4OI4A

Protein complex of clp1 bound to atp and mg2+ with pcf11deltan454deltac563 of s. cerevisiae
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cleavage and polyadenylation factor CLP1
publication title RNA specificity and regulation of catalysis in the eukaryotic polynucleotide kinase clp1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 125
structure length 428
sequence length 428
chains with identical sequence C
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4oi4A01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oi4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oi4A02
4YMVA 1ZC4A 3AB3A 2C03A 1RPZA 4LV6A 4PFSA 1GRRA 2OSBA 1CXZA 3W5IA 4DT1A 2QL6A 1EFRD 2XNSA 3EAQA 3FKSD 1ZUHA 1SVSA 1WE2A 2J0UB 3EC1A 1RZ3A 3EZ2A 2JLZA 1GNRA 3EX7C 5AUOB 5CJ2A 4L15A 4H1VA 1YZTA 2ZUBA 3QXCA 2PCLA 4E09A 4Q1CA 1D2MA 3CPJB 2REXB 1Z5ZA 3QEJA 2A5GA 4HZUA 4EPXA 2AXPA 4BZPA 1UJ2A 3AVPA 3KJGA 1JR3E 3A58B 3AKYA 3MWJA 1QHHB 2OFXA 2YINC 3IBGA 1DTSA 5AJVB 3NWJA 2FSFA 3F0TA 4MKFA 2JLUA 1OB5A 2F1RA 5JHHB 1R0ZA 1IXRC 2Q9BA 2YHSA 1D5CA 3QPWA 3PXGA 4A9AA 2O0KA 5LD2C 1E2DA 3QF7A 4C2TA 3PEVA 4G5GA 1M34E 3L0SA 5E7MA 1XMJA 3O8BA 3KXLA 4HLQB 1E0JA 4K46A 4C7OA 3KB1A 1DO2A 1CF4A 3AVXA 1RYFA 4FMBB 2ODEA 2IK8A 1T91A 2WWGA 1TU4A 2YVUA 4A0HA 1E3MA 1Q21A 4Q1EA 2VP0A 1TF5A 2C9CA 5TXGA 2FDCA 2R6GA 5TB5A 3LFUA 4RKEA 5BWMA 3BD9A 2CCJA 2ZVQX 3GJ4A 2OXCA 4MRVA 1JJ7A 4WZBE 4N1AA 2ZRHA 1Q3TA 1GTVA 4M1SA 2RGDA 1K5DA 3BB1A 5FTMA 4LPSA 5FH9A 2DY1A 3F5FA 5L3QB 3EG5A 4L5BA 3MUFA 1PVOA 5GVRA 4GDFA 3CKLA 1NVVQ 3NBFA 4P31A 4CEIA 1CBUA 4PC2A 4B3CA 3AKDA 2LKCA 4QG7A 1EG7A 3ZZUA 2GF9A 2WHXA 4YC7A 1SQ5A 3TUZC 3LXRA 2WOOA 3NEYA 2O8DB 2BCGY 1E2NA 1T3LA 2J9RA 3PEUA 1XPOA 4PSVA 1P72A 1RRPA 3OAAD 3WRYC 2C2HA 4RD2A 1ZNYA 2GCNA 5EE1A 3QE0A 2VF8A 5JMTA 1DAKA 4C0HA 4EDHA 2WPDA 4M22A 1OE0A 1XD2B 1I4DD 3SEAA 4Q4LA 4X8MA 1P5ZB 2XTZA 2RGEA 1RE0A 1TEVA 3O47A 1PV4A 1O3YA 2DR3A 1H8ED 4CVNA 2GWHA 3AP2A 2PEYA 2R6FA 3LBNA 1LB1B 2QG6A 3B1VA 3IIJA 5CYPA 3TK1A 4IDOA 1J99A 3T5GA 2C8VA 3UMRA 2B7CA 4US2R 2W0SA 4LX0A 4LYFA 1TX4B 2JJ1A 1E96A 3W5JA 3WMGA 1FPMA 3RSOA 1TU3A 3AEZA 4LBWA 4G01B 3VKWA 4CIDA 4KVGA 1NJFA 3PUXA 1B23P 4IXNA 2IS1A 2ZRPA 2VLIA 3TJZA 5JRJA 3PUVA 2HF9A 4JLDA 3WYAA 2VL7A 3CO5A 4XVUA 2IYVA 1KZGB 3CH5A 4DDTA 4IVRA 1DG1G 4Q7JB 1ZIOA 2FGKA 3UPUA 3FMFA 2O8FB 1MRNA 2KJQA 2VQSA 4TSFD 2IWHA 4P32A 4PC7A 1Q0UA 4UNRA 2HYIC 1CRPA 2GXSA 3SJBA 2GA8A 1TMKA 3LLUA 2SHKA 2VIIA 3KFXA 2WJIA 2NTYC 4ACBA 2Q3FA 3GLFE 5CIQA 3A4LA 2HYDA 5AJWA 3IKJA 5CB6A 3DOEA 2XJ9A 2ZANA 4IW3B 5FUYA 4PQRA 4BLRA 4UKDA 1G291 5K8IA 4BGDA 3BH0A 3AF4A 1KI1A 4NCHA 2C99A 1W4AA 2YKGA 3AGPA 4TLAA 1YZLA 2V4ZA 1TL7C 4Z54A 1P4SA 4Q9HA 4MGIR 2CHVA 3LV8A 2R8RA 1CLUA 1QRAA 1XBTA 2CCGA 1IOZA 3BAFA 4MYHA 3SJAA 3UG7A 2ATVA 5DH9A 4B6EA 2JLXA 1KZ7B 2O8EA 1SULA 1G4AE 1NKSA 1RYHA 2ZI5A 4W5WA 3R8CA 1EXMA 2HCBA 4NH0A 1N5JA 4Q00A 4DVGA 1L8QA 3TAHA 1IY1A 2ZRGA 1Z0JA 1VG8A 2YV5A 3QG1A 5EP2A 1JR3D 1UPTA 3CRMA 3JVUA 4GBMA 4PPQA 4XWAA 3BGWA 3A1UA 4DUGA 1CR4A 3CR7A 2W0MA 4PAMA 5B58C 5CB8A 2ZXUA 3CF6R 1Z6YA 5KOYA 4URZR 1WB9A 4I81A 1B0UA 1II8B 1M2OB 4YDSA 2P6UA 4DHEA 2VRWA 2WWWA 3Q7QA 1G8PA 1R2QA 1UEIA 4HB3A 2MSEB 4TTRA 2GZAA 1U9IC 1IAQA 3LBHA 3QBTA 2JJ2A 4XD7A 3TSZA 4RZ3A 3LW8A 1M74A 3IBYA 2VH5R 2PZFA 1F48A 2FPKA 1Q44A 1KDPA 1MV5A 1NMXA 2CNWA 2ZYTX 2RKOA 1AQYA 5DYGA 1VYTA 4I1VA 1KI6A 4QL3A 1MO3A 4IKEA 4FCVA 5FPSA 5FBRB 4GI7A 1IY0A 1YR7A 4QHYA 2PCJA 1H8HD 4GPTA 4KJZA 2OCYC 3LY5A 4OQXA 3A1WA 4HAVA 3F8TA 4YXWA 3FE2A 2AXNA 4D0GA 4QC2A 5GJCA 4JVSB 1IY2A 3VR5A 721PA 5L8VA 1AQUA 1YU9A 4NP6A 2GK7A 5CJPA 4EPWA 4GOXA 4US1R 4TMVA 1T6NA 3K53A 1II9A 1PZNA 3Q7PA 2GAAA 4LRWA 1WCV1 4D26A 1N6NA 1DE0A 2UZ3A 3FYHA 3ZIAA 4ZDJA 4Z8XA 2QGNA 3ZQ6A 3WMFA 5DI9A 4QKQA 4ASUD 4U02A 4O3MA 4Q7LA 2IF2A 5LPNA 1ZM2A 3RVBA 4TMKA 4EJSC 3DEFA 1S1CA 1ZM4A 2A5YB 5FPYA 5HPYB 2ZSBA 3PJRA 3W6PA 4B35A 3QNUA 2K5UA 1D9ZA 1YZKA 2VSOA 4M1TA 4OK5A 3KJEA 4V0ME 5GADl 4RZUA 3FHCB 4G0NA 2CK3A 2NOAA 1FUUA 4BFZA 4V0OA 2DYKA 4FCTA 1XCMA 3A37A 3A1VA 1HA3A 3RANA 2X8AA 4JJZA 2QAGB 4OI2A 1XPUA 5A4JA 5AR1A 1OXTA 4B33A 2WM9B 2WTUA 2WJHA 2YJTD 2CVHA 1LV7A 1LW7A 4Y0AA 2Z6VA 1Q22A 2G0NA 4S35A 4NYIQ 2J87A 3CLVA 2AX4A 4JLPA 1P9NA 2ZJBA 1VIAA 3RS0A 4B75A 3ZD7A 1X3SA 4DT1B 4X8HA 2WKPA 2YWEA 3UATA 1IQPA 2YNMA 3JZAA 3MWLA 5FR2A 2H16A 2ZYVX 1ANKA 1FUKA 1E1QA 5SZKB 4TYWA 3KKMA 4NYJR 1XXHA 3IEVA 1GL7A 1N6KA 4U5XA 2QU8A 2JJ8A 4PPNA 1ZIPA 4HZUB 4UJ3A 4RKFA 4KO8A 2G88A 2ZS9A 1G19A 5DIFA 5EZ5A 4QOSA 4E07A 2N46A 1W1WA 4YMWA 1VKJA 1R10A 1U0LA 5B2ZA 3HPRA 4NYMR 4Q18A 5TMPA 1JJVA 1G18A 5H1YA 4D4LA 1VECA 5C4MA 1AJEA 3CB4A 4C7OB 3C5HA 5FFMA 2IT1A 5AUNB 4OI4A 1KK3A 2DHRA 2CHGA 2OG2A 3SFZA 1YZGA 4Q66C 4MRSA 1NG9A 1NSTA 4KFSA 4QGFA 3REFA 3WMEA 4R98A 1DADA 2B6HA 2PL3A 1QVRA 2EWVA 4OHVA 2B7BA 3AF1A 3ZS9A 2NIPA 4LGMA 4C0QC 2F7SA 3H1TA 1T9HA 4R71A 3B1WA 3Q72A 4LK2A 5K8TA 3BBPA 1VCMA 1XD9A 2Z43A 5AJYA 5J5CA 2G1KA 3LW7A 3K70B 1KO8A 4GZMA 2FX3A 2OE2A 5AJZA 1SZPA 2GEDA 2Q9AA 2ZI7A 4PO1A 3RS2A 2XX3A 1TAGA 4IFBA 3RS4A 3K0AA 2YZ2A 1YRAA 3THYA 4LPKA 4TN1A 2O8CB 2EVWX 1Z63A 2FGJA 1NLFA 4DB4A 4ZI3A 4MRRA 2BMFA 4MKGA 4A2PA 3FPAA 2ZR9A 1RRGA 3ETLA 2XGJA 2JEOA 2A30A 4M9QA 2A2ZA 2BMDA 4G1UC 4Q02A 1N0VC 1FMJA 3QQ5A 1BMFA 3KQHA 1JEDA 1IXZA 3CZPA 5FTNA 2GEUA 2FN4A 4F38A 3N2EA 4YMUA 2RGAA 3B13B 2V8OA 5FL7D 3ECCA 4GL2A 1KDRA 2WJVA 1I2DA 1N5IA 3M6AA 4DLYA 3CF2A 3AF0A 2D06A 5DSZA 4UXHA 1MO6A 2HF8A 4DJTA 1QHGA 4FMCB 1F2UB 2OBLA 4WZAE 3LWNA 5FPTA 4BASA 3EPHA 2XAUA 5FOVA 4PAQA 4PC6A 4ABYA 2VYFA 4DLUA 2CLDX 4D4JA 1FP6A 4TYPA 1NLZA 2BDTA 1WF3A 1JXOA 5FOTA 3GEHA 2ANCA 5AUQA 3P27A 1NNEA 4PPFA 1NL3A 4OQMA 1UDXA 2EFEB 3DMDA 1G1MA 3IPYA 3FWYA 3UIEA 2JLRA 3MJRA 1AZSC 1XP8A 1N2CE 3DZDA 121PA 1IHUA 1CR0A 3CWZA 1HE8B 2BC9A 5JEDA 4TL6A 1E2PA 4TLDA 2DFTA 3BJIC 3AVVA 5K8LA 1KO1A 4PHGA 4RSGA 5FUVA 1F5NA 2BOVA 2NQ2C 3AF2A 4MKIA 3TNFA 1SKQA 3AGQA 2ZRIA 2NPIA 2VHJA 2CE2X 3HYTA 1ONBA 3IPXA 1EFRA 5DISB 1XTJA 3AF3A 4TT3D 4XJXA 4BQSA 3FKSA 1FL9A 4QXAA 2PJZA 2Q6TA 4G5SA 2AWNA 3W3AA 1OPXA 4C3ZA 1RIFA 4V0KA 2JIZD 3N5CA 4L4UA 1DEKA 5H8WA 1HH4A 1A7JA 1WBDA 2E87A 2NO6A 2F1JA 5DN6D 2XXAB 4CEJA 3FMOB 3GLIA 3Q5EA 2GESA 1U0JA 3TAUA 5JJIA 4LZZA 4PZLA 4OK6A 4JZKA 4KFTA 5EUQB 3FHTA 4PHTA 3SJCA 1P3JA 1NBME 1G5TA 1ZM9A 1DAGA 2ORIA 5JS7A 5IK2D 3CPEA 3CX6A 2P6RA 4CGZA 1HUQA 4PQYA 2I4IA 4BLOA 2YOGA 1D8TA 2C78A 3KB2A 1AS0A 3DMNA 4LHWA 1UKYA 1A4RA 4OHWA 1CP2A 2HCJB 4C0BA 2HLDD 2GDJA 3BIFA 1U98A 3KJHA 1CRQA 1N5LA 4FI3C 4L9WA 3EZ9A 4P0TA 2D7DA 2ZSAA 4GFDA 3RNLA 8OHMA 4BFVA 4LDJA 1MR3F 1Q1ZA 2O0HA 1ZM7A 2D4HA 6Q21A 4IEIA 2A5DA 4NCJA 1MO5A 2AHOA 2OILA 4HDCA 4DLRA 4MRPA 3U7EB 3AVQA 3SI7A 4XWKA 3BB3A 3NVAA 2ZAMA 5LB4A 1KI6B 1BKDR 4BLPA 2P3SA 4PQFA 2ZPTX 3PG5A 3Q9LA 2EU8A 1YQTA 1Y63A 5KTYA 4GMDA 3OFNA 3K9HA 3CR8A 2XEXA 3K1JA 4ILEA 4Q4JA 5EE3A 5FBQB 3HJNA 5J4KA 1O87A 4M8NE 3AKCA 1JAHA 1ZNXA 3QBVA 3ZD6A 2FMXA 2RAPA 2XB2A 2NO7A 5FOXA 2YOHA 3NTUA 4ZCLA 4DLSA 4F4CA 4PZZA 5HE9A 1CTQA 2ERXA 1QZXA 2V9PA 4D0LB 3OAAA 2KSQA 3BH6A 1ZRHA 1VYVA 1FMLA 3UMFA 4QM6A 2QMUA 3R7WA 2IEZA 4RD0A 3FB4A 1SHKA 1X8JA 5J4YA 1ZJ6A 2W6ID 1XCPA 4DC9A 2IF0A 4CW7A 4QBHA 1ZCAA 1H8EA 3HU1A 4IRUB 4ZCIA 5JSZA 3GJ5A 4POAA 5L3VA 2WKQA 1UBEA 5KUTA 4Q48A 1DOAA 3WXMA 1G20E 1N6IA 2JLQA 5DHFA 2IBMA 1XJ0A 2P6NA 4GOKA 2V1UA 4BUJA 1SVOA 3FMIA 3U7HB 3GLGE 5DO9A 1E2IA 3KZ1E 1Q57A 4WOPA 1U81A 3DKPA 2ZRBA 3TIFA 2IEYA 3D6TB 4AKGA 4UXIA 2WAYA 2ORWA 3T61A 4ZIRB 1RFLA 2Y8EA 1IN6A 5TDHA 4WBSA 1MABA 3KXIA 4TSFA 4E5UA 1Q3HA 3NHBA 2FV8A 2BEJA 1NLYA 3BFXA 2HXYA 5JJLA 3QUSA 1W0JD 2ZE6A 1T0JB 4G5OA 1HT2E 1GKYA 1OH8A 3NDBB 2ZREA 4QNMA 1E2QA 4ZDIA 2CL7X 2ZITA 4JKYA 2ZJ5A 1OIWA 1XXHB 4H1UA 1MT0A 3DM5A 1G7CA 3T15A 4JLKA 3W9YA 1R5NA 2WIAA 1KI2A 2BKUA 1XTSA 2WWIA 2ZM5A 3T1OA 1KYIA 1TUIA 3U3OA 3P26A 2H92A 1G21E 4AD8A 3QKTA 4DLXA 1AZTA 2CHQA 1U9IA 3B9QA 3K0SA 1DAHA 1S9DA 3DOFA 4L8GA 2F43B 1DAMA 4TL7A 1GL6A 3RRZA 4CRWB 4QHTA 2ZTSA 5D3MB 1KTVA 3I32A 3QEOA 2GF0A 4ON9A 2J7PD 2GBLC 5FR1A 1JR3A 2BJWA 4ARZA 2IUUA 1Q20A 2GCPA 2R2AA 4RJLA 3T34A 3QF4A 4NONA 2FZ4A 1NBMD 1Q12A 1W46A 5C46F 3FFAA 3BE4A 3RS7A 4WW0A 4Q03A 3ZZ0A 1OXVA 2FJUA 4PXAA 2VHUA 2MMGA 4GP6A 4X8LA 2UVQA 1QBKC 1OHHD 1QHYA 3C7KA 1G8YA 2J41A 3TVDA 3B7GA 1GNPA 3RS5A 3KUDA 4W5HA 1YZNA 4OL0A 1TUEA 1KMQA 4JL6A 4URUR 5KHOC 3HR8A 3AM1A 4D4MA 3WY9A 5J47A 2O8EB 5B64A 2HUPA 2IS2A 3K0AB 3LD9A 2H17A 4QNRA 1T3HA 4O0MA 3VNUA 3THYB 1KKLA 2EFDB 2QN6A 1OXUA 3WHKA 1H8HA 4EJSA 5HKKD 1ZD8A 3ADKA 3U4QB 2RGCA 2XZLA 1FQKA 3I8SA 1G41A 2MMCA 1ZMXA 2N42A 2YWFA 3GJ3A 3HP1A 2HJGA 2ZE5A 4OKSA 1KY3A 5CIWA 2QAJA 3OFND 4ERNA 3AP1A 4M1OA 4BLTA 4M1MA 1GFIA 4JSTA 4JKIA 4DCTA 4IDHA 2QTVB 4OHXA 4TLEA 4A8JC 5JWRA 3SBDA 4A82A 1GM5A 2GILA 1SVLA 4RD1A 3WBJA 2QROA 4EPRA 1OFHA 1SKYE 3SDZA 1S9HA 3K0CC 1FP7A 2C96A 3TMKA 4ASUA 5EP4A 1NIPA 1KJYA 2FSIA 2ZRMA 3LAWA 4KFUA 4OQNA 1NN1A 3AP3A 5CITA 3QVVA 2WSSD 5KYKA 1NKTA 3TQFA 4HYYA 1KOFA 1OT3A 1GIAA 2XB4A 1G6OA 2QRZA 2Z5FA 1CJVC 1GL9B 1UM8A 4Q47A 3W34A 4RFSB 3U60B 3ADBA 1U0HC 1RRCA 3EXAA 3BRWD 1FNMA 5CDFE 4GSYA 1CEEA 3BORA 2GZHA 3NBXX 5JZVA 2FOLA 2VSFA 3FGNA 1MH1A 3SHFA 4LJ8A 1SVWA 4AYTA 1S3SA 2GXAA 4MDEA 4PTLA 3VTKA 2CMKA 1ZNWA 4Q19A 5FI1B 2DWOA 4JLVA 3FTQA 1XDBA 2ZSEA 1E9CA 3OHMA 1E4VA 2GXQA 3I62A 2WZQA 5JLJA 2B21A 3GMTA 3MJHA 3FHOA 4HUQB 2BWJA 5FL3A 3OIWA 3VR1A 1E2EA 1XEFA 3GLFA 4FXPA 4LJ7A 4CT4B 1GOTA 1FFHA 5HR5A 2DWQA 1W36B 1TQ6A 5G41A 1V43A 2OBMA 4WIAA 3WP0A 1DELA 4A0GA 2GXUA 3TKLA 5CM9C 5LB2A 2IYRA 1U94A 2J46A 5H68A 3GLIB 4CEJB 2OM2A 1UADA 2G83A 3T06B 4L9SA 4RZXA 4M0LA 5CLQA 3NEJA 3RDPA 3GD7A 5F3WB 1F60A 2VP4A 3QXXA 4Z1MD 4B47A 4B71A 1WQ1R 4DLVA 4RD6A 2Q21A 3TLXA 1LF0A 2DFKB 2ZVPX 1JQJC 5L3SA 2HXSA 1X1RA 3REGA 2VTKA 1N5KA 3KQNA 5TVKA 2GZDA 2PH1A 3B1XA 1N6HA 4BFSA 3ADCA 2DB3A 4QHSA 3VHXA 5FTJA 2XNDD 2IUTA 4QJ3A 3UXMA 1G6HA 1OYYA 4D6PA 2BHRA 4LYHA 2OXRA 4MQBA 4R2HA 3LX5A 1WBBA 2PT7A 1KHTA 4AKIA 1QVAA 4FMDF 4XTRA 5JJKA 2IYQA 1KI4A 1VHLA 1N6RA 2XZPA 1XEWY 3BC1A 3CX7A 4N0EA 3PUZA 2XJ4A 1BH2A 3KKNA 1E9RA 3I1FA 3KJIA 4Q4JB 4UXJA 1OH6A 4GT1A 1G3QA 3OZXA 3ZLJA 4Q7KA 1N6PA 4C0AC 2VBCA 4TQAA 4YLGA 5BYKA 1XTIA 2BBWA 2C9OA 2F1IA 4LI0A 4OJKA 3WYFA 1FNNA 2VP9A 2GTPA 2CLSA 3S1AA 4I4LA 1YE8A 2RGXA 3DKVA 3LQQA 3SU8A 3QOFA 3W8NA 4LV5B 2ZUCA 4HATA 3SZRA 2ZS8A 4B2IA 1Q1EA 2GCOA 4MKHA 4HLDA 4B3GA 3UK6A 1A2BA 4ESHA 4TMZA 1Y3AA 3QKUA 3F3YA 5HTKA 3TW4A 1M7GA 5J4VA 1IN5A 1IN8A 1GG2A 4LHZA 1E2LA 3IQXA 4HLUC 5EXSA 2O8BA 5FL7A 2NGRA 3PENA 2A78A 5JSZB 5KNCA 2O0JA 4LV8B 5CLLA 5KSPA 1KGDA 2I1VB 4K8OA 3SQXA 2IC5A 4U7DA 4AI6A 4D80A 1RRFA 3SHWA 5BW8A 3MCAA 1GKUB 3DPUA 3FDIA 5A0FA 4TZ6A 2X19A 1E9AA 2FPLA 4OYHA 4HEJA 3RSLA 4DXAA 1AM4D 3GEEA 4KSCA 5E4FA 2J0QA 3W6NA 4LOAA 5FOWA 2JLYA 3THWA 4DKXA 3RRMA 1JB1A 2N1BA 1SXJE 2C95A 2ZJ2A 4V0MA 3X1YA 1Z0AA 3FKQA 3ZDQA 1MABB 1NVWQ 2F3TA 4RCYA 3U2QA 3H84A 3EZ6A 4IXMA 1R7RA 3SFVA 4KYUA 1E0AA 3U5ZB 3TVTA 1C9KA 1S1MA 2CLCX 2EYQA 3AH8A 3WBKA 4K81B 1KDTA 2L0XA 1J8YF 5SZIA 1YZQA 1NRJB 1QG4A 1G3RA 3VU9B 4DZZA 4EPVA 1CR1A 4JL5A 3CNLA 3TGPA 3BERA 4DDUA 4PC1A 1J7KA 4A2WA 4LYAA 2QPOA 4P4TA 3I61A 3CF0A 1KK2A 4MYTA 1T8UA 4TT3A 2ZJAA 3TRFA 3EPJA 1P73A 1OIXA 3BFVA 4TLBA 3L2OB 3V9PA 5EXXA 1PJRA 2IYUA 4KCGA 5JECA 5H70A 1T3SA 821PA 2CL0X 4DIEA 2LKDA 2JIZA 2R6AA 3BXZA 3NKVA 2LWIA 5TARA 3W8RA 2G1JA 2QT1A 3QIAA 4L16A 4PO8A 4C0KA 1TQ4A 1X6VA 5JCZA 2JATA 5DN6A 2FFAA 2G0TA 2QNRA 3HYRA 1P2TA 3GFPA 3EPKA 2P65A 2XOKD 1VPLA 5FBWB 1FW6A 3GLHA 1I4TD 4ARZB 3MWKA 3GEIA 5AWFC 2P67A 4Q9KA 1RC8A 3QF4B 1KAGA 5IK2A 3VR3A 1NN3A 4FCWA 1OB2A 2X2EA 2NZJA 2AR7A 4URYR 3X2SA 3W6OA 2PMDA 3M1IA 3P1JA 3DVLA 4QGGA 5BYJA 3GLHE 3QENA 3DDCA 1DG3A 1A5TA 2HLDA 2Q0HA 2GJ9A 1W4RA 1KJZA 4HB0A 1X86B 3BFKA 5G3ZA 2OCAA 4C0LA 1G4UR 1W44A 1J90A 2ZRDA 2ZRLA 2GVZC 2GKSA 2R44A 4MA4A 2ZU6A 1F2TA 4Q1DA 2OAQ1 4BEBA 1R0WA 1AS3A 1XEXA 1MOZA 3HDTA 3L82B 2R62A 2R65A 2W58A 4CDGA 3LNCA 3K9GA 3QKSA 3LVRE 4OBEA 3GJ7A 4EJSB 2JGNA 1E98A 4IEEA 4LC1A 2P2LA 3IO5A 3M0EA 4F91B 3AVOA 1N6LA 2J0UA 4BECA 1GDDA 3EWAA 1TTTA 2YWHA 4I1SA 3P32A 1A82A 3CBQA 5GVSA 3LLMA 4PSKA 1XNJA 1IM2A 2QEQA 2V6IA 1COWD 4CT5A 1W2GA 3C5CA 4B73A 1Z2AA 4CZ2A 4Q9JA 4XIGS 5HCIA 4QFMA 4CEIB 2H57A 1GSIA 2ZS7A 3CRVA 5FBLB 3SBEA 2E9SA 1VDZA 5G40A 1W0KA 1D6JA 1QHHA 1G7RA 3MMPA 4PX9A 4C9BA 1KMHA 5F9FA 4LYJA 2RGBA 3X1XA 3ZS8A 4OI0A 2W6IA 5FUWA 1KDOA 4LBYA 5KNBA 1WDTA 4KAXA 4B74A 2PZGA 4BFWA 1JQLB 4JBYA 3SR0A 3OEHD 1II0A 3ZYCA 1HV8A 1ZINA 2J5XA 4II7A 1F3OA 4D2IA 1LFDB 3LVQE 4A6PA 1QF9A 3KKQA 1PLKA 2WICA 1W49A 5J4HA 5FOSA 2G6BA 2OO7A 1UEJA 1XPRA 4TLCA 1EK0A 1HYQA 1OLOA 3GP8A 3ZVMA 1NY6A 4G5QA 3B9PA 1AGPA 1G3IA 2IYTA 1FTSA 3GFTA 1Z47A 1E79D 2FSGA 5EJEA 4KV9A 4OQLA 1E0KA 2GRJA 2C98A 1OIVA 521PA 1SXJD 2IXEA 3K9LA 1Z6TA 2GAOA 4KYIB 2OUKA 4LHVA 2RMKA 3ICQB 3L8ZA 2QMOA 5M04A 3TH5A 3DM9B 4Q21A 1LTQA 1BOFA 2OBNA 4XVQA 2WAXA 3T5DA 4QBIA 3A36A 1HY3A 1XB2A 3RWMB 3KQKA 4XSGA 4LJYA 2GBLA 1W0JA 1WP9A 1ZM3A 3B1YA 4URWR 4D81A 3GLFB 2CDNA 4KXFB 3MWYW 1KK1A 1Z0KA 1P62B 2QPTA 3SE0A 2QA5A 1G64A 3EA5A 1NSFA 3VR4A 3G82C 2ZIAA 3B2EA 5AK0A 1VCOA 2A7QA 2REOA 4I1UA 3TR5A 2ZI3A 2GHIA 4W9MC 4TQ9A 2ZROA 5LBIA 1EFUA 4LC0A 4WVFA 2FFBA 1J8MF 5JWHA 1FOEB 5IHPA 2GETA 3I8XA 1SXJC 4P4UA 2B8TA 4DB2A 1XWIA 3B60A 4BFUA 4D82A 3KQUA 2YC2C 1LVGA 4V02A 2A9KA 1R8SA 4JVNA 4NYJQ 4TL8A 2RHDA 2ZI9A 2Z4SA 1NIJA 1NG1A 2F1HA 1P75A 3AUYA 1KSGA 4G5RA 5L3SB 3MRSA 2WOJA 2NPFA 1CJKC 2J7PA 1JXMA 2GVDC 1OKKD 1XTKA 2FSHA 2BBSA 4NL4H 1VYUA 5EUMA 1NBMA 5F2EA 4YDHB 4MUAA 1IBRA 4D4KA 3AUXA 1E1RD 4NYMQ 4V03A 1CJMA 2D7CA 3B1ZA 4NE2A 2OEPA 2H7VA 2H5EA 2IHYA 1HQCA 1UKEA 2KE5A 2ODBA 2VHQA 4A15A 1OHHA 3SQWA 4MUBA 1R4AA 3KFVA 1NVUQ 4IDPA 5JRZA 1S96A 1S8FA 4KITB 4XH9B 1I4LD 4Q4AA 2BBOA 2QE7D 1JPNA 2F9MA 4A8JA 4BLQA 4EAQA 1OV4A 3GCGA 3QJYA 4M4SA 1QG2A 4HSEA 3LA6A 2GJ8A 2W83A 1Z08A 3K0CA 1S4QA 2QM8A 1Z3IX 2QT0A 1DARA 1JEEA 3EPLA 4FW9A 1Z22A 2EQBA 4RD4A 4A92A 2VHCA 3IHWA 5HKKA 2QP4A 4B3XA 3P4XA 1AIPA 1UFQA 2A5FA 3K09C 1XJQA 4PC3A 1BYIA 4HDQB 3EZ7A 3K0FA 4B48A 1VHTA 4P4SA 3PEYA 2GCOB 4DSNA 2GNOA 1X8LA 3CPHA 1W47A 1YHNA 4NTZA 4DIDA 4MYCA 5F9HA 2BJVA 3ZVNA 1G5RA 1EESA 1M7BA 4NCNA 4A4DA 2IYSA 3NC0C 4ZDKA 4ESVA 4XVRA 1A1VA 1E9EA 5HZHA 2B8WA 2J59A 1NI3A 4PPGA 1E32A 1GWNA 3UKDA 4AG5A 3U3KA 1OH7A 3BOSA 2X2FA 1R0YA 2AN9A 3A4MA 2VPPA 1E0SA 4NCKA 4NU0A 2CL6X 2ZRNA 3WP1B 5FUXA 1GAJA 3K8YA 2WMNB 4M53A 1TF2A 4UQOA 3ZVRA 3RAPR 5CK5A 4FIDA 1LY1A 4P33A 2HDNB 1U8ZA 4J0QA 2WSSA 1BIFA 3SYNA 3O8DA 5C4GB 3I5XA 4G3XA 4LY6A 2J7KA 1E9BA 1E9SA 5KU1A 2F9LA 1W0KD 1FTNA 1II8A 1MO4A 1SVKA 3MAAC 4IJMA 1XZPA 3R9WA 4N0DA 2ZYUX 4NPHA 4V0LA 4GMXA 4HAWA 2ODNA 4Q9LA 4DCUA 1G17A 4EFLA 1T0HB 2FH5B 3CM0A 3GLGA 1IJEA 2J0VA 3UANA 4LJ6A 4YMSA 2RGGA 5ELXA 1G9XA 2Q3MA 1DBSA 2Q3HA 3OEED 2WSMA 3OF5A 4JLOA 1KAOA 3SC3A 2ZUDA 1XMSA 221PA 5DI3A 3TR0A 3DO6A 1KI7A 1OFTA 1AKEA 4BPBA 2O5VA 3PFIA 5AJXA 2QP3A 2IWRA 1VG1A 1KSHA 1NVVR 4M2LA 4DEXA 1ESMA 1EGAA 2QMHA 1KK0A 4YQFA 4LWZA 1VTKA 2AK3A 1IJFA 4HAXA 4V0NA 1E4YA 1FQJA 1W5TA 2B92A 2Q9CA 1DVRA 1E69A 2JDID 3E1SA 2WIBA 2IUSA 5A5GA 1BO6A 4JLNA 2GEVA 1R6BX 3J81k 2WKRA 1CS4C 4EQ6A 4A0RA 1DPFA 1W4BA 1J70A 1TQ2A 1XF9A 3L43A 4KVAA 2VSXA 4OQFA 2WWFA 3GLHB 4EIWA 1US8A 4Z1MA 2BM1A 1XMVA 4M21A 4BWYA 2ONKA 2C9YA 2IYZA 3ZQJA 1D2NA 4JLJA 1P6XA 3WNCA 3CH4B 4KBGA 2DFLA 3ZGXA 4C0JA 2GJKA 4TTQA 2RB4A 1G3MA 4WXPA 3H4MA 3PEWA 4B3BA 2IX3A 2XNDA 3IIMA 1KO5A 1T8TA 2QSZA 1R5BA 3JVVA 3T12A 1ZD1A 4B2LA 1IXSB 4ACAA 1OXSC 4Q5IA 4R2IA 3MD0A 2OFWA 3BH7A 1Q1QA 2DCUA 2ZSFA 1OXXK 1XEXB 2NO0A 3UG6A 2WJYA 4JS0A 1R8QA 2A3RA 3I73A 4HLUA 4IFEA 3AKEA 3QKSB 2WJJA 4KLNA 4OJQA 4PAOA 4WA7A 3VQTA 4URVR 5KSOA 4TMWA 3U7GA 1P2UA 1NY5A 3ADDA 4BFXA 4RFVA 1NP6A 2R6DA 3NH6A 1XMIA 4B3FX 4BRUA 4IVPA 2FPMA 5KDLA 3VKHA 3OIVA 4UNQA 2FEMA 2EWWA 4YONB 1N0UA 1HE1C 1RKBA 4LJ5A 4DWJA 3U61B 2C5LA 4N3NA 4DRZA 4AK9A 1P61B 4US0R 1W36D 3WRXC 1QDEA 2UKDA 1PUJA 2JAQA 4ZI2A 2BKEA 2QPAA 1GITA 4WAUA 2BBTA 5EXPA 1EFCA 2D2FA 5DNYB 2V54A 1ZUNB 3HU3A 3IIKA 1KI8A 4JT4A 1YZUA 1ZYUA 2JA1A 2UZIR 4IOJA 3U44A 2NG1A 1KMHB 3IDQA 1E2JA 2VP6A 2IYLD 3QPVA 3VR6A 4XWOA 1Z0FA 1JR6A 3Q5DA 2BV3A 3HR7A 1FX0A 2EYUA 4PHHA 1ODFA 4M1KA 1OJLA 1JECA 1KNQA 1A2KC 4PANA 5TV2A 1HTWA 1W36C 5B57C 1IONA 4ZDWA 4EFMA 1G16A 3IUYA 1KSFX 3NC1C 2ZJYA 5G53C 4AIIA 1Z0IA 3QKRA 4E22A 4B32A 3B85A 1YVDA 1Z83A 1F6BA 3L8YA 1SVIA 2QORA 3VMFA 3KL4A 3UWOA 2ATXA 4TQUS 1M7HA 2VP5A 3IO3A 5CDFA 3Q3JB 3LXXA 4AKHA 4DLTA 4HAYA 3N70A 5LDDC 4LJ9A 4FINA 1YJ5A 5D3QA 2NO9A 3NXSA 2TMKA 4M9SA 3R9IA 4BRWA 1CU1A 1CJUC 4I1OA 2O8CA 5UKDA 3W90A 2JASA 2ZEJA 2QBYA 5J40A 1KSJA 2QRNA 2QUZA 5KPDA 5JBQA 1ETUA 3D8BA 1L7VC 3LQRA 2FFHA 3GJ6A 5E7JA 3MSXA 4PR0A 4B34A 5FPHA 3ICEA 2VHTA 2V7QD 1P9WA 1ELOA 2ANBA 4IHQA 3OESA 4M9XA 3RHFA 1QHXA 1YRBA 2I3BA 5KPJA 5LD2B 3CUEF 2JCSA 2F3RA 2PBRA 2XOKA 1EX7A 2J45A 4PO9A 1HURA 3X1ZA 1GP2A 1VIYA 1ZAKA 2VEDA 2DFNA 1F2UA 1NVXQ 2IS6A 3GJXC 1L4YA 3T1TA 3EIQA 3U3MA 1OFIA 2PMKA 3OE7D 4JVMA 3RC8A 2KB0A 3EWSA 5ANRB 3MLEA 3LRPA 5IRCD 1DO0A 2KBFA 5BN5A 1I2MA 2Z0MA 1K6MA 1CR2A 2BMEA 1TPZA 4JSYA 5EXTA 5KNDA 3U6KA 2NMVA 4Q1AA 2J0SA 4Q9IA 2ZQ5A 2FEOA 1UF9A 2VP2A 2IYYA 2ZJ8A 2ZRCA 4M1WA 4MITA 2W00A 5DHAA 3D7MA 1XX6A 5IT5A 2F55A 1GNQA 4B2PA 1N6OA 4Q4AB 2ONJA 3KUCA 2VA8A 1P60A 1E2GA 4JLAA 2ZJZA 4A8JB 3NIBA 1YR9A 1XRJA 3PUWA 3BK7A 1CIPA 4O25A 1T5LA 3WNBA 4LSGA 2XTMA 4B43A 3T1VA 4F7WA 4Z8YA 4KLZA 4MGYR 1T4GA 4NYIR 1GUAA 4HI0E 4AWXA 3DL0A 4MH0R 2OT3B 4IOKA 1C4OA 1IN4A 1Z6XA 3K0FB 3VX4A 4P4SB 2PJRA 2O52A 2OCPA 3L0IB 4QJ5A 1XU4A 2IW3A 2W6JD 2W2TA 2V6JA 2YWGA 4IVQA 1JALA 1UKZA 2QP9X 3EARA 3PIRA 5GJBA 2ASEA 2OCBA 1COWA 3LO5A 5EQTA 1G8HA 2WVJA 4C0SA 3B8HA 3QXJA 4F4IA 3GJ8A 2XXAA 2FWRA 1Z0DA 4LHXA 2AKYA 4M1YA 2PLRA 4KSBA 2ERYA 2V55B 2YOFA 4JVLA 4O2RA 2ZYWX 3B5JA 2CXXA 3RABA 3AVTA 3BS4A 2WJGA 1JPJA 2VO1A 1M8PA 2XSZA 4LHYA 4JBWA 2CJWA 3OEHA 4JMPA 2QAGC 1TF7A 4HLCA 3R20A 3R7WB 1JI0A 4HZIA 5JI2E 5AUPB 1YR8A 2X1VA 1VCIA 4F92B 2QQEA 4Q01A 1GRQA 3ONWA 3AQ4A 4KBFA 4BZQA 2RGNC 2AD1A 4DDVA 2NO1A 2PLFA 3B82A 1K5GA 2PEZA 3ND9A 1E2FA 4XSHA 1TNDA 1XJCA 2CEAA 3WNDA 4FMDB 3PUYA 3GLGB 1E79A 3NH9A 2IYWA 3TUIC 1XZQA 2P0EA 1W5SA 1EFHA 4XOIA 3THXA 4CEHA 1E2KA 1SXJA 3TQCA 1XCGB 4OK3A 3SN6A 4BFYA 3PR1A 4KI0A 5DI3B 2G3YA 1WA5A 3PVSA 1AA9A 4W5JA 2HT1A 3CX8A 3JZMA 3A1TA 3AVYA 1RJ9A 3LH5A 1ESNA 2C77A 3A1SA 1PLJA 5KO2A 3VKGA 3LX8A 1ZD9A 4TYQA 4DBLC 1NN5A 4LUCA 3L0PA 2QQ0A 4URXR 2ZI6A 2QMEA 4JBXA 2PX3A 4ZPXA 2XZOA 2FG5A 2RCNA 1RW4A 1XEWX 3RRNA 4B44A 2QTHA 1TEXA 2HJVA 3QY0A 4ZKEA 3K70D 4GRAA 3B78A 4LJAA 3P20A 3NBZC 5K8UA 3SNHA 4EQ6B 4RCZA 3B6EA 3SYKA 2BM0A 5GJVC 5FTLA 3C16C 2FNAA 4KFRA 4NDZA 1G8FA 1US8B 5FPKA 2FE4A 1D9XA 3AV0B 4FWIB 3C4JA 3ZVLA 4C2UA 3RS3A 1KNXA 3T35A 4ITRC 4RD3A 2KBEA 1N25A 1GVNB 2XITA 2ZR0A 5P21A 1ZUIA 3MFYA 1OKKA 1VMAA 4Q7MB 3TSOA 1ZCBA 3I5YA 3PV0A 4KU4A 2WPDD 4EUNA 2J3EA 4DLWA 1E99A 4IDNA 1GRNA 1E1RA 1KJWA 4GNKA 5KSYA 3K09A 3TE6A 3K70C 1PUIA 3KTAA 2P5SA 3OIUA 5L3RA 1WMSA 2D2EA 5HCNA 2CCKA 4Z51A 2LCFA 4ZIRA 1SVMA 4HAZA 1CJTC 1U2RA 2QENA 2ZRFA 3WYGA 1OH5A 3A8TA 1KO4A 3NDPA 4CF7A 1Z2CA 3C41J 4AYXA 2JJ1D 5JI3E 3OIYA 4DSTA 2QE7A 3X1DA 2YC4C 1JAIA 5E7IA 4RVCA 1G3UA 5EE0A 1U8YA 1KI3A 4HB4A 5DYIA 4TL9A 4QGAA 2AFIE 2FU5C 2CE7A 3ASYA 1VG0B 4TMXA 5FOUA 5EE9A 5IF9A 3QG5A 1OYWA 5EE5B 4BEJA 2JLVA 1EFTA 3G0HA 1P2VA 4WXRA 5HE8A 4EFNA 4ZV4A 1LNZA 2ORVA 2OZEA 3CRW1 3UMSA 4ZKDA 4Q4HA 2ZETA 3C14C 3VHLB 3L0OA 2DPXA 3M4YA 3SS8A 3IEUA 2ZE7A 2REBA 3GQBA 2V3CC 2IHBA 4OI1A 4BLSA 3NHAA 1R0XA 3U44B 1E94E 1YKSA 4QGHA 2OV2A 4NCIA 3VFDA 1XXHE 2YYZA 5IDVA 2F43A 2IS4A 3SYLA 1XTQA 3RC3A 5EP1A 1BYUA 1Z6AA 1LF5A 5D3MA 1ZU4A 2QGZA 1EWRA 4R9UC 1AKYA 1FX0B 1SKYB 1E9DA 1Z07A 2QTFA 3C15C 4TWZA 3CIOA 2JLWA 2Z4RA 3PITA 4PHFA 5BQ5A 2AL7A 3C8UA 3P4YA 1DAIA 1LS1A 1QHSA 1IN7A 1U8AA 2GJAA 1G5PA 4MGZR 2OLJA 4QBFA 4B6FA 4QBGB 1W4CA 2QI9C 1TADA 3H0KA 2BEKA 3W3ZB 3QKRB 5KSZA 1JBKA 1XTRA 3CONA 4DEYA 4UNNA 2XSZD 4DUGD 4IDQA 4FMCF 1V5WA 1ZU5A 2DBYA 3NG1A 1ZVQA 3OEEA 3THOA 3A6PC 1SHZA 1T5IA 1M1YE 2H8KA 1NMYA 2IL1A 3ZJYA 4AG6A 2D3WA 4P3YA 3LBIA 1U90A 3QI2A 4JT2A 1OSNA 2JJ2D 4XD7D 3QXHA 1C1YA 5B30A 4A2QA 5DE3A 2QBYB 1R5OA 3CWQA 4YMTA 2ECKA 3U4QA 4MDFA 1UAAA 2CVFA 2CNWD 3EIHA 1E6CA 2W2XA 5JS8A 2EW1A 1S3GA 4TMTA 2RH5A 4LBVA 5FTKA 1VCNA 4DSUA 4LBZA 2JDIA 1AK2A 2ZAOA 3K9NA 3EC2A 3X1WA 4JL8A 3U7FB 5L3QA 4DSOA 3KQLA 4MRNA 2QSYA 4EPYA 3CZQA 3O8RA 4Q1BA 3KDSE 1E2HA 5EZ6B 3V00A 2W2VA 4FD2A 4RY2A 421PA 4YXWD 5KDOA 3Q85A 3QVUA 3I92A 3R8FA 2FFQA 4D0NA 621PA 1NF3A 1DS6A 2KI5A 2G77B 3E2IA 3QPUA 4U00A 2O8DA 4HB2A 1KKMA 3UWKA 2I1QA 4IOLA 2IYXA 2WMOB 2BCJQ 5BXQC 2D62A 1ZBDA 4JIMA 2ODWA 2FF7A 1EWQA 4HDOB 2AK2A 1P2SA 4LCBA 2PT5A 4M9ZA 2OAP1 3H86A 3KX2A 5KDDA 2XTNA 2H18A 2Z83A 3ZIAD 1Z29A 2FZLA 4RFSA 2AFHE 1XD2A 3IGFA 4TYNA 1NN0A 4HUTA 3IQWA 4JLBA 1W2HA 1X8KA 2OLKA 2WWXA 2QM7A 5BN4A 1UDWA 5E3HA 3QSYA 1MKYA 2R9VA 3U3JA 3N2IA 3HPQA 3T1QA 2HT6A 3PQCA 1S2MA 5EP3A 1HEIA 4QJ4A 1W7AA 2CK3D 3FMPB 4DCNA 3HWSA 3WHLA 3R9XA 2P5TB 1S0UA 1Z06A 2WV9A 2AWOA 1P9RA 4Y0VA 4JYBA 4HUQA 2DWPA 4B76A 4TZ0A 1DAEA 3VR2A 4XTCS 5C1BA 1XD8A 2VF7A 3EIEA 3EASA 1KO7A 5CM8B 4E03A 4B3DA 4CYMA 2O8FA 5DLQC 3D3QA 4NBSA 4D25A 3AVUA 2A5JA 1U99A 3DZ8A 5JFGA 1X1SA 4AKEA 2NZ8A 4UJ5A 2BMJA 3CRRA 1GKIA 3H2YA 4QRHA 1L2TA 4BZXA 4FWTA 2H1LA 5HZKA 1Z28A 4DDWA 2AKAB 3S1AB 4EPTA 1Z8FA 3FVQA 3EW9A 5CK4A 4HAUA 1KY2A 2ZSDA 1E1QD 4PZYA 3V4FA 1OW3B 1SGWA 3V4RA 2QY9A 5F98A 1G7TA 4F4JA 2CJWB 4GOJA 1E2MA 5SZHB 3GLIE 1D2EA 4OHZA 1L4UA 2AD5A 1KI9A 2ZR7A 4Q1FA 3CNOA 4GZLA 4JYCA 3A4NA 1UBFA 4A0FA 3G5UA 5TY0A 2KWIA 3RWOA 4H9GA 2ZJOA 2EFCB 4UNSA 1AGRA 4X8OA 1N0WA 3U3RA 1TQDA 2WWYA 2O8BB 3QXSA 2BIFA 2F6RA 1UBGA 4FN5A 3VX3A 4C4PA 4JLMA 4NKRA 1YR6A 1P7CA 2R6CA 3RYTC 4TTPA 4ZO4A 4EKDA 3ASZA 1G7SA 3E5HA 1CULC 4NMMA 2V1XA 1K8RA 3THXB 4CEHB 1SXJB 4O2LA 3SJZA 4W7SA 4BE7B 4AY2A 3DHWC 4A6XA 5JWOA 3AVWA 4A1FA 1M6NA 5FBVB 1ZP6A 3ZH9B 2PZEA 4R7ZA 4MGKR 2G9NA 3THWB 2IXGA 1RJ9B 1H65A 3FOZA 2J1LA 4DCSA 1NMZA 1FZQA 3I4LA 2EFHB 5CYOA 3KKOA 5SZJA 1AS2A 4AYWA 2RHMA 1CKEA 2HEIA 1RVDA 4AC9A 4QM7A 5C18A 1EX6A 3FFBA 1ZW6A 1MRSA 3VNVA 1UKVY 1ZNZA 4PSAA 1BS1A 3CRQA 3KXKA 5J4LA 3U6BA 5E95A 2V7QA 2GJSA 1GILA 1AN0A 4OHYA 1N3BA 2ZE8A 3KKPA 4AURA 1JNYA 2IA5A 5GJWC 2FA9A 4WZ6A 3EA0A 1KIMA 2PX0A 3IHLA 1ZC3A 1HT1E 3E70C 1G8GA 4LJ4A 2EFGA 3MGCA 4TYYA 2WBLC 2X77A 4RZ2A 1E9FA 4NZYA 2C04A 1BMFD 2GK6A 3LDAA 4KODA 3RLFA 5JEEA 1QHNA 5FI0B 3OE7A 1J2JA 2HV8A 3TW8B 1DAFA 4JJKA 4NHOA 5C2JB 2WWHA 4F93B 1NJGA 5BN3A 3TBKA 3HU2A 5G3YA 3KTAB 3TUJC 3O8CA 4C30A 1PLLA 2ZU0C 3D31A 2CBZA 4ZCMA 2BVNA 2OHFA 4I99A 3Q8XB 1OFUX 1XFAA 2MSDB 1HQYE 2IXFA 1UBCA 3VAAA 3GFOA 3RRYA 1WXQA 3GJ0A 3EZFA 3ND8A 4DCVA 3ZZTA 4DLZA 3SOPA 3BWDD 4GP7A 1VG9B 1Z6GA 3GPLA 3K0EA 3VU9A 2D74A 1GZSA 2ZRAA 2ZI4A 3I72A 5JCPA 2MSCB 3I3SR 4KHZA 1W48A 4S2EA 3TSWA 3PCRB 3CW2A 4BFTA 2E1RA 1OF1A 3CNNA 1Q1BA 4IOMA 1F2TB 1WRBA 5JHGB 2QAGA 3IILA 4A36A 3BB4A 1LS6A 5DGXA 3MG9A 4Q4HB 2QZ4A 2ZRKA 2OFOA 2JLSA 2W6JA 3NBYC 2OESA 2ZRJA 4UNPA 2RGNA 4MYUA 1QHIA
chains in the Genus database with same CATH superfamily
1BK0A 1X77A 4ECXA 4DR3B 2XG8A 5A6ZA 3AETB 1XMOJ 1RZ3A 2XTJP 1X7ZA 3EX7C 1W39A 4QHZA 2YHIB 3A0RB 4RTSA 2PAEA 4YOEA 4Y2CA 1V7CA 3NGXA 2XIQA 3D0IE 2E7XA 3JQ9C 5HJ5A 3VBFB 4Y2AA 1D5CA 3M6VA 2KA3A 4C2TA 3OA2A 2O57A 1D7OA 4B6QA 4CIVA 1E0JA 1S89A 5FO7B 4BKRA 4MLDA 3H1MA 2OC9A 1M2JA 5BWMA 1SOAA 3CT6A 4IJWA 4C11A 5LM3A 4TUYF 4META 2RT3A 3VHPA 5HRCA 5E3AA 1SO8A 1W0PA 4HFJA 2JGDB 3QLVC 2DF8A 3ZZUA 4DR3J 4N9IA 3NEYA 4L2IA 2WVGA 1U02A 1OQAA 5EWMA 1RADA 1W06A 2A1TR 2R5FA 1TQ8A 1AR81 2IHUA 4M22A 3T4UA 2EVZA 3HI9A 1H8ED 2HK3A 2OCKA 1GU3A 2QG6A 5JYEA 2YH0A 1TX4B 3K5PA 4YRLA 4P54A 4HH4A 1GKBA 2R042 4G01B 3CZ9A 3VKWA 4QPYA 4ZI7B 2IA0A 3ZU6A 4R51A 1Q83A 1XLTC 3WLPA 1P27B 3ZTRA 4DDTA 1B64A 2VSQA 1SJ4P 3IYLW 4D9NA 2G1MA 1CRPA 5L8RC 1W6NB 1TMKA 3S2FA 5D5QA 4WN9A 1UJ5A 2GGSA 3IKJA 3HUDA 4JBGA 5CQGA 4UVIA 5FK8A 3GRUA 1NPTO 5F9LA 2VBYA 5C2GA 4NCHA 1EUTA 1Z8DA 1W4AA 4NECA 3AGPA 3K92A 1C4KA 4INAA 1NZFA 1P4SA 5I9BA 4MGIR 4FK8A 3BAFA 2JLXA 4G4SO 4OJNA 5FO9B 5HQ3B 2QTCA 5B3KA 4YEAA 3F7NA 4DMCA 4GS5A 5EFZA 5AVKA 2R5WA 3DWGA 3MFQA 4DHEA 4PG6A 1YI2S 1V1RB 4HWKA 1J00A 3PL0A 3IBYA 2VH5R 1IJEB 4W4MA 4O4HB 4RE5A 5DYGA 4R5MA 1OLUB 1KI6A 4FCVA 1T05B 5FPSA 3MEPA 2EC5A 1ZA4A 1ZN9A 4H7HA 2FLKA 4LO5B 5GJCA 4EFAC 4JP1A 1ZTWA 4MQFB 1W8ZA 2F8MA 3S1TA 4AGVA 5K0BA 2ZABA 3BQNB 2OUHA 3ZV5A 3PT5A 3TIVA 3ZQ6A 5ISMA 4YRFA 4ASUD 3OFEA 1IBMF 4EY8A 3DEFA 1XL1A 3HR4A 3ZYPA 2F67A 4G26A 5IVKA 3QNUA 4KLAA 4DR5B 1WD3A 4M1TA 2CVIA 1YJBA 1WD4A 1XFDA 3RTGA 1XCMA 3M3DA 4DWVA 1HA3A 3RANA 3ZOIA 2I74A 2CVHA 1WKBA 3SM9A 1WKVA 1RZRA 4LY3A 1NYLA 2KKHA 3AFKA 2FPOA 1KFSA 1Q0ZA 2JBAA 1RUC2 1VBD3 3R41A 4FO9A 1HIXA 1ESEA 1YXWA 3I42A 1USIA 1YNSA 4R69A 1PKXA 2JJ8A 1ZTTA 1Z56C 2HO4A 4USUA 3SZUA 4U9UA 1VBFA 1Y6QA 3RMYA 2IZ1A 2K4MA 2YY1A 3BILA 1DEXA 4J3NA 5CMLA 5CISA 1H0RA 4C21A 4YP7A 1BXZA 3PIJA 4DR5J 4GKVA 5EJZB 2KZZA 1IS3A 1Z37A 4NROA 4OLHA 1Q95A 2YIMA 2JEMA 1XAIA 3F1LA 4GYYA 3CSUA 5ETMA 2Z1DA 2FUKA 2K1RB 4DLAA 5DJBA 4NWBA 5JNLA 5AJYA 3LC7O 4HAOA 4IFBA 1SHWB 1CFZA 1PHMA 2RV9A 3ETJA 1R8CA 4YW1A 5YASA 5HX7A 4GZ6A 4UBMA 1Y1LA 4O4JA 3NHPA 5B3JA 3VO1A 1S6YA 2XB8A 5EWMB 1RADB 3TLGA 2ZSJA 2WWTA 1LWOA 2LDYA 5T52A 1U0GA 1P7VA 5SICE 2C9AA 1WDDA 3QITA 1SURA 3M6AA 1PRYA 2P79A 1S2DA 4YQEA 3SFUA 4O4LF 1YJAA 4ZJQA 5EMMA 5G1PA 2CZ4A 4BASA 5KTQA 5H83A 2XYHA 4RF3A 4PU0A 3TXYA 4TYPA 2GDFA 1EHIA 2SNIE 3SLIA 3LWLA 1CX9B 2GFQA 3WLSA 4NLGA 2RJOA 5LQDA 2QD2A 2VJQA 2PRZA 2YXPX 1RBYA 4W98A 4ENVA 1V47A 1MPXA 2DBNA 2H59A 2WA2A 4QXAA 1UBRS 3SXPA 4MJKA 3R4DB 1RT6A 1M5OC 3FCUB 5IYZA 1WBDA 4KY3A 5DSXA 2Y0CA 1DRJA 3GV0A 4BMZA 5EUQB 1DIOB 1U5CA 1ULBA 1PWYE 3VV3A 3GBWA 2BSXA 3QFWA 2CJFA 1U8SA 3WT3A 1MHPA 4IV0A 1U98A 3KJHA 3ACFA 3EZ9A 2DBZA 3H3UA 3KTQA 2GNKA 4LDJA 1Q1ZA 2O0HA 3WRYA 1SCRA 3IQZA 4RK4A 4HDCA 1EXDA 2A7XA 2A10A 2ZAMA 1KI6B 2NT4A 2GM5A 2ZPTX 2CNNA 4RA0A 3CU5A 5K03A 4M8NE 1VL2A 3H2LA 4DIQA 3K46A 1NBHA 2W1BA 3CVOA 3BB5A 3NTUA 2YRXA 1Z2ZA 4LDNA 1JPUA 2V9PA 3OAAA 1MOPA 2KFZA 2INGX 2O3DA 4V1CA 2XJVA 2H9IA 1DGQA 2PJDA 2BGKA 5EJ2A 5J4YA 4QELA 2W6ID 3KSRA 4IRUB 3O6VA 5JUVA 5DSTA 1SJ1A 2YU2A 4QIHA 3MO4A 4GOKA 3FMIA 1NHKL 3DKPA 5EVJA 2Y2VA 1OSGA 4ECAA 2PI5A 5FBJA 3GLUA 4R9NA 4I0AA 5CW1A 4DINB 1ZRRA 3PMSA 3LGAA 1RUJ2 2ZVDA 2JBAB 3EICA 4G5OA 3AIKA 4BO6A 1XJ5A 3PR5B 4ZRNA 4MW0A 2V65A 3KKKA 4Z7QB 3C6TB 3ZXWA 4AD8A 3N76A 2BFUL 2R7UA 2DRIA 1HFEL 1GZCA 2R7LA 3QE4A 4D7TA 3H1WA 2ECQA 1Q20A 1CHDA 3LDGA 1EAYC 1OXVA 3FZYA 3KOZA 3AOEA 4A8YA 2VPIA 2OQVA 4Q0QA 2OIHA 3RKRA 1KMQA 3SCGA 4DNYA 3PXBA 4FYXA 1A1SA 4AO8A 1VJQA 9LDBA 3PHTA 5CEEA 1OXUA 4F9EA 1H8HA 3LSEA 1C8LA 4O4JB 2V72A 3K59A 1ZMXA 3EYZA 3TLGB 2YNIB 1JRLA 4JLUA 3EM1A 4I1YA 4X85A 3N8HA 1ULAA 1NUEA 3UQSA 2VNJA 3I2YX 5JWRA 2PD4A 4IZOA 1QFSA 3G6WA 3ZTTA 1APNA 3A1EA 2XNCA 3CE8A 4ZLPA 1RKUA 2XYHB 2Q0AA 2JA2A 2FMYA 4YZ5A 3HDQA 3F1KA 1XE7A 1SY7A 1BZYA 2VDRB 4KKVA 2XOMA 1U0HC 3WIDA 4Z1OA 3HT2A 2VA2A 1MB9A 4DBZA 1VQ6S 3ANSA 4L57A 5JZVA 4L3VA 4JB8A 3R2JA 3OT9A 5CEHA 2ERCA 1LBTA 1TEIA 1H3NA 3NLLA 2BWJA 3CXRA 3H9AA 1YQ5A 3HCNA 1JN0A 1SD5A 4G1QB 5IMBA 3MOJB 5GP1A 4XVCA 1K12A 1RT6B 5TVGA 3HG7A 4WIAA 3AJYA 5T5PA 4YUDA 3S5JA 4ITVA 3ETOA 2H4ZA 3I55S 1Q7TA 3THPA 1UU6A 4MMOA 4ECVA 3PDQA 5F3WB 1DBQA 1NB7A 2O1XA 3QLTA 4CTKA 2Q21A 4NHYA 4ES3A 4LBQA 2D7FA 2JD1A 4WASA 2XG3A 3IUEA 2F2TA 3I2JA 3WDMA 5L7TA 1ND3C 3AU8A 1XDGA 2BONA 1A72A 1ZOOA 5K9FA 5KVSA 5C33A 3FMBA 1QVAA 3JVIA 5FZFA 2GZOA 3T3MB 1X0FA 4I08A 2CNNB 4W5RA 4GC9A 4B7ZA 2GTPA 4I4LA 1E4OA 2GH1A 3QWUA 3QOFA 4WJKB 3LZDA 2J1SA 1A2BA 4J9LA 2GBIA 1RUG1 1YWGO 2AEJA 5LP1A 4EMDA 5EXSA 2R072 5I3QA 1Y43B 4FQ5A 1EIWA 1M2FA 2CLKB 3R2CJ 2I8LA 1IPFA 1SBFA 1LQ9A 3N9LA 5I4IA 2W98A 3O9VA 3L3CA 1GKUB 3EXEA 3LQCA 2FPLA 4ITCA 2B5VA 2CGEA 1OFSA 1KONA 4URHA 4IXMA 2X76A 4W92B 3DMRA 1JI6A 3TBHA 1RUI3 1YZQA 1R3DA 3U02A 1V6LA 3NRJA 3QTTA 3TGPA 3EB9A 2AUMA 1SFPA 1QKKA 4EZ6A 2R8BA 5AKZA 3ZW9A 3L2OB 3DU6A 4OREX 4N40A 2ZAAA 1X7XA 5TARA 1Q14A 3BRQA 1GQRA 5AM5A 1ZM1A 4K1ZA 1X6VA 3T5KA 2AVNA 3MS7A 2ABWA 1JQEA 2BVZA 1P9OA 3X2SA 3VOTA 3CBGA 3OJWA 5LBBA 5BYJA 2FHSA 3H6KA 2DR0A 3IB3A 2GJ9A 3BICA 1Y1SA 1J90A 1U2DA 3QU4A 1Z88A 5LZ2A 2MSWA 4RW9A 2QM0A 1GGMA 4FYXB 4CDGA 1VBMA 1SUFA 4UAVA 4IZIA 4PTZA 3ZD9A 1TYBE 5FADA 1HQLA 3M05A 3H65A 1TTTA 4AN0A 4P53A 1JYCA 1NA5A 1URRA 5GVSA 1J0EA 1COWD 1R4MA 3NNGA 1Z2AA 5HCIA 1N34B 2SBTA 1EDDA 3JZIA 4TLRA 5HG0A 5B6JA 2GCIA 2F8TA 3I23A 4NXNF 4CLSA 4E1AA 4AXJA 3K20A 2BM9A 2WF5A 3PYXA 4IE4A 2HWE1 1K5JA 4TLCA 5AP9A 2BBEA 3G2MA 4LIWA 4DV3F 1ZBE2 3QFFA 1RZUA 4JHZA 4KV9A 1NU4A 2I0FA 1ZJJA 3L7CA 4IEYA 4JB8B 4CQJA 1J4AA 2GPYA 1X1CA 3DM9B 1YB2A 3D8NA 4PCAA 3ZJVA 2FMFA 3I4HX 2VUAA 4LXQA 3K2YA 5CGQB 4MH8A 1JSRA 4R40A 4A6DA 2QPTA 4R7GA 1G64A 1Z5GA 3T6BA 1ST2A 1UZNA 1E3WA 1N34J 2B30A 4R7TA 3Q9SA 1EUUA 2A9KA 4NYJQ 3D54D 5K6RA 1Y9JA 3GZTB 1ZZ8A 3EQ7A 6ADHA 4Y9TA 2QJ3A 3MBKA 2D1RA 1P1TA 1U6JA 1AA1B 1T5BA 1XVLA 2D7CA 4EUFA 1Z5VA 4RUHA 2WWVD 1S96A 5HQMA 4UZFA 2VT6A 2D43A 2J5QA 1U31A 1JS1X 3WMRA 1YITS 2C5SA 2L9LA 4WGFA 3AL2A 5B7WA 4FYJA 2I66A 4YNBA 4EJ2A 4HDQB 2D5BA 1X8LA 3P9IA 5ILOA 4WLOA 1RIRA 4ZDKA 1PG2A 2Q5IA 2B8WA 4G23A 4E7PA 3PDUA 1AC5A 2XQFA 5ALZA 3HSJA 3MQ2A 5F4ZA 2D3SA 3BXPA 1TF2A 3RAPR 4FIDA 1HXS1 1MEOA 4QDXA 3EXEB 3I5XA 5CH3A 2XT6A 5KC8A 1R8HA 1ZGHA 5JSQA 1QJU1 4N0DA 2BFCB 2HQRA 2VBXA 4ZD6A 5KX5F 1Q53A 1YNOA 1M5KC 2BP7A 2GKOA 1GPYA 2JI6A 4ILRA 3JYHA 4YFWA 5DAWA 1EIZA 6ABPA 3AI3A 3RGBA 4DEXA 1SH3A 4EHFA 2XS5A 2I78A 4YQFA 1OWXA 2A1IA 1KWMA 3W2WB 1W5TA 3R5TA 2K3IA 3P8BB 1X7XB 1V3UA 2CQ1A 2APJA 1R6BX 5DPMA 4O2AF 3S3TA 4UFKA 1PYOB 5EYYA 3R0IA 5FLJA 3I5MA 1O5OA 4HGQA 4WZZA 3TFQA 4CM7A 2JW5A 2ZJ4A 1O1YA 4LTMA 1AKVA 1XVVA 2AKEA 3ZFEB 2HFKA 3FYTA 2RS11 2DCUA 3ROPA 1GARA 3OZFA 1EWVA 4RW9B 4LNHA 3PJWA 1FV3A 4C3MA 3E61A 4XACA 2KM2A 1I7PA 4AUMA 3BYPA 1OPZA 1DKQA 2WFAA 5E3QA 1JWLA 1JG1A 1R4MB 4ZP8A 2XOXA 4DQPA 1CR7A 3ML1A 5HCBA 3SBMA 2QPAA 3U5TA 2ZH6A 3UK2A 1P44A 2R7TA 3U44A 3GLRA 2LE0A 1QANA 3K17A 1HKUA 2VP6A 3EVEA 5KXBA 2K0GA 4U6NA 4W6WA 5F33A 4FDVA 2HPZA 1QU0A 3A6GA 3OPYI 3HR7A 2EYUA 4UF0A 1BDJA 1SWVA 2I6FA 4GKJB 3TKAA 2JZCA 3BYZA 5BMVF 3V2UA 1O8BA 3NJ8A 1G16A 1AR61 3AB4B 4MW1A 1Z0IA 1LZKA 1IY8A 1V5GA 3L8YA 3OTIA 1L5YA 4E5MA 4B40A 2P3YA 3U19A 2QRHA 3LXXA 1WU7A 1HSZA 2HBTA 4LJ9A 2JLEA 4KC0A 1H2UX 3D0HE 4ALJA 1SQFA 1S9EB 3W90A 3R6GA 2QRNA 4NI5A 5KPDA 3UJ7A 3MPPG 4AAPA 1D5WA 4Z4IA 3MLKA 3W7VA 3WK8A 5E7JA 3OMXA 1YFLA 3D67A 1E3WB 1FXRA 1VLMA 1ELOA 5FY0A 4G5FA 2GD0A 1VI2A 3O7WA 1O5JA 2YFYA 1VPWA 3D7NA 1N6QA 2W24A 1J59A 1G9CA 4UQGA 3FI9A 2VEDA 2WJAA 3NWPA 3DFIA 1AXRA 3ITQA 4GKJJ 1Z6QA 5EWSA 2JSXA 4XX0A 2KBFA 3ZHQA 3U39A 2FEOA 1NK8A 4J03A 2IYYA 3LB9A 4FFRA 1KC1A 2F55A 2WNSA 5AIBA 1G0NA 4F3RA 4WXOA 1TL1B 4MCIA 2PLV1 1NOVA 4M63A 1CP3A 5F77A 4IOKA 1F5SA 3VC1A 4JV4A 1C3HA 2PJRA 3RRKA 2OCPA 1YQWA 1HBNA 3DT8A 2FRDC 2WTAA 1OKQA 1WDLA 2CAJA 3I49A 1CYEA 3L6CA 3DUWA 1JQ3A 4F25A 5FLHA 3NGMA 1OWLA 4H54A 1X5PA 4W1QA 3M82A 1M8PA 3HXOA 2UYQA 3F49S 3E5RA 3R7WB 1Z35A 1C7RA 2JHAA 1USKA 2E0IA 3INRA 2PEZA 4FI9A 3MHPA 2PL1A 4DAEA 2BP7B 4RQTA 2CXSA 5IAJA 1U04A 3EQ8A 5DM7Q 2QGFA 2YC2A 2X5JO 2RD2A 4BNFA 3I01A 3TO8A 1MV8A 1ORHA 2ZJFA 2LRPA 1RLUA 1PW7A 4ZPXA 3RRNA 3MUZ1 5FIIA 5FZ7A 3C8DA 2O3SA 1TAHA 3C16C 1DAOA 1K73T 1G8FA 2DDUA 3ZUPA 3BGSA 2JFZA 4KQ6A 3UUFA 1C1CA 4ITRC 3V2IA 2ZPAA 2KBEA 1US3A 4P35A 4FFFA 3BXEA 4U8VA 4DX6A 5LP6A 1J5EB 3D1OA 4IJQA 3QKWA 2HWD2 2VBBA 3TW8A 3BR8A 3OFHA 3KLNA 4CLKA 2ZX4A 2CCKA 4BCUA 3IBTA 1SVMA 1U24A 2DCUB 4HAZA 5A71A 1E3LA 4DSTA 2OK7A 1BKZA 3EA4A 3TNJA 5CM2Z 2FJBB 3Q0IA 1KI3A 2I7TA 1F8GA 1VG0B 2R063 3L0CA 3S57A 4IIXA 1IBLB 2OWEA 5F2SA 1GZWA 3C14C 3VO2A 1ISHA 2F1KA 4BNTA 3MAAA 3ZNPA 3U44B 2P35A 4YP0A 1FLVA 3I9ZA 3AJ8A 3SYLA 2WE7A 2AN3A 2Z2JA 1FBTA 1VCHA 2HEGA 4NRUA 4UF0B 1YRYE 2JLWA 3D8SA 2WDBA 3WF4A 4JT8A 1J5EJ 4A8WA 1YUBA 3S5AA 1EINA 2O3QA 3UFXA 3VF0B 3H0KA 2EWHA 1G7YA 1JJHA 2RHQB 4RNOA 4LXHA 1HK7A 4PLVA 2H4YA 3R5JA 2GEFA 4FSXA 3S7TA 1Q0TA 3C3AA 1A4UA 4TTSA 1H1LA 1BSVA 2D3WA 4RZRA 4Q3KA 1XRSB 4Y8VA 2RHRA 1C1YA 3OCPA 3R6GB 3U4QA 2W01A 3SY8A 2J9YB 1BMTA 4KOAA 1WG5A 3AJ1A 4LZWA 3Q8LA 3HH8A 1YBFA 4KXMA 4JL8A 3U7FB 3J7A1 3DC7A 4NZMA 3R1LA 5IVYA 4EQVA 5EZ6B 1X4HA 3V00A 5KDOA 5CXUA 2WSLA 3T5HA 3AYCA 1SG0A 4LJSA 1S6QA 5BWCA 2BM8A 3C3EA 2GS8A 5FY9A 1WXFA 4LCBA 2Z57A 4XX0B 5K99A 4M9ZA 3TPZA 4MK4A 1WQ4A 1Z29A 3PEHA 1G86A 4BMSA 3K2QA 3LO3A 3V7FA 3AEXA 4G4IA 1PN3A 2IBOA 1CZOA 2C42A 3FMPB 3KK1A 3HO1A 4QUDA 4JYBA 3HVIA 2Y1CA 5C1OA 3VR2A 4RUBA 4XTCS 2OUGA 1WHTA 4CLWA 4MO3M 1HBNB 1GNKA 4B3DA 4CYMA 4EUVA 4OHMA 3G7NA 2DU0A 1Z28A 2ZYHA 4DDWA 4IP0A 3ZDRA 4DSIA 1UPXA 1CNEA 3P0HA 4BISA 5J37A 5IW8A 2KWIA 4COYA 3K30A 5BSEA 3C43A 3QXSA 2A8YA 3OPMA 2P3OA 4NUBA 1VC5A 4NKRA 1FCJA 5E1BA 2R6CA 1HFKA 4HZFA 1QF3A 1QJY3 3IWZA 2V69A 3TZYA 1J0XO 5AKXA 4L6V3 3LA3A 4MGKR 2IDEA 4B08A 5K6AC 4QPIA 5KG0A 5SYAA 4ZN1A 1EAH2 5FT9A 3KQTA 4GB33 5THQA 2DSNA 3GIDA 4LHSA 1CKEA 4XUPA 4DX7A 4LIUA 2FMIA 1OY8A 3OHSX 2CHFA 1EUDB 3L4SO 5KOJB 3OE4A 4I2PA 2GC8A 2ZE8A 4Z3OA 1HZZC 1Z4QA 3PR3A 4NU8X 1C1CB 3T3DA 1QM9A 4F2DA 1KYWA 5CKQA 3GROA 3ABQB 2EFGA 5LP6B 1E9FA 3ZH2A 3KZXA 4CMAA 4NR1A 1RYSA 3TW8B 3O94A 1RYBA 1SD2A 1VQLS 2EZ4A 4CM8A 4BTVA 2NU8B 5G0TA 5JCJD 1FSGA 1PYTA 1C0PA 1EZ4A 3RFCA 1WXQA 2FJXA 3TRGA 4ZODA 3ZZTA 3OPKA 1SELA 2XL7A 1GQQA 2Y93A 1K1QA 3ZSLA 5KB3A 2R16A 2IX9A 3JRWA 1Q77A 1L7LA 1GZWB 5DF1A 3MAAB 2OV3A 2QRKA 5F9MA 1BHJA 4TVOA 2WS93 1YFXA 4FEYA 3WG3A 3RLIA 5JTTA 1MZVA 3G8AA 2YR0A 2Z3ZA 2GZ3A 5LQMA 2JLZA 5BNNA 2Z3WA 4H1VA 1ULUA 1CY2A 4F06A 2JD0A 3GBSA 1EZZB 4ZDNA 4XA8A 4DABA 3FHJA 4BZPA 2VTFA 2V2ZA 4MGQA 4DCOA 1ISGA 2H4YB 1DDOA 3C24A 3CWJA 5C7GA 3A9UA 2H1WA 4A9AA 3GHYA 4YCSA 5LD2C 1H1LB 3IX7A 1WACA 1CF4A 2ODEA 4WBNF 2WSBA 3QFRA 1O0CA 2WWGA 4A0HA 3OZDA 3P5BP 1RRVA 3DHNA 3ENRA 5DN9A 2VNRA 5HLFA 2JBWA 3ES1A 1CSJA 2BKNA 4ID3A 1CUWA 3LP6A 1AUYA 3WGMA 4UBLA 5GVRA 3R7FA 2FB0A 2SKDA 1H4TA 3S1SA 1DEAA 5LUBA 1PVOA 3SHRA 4P31A 4MROA 2C0QA 4CDQC 3GTYX 1A0OA 3GFRA 3W5MA 1OMOA 3SYTA 1RU2A 2PTMA 3TUZC 1MHTA 1MAUA 1PWEA 2WWRA 1S6QB 1DLIA 4JP5A 3ZWYA 4H4EA 2VJAA 4BNWA 2GH8A 2WVCA 1I4DD 5DULA 4C91A 1RE0A 3O47A 3FLTA 4ZOAA 3W7BA 1LB1B 2A9FA 2A3YA 3H17A 3QVMA 4FDTA 3WGUA 3MXHP 3KK1B 1GL3A 1TU3A 1NF9A 4Q37A 4QYMA 4KVGA 1NJFA 4FKYA 2ZRPA 5JRJA 3IMKA 1WHTB 2FW0A 1FJ2A 4LN1A 1NI4A 3T7EA 4PW0A 4U0KA 1YIPA 2FP3A 2ZCJA 2VJXA 3LLUA 2HURA 1DFQA 4R52A 1TYDE 4ORFA 3CHYA 3NNAA 2DNPA 4B81A 2WSFC 2QDNA 1IKXA 3Q8RB 2PVCA 3DMHA 2X9VA 4IIGA 4RA9A 1HV0A 1VALA 2B1IA 4TLFA 1CLUA 3F5QA 4EBEA 5A33A 2XHEA 2A4KA 1LJUA 1IM5A 4DLNA 2B46X 4ZARA 2V4MA 3BL6A 1L3VA 4XOUA 2ZK7A 1P18A 4LBPA 3RR8A 1U6BA 2WRMA 1U2GA 2W2OA 3LPMA 3ZI0A 2VF5X 1L6IA 2V5YA 5BT9A 4UTRA 2E9TA 5KFNA 4QU2A 2VRWA 1ZZ7A 4QPIB 3A9WA 3CUSA 4K0KF 1X9PA 4KQWA 3H5VA 3HXPA 1SL2A 1CDOA 2B35A 2RQKA 3D3AA 2PRYA 4BNIA 4GRIA 4RXTA 1T5HX 1MO3A 4IKEA 3VGTA 4I2PB 2LEPA 2K3KA 3D4JA 1FP4A 4I4BA 2B1JA 3GM8A 4KQGA 4YXWA 3KJXA 4FB5A 3WDVA 2YV3A 4MQ5A 3Q41A 2OW4A 3ZCVA 4YQYA 2JG9A 1YR2A 4AQTA 4MX3A 4XFFA 3MIHA 3K53A 1Z4MA 2BE9B 3NHRA 3VH3A 3PUIA 3NP7A 4LRWA 4URGA 4OP2A 2W42A 3OTGA 5EX3A 3WMFA 3G9ZA 3LGXA 5I7VA 2Y4NA 1FLDA 4Q7LA 1ADBA 1MDBA 5HPYB 3GIWA 5LA6A 4DF3A 1AB6A 4UHEA 1LX7A 2YWKA 3MAJA 4BFZA 4V0OA 2DYKA 4UULA 2Q2VA 5IC5A 2IOFA 5D51S 4TMFA 1OXTA 3FTPA 2YJTD 3FF1A 3TTXA 5AXAA 1JHPA 3LGMA 5HRUA 2OZ6A 1PBNA 4FFMA 4X8HA 3JXEA 2HRYA 3COPA 4MVJG 3UATA 1TA0A 5EUBA 5BNNB 1HE4A 2QN8A 2VL1A 2QU8A 2HW8A 4COUA 1FDUA 2IU3A 1C5HA 1ZRDA 3OQ1A 4QOSA 3H1GA 1VKJA 3HB0A 4Q18A 3DCIA 4ZC8A 1E7YA 1A9XA 4L11A 3HCCA 1WA4A 4QQOA 4UFPA 1EDEA 1KR2A 3UC9A 5CVVA 4OX9F 2DHHA 1L4EA 3DE2X 4RTQA 2Q5FA 3WV6A 1LDYA 3SS9X 1V8FA 4X7PA 1O3TA 2B6HA 5HLFB 4LHKA 3GILA 4CCOA 4U7TB 3H1TA 3PMEA 9LDTA 1BEV1 3WYDA 1D2SA 1RU1A 5HCAA 4B9TA 1P7ZA 5AJZA 3WF2A 4HEA1 2JX9A 3ON5A 2O8CB 1CQWA 5H81A 2FHJD 4A2PA 2QQNA 4DOMA 4C9DA 3HLTA 2DBVO 1VXRA 2ZKNA 2A30A 1RLMA 2H0VA 4Q02A 4KHPB 5JARA 2QUIA 3AVSA 2WKKA 2HUNA 2GZ2A 1LSOA 1QY7A 2LIPA 3UXYA 4F38A 3KYCB 4CKZA 4D92A 1N5IA 3D2BA 4E4DX 1V41E 3A2MA 3R5SA 5A3MA 1S55A 4WZAE 3E18A 1H4HA 1UFVA 5FOVA 5C37A 3A2KA 1O6BA 2Q46A 2G40A 5M0TA 1N2CA 1O08A 4ZVTA 2A9RA 3IP5A 3AXDA 3SIRA 5IK5A 4CUGA 2PS3A 4JCOA 1NI4B 1DMRA 2GJFA 3HD8B 4AHXA 1K5MC 1H0KA 1JJBA 2XF2A 4ES2A 2X8WA 5JO0A 4TLDA 3EYPA 3G88A 4RSGA 3Q7IA 1M1NA 4L95C 2JLAA 1IKXB 4FKXA 4RA9B 2ICAA 4ED0A 3UJAA 2GYUA 4IIJA 3WW4A 1YS7A 2QMXA 2RJZA 2XNQA 2ZAYA 3NPAA 2A58A 3CJKB 1KDMA 3TJRA 3A7DA 2DTEA 4KHPJ 1BDHA 2FSUA 3SYZA 1YMQA 2F1JA 3TWZA 1UYPA 3CJ2A 2Q1XA 4JZKA 3M9MB 3GI1A 2DR5A 2WZBA 1UKRA 3SJCA 4KKOB 1DAGA 3JD0A 3KK0A 4OMDA 1J2RA 3CC7S 1AS0A 3VYSB 2GDJA 4L9WA 2JFVA 1YVRA 2VIHA 1L4KA 4GFDA 1Y10A 1AYM1 1ZITA 3ACGA 1WOMA 1MO5A 1JLKA 2DR8A 2J31A 3UH0A 2XWSA 3OLVA 3JBG2 3SI7A 3NVAA 4ARXA 3WP6A 2P3SA 4PQFA 5AE2A 4CQLA 3Q9LA 1YK1A 4AMGA 4XGRA 4HEHA 2PSJA 1LPAB 1E59A 3K1JA 1GPJA 1FP4B 4WESB 3OVAA 1JAHA 1KKUA 3V4IB 4RW4A 3EMBA 4F50A 4MK8A 4BUCA 2JG9B 2AW3A 2DUNA 3GUUA 4U7FA 4Z0TA 3KLHB 4LNAA 4YW5A 4XC9A 5ALUA 4WL0A 3BVCA 1PQYA 1ZKMA 4MEAA 3V48A 3PF8A 2IF0A 3I59A 5JSRA 4QBHA 1BQNB 1ZCAA 3HXQA 2I6SA 1T8SA 4AUNA 4PCLA 3WB2A 1EBUA 4N43A 1DOAA 3AEQA 3HEIA 2JLQA 5LA6B 1RUH3 1XJ0A 1E7WA 5ADVA 3DAYA 2XRZA 5ETVA 1QC5A 1HWLA 3LKDA 3N4MA 2J7MA 5KX5B 2IBKA 4LS3A 1U6ZA 5TDHA 2H48A 2WNVA 1W8DA 4YTEA 3RR7A 2P0AA 1QGUA 3BIOA 3KNZA 4R8LA 1RJJA 2G17A 4Y22A 1QOQB 2FV8A 3KCQA 1YU6A 4HVCA 3BFXA 5E4TA 3WSVA 2OZVA 4IRXA 3ZFGA 4MGYE 3SQOA 2Q8DA 4JKYA 1K6EA 2ALJA 3DZBA 4A8HA 3DKKA 2DX7A 4OZ1A 3B7WA 1KIFA 2WWIA 3OQBA 1H69A 3P26A 4LW8A 2OPPB 1N8KA 1CUBA 3ZCTA 2PTHA 1MIOA 2H0RA 1V4VA 3EVOA 5TJ9A 1A9XB 1JILA 3HA3A 4KIAA 2OGSA 2DIVA 1W96A 1LWEA 2X1HA 4E2XA 2UVQA 4QQBA 4XCBA 4LQ9A 4W9NC 4FFVA 2PAAA 5B7GA 2AF6A 1I24A 3A25A 1TMF3 4X84A 4AJJA 5DETA 4IQFA 1NYTA 1YDGA 2RGCA 1Y42X 4UMFA 1AHPA 3UPTA 4NDAA 2GIFA 2WB2A 2GUGA 2B45X 1VKNA 3EQ9A 3ZYZA 4ERNA 1YL5A 1JWAB 2BI4A 4TLEA 1VHQA 3DFFA 4FSHA 1VLZA 1T2FA 5FWXA 4A26A 3ZWKA 3D68A 3FGZA 4C29A 2VUJA 3RC7A 3AIIA 4K6GA 4NJ4A 4YEDA 1NIPA 3LAWA 3UH1A 3BKTA 2WF9A 3V1LA 5G02A 3TCNA 1OT3A 2JL9A 2IFWA 4RFSB 1HR0B 3RIHA 3PIPQ 2ETXA 2XWQA 4K4TA 1RUF3 5BN4B 4KDCA 4L0DA 3X1KA 3MM4A 5GOZA 4MIYA 4GYKA 1G9SA 3L18A 2ZIWB 3PQFA 1M1NB 1B1AA 2W4MA 4IIJB 1E2EA 1EVKA 3GLSA 4WHMA 2WNUC 2X4GA 1CJSA 2D9OA 3NIFB 5KZMB 2ONYA 1QR2A 4A0GA 1MX1A 2O5CA 3JQAD 1N2BA 3GD7A 3TW6A 3H19A 4AJ4A 1CQJA 5DAXA 2JH9A 2IY5B 2OJ3A 2C2ZA 2JKXA 1EFAA 2XMWA 2P3IA 3RRDA 4ZEXA 2B61A 3KQNA 2XKOA 1JHVA 5DAQA 3SVTA 2DB3A 1PL8A 2Z1MA 3QMPA 1HR0J 1FJEB 2WC2A 1CQXA 1KRHA 1JU4A 2VW0A 2IZOA 4B4KA 2K9ZA 1RCFA 3DO8A 1Y6GA 1P1RA 4CQLB 4LVOP 1JHZA 1N6RA 1VHLA 2XDYA 3BGIA 5DM2A 3RSGA 3OLAA 1L8XA 3EZ5A 1RLCL 3KKFA 1FRMA 3AQOA 2HD4A 1CUJA 3OFGA 3F3YA 1VGQA 4MXDA 1D6SA 3EIFA 4LHZA 2O8BA 3Q87B 2YKOA 3WMXA 1M5UA 3OEBA 3I59B 2ENWA 4B7UA 1IRXA 5KNCA 2O0JA 1Q50A 3CE6A 5KSPA 4JOBA 4N43B 3AEQB 4AI6A 2W11A 3KEMA 3FDIA 1QC5B 3LK6A 2J1TA 3LCMA 1RQGA 4LOAA 5HTOA 3KEQA 4JJGA 2KL8A 2H48B 3TWOA 2WNVB 1UVJA 1IBCA 1VMIA 1QGUB 1C9KA 1W93A 4JGYC 1J3QA 4K81B 1EVIA 4Y22B 3TLEA 3HSGA 1IZ8A 1ORWA 4P3OA 5SZIA 1VYAA 2JGJA 3UWDA 3MURP 4PQ9A 3CMGA 4A2WA 3I3EA 2VKZG 1U0RA 1LW6E 5EXXA 4RHXA 1N8NA 1OC4A 2R6AA 2PAMA 1PGL1 1MIOB 2JATA 3PX3A 3BHIA 3GFPA 4YM1A 2P65A 3P0EA 5ADWA 1XQVA 1XO1A 1SK8A 3IKLA 4IUGA 3HCPA 4FCWA 1LWEB 3K4HA 4HWTA 3D02A 2NAFA 4RW0A 2VOTA 2UU9B 3GLHE 5D8AC 3EUEA 5WRFA 4HEA6 4IDZA 3H40A 5EHZA 3OZWA 1ND2A 3FNIA 3HBKA 1KYVA 5BNQA 2YHJA 4LF8F 2R65A 3QKSA 4DL0C 4C04A 2N7CA 2AR9A 1N88A 3R23A 1LCIA 3EWAA 3P32A 2LXUA 3V42A 1OVSA 2FUG9 3RG6A 2UVRA 3VOSA 3TI0A 4Y30A 3MUVP 4KUGA 4C9BA 1KMHA 5DHRA 5FUWA 1QO0A 5E8RA 2FRXA 4MXVA 4P2SA 5KT5A 2QW1A 3NYQA 1BX1A 1PLKA 4R68A 5HI0A 3FZGA 2CPFA 1GQYA 1QUEA 2UU9J 3GP8A 4RAOA 4NAOA 3AZVA 4HT1T 4KV8A 5FO0A 3FCWA 4GO1A 4OQLA 2GRJA 3WNPA 1OIVA 1ZH5A 3PHMA 2JGDA 2PKYX 3LNTA 3KXDA 1YUMA 5I5GA 3LYHA 2W6OA 1Y1KE 3L0YA 4MI9A 4TV9A 4BO9A 3ZR6A 4W9MC 4U0JA 1SMVA 4PLPA 4Y7CA 5BW4A 1CQJB 2RH4A 4ET7A 4DZRA 2C2ZB 5ALMA 3DOCA 1ZJWA 4LRQA 3UW1A 3HYNA 4KIUA 5DXJA 2CLIB 3KOWA 2OEPA 4K28A 4PYLA 3J8F2 1H2KA 2HWUA 1PO21 1HNVB 2QB5A 2HWWA 1GNHA 5A5DA 1A7GE 4P00B 1Z15A 3WLQA 3I0RB 2ZJ3A 3IEMA 1WI8A 1TKCA 3T38A 4AP5A 4GX2A 4ND2A 4Z07A 4Q39A 2HZAA 2QT0A 4QXMA 4IYQA 4ZVKA 3QPIA 1JLCA 1GSLA 2WU1A 2DPYA 2CZVC 1XJQA 3H1AA 2YVLA 2DH9A 1QZUA 1G5RA 1THZA 2QUBA 3H8VA 3U3KA 1J97A 3BOSA 5IZ4A 2Y6VA 4EYEA 3JWPA 3FNGA 4TKLA 3ZVRA 4J1TC 2V6FA 4YMIA 1APBA 1EKSA 4K5RA 3MAGA 4PZ0A 2H8GA 4I6GA 2FLLA 1P5RA 2ZYUX 3GAAA 5EPOA 2ODNA 1H2LA 2P27A 5IAGA 1IBCB 1WBLA 4D3SA 1IJEA 4O4HA 4TXLA 4E2GA 2X5OA 1T05A 1JQGA 4RQPC 3QJGA 5CT9A 2FN8A 5CJJA 4EHDA 3PFIA 1LENA 3SC6A 1PVC2 10MHA 4NWWA 1XPJA 2D54A 2NXUA 3CMQA 1BO6A 5KHIA 4M3CF 1Q92A 2D69A 3QH6A 1C1BA 3JWJA 4DN0A 1RAIA 3UOGA 1XF9A 2AJ8A 2VSXA 2X86A