 4JLKA 1UF9A 3CLVA 4Q1CA 2J7PD 3PUYA 2GAAA 4DBLC 1Q57A 2V1XA 5AK0A 5UKDA 3ZGXA 4O3MA 1JJ7A 4YONB 3UMFA 3EPHA 1FX0B 4IVRA 1II8B 1UFQA 4HLCA 2GA8A 3SE0A 4YMVA 3U6KA 3QUSA 4QBGB 4QBHA 1NSTA 4TT3D 2WWFA 2OLKA 1US8B 1EFRD 3IDQA 4OJQA 3SHFA 4BWYA 1NVVR 2CCGA 2PX0A 4PC2A 1C4OA 1EK0A 1QG2A 1QHYA 2ZREA 1R2QA 4JVNA 2BMEA 2FN4A 3KZ1E 4GOJA 3B1YA 1BO6A 2EFGA 1QG4A 1Q1EA 3QKSB 1YU9A 3LBIA 1D8TA 1PJRA 2BMJA 4MKFA 5DYGA 3GEEA 2EFHB 4LGMA 3PFIA 1ELOA 4LBWA 5JSZB 3RRNA 3GLHE 2IXEA 2CLDX 1TUIA 3BJIC 5EXTA 3VU9A 4DLVA 1XD8A 4QGFA 3J81k 1E1RA 5C1BA 1P2UA 2IA5A 1E2QA 4TL8A 5DN6D 3ND8A 3JZMA 3WP0A 3P20A 5EXSA 2OCBA 1UBEA 2RCNA 3QI2A 3WNBA 4K46A 2J3EA 2ZITA 3T15A 2NGRA 2IS6A 4DUGD 4RD1A 1A4RA 2VP6A 3RAPR 1E98A 3QOFA 3GLFA 2ZJYA 2VHJA 1NKSA 4Z8XA 4C30A 4OHXA 2QU8A 1FUKA 3W5IA 4IRUB 2J7KA 3F8TA 2A7QA 2YHSA 4TLEA 5AJZA 4NYMQ 2HV8A 2HJGA 4XD7D 3M0EA 2JJ2D 4Q4HB 5FPYA 1ZW6A 2VPPA 3X2SA 4F4JA 1KO1A 3AVOA 2GVDC 4X8MA 3VX4A 4OHYA 4QJ5A 2Q6TA 3TAUA 1RRCA 2AK2A 3I3SR 3LQQA 4NYMR 3W3ZB 5SZIA 2J0QA 5E4FA 2QAGB 2V3CC 1HT1E 1R0XA 4JJZA 3CM0A 2FEOA 4Q18A 3TAHA 4XSHA 3FPAA 1TU3A 2ZTSA 5K8LA 2QY9A 1RJ9B 2QGZA 2OT3B 3EWSA 1D6JA 1OFUX 2ERXA 2GBLC 4ACAA 3I1FA 3MWYW 3TJZA 4DDVA 1W0KD 3SQXA 4QGHA 3EWAA 1R8QA 3QF4A 3WXMA 1ZM9A 2CDNA 2A2ZA 2FZLA 3P26A 1NNEA 3CUEF 1IY1A 1NN1A 2PX3A 1CULC 1P5ZB 4IDQA 1AKYA 4B6FA 2QRZA 2JLVA 2HXSA 3AUXA 3KUDA 2R6GA 5HCIA 2UVQA 3OESA 4TWZA 3W6NA 121PA 2NO6A 1AQUA 3MWJA 3OIWA 4DC9A 1AS0A 1NRJB 3RLFA 1UDXA 1OB2A 1G8PA 1W4BA 1FZQA 3IQXA 4JLPA 3DKPA 5JLJA 1D2NA 1XNJA 1Y63A 2HYDA 2G6BA 3RWMB 4ZCMA 5JI3E 2ZAMA 2GJSA 1DS6A 2VP2A 2VEDA 5AR1A 3TQFA 1Z6YA 3FWYA 3PJRA 3FTQA 4GP7A 5FTJA 4DRZA 3DMDA 3EA0A 3H0KA 3SJZA 4U02A 4HLDA 4HAZA 2WICA 3AVPA 1EXMA 2NO7A 3JVUA 4B3GA 1G9XA 2D7CA 1NI3A 1Q1BA 4UXIA 4PAMA 2AWOA 3W34A 1T91A 2FPKA 5HZKA 4UNPA 4DCTA 1CRQA 2V8OA 1XMSA 1E2KA 2PBRA 5IF9A 4ZDKA 4OI4A 3IPYA 4US1R 1NLYA 4US2R 1GNPA 4Q7LA 221PA 4PX9A 4RD2A 3EZ9A 2W6JA 2O0KA 1PLJA 3IQWA 3CBQA 2EW1A 1XFAA 2D4HA 4V0NA 4H9GA 5FOVA 3TMKA 1G3RA 4I4LA 3LFUA 1C9KA 3HJNA 3PCRB 3RC8A 1EESA 3KB2A 1TF5A 4Q9JA 4PXAA 1PZNA 1IOZA 1VG0B 2FFAA 3RANA 4FMDB 3DHWC 1Z0KA 2VP4A 2PH1A 3F0TA 4O2LA 4DHEA 4YDHB 4Z1MD 3FMOB 1E6CA 2IHYA 4IOJA 4D0NA 2H16A 1GM5A 4Q48A 4G1UC 3S1AA 2PEZA 4HB0A 4LV6A 1X8LA 3AB3A 1VIAA 5L3SB 2WMNB 2OG2A 4Q7KA 5EP1A 1T4GA 1UDWA 2IYUA 2Q9BA 3U60B 1EG7A 2ZUCA 1SXJC 3L0SA 3U44B 1U8AA 1XD2B 2FJUA 3QF7A 1E1QA 5FPHA 2QBYB 2HYIC 2J59A 4PPQA 3GEHA 4POAA 4GFDA 2Z83A 1WCV1 3TKLA 4Q9KA 3SBDA 2ECKA 1F2UA 1OXSC 1T6NA 4GMXA 2XOKA 2BCJQ 1JR6A 3EZ7A 3RS5A 4JL5A 2FDCA 1KNXA 4D82A 1SVLA 2ZI6A 3EIHA 3KXKA 3OZXA 1G8FA 4KBGA 4E07A 5JSZA 2QMOA 2GJ8A 4Q4AB 5FR1A 2QL6A 4FMDF 4MKHA 3FHCB 2ZRGA 1VECA 5CLLA 3CF6R 3TLXA 4HSEA 1K6MA 3GJ4A 1EWQA 4KLNA 4ZV4A 1XTKA 4M21A 3SDZA 4MKIA 2QSYA 3GLGB 4I1SA 3KQLA 3MLEA 3KQUA 1MO6A 2HLDD 1N5JA 1IN8A 3K9HA 3MMPA 3ZIAA 3I32A 3TSZA 3L0OA 1Z3IX 4Q4JB 3QKRA 2C9OA 4TYNA 3R9WA 1XEXB 1OLOA 4CEIB 4D4LA 1Z2AA 4LJYA 1J90A 4B3FX 1WA5A 1TU4A 2ZVPX 1KTVA 3OAAD 4PHGA 4RD0A 3MRSA 4M22A 2X77A 3BS4A 1LFDB 4CEHB 1QRAA 4DLYA 2R62A 2FFHA 2P5SA 3RRYA 3B9PA 4PQYA
chains in the Genus database with same CATH superfamily
5AVOA 2BRLA 3G7UA 1GNVA 4ZCQA 3KR2A 4I66A 2RI1A 4FI3F 1O4YA 2PMWB 4HATA 4JK3A 3F2IA 5FFFA 4U00A 4HWGA 4MLOA 1WLYA 4KQCA 1NBMD 3HZOA 3T0GA 1U2PA 4QKDA 5H82A 4NPMA 5A4MS 3F6CA 3LLMA 5JPCA 3AHFA 3E8OA 5TT0A 3O8RA 1GZTA 4RW4B 2KH9A 3DZCA 1P62B 1SCIA 1CUDA 3KJNB 1A2QA 2BCGY 2XB2D 3O74A 3UGFA 1QIDA 3GDHA 4LRWA 1VB4A 1S49A 1A1SA 3GUZA 1N6LA 3ISJA 4AMGA 4CMEA 5A0YB 2FQQA 2D3O1 1S0MA 5J98B 4UXAA 1T2EA 4B8ZA 3FDZA 4AQDA 1HLFA 1SLLA 3D3BJ 1LOBA 5E3CA 4HKWA 2FLWA 4KHPF 4G2NA 1V3RA 3DMNA 1ML4A 1E9AA 1OW3B 4EHJA 3LBYA 4F36A 4XJ8A 3M32B 3LSEA 5HI7A 2XY4A 1RYYA 4F06A 3CCBA 3IXQA 1VC2A 5HOQA 4UOHA 3PL1A 2VQDA 3PS9A 3O3MB 3AFMA 1XNRF 3VVLA 5JNVA 1ZJ5A 3O3LA 4PGFA 3B5LB 2K2QB 3KLOA 1UY2A 3AFIA 3B1FA 4L2IA 2VDJA 1CQNA 3GNEA 3H8VA 3OOSA 4M4SA 4MJ3A 1W8NA 4KQ7A 4RTSA 2ZD1B 2FOIA 2GAJA 1ZXBA 1ZMBA 3MINA 3ZXIA 1BKDR 1KIFA 4XUCA 4DT1B 4EW3A 4XFHA 4YA6A 4H1VA 4LBQD 1Y7TA 2G82A 4GB33 1M76A 4DLGA 4KB5A 1U4OA 1QIEA 3PDNA 1RZMA 3OZAA 2ZRIA 1Q53A 1RD4A 4YCLA 1L7VC 3OJEA 1RWMB 1UZWA 3RDPA 1KS5A 5FZ8A 1X9PA 1T9GS 1QCDA 3H90A 1PQ4A 2FN9A 2TNFA 4I4BA 1HE3A 3GLHA 4JQYA 4HDMA 3I04A 3PEWA 2I2SA 2JEZA 3BMOB 1RABB 1HYQA 1CAWA 2PYIA 1ZPDA 1PVDA 4X1IA 2PLV1 2EWWA 4XEZA 1DX4A 2ZGVA 2OFWA 4W99A 2FVCA 2ZE6A 3RRXA 3AHPA 3POFA 3LDHA 4S0MA 1Y9ZA 1XRQA 2XWQA 2GK6A 1S8OA 4CCEA 1J83A 2W43A 1I2CA 3L7CA 3DKQA 2A86A 3Q8SB 2AW0A 1EWTA 2JNJA 3OEHD 5C24B 4LA3A 5LP6C 2NMOA 1NA5A 1G7CB 4KXWA 3UWPA 2OORA 2EP7A 5LD2B 3J7ZT 4A26A 1YJ5A 4ECUA 3QT5A 3G9CA 4B4RA 1J0BA 4N5IX 3O14A 4F7VA 1BYUA 1LPOA 2GA9A 1N33F 2LFVA 1TKAA 3EBPA 2HD4A 4GGPA 2B8MA 3EXG1 3CEPB 6YASA 2WNOA 1P39A 2H7XA 2I91A 3T35A 1GPJA 1X8JA 4L2IB 2BUNA 1LVHA 4OYXA 3NP7A 2OCYC 3CN7A 3MWFA 5K2OA 2ZR8A 5IYYA 3HN1A 3PFOA 4UCFA 1NXIA 3RZMA 3W9YA 1SXJA 1NA1B 4HX9A 5E38A 4RADA 4F02A 5LU9A 2CAUA 5IVDA 3WLKX 3P45A 3BC1A 4P9IA 5KFWA 3PKYA 5PGMA 1ZGZA 4BJ0A 4UOCA 3S6EA 4WN9B 3RAEC 5DGXA 2ZTMA 3TN93 1VJ2A 2EFOA 2ES3A 3BMCA 4PSCA 3LC2O 3P0EA 4HT5A 5C4WA 2B8EA 3OEEA 3L1HA 3GGCA 2UXDB 3PVSA 4WOKA 2Z79A 2EA7A 1RTTA 3F5DA 2QDRA 3B9QA 4IDNA 2CQCA 1XXLA 3KZ4C 3I73A 2VG7A 2Q5IA 2U2FA 2F8MA 5EEGA 5JQGA 2UUBB 4OG2A 4KO8A 4E4SA 2WJAA 1EFDN 4L95C 1ATIA 1HQKA 3OQVA 3ZCQA 5LOVA 3AD7C 1Z13A 1GFWA 5B4UA 4IQXA 3AR3A 2JATA 1BJRE 4WKOA 4M76B 3VRHA 3OSUA 4M3NA 1RHI3 1J42A 3D2AA 3KM0A 5BWMA 1F2GA 4S2HA 4KV7A 2IYLD 1S48A 3MQ4A 1B0AA 1XZQA 4S1VA 3RE1A 1OWPA 1GQSA 4ZDJA 5J4YA 4BTVA 1HDKA 1XYPA 1KI9A 2C2YA 1CK4A 3MM6A 2J8AA 4JR2A 3B94A 2WNVA 4L3VA 3Q15C 1YI2S 2AQ4A 1FFCA 2IYEA 4Z53A 2V7EA 3A4VA 3WBZA 1DXYA 3T3OA 3RVHA 1E0SA 2Y1GA 4LPLA 3BA1A 2F5GA 3B20A 2QAIA 4BHQA 4MLZA 2IOFA 3PWTA 3RBXA 4ZIVA 3RB6A 2ZM6F 3DDUA 5FBZA 1ADFA 2A88A 5AUQA 5L19A 5CVEA 2R8HA 4KFTA 4HRXA 1NDLA 4OVEA 4G0WA 4YB1P 4A2PA 2OZVA 2Z5FA 2F4LA 1P4JA 1GVNB 4BV8A 5KC8A 5DHRA 4C91A 5D8AC 2B98A 1VDZA 4EG4A 4JASB 5I8WA 5IVVA 5HDBB 3E3AA 4F2HA 2GAHC 2QD2A 1O8BA 4IUCS 1Z0IA 1OIAA 4DXAA 3KJQA 3DF7A 1EX9A 4RYLA 1I3NA 4C78A 2XS7A 1XE3A 3BMCB 2AD1A 1DT3A 1W85A 5HILA 2GMHA 4PE5B 4BFTA 4JIMA 3P27A 3C8ZA 3DAPA 4OP1A 2WTNA 3I9NA 1FX0A 2VIIA 2QT9A 2COKA 5FOSA 3EOZA 4GMFA 1PJ2A 3FPBA 5LRRA 1VRH2 1M75A 1U4NA 1OXBB 5E5NA 4Q1BA 4CEYC 3CCWA 3ZHZA 4LHLA 3VBFA 2VVTA 3JS5A 2FZ2A 4GZ6A 4OBEA 4JGIA 3FUOA 2J33A 3CTRA 4MGTA 4BFVA 5C3PA 4WBNB 4R3WA 1C3OA 5BQ5A 4BS2A 1GZHB 2R7SA 3OY8B 2H11A 3TTXA 5I9NA 2QFEA 1NVBA 1B99A 1EWKA 1RA7A 5HK4A 3IPXA 4HGQA 4NFLA 4YCBA 4LDJA 3VZBA 3IDCB 3BIJA 2ATCA 3TCNA 5GZ3A 4X8NA 1U5YA 1XQIA 2W52A 4TN1A 2GFHA 4MIOA 3OYWA 3PWZA 2XWSA 4EVQA 4F71A 5K8JB 1VYUA 3GL9A 5E9AA 3WIDA 1C4KA 1ZH4A 5M29A 3IIIA 3RJ5A 1DIHA 4O8ZA 4G5OA 3RSOA 1YI7A 2EG1A 2QUOA 7ABPA 1BVP1 4UOQA 3EUAA 1Z4UA 1RFLA 4AKHA 4G65A 2BYCA 3ZW8A 4WBSA 5F2EA 1V41E 3UAZA 3LDBA 2IXBA 3ZHOA 4MS1B 3DLPX 3TSOA 4BQ5A 2I1VB 1BHQ1 3LA7A 1RPJA 5HK9A 3ACBA 2A18A 1JLQA 3ONNA 1PWXA 1C7IA 3OQMA 2CXUA 2WWGA 4BWGA 1T0JB 4QNNA 5E2BA 5CFMA 2JS7A 3MIGA 5J2UA 1VP6A 5KREA 4OQYA 2O2JA 1NDKA 4BX9A 5I8SA 3PZBA 3DLEB 2V5AA 4GPBA 2BEFA 2CB0A 3CMMA 1A9PA 4UKDA 2YNFB 3H5SA 3DCNA 4ZPIA 3CMQA 1X60A 1N34F 3LVRE 1W9WA 1PHRA 1H8VA 4ZVQA 1EFPB 3DOHA 5CFCA 3MGGA 3G2JA 4YP0A 3KG1A 1YR8A 1CWUA 1CULB 3V9AA 2JLXA 4YJ3B 4G1QA 2ZQYA 3O7WA 2DLDA 3T7CA 1SACA 3U31A 1ADCA 1N56A 5B0BA 3CZCA 2QSWA 3IKLA 3UCUP 5JVHQ 2GUWA 4F6RB 2NP6A 4B74A 3M8SA 2NTNA 5KOWA 2B78A 1M9NA 4NEZA 1A95A 3VBEA 4BCBA 4UNNA 2KG0A 5G0RB 1QU3A 3LTNC 4TMTA 5CD1A 2Z2MA 5DSZA 4QOIA 5E3QA 1TAUA 2HJ9A 3U7GA 1UPSA 1JZ5A 3DJYA 2VUSA 4Z7YA 2ZBQA 3PYEA 1JFLA 3R3ZA 3DEIA 3R7BA 1CRPA 1LOFC 2VZEA 1R4MA 1Y1PA 2E85A 3W63A 5IM5A 5LZ7A 2D54A 2I6SA 1UT6A 2PS1A 1REVA 4M0KA 3SP1A 4FCCA 4BNKA 5JALA 1KTIA 2EHJA 3CVKA 2CGEA 3L04A 5FIUA 3K4HA 1UKAA 4LN1A 4EIWA 3X1KA 1G6BA 4AQYJ 4JI5J 2R0HA 2C98A 2P2CB 4EFLA 4Y7DA 4CLRA 2BBTA 5EWJA 3IUQA 3COJA 1J0EA 2C07A 8GPBA 2BELA 4M8KA 2GJKA 4M6WB 5J2UB 1E1YA 4A0RA 1IRIA 1LI5A 4QPIB 5FUMA 3E01A 4U8HA 4JBNA 3C8UA 1D04A 3OI7A 1ZM3A 4JBLA 3V6DB 1CD3G 1O6ZA 3CNLA 2O8CB 4NJMA 1DG9A 4MTLA 3G1WA 5ALRA 2PU5A 4RJTA 3DBLB 3PHLA 4FB5A 2ORED 1WA6X 4DX8H 4DBVO 4YR3A 4DUGA 4KYUA 4K6MA 2VVDA 1QHNA 4RNMA 4XF9A 4FK8A 3V7YA 4TV8A 2P40A 2GZ3A 1QDOA 3AF2A 4EA8A 3ZHVA 4YRRA 5KG3A 4X65B 3CTMA 1TKRA 5LASA 2QTZA 2C3YA 4L07A 2NV6A 4QDOA 3ICWA 4H55A 3DEYX 1MB4A 2MYTA 1RUF3 1NI4B 3G89A 4NATA 1C41A 2A3NA 4J16A 3VH3A 4W1QA 2JANA 5A1FA 5ALIA 4RVCA 3H8OA 3JSXA 5JSPA 1M8GA 4Z92B 2DB1A 2MYNA 4RCYA 1UPIA 4GWGA 4BLRA 3CF0A 4URYR 2WD8A 4EUFA 3L5KA 3KVOA 2OGWA 4WM7A 1R1A1 1WB6A 2ZYTX 2JGEA 1GEGA 4JZKA 2HRDA 4KREA 1S96A 1SCBA 2IPNA 1Q92A 2UWAA 4YHBA 5B30A 1ZOOA 4P3PA 1AZSB 4QPXA 1RC0A 2B4RO 1DBWA 3IPAA 3MF6A 2AJ4A 2ZRNA 3N76A 4C98A 4LO6B 3RSFA 1ZVVA 4KRFA 5FMOL 2HRYA 3G2MA 2QZPA 4OJMX 3MOJB 3KNGA 3G96A 1PGOA 3LGXA 5T7LA 1AXKA 1XJ0A 4D9IA 3OT4A 2XB6A 5HMXA 1ZVKA 4AZ3A 4Q4JA 3PUWA 4XQGA 1S8NA 4GZ5A 1SVIA 4XB2A 3GP3A 5FV3A 5DXDA 4OI0A 2OTCA 2YYAA 2H1HA 1C8KA 4BAZA 4PLNA 3FGNA 4K9QA 1M2KA 3DO8A 3MMBB 1ND3C 2AG8A 3I8OA 3SXJA 4WBFA 4P9YA 4G4SP 2X0EA 1OI6A 4DV2J 4FOWA 4O2BB 2NTVA 5CVCA 3QKTA 4UT4A 3D8RA 1YI1A 3G0CA 3MPPG 1EVLA 3CCTA 4Q1EA 1YQGA 5HRCA 1MWQA 1R8JA 1XTIA 4XR9A 3V9PA 2IKSA 1XR3A 4P7VA 2JJMA 4Q93A 1XAGA 3WGLA 5AM4A 4NDAA 4A9AA 2H4ZA 1OVMA 3I6MA 4OZJA 4U9RA 2EJBA 4WCDA 3OIVA 3NU1A 4C0QC 2ZFHA 1TV6B 4RL1A 1CUHA 2X5KO 4YALA 4RLSA 4BIFA 1DTQB 3CE8A 1Q82T 4A6OA 4ES2A 4K8RB 3JQ8A 4GA9A 4HWOA 3V4PB 1DQSA 1QZUA 2W2KA 1Q43A 1KD1T 3HP7A 2ZABA 2IDEA 4DADA 5E1RA 621PA 3AOEA 3LFHA 1LDEA 2G4BA 1UK6A 3GFSA 2XL9A 4IVNA 1ZM7A 3Q22A 4F56A 4AVBA 2IYQA 5AM1A 4GKKJ 4IJUA 1US8A 2MKYA 5HUHA 3IDEA 1LNZA 2B4AA 3MW3A 2Y9MB 3ACGA 2CQ4A 3TRGA 1NNLA 1A9QA 1OYOA 2GC0A 4EL0A 3HKEB 4NEGA 1RW4A 2XMPA 1U45A 1ZCBA 3QI7A 3VNVA 5BN4B 4RF3A 1IDN1 1E2IA 1JQJC 3FZGA 4AWBA 1LHWA 3CDEA 3QBQA 2R42A 1LV8A 5DISB 4EDHA 3DMJB 4GVLA 3X1DA 1U3TA 4M9CA 1F2TB 2QQNA 3D68A 5L3QB 1NN0A 3P3NA 5CD4A 4NPLA 1W6QB 1N5TA 2XO7A 2GRUA 3T4HB 4ES9A 3AF6A 3DKRA 2RBGA 5ALQA 4A8XA 3M2UB 4C4AA 1AXEA 1Q4RA 1X0VA 5CK5A 2H0RA 4RVOA 1EZ1A 4JGZA 1Y4SA 1RA6A 3ZJVA 1UU4A 3PLAE 4PFSA 1GTG1 3SZMA 1U02A 1W2NA 2AJLI 4PYOA 5KYTA 2WB2A 2BHTA 2O5CA 1CQIB 4AI3A 4PTZA 3GZNA 1I7QB 3OFVA 4X7MA 2CJXA 1ZCJA 4AUNA 1BD6A 3KLFB 2GLUA 1MS8A 1B4SA 5EZYF 3C6KA 1B64A 1PR3A 1QXPA 2H6BA 4S1OA 1HUQA 5EJ6A 4B6GA 1RUD1 1JHRA 4XWOA 3TZYA 4U8YA 4TTPA 1G8GA 4I68A 4CCDA 4IKPA 2C2MA 3A7EA 3CWCA 1PTJC 2GDZA 2WINI 2JE8A 5TPWB 1LOGA 2FWRA 5DQHA 2I71A 3LKDA 2N4DA 4UF4A 3F41A 2ZW9A 2WKWA 4KK3A 6NULA 2X3GA 4UAUA 4DNXA 1Q0SA 3GGJA 3LRTA 1EK5A 3K0SA 4A6XA 3QZ7A 3BWVA 3CQ9A 1P77A 1TUGB 3BB3A 4X44A 1TM1E 1OSCA 1LX6A 3CUUA 1J00A 2WFLB 4F0JA 2A78A 4ZOAA 1UBRS 5FREA 4X6XA 2VA2A 4IV1C 3B1JA 3FG9A 1WDLA 1YZKA 2A6MA 3K72B 4RFRB 1I2MA 2YW9A 3WK6A 2FJPA 3NQHA 4FS3A 1LWNA 2YBDA 2C3UA 3RI3A 3PQCA 2JJ1A 2C2OB 3ENNA 5JV5A 1RMYA 1GCGA 3R3UA 1YRLA 1QHEA 2QX8A 3FEYB 3RYIB 5L95A 3PUIA 2QF7A 3LUHA 3WC0A 4IIJB 3G8DA 1YJ8A 4F5EA 1FV3A 3JB4C 2EOAA 2EXXA 3D0HE 3ND9A 3AP5A 2CPDA 4AY4A 4X64B 3ZVXA 2HWE3 1T5OA 2EP5A 1ISPA 1RWOA 3OJXA 1B8UA 1J3PA 1RXSA 3AK4A 4A42A 2QTGA 4CCKA 4L8VA 2YXLA 3ZDVA 3PUAA 2JLSA 2OUHA 5L3SA 3V7FA 1ZAVA 4X3CA 1Y3KA 1DJ0A 5GAGU 3EZOA 2QZJA 1XC6A 3CT9A 5IH7A 2VXOA 2Q99A 3MPBA 2PEBA 4WVWA 2MSTA 3HB9A 1W8UA 3LCPA 4L22A 3R3TA 4FU0A 1R9JA 1LWXA 1YL6A 1LOAA 3OT1A 1OFNA 1T8UA 2XT6A 5KVCA 1TVRB 5HS6A 5JISA 1C2YA 5KQRA 2ZSHA 5JSHA 1QZTA 4TXSA 4A0QA 2AX1A 4CV3A 1F9KA 1FLDA 1HYBA 5KQLA 3BF7A 3IPVA 1AUVA 3G6KA 3GJBA 1PL0A 4I9UA 4QM8A 2XCUA 3ZH9B 1KAOA 4LLFA 1L6IA 3OFNA 5E8RA 2F1OA 4FT2A 5DETA 1WLCA 2GVDA 4Y7CA 3V2UA 4KY3A 4R84A 3CZ4A 5AJXA 1PR9A 5G40A 2F4FA 5K0UA 2BD0A 4QATA 5BORA 4UI9L 4ZKAA 2ZQ5A 3C3KA 2OELA 5SV8A 2EI5A 2ZZJA 3UICA 1VGQA 2E5GA 1HI0P 1YIDA 1B8OA 4AY5A 2D0OB 3GJQB 1QBKC 2QTRA 1HBNB 1ZAKA 2NO9A 3SGLA 3PE6A 1NVEA 1R0YA 4E2ZA 2A3RA 2I6UA 2I2DA 2DIUA 3QXJA 1SD2A 3GJ3A 1OQ3A 3WGTA 2A6PA 2LQJA 3CCCA 3WNZA 3S5QA 1MD9A 4ALIA 2IMOA 3OFGA 2MR5A 1OA2A 4AZTA 1KVSA 1GUBA 2YQ1A 3K1TA 4WK0B 1IGOA 1I33A 1QZZA 3RQIA 4DG1B 1Z63A 3OBTA 1GG9A 5HA5A 4V0SA 4ZLPA 3U7FB 3OZDA 1OH5A 1W1WA 1IJKA 5C5EA 1T4BA 1RI7A 5JAUA 5C5JA 3UCGA 2BFDB 4RUKA 3OJWA 1TKDA 3DWEX 1XNRB 1POQA 2Z1MA 4Z2XA 2AZXA 2ORIA 1RWQA 2BEWB 3FBBA 2A4MA 4LHWA 5TMEA 3PTZA 4KBBA 4AEKA 1VHLA 3BRWA 3M5DA 2JFGA 4HADA 3ZXXA 4IXTA 3HPRA 4GXRA 2N3LA 2OY0A 4CQMA 4YLYA 2P27A 1XERA 9GPBA 3L77A 4AC9A 3WNDA 2GH2A 3IAFA 4UU0A 4ZFNA 1Y9AA 2A30A 4GOXA 3U7QB 5L1IA 1MT3A 1FP2A 1YL5A 5CLGA 1Y10A 2VAPA 1JX4A 4DR6F 4JLKA 3DBIA 1C9YA 1WC6A 4ZQEA 1S99A 3U6KA 4QBGB 4TTAA 3ZV4A 5T8KA 5KVSA 1OOPC 1LK7A 5EI5A 1SELA 4I56A 2BMEA 2BOJA 1DQPA 3IJRA 1FNSA 5AKXA 1KWKA 2OECA 1ZOLA 5MF6A 1SZJG 3G9ZA 2ZIVB 1FFYA 4HVQA 5JZMA 3L40A 5FYSA 5BNQA 1C80A 2YKMB 1EP9A 3PACA 3OVSA 4OFBA 1LLDA 1TFYA 3HZHA 3OQPA 2DH5A 3GUVA 3WNBA 2ZITA 1OLXA 3WLLA 3WQRA 2A71A 5AVSA 1NKSA 3ZXFA 1U5ZA 1SOVA 2NNLD 4AFNA 2DUQA 3F8TA 4A6SA 2OKXA 3TEGA 2X7IA 4XPCA 1PDVA 3V0AA 2QMXA 5FF9A 3DDZX 4NYMR 3W3ZB 3K5PA 2QAGB 2YH2A 3W4JA 3TEXA 1S1TB 2HPVA 3E5MA 1TKTA 2VMDA 2HIYA 4RK0A 2P4QA 1SB6A 3DVSX 5C24A 3FJOA 1Q1GA 2XMZA 3NY0A 2AJQA 4EEZA 3NT5A 5C4IA 3K35A 4YR2A 4G1QB 5BOVA 3BR9A 1AG9A 4J0EA 3CUEF 2XH6A 4H2AA 3JARA 4DL9A 3IVCA 4K4YA 3NEKA 3KUDA 2PHFA 4DDHA 5AKZA 1U3WA 3RLFA 1VJDA 2PO4A 5CTAA 1PGPA 4MV7A 3DFIA 1HFWA 1D2NA 1Y63A 1KFCB 3W7BA 3L7YA 2VZ9A 4GP7A 5IKXA 4PAAA 3M4XA 5A8RB 4ARUA 2QWXA 2ZZTA 3W34A 2VQFF 3NWEA 4UNPA 1EVZA 2UZ1A 4LFBB 5IF9A 2CSUA 4D9CA 3IPYA 2Q6KA 1L1FA 1KEPA 3H3ZA 4OZXA 4FVCA 1EESA 2XW6A 1CN1A 2O2HA 3CH6A 2ZT7A 2FWPA 3NHJA 4GC9A 3C1OA 3CBGA 4DHEA 4EO6A 3KLGA 3RYKA 4IOJA 5AM3A 1JLEA 3QYFA 4B9NA 3SQOA 3PEHA 1T4GA 4W5OA 2WN3A 2X0IA 2PAMA 3NVDA 5LQDA 1U8AA 3PDIB 2BJEA 1FTCA 4WPAA 4GFDA 2WQZC 3BEDA 1I0IA 4IHJA 5KI6A 3EF1A 4FT4A 3VVTA 2BCJQ 3OGRA 3L8FA 5EUCA 3LUFA 4NICA 4NXMJ 2FDCA 3OZXA 1ZM1A 1U8SA 3RB4A 3DKWA 2X4LA 1QIMA 1KRWA 1B74A 16PKA 2M7SA 2AR0A 3FBTA 2AYBA 3QX8A 1EWQA 1NX6A 4EHLA 3KDOA 1RINA 3K6SB 5JOQA 1AT1B 1L7PA 1KVJA 4ODIA 1Z3IX 3B36A 4I9GA 2ZSJA 3OD0A 4JNKA 5I3PA 4JB8B 1VKNA 3B02A 1KQGB 1ITZA 3U81A 2JLCA 4BLWA 3HVTA 2GEKA 4W5NA 2B37A 2OGZA 3B9PA 3SZOA 4CRJA 3FOFC 3OX2A 5GV7A 1SHWB 4BMBA 3MFYA 5T4HA 1LB1B 4RW8A 1Z0AA 2OO7A 4F92B 1LNQA 1FS4A 4HUQB 2QX4A 4JQSA 1G66A 4B3TB 1XXHE 2UYCA 1SG0A 3D3JA 1KZ9A 4WBNA 3SQMA 4C9BA 2R1UA 1U8CB 3WWYA 3MCTA 2R8KA 4XCXA 5T6BA 1QQ5A 4CL8A 3SKJE 1NT2A 2PZLA 1JMYA 2IC5A 1KBQA 2W71A 1RWPB 4N5MA 2HC9A 4EGAA 2MGZA 3TAPA 4NU0A 2V5DA 1PCXA 2I67A 2FPLA 3QSYB 1WI6A 1ZBA1 1UFWA 3Q3VA 3FFWA 2N9UA 4FWTA 1F0PA 2LUOA 5HIKA 2WE8A 3CZJA 5LM3A 1US2A 4BNFA 4ALNA 4OGKA 2VZPA 1QQP1 4OQNA 5G3ZA 3IP3A 1G3UA 2AOWA 5HXAA 1RQLA 2HA5A 4AX8A 2BFAA 1P61B 3SU8A 1HKUA 3A1SA 5THWA 5C7OO 3SICE 4FWBA 4NWWA 2FDNA 4L1KA 3LUKA 5GLVA 3A9RA 4HR7A 4LOTA 2ZSFA 2N42A 3CEDA 4UFIA 3DGFC 1ICIA 1V3UA 5ALJA 1OBNA 4P2FA 1Z45A 1OXCA 1W6RA 2X1MA 2ZATA 2GCOB 3VAKA 2MKJA 2ZRDA 3K0HA 1U0BB 3LGMA 3IE0A 1C8M2 1ZD9A 2GXUA 2XLJA 3FNHA 3IR6B 3EF3A 3J7TA 4RH0A 4JJGA 2QIPA 4H7DA 3TXXA 4B2PA 4DZDA 3SFVA 4BV9A 3HJTA 4EJ6A 1DO0A 1OU4A 3ZZUA 2W47A 2AF3C 2ZWIA 5DDRC 4MV6A 4ZP8A 3LB9A 3OE5A 4B3IA 3Q72A 1DURA 1FXZA 4YWHA 5HJEA 5CEJA 1HMVB 4MCIA 1CP3A 3PPYA 1PS0A 2XB6C 3DOKA 3FFIB 3C5CA 2O8DA 4BVGA 1H65A 4Q01A 4QG3A 4GL2A 2I38A 5KKCA 4WW0A 5B0GA 4RXUA 1YO6A 2JX2A 3TEHB 3Q8BA 2FX3A 3IP8A 3T4EA 4LE4A 3VC3A 3ET6A 2JB8A 4QGSA 1MG5A 2LZ0A 2QQIA 3M3CA 1A9OA 5BUQA 1YB7A 1VQ8S 2JHCA 4Y2KA 3KSCA 1E77A 1K3IA 5FZCA 1T05B 3VGJA 4MUNA 4KWHA 5LJLA 1W39A 2BL4A 4XB1A 4F8EA 3JAWB 4DQKA 4X4RA 3RNOA 4HVOA 4N8SA 2G8NA 2WO1A 2QLMA 3D3WB 2XYVA 5CAAA 3M6MD 1QDCA 1W6OA 1MVEA 5IBRA 4G1BA 4NOJA 4XFGA 1XMOF 5DBIA 4MDYA 5E3PA 1ZTTA 5C3SA 1PZ8A 1PFYA 4CDQA 3FBEA 3HKWA 3OQHA 1DLLA 3A6JA 2H4JA 4R1OA 2IYVA 4CU9A 1P0PA 5TQ2A 1KONA 3T30A 2AYGA 1M72A 4F5ZA 4QIEA 2I8AA 2DTYA 4LTAA 1HA3A 3BYWA 3W5YA 5AJWA 3EC1A 3B1KA 3TW0A 2J6UA 3LT2A 4J37A 2XD9A 2P6OA 4OHOA 1XC9A 2FHMA 3ZJ5A 3FSJX 1T5LA 4EGJA 3JSRA 2MEV1 3FUTA 5C4WB 3P4XA 5FZOB 2L18A 3T7DA 1P7PA 2DC1A 1DAMA 1B8PA 3OUIA 4BHPA 1YS1X 2OP5A 3Q8YA 5FP0A 4LF2A 5E4YA 1DAFA 1XLWA 2F6RA 4OP2A 2WAAA 3NBYC 2IZ5A 3HSSA 1CJUC 2CHHA 2E33A 4DFKA 4KQWA 3IMGA 4XWAA 2R7XA 3RU0A 2YHAA 2VZQA 3OZ7A 3AVYA 4Y98A 2OTLS 2AGSA 1JLCB 3A3NB 1VL6A 1VRUA 2YVSA 4Z0NA 4MO9A 4HS4A 1U9IC 3POJA 3LC1O 3IE2A 3NIBA 5CFQA 3N8GA 5AW4A 3C3XA 1GD1O 2EFVA 4B3MB 4CCNA 2Y6LA 5C5IA 1EINA 3GCGA 2CPZA 3OQOA 1Z7GA 1JMVA 5JVDF 2ZACA 1UC9A 1U7OA 1SCJB 1DWQA 1PJ6A 4WHMA 5CDFE 5IM0B 1UEJA 4FHZA 2LCQA 2EFEB 5LSRA 4H7LA 2FDXA 3MSXA 1Z73A 1W44A 3V6LA 1J99A 1UAWA 2QYTA 3ES4A 3ZE2B 2QKYA 4BCCA 3OFFA 1QYWA 1NJIT 3MCVA 4NP6A 4R6XA 1EZZA 1S89A 3VR6D 1UL1X 2VBPA 4JBGA 4MK4A 3PE3A 1NLKL 1XNCA 2ECQA 3ONQA 4AUMA 4HEJA 3LL7A 2LGJA 4BQ2A 3BD6A 2JDKA 3KQOA 3PYMA 4LWQA 2HWB3 5KYNA 3REFA 3UL2A 3FBCA 4CUGA 1K9VF 4YCDA 2FPUA 5J2NA 5I7EA 1AQIA 1CJKC 1HW9A 3N8HA 2VATA 2RGXA 1L3VA 3L46A 4MAMA 2EARA 3OM1A 3D3NA 3KG2A 1H2YA 1RTKA 1VYVA 5IAXA 4HNHA 3KV4A 3FSGD 4ER8A 5HMLA 2Y8EA 2FSVA 5D87A 1GRRA 4LZNA 2ZJCA 2OKGA 2IYGA 3VCDA 2Q1TA 4IRMA 4NENB 1YS4A 4INJA 1XNBA 4DARA 1D6MA 2D93A 1T3TA 4Q3DA 3CWJA 1X4GA 1JK9B 2QFJA 1SBYA 1E63A 2PHUA 3VBRA 4KBIA 3REQA 2DPMA 3DNMA 1OYWA 4P38A 4JRLA 3Q8QB 1VBB1 2O1WA 4KGDA 1CERA 3LE8A 4D6QA 2QQOA 5BV2P 4ZYXA 2WJHA 4M01A 1B43A 1RWOB 1N3PA 4FR2A 3RAJA 1KC1A 1DP0A 2XNDA 3Q9LA 4PLVA 2BLLA 1R5NA 2C5FA 1ZMOA 2HUPA 4RW9B 5IU6A 4ZP1A 3H7AA 5B0FA 4D74A 5C53B 2WSUA 3ILVA 3JZFA 3T9AA 1ORVA 3DV0B 1R0RE 3VN4A 4WKNA 1P6QA 2C1EA 4KG7A 4J8PA 2C2NA 1LPBB 5J09A 2XMDA 1HQEA 3IIKA 1ONBA 2WNHA 2HBQA 2F9FA 5EMLA 2HNZB 4GYYA 3VV2A 5KHJA 3W2VB 1J8YF 3LX6A 1SC4A 4RVSA 1JIKA 4K5QA 1WOSA 1EFRA 3C14C 2OPPB 4F04A 4BQXA 4FOTA 5AIAA 3WSVA 1W5AA 3PRDA 4NLOA 3IBGA 2QE6A 4BC7A 3PA8A 1WCKA 5KFEA 5DHSA 1BWSA 2Y1DA 5AXCA 4Y9RA 1V6OA 2FMDA 1YZLA 1JIIA 3PNIA 3T5CA 4A3XA 3OPKA 3C3BA 5J2NB 4U7FA 3LX5A 3JQGB 3CRZA 1YRAA 2UXBJ 5DI9A 1F2TA 1IVSA 2V72A 3LT1A 3OECA 3DTNA 5FJKA 1PO22 1KY2A 4BYGA 3POIA 2RONA 3KLPX 5DQIA 3L0PA 2PTHA 2LEPA 2JC3A 4EG7A 3VH1A 1E0JA 1B6TA 4TKVB 5KG2A 2ZOGA 1RJEA 3IDOA 2FLOA 1N48A 1X39A 4USWA 2LXIA 2ZZNA 1X1QA 4D9EA 1LDMA 1EQAA 1YRXA 4K4WA 4MZUA 4NE7A 4MITA 4YRFA 1H8HA 3ZZRA 1XNQB 3PGMA 1W2GA 3DBVO 1BDJA 1Y8CA 1RJFA 1UZAA 4B73A 1S01A 3ZHYA 1O7FA 4U6PA 1WG4A 1GQEA 1S9DA 1VRTA 5T54A 2PNJA 3GDGA 4EBDA 1IHPA 3KV5A 2BAGA 1E4VA 2N46A 2VHZA 4JKIA 2BM9A 1VBNA 3UN5A 1XNQF 1NPPA 1OGIA 4QEDA 2V74B 3JQ7B 5C33A 4XLZA 3S27A 4DV6B 4XE9A 5IABA 1Q8OA 1PJAA 2RF2B 3C4VA 5T5LA 1CEXA 3ODGA 5T5JA 1N75A 1VBMA 4I6YA 3CVVA 1SWVA 2C9AA 4O0MA 3VL9A 3MA0A 2O19A 4B80A 3NEPX 5C7LO 5C32A 3AY3A 3PPXA 2I65A 3GLRA 3LYHA 4G0NA 4G5HA 3HU1A 4IICA 3MS7A 3SH4A 4G81A 3PNAA 3QBCA 4AXBA 1AX9A 3NBUA 3LP1B 1PL7A 4FFDA 1M5OC 3PQDA 2JIPA 1I5RA 1NSQA 3TAMB 3HXMA 3PIGA 4WK1A 2ZZMA 1F0YA 5H59A 3EVAA 5CCEA 4LMPA 3LX8A 2W94A 4CWBA 1E94E 5AI4A 4FSHA 3A11A 3AKRA 4ELVA 4V0RA 2NVUA 4HDRA 4KC0A 2P90A 4IDKB 3VBCA 2J6TA 4BLPA 4L3KA 3DKKA 5K01A 3V4IB 4WU2A 1CJUB 3NL0A 4H4OA 4O4HB 5CGQB 5D7NA 1I3LA 4B9EA 5G4KB 5CFCC 2DY0A 2O5RA 3LY8A 4OBXA 3G68A 4HMZA 2Z4PA 4G0YA 2ZRJA 1D09A 4QDUA 1S8FA 1AQNA 2CJWB 1ST2A 3C3DA 4Y0NA 1AYN3 4NOLA 1SN7A 2UUBJ 5U1PA 4H0NA 4BDSA 1YVUA 1UBKS 1KBRA 4KRXA 2EKZA 1PHMA 4Q29A 1RHUB 4BMCA 1QDEA 1MIHA 4JGYA 1MXHA 2IVFB 3POGA 1CRLA 4GVPA 1H94A 1XQ1A 3MZ0A 2C9KA 3BH7B 4QQPA 1AQ6A 4LYJA 2XUIA 4ZVRB 4L6V3 4OX9Y 3PR1A 3D8TA 3O38A 1ZVMA 5J5VA 1VRWA 5DPMA 4K03A 4B7ZA 2EXHA 1FBNA 3M7IA 4YAUA 2C0PA 4NCBA 1J7JA 3IRVA 3SI8A 2JBAA 2RU3A 3ZS9A 1XXNA 4GNKA 4WH0A 1KOOA 3FSRA 2RKOA 3ZHTA 4JJIA 4N18A 5CVVA 4E33A 1G5FA 5LB4A 2FV8A 1VRH3 1RUD2 2P91A 4OMDA 1BU5A 3GDBA 4MWTA 5CB4A 4JMLA 4LDAA 4ZO7A 2OO5C 3T1HF 1XB2A 3VJKA 4WGFA 1NYTA 1T0BA 1ZA1A 3O1PA 2ZSEA 3UKTA 2ZIWB 1X4CA 4HGZA 4XEHA 3N9LA 2KB2A 1HMPA 3J8F2 1T94A 4BWMA 2XI2A 2AFIE 3KVBA 2WNSA 4BFSA 1ICEA 4DB5A 2IIQA 1GNYA 7REQA 4I14A 1C0EA 4DPKA 1RXYA 5L3ZA 2JDYA 1DQAA 4OGWA 2X29A 2YWFA 1YMQA 2XDQA 4CP1A 3B52X 3K2IA 1O4VA 4FOYA 3IAEA 1N2BA 4LF5B 1WUUA 4B3JA 3MMCB 1O0CA 2ZM6J 2CHFA 2RJZA 1D09B 1VS3A 5FZ0A 1HNVB 2XMVA 3I2GA 3FNQA 2DCJA 2ALJA 4HX2A 5ALNA 5KTNA 1K08A 5F73A 2OYSA 3MNFA 2WC1A 3DH0A 3M3OA 1G2QA 1R10A 1P6XA 5DNVA 5I6DA 4HK4A 5KFZA 2DY1A 4PRZA 2A58A 1UMHA 2FMFA 4UHHA 5DHQA 5DHAA 4WFNQ 4LZAA 3FB1A 4WFQA 3K9WA 2N75A 5JPMB 3G6VA 2VXCA 5J4KA 1S4EA 2P9QA 2GRJA 5EINA 3LP5A 5B5SA 4CO2A 2V3VA 5E41A 3TNQA 1DQRA 4NVPA 1YU6A 1GL9B 1YFUA 3PFFA 3TINA 2GT1A 2UXBB 5KT4A 2Q3BA 2ZWVA 3R7NB 1J2JA 4O44B 2IDJA 1YR2A 4BNHA 4N7UA 4KITB 3DP7A 2PSZA 1MTZA 1RTHA 3E6BA 3L02A 4ESOA 3AQOA 2M3DA 3H2YA 2GZHA 2IW1A 2QYOA 4F96A 1WEYA 4YIKA 1D0GA 2GBIA 3TA0A 1NQTA 5K6AC 3HA5A 1AS2A 3RARA 2QXYA 2G25A 3RVLA 4AJ4A 2GYUA 1PS9A 4DM7A 1RKUA 2OP0A 3VBUC 5CYMB 3QBDA 1OAAA 1N36J 1NPDA 1QO7A 3DXXA 3WZ0A 2YHBA 4OLOA 1JHOA 3O1IC 1NV8A 5JQWA 1HD0A 3TIIA 1E6UA 2FXVA 1RZVA 3VV1A