4OIIH

West nile virus ns1 in complex with neutralizing 22ns1 antibody fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
217
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKLRPGQGFEWIGDINPNNGGPSYNEKFKRKATLTVDTSSSTAYMQLSSLTSEDSAVYYCTIDDGYRFGYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Flavivirus NS1 assembly and antibody recognition.
pubmed doi rcsb
source organism West nile virus
molecule tags Viral protein/immune system
molecule keywords NON-STRUCTURAL PROTEIN NS1
total genus 41
structure length 217
sequence length 217
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oiiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oiiH02
5DEZA 1X4ZA 4JFQB 3L6FB 1QNZL 1OGAE 3ZLQC 4HZLA 4QHLA 3MLZL 5CJBA 4TUKH 4X6FB 1I7ZA 4JZJC 4X5XB 1KB9K 3BN3B 1NBVH 3MNZA 4POUB 5E6IB 4JLRB 3RVUC 3MMEB 1JGUL 5EULV 3TO2A 4P5TC 5DS8B 1UEMA 2X1PA 1P9MC 4V1DD 2F54B 1MCOH 4HUXB 4MJID 2DI9A 4PB0H 1Z9OA 3ARGD 2OJEA 4TPRH 4QNPE 2PXYC 3BT2L 4B50A 2DMBA 3NCEB 3GMMB 3ULSA 5LXGH 1RHHA 5C09A 3UDWC 4XPTL 4G8EA 2PKDA 2F74A 1A4JA 2CKBB 4IJ3C 1IRAY 3RQ3A 1DL7H 3GUTB 4ENEC 1JRHL 4CL7A 5IMKA 5TF1L 3BD3A 1J5OL 3EYUH 1SJEA 1T1XB 1CE6A 1I3GH 4LU5L 2Q6WB 1FBIH 3PXJA 1CQYA 1ZLVH 4YR6B 2VDLH 4U3XA 2X4PB 3UJIL 1IAIH 5ITBL 2DQJH 3CUPB 5TQ0L 5C0NC 3JWOC 4UTBH 1BEYL 3SJVE 1P7QA 4QGYA 4B41A 5I71B 4C83B 3BUTA 2WV3A 5ERWA 5J1AB 5E6ID 1N0XH 5JHDA 3BPNB 3C5ZB 4JREB 5CJQH 4RMSA 1EHLH 2I5YH 2ADIA 4QF1B 4QTIH 2ICWJ 1FGNL 2Y6SC 3FFCD 3GKWL 3V4UH 2XTJD 3SE8L 2DKUA 1D9KD 3RDTC 4FABH 1NUFA 1QHPA 3MJ6A 4ZMAT 1YEEL 4Z5RB 4M48L 2GUOA 4XP6H 2HTLD 1QQDB 2AEQH 3MV9B 2DQDH 1NUDA 4K3GA 4TTDD 3FCTA 1A9EA 3BX7C 3VWJD 1FNSH 4PJBF 4YE4L 3LMJH 3NCYS 2A9NL 2KQMA 4Z7OF 1ZT1B 4OM1H 3T77A 1GC1C 1N5YH 4PJBB 1NCDL 1A7OH 1I1AC 5C0DB 2IFFH 3E1F1 4TULL 2V7NA 4XXDB 1RUAH 1GHFH 3WHXA 2FCBA 4ZAKB 3VXRD 5EC1A 3SPVA 4XMLH 2PO6B 1JWSA 1P6AB 1QG3A 5DK3A 2AK4B 1NEZG 2DQJL 4GKZB 1GOFA 4HJ0D 4ACPA 3VMOA 3UTSB 5E0QA 5TE4H 5BO1H 5KZCD 3NIDE 1XH3B 3CFDA 5GJSH 3KJ4B 5L9DL 1FO0H 1MFCL 3GI9L 2UYLB 4JANB 4ZPTB 1A7RH 1RJZB 2R1XB 1IT9L 4Y4FA 2K7QA 4WJ5A 2YD4A 2DICA 1C5BH 3MFGB 3E3QC 4OV5B 4OIAA 3QDGD 4G6AC 3TO4A 2XWBA 3G04A 2PTUA 2CRIA 1CVSC 4PBXA 4TUOB 1U8KB 2AJVL 3TVMB 1INEL 3HUJF 4MAYB 3VXME 1QSZA 2X09A 3FOLB 3QJHB 5DZLA 3RAJH 3LN4A 3SDXA 4EUPG 4JAMA 1YNKL 3LPGA 4R96A 5DR5L 4L4JA 1CIDA 4E0RB 2Z4QA 3FO1A 3MYZA 5GGUB 1JTOA 1YY8B 3LRHA 1F58H 5GGTA 1NFDF 1JPSH 5T1KD 1F4XH 4D3CL 5J0BA 3DUUB 3HNSH 1VGKB 2OI9B 2RCSL 4KI5D 1A4KA 4Y5XA 1BZQK 4DFHA 1I4FA 3C9NA 4OZFG 5HI4D 2RR3A 1IAKB 3LIZH 4WIQA 3MLYH 5HGBB 2JK5B 3I6KB 3W0WE 1BM3H 3TIDA 1QFHA 1FORH 2FJHA 3GGWB 4KTDL 5MP6H 3X11A 3GJFH 5F71A 2EICA 4KJWC 2A9MH 1YJDH 5EORL 3PDOB 1MELA 1A7PH 5ENWA 3O6MH 4HIJB 4NQUA 2F5AH 1CLCA 1C5CH 1D5XB 1KC5L 1MFDL 3A67H 3FO0H 4G80B 3UJTL 1SJHA 4YGVA 3RDTB 4Q9RL 2XT1B 4CNIB 2AKRB 3VXRA 5C0FB 3BKMH 3A6CL 1FE8H 5DJYA 1FFNA 2DYPD 3MXVL 4BSJA 2X05A 4RFNB 5BS0B 4PJHE 4X8JA 2E7HA 4I3RH 5T1KB 1PG7H 2ZOLA 4P5MB 2YZ8A 5F1IA 1NGPH 1H0DB 2PETA 3U9UB 2DL2A 2VQ1A 4MA7L 5IG7B 2X70A 3VXMA 4S10A 5IEKB 3H9SA 1CXKA 2FEDD 1I7UB 3NFNA 5DI8B 5DQDH 4JN1L 1LO2L 2QR0A 3HNVH 4RIRB 5F44A 4YR6A 3NCYP 2OSLB 3EO9H 1G7LA 4NN7C 4LSVH 2XKNA 1AXIB 1MWAH 2UWEE 3GK8H 3D85A 5IB4B 4PRBB 2WZPD 3TO4D 3QXDB 1HYRC 1TMCB 1LEKA 3V5KA 2Q87A 4CAGA 1W72B 4QCIA 2MHAA 3AU1B 2BERA 1JGLL 5TH2B 1KSRA 4LPUA 2LVCA 5BQ7B 3MLUH 5C08E 3WIHL 3O9WA 3OXSA 1FZOA 4MA1C 1N3NA 3K46A 4UZGA 2D0HA 1QFWI 2QR0B 3EO9L 3HC4H 5IVOA 2HJLB 3TA3A 1ZMYA 4WHYG 4XNXH 5E00A 1VACB 1NMCC 2FZ3B 2XY2A 4D0CB 3MOBH 4NM4H 4JG0H 2GFBB 3NIFE 5AZEH 1MJ7L 1IGFL 4F33B 2NXYB 3O9WB 3MBEB 5L6YH 2R0KH 4JEGB 1FL6A 1ZHKB 1YYLH 5GS0D 1CICC 4ESKA 1NJ9B 2X89D 4JKPL 3WIIH 1FN4B 1IGJB 4L4TA 1ZGLM 2IANE 1T1YA 2VISA 5C07D 5CBEA 2FNBA 1FVEB 3H3PH 4R2GC 2VABA 1H3TA 1CLZH 1RFDL 3U0WL 4FQIH 1U91B 5IUSA 3BKML 4PJ8A 1HQ4A 5KOMC 2VITB 4L3EE 3RWDA 4Q9RH 1HKFA 1TVHB 4H8WC 3K4ZA 4P5KB 5DJ0B 1Y6MR 2BVQA 3VG9C 4TQEL 5EZIL 5E7BA 4MNGA 2H2SD 4XXCC 3T3MF 3LEXA 4NCC1 5EA0H 1WWAX 2A73B 4HFUL 1K2DB 2UWEA 4OT1L 3CLEL 1U36A 3IFLH 3U0TA 3HMXL 2IQ9L 2Y25A 3D2UB 4FRWA 2WUBH 2P8PB 4RGOH 4YDKL 4G6FD 3LVEA 1MNUL 2GK0A 1QZ1A 1FV1A 3Q5TA 4OZ4B 5EZIH 5A2LH 2CO7B 2QSVA 2V2WB 3RA7H 4HG4K 5C08A 3FO9A 1URLA 1CYGA 1VB9A 1UZ8B 3VFSA 1IL1A 3VXNB 2OK0H 2JB6A 2G2RA 1RMFL 4K7FA 3U83A 1T66C 4TUOA 3WEXB 4IMLA 4WCYH 3C60D 3AS0A 4UQ3B 3IJYB 3GBML 3H0TA 4OD3H 5IF0A 2FEDC 3P0VH 3K7UA 3QIWA 2ZSWB 5DD6B 3UPRB 1V5JA 4DEPC 1YECL 2HKHH 3MX0A 4MAYA 1UB5A 1HEZB 25C8L 2FGWH 3NPZB 2AXGA 1ZLSH 1KTDB 5IBTL 5KN5A 2PTTA 1O0VA 1FVDA 1OD9A 4PTUA 4D0BA 3TFKC 3RGVC 4BQ8A 5E2VL 5K9OB 1NCWL 1CGUA 2KDGA 5F3HB 4MNQA 4NQDD 2VTFA 4YHKL 1C1EH 2MFNA 3ULUF 3VXSA 4YBLC 3CXHK 4YDVA 4LLQB 2PO6A 1JZ6A 1WIOA 3VA2C 1E4KA 1EFQA 1MRCL 1JNHA 5TE4L 5E94A 3S97C 4XNQA 2Z93B 1TNNA 2DQHL 2DYPB 4MAYC 4H0GA 4OGXL 1NLBL 1HHHB 4YNYA 3QWOA 2VE6B 3G5VB 2NY2B 4P4KD 4JZNB 5E8NA 3QNYB 5D1ZB 5FGRA 4GUPA 2NW2A 4UQ2A 3D18A 4FG6C 4OCSH 1RUMH 3VXTB 3VFTA 1KUMA 2F8VA 3IXAB 5D7JC 1VHPA 1CL7L 1IAMA 4X98A 2R29L 2P5EB 1OSPH 1UKTA 1SJEB 4M6NH 1N5YL 5CEZE 4R7DB 3LV3A 4JFDD 1XH3A 4NYLA 3D6GA 2XNAB 2DLFL 1UM5L 5IF0B 2VKWA 3SDYL 2EDNA 2NQCA 4FQQB 3PV6A 3QEHB 4PJEA 4PJXE 3LMJL 4U1IA 3S4SG 3L7FB 3ZSTA 2WWKO 1A9BA 4Z76A 1A6VL 3PP4L 4AG4L 4WVRA 1UM6L 1DLHA 2ZCHH 4I18C 2Y1VA 5KANG 3BRGC 5FDWA 2BCKB 3A6CH 3RBGA 1I1YB 5HYSA 1U8MB 4KKBD 4WFGD 4P2RD 2A2QT 1B6DA 3DNKA 3KG5A 3MUY1 3ZHDA 5E08L 1I7TB 1E28B 3ZT7A 3DMMC 2WBJD 5I8CA 1PLGL 1J88A 3GSNB 2Z91B 1RULH 3K74B 4KVCL 3T2NH 4O2CB 2BVOB 4MAYD 2ITDB 1AR2A 3NPSB 3VXSE 3F7RA 5M95B 4MA8L 4Y8AA 4Y7MA 1ZE3C 4KTDH 5T33L 5EG6C 3O6FD 1KTRL 1BM3L 1U3JA 5E5UB 1Y6KR 2X1XR 5K93A 2D03H 1HZHL 3FCTB 2Q6WA 3V52H 4KI5C 5TQ0H 4HJGA 5D2LA 4ZOEA 4FFZL 3AFLA 1YMHA 3VI4E 2I24N 3GO1L 4N8VB 2C1OA 5F7DB 3BMWA 4RAUB 5KAQG 2VSCA 1OP9A 2E8YA 3TA3D 1QO3B 4LSSL 1MIML 3O0RL 5DEFB 5DJ6B 1QKZL 3GMMA 3MJ9L 3D0LB 4KDTC 1MJUL 2CK0H 1I7UA 1YC7A 5EBMB 2PUQT 5JHLH 1F3DJ 1YNLL 2BHYA 3HS0A 4JY4B 4M7LL 3VXSD 1MCOL 1S7RA 2EXWC 2R1WB 4FZEH 1V3LA 3RX5A 2XPGB 2VOTA 2DM4A 3O2WL 5FYJL 4KU1A 1I7ZB 4CUCA 1CGWA 3O11A 5GHWL 4QRPD 2AGJH 2CXKA 3HI6L 1NBYB 5C07A 2DQIL 2NX5A 1RZJH 5T3ZH 4OF5A 4U6VH 2YKLH 3VE0A 4M61A 2MPAH 2HRPL 4X4XA 4FZ8L 2VN7A 2G9HB 3VI3F 3KPSD 4NQCB 4FFWC 2A6KB 2DQFA 4NHUB 1NFKA 2V17H 3N85L 4N5UA 3MLSL 4Z7WB 1T03L 4TOYL 5GGQH 5IW1A 3ZE0F 1JZ3A 4EN3B 1BD2A 1R3KB 1NEUA 5DO2D 1DQJA 1X4YA 3ZT5A 4D9QD 5BVJA 1ITCA 4FQXD 1QR1A 4JFPB 4XWOC 3O2DH 4O58L 4RAHA 1GHFL 4DN4H 3GJFA 4U1KA 4HS3B 1DDHB 1MAJA 2J88H 1DQLL 5J57B 1MOEA 4PB9H 3DTXA 2ESVD 1MHCB 3QIBB 4WHTA 4BKLA 5L7XH 5E9DE 3JXAA 2EH8H 3WL9A 2YD7A 5BVJB 3OTTA 5EO9B 3V6OE 2NY7L 3QUYC 2A9NH 2X1OA 5M7QA 5F1NB 2X40A 5CAYB 1ZVSB 1KT2B 4ZQKB 1BZ7B 5I1KH 3L7EB 4M7JL 3RL1A 3G6DH 3GZKA 3KLAB 2OR9L 5IJVB 4WFED 3RX7A 3EYQC 4OQTL 4JZJB 3LZFL 3TIEB 3C6SB 3MJGX 4GRLA 2PCPA 5B38A 1T20B 4XP5L 2A77L 4QHMA 3ARDB 2I07A 4ZDHB 1KF9B 3ROLA 3QIBC 4Q9BA 1GYAA 4P2QD 4MJIB 2NYYC 1U8PB 4HUNB 5TDPB 3WXVH 5DD0H 2N4IA 5T1MB 4LPVA 3CC5B 4CN6A 1DLFH 4XMPL 5IW3A 1BEYH 4HC1A 2FD6L 5F8RC 1VERA 4ZS6D 3CH8A 1Q9WA 1CI5A 1DQJB 5FYLH 3EYUL 4WW2F 2R23B 3X3GL 2GY5A 1AGCA 4ZUVB 1BVKB 5B39B 3CDGA 3S9DB 4JFOA 4CVZA 4O02L 4QTHB 4WTXA 3ZKND 1XCTB 5J9PB 1UFUA 1XF3B 3ORJA 5I71C 1MCEA 4MXQC 1ACZA 4LDLB 1HCFX 1BHGA 1QRND 3F6IA 3HMWL 3SCMB 3S3PA 4ZFOA 4FQJH 1GPOL 4IRSB 5TFSH 2ZPKL 4TVSa 1N5AA 5F7LB 4B7LA 5HHQB 5I1DA 5FO7A 1U41A 4JGMA 2VLJB 4OQTH 4P99A 5CIPH 4UT6H 1XIWA 4FOMA 2OR9H 1J05B 4HWUA 1Z9SA 2GCYB 1MPAL 5EZOH 3T3PE 4CU6A 1QNZH 1MLCB 4S1SH 3S35H 1CDHA 2E7CA 2GEEA 2IQAA 3GMLA 3SN6N 4V1DE 4ZTOH 1FPTL 3RPKA 3IFPB 3SDAC 4DKEL 3W9DA 4KMTL 5DDHA 4ZXBB 4K3DH 4WFFE 4NN7B 3ZTJG 5I17B 3JWDH 3OAUH 4QT5B 1QPXA 4FTVE 2YN3A 1A9BB 2FX9L 3MV8B 2XN9E 2NX5D 4NRZA 2CMRH 1WWWX 4UV4L 3BIAX 3SDDD 3NA9L 4RNRB 1MLCA 2D2OA 3OF6D 2DJUA 4N8VA 1NGQH 1S7SB 4JM2A 5FHBH 1J05A 1OHQA 3KPNB 3HNTH 3UZEA 4S11A 4YK4B 2NY1B 5JPNA 4C56E 5GGQL 4TOYH 1VGEH 2W9LA 2P24B 1MVFA 4XH2A 4JO4H 1UGNA 3OKMA 1HSBB 2PYED 3OAUL 5I1IH 2ERJC 4QXUL 3VFNA 4LHQB 1TQCC 2HP4A 4KKCC 4Y88A 4L9LC 1M71A 5DURD 4ZODA 4LOUC 3QXAB 4D2NA 4FQ1H 4OQTA 3B2VH 1LK3H 2PYFB 3PWPE 3BHBA 1VFAB 5FF6A 2N56A 4M43H 3TN0C 5DRZB 4U1LB 4F15B 5C8JB 3O4LD 5D1XD 3ARBD 4KQ3H 5IWLC 2BRRL 2R69L 2VAAA 1MFBH 3O3BA 3O6LL 4MNHB 3VFNB 1IE5A 3ES6B 3GEWB 4MXVF 4PRNA 1NDMA 2ADFH 5D1QC 4FZEL 5DT1L 3K3QA 5ABDE 1DUZA 3U1SH 1C7TA 1YNLH 3KPTA 3QCTH 3ZE2E 4ELMF 3WKNA 5CP3H 1MIEH 5L2KB 1T3FB 1KIQA 4HAFA 4XHJD 4V1DA 2D31B 5ESAB 1T4KB 4JCLA 1T0MA 4JO3H 3BH9B 3MLXL 1KTDA 5GGVL 3ARBC 4WY7L 3VFTB 2CR3A 1OB1A 3WS6C 4PRHD 3B3IB 3LDBC 3BSZH 4NZRL 3KYMB 3EIFA 4KK6D 3REWB 2HVKB 5E1HB 3STZA 3RWHB 2ZCKL 4YFLI 4HIEB 4Z7WF 5GZOD 1RZFH 3I6GB 4F3FB 5IMOB 3F12A 2FJGB 3N9GL 1HHGA 3ZTNH 1HXYB 4ODTL 4IHOB 3EO1A 3QFJB 3WN5C 1MJ8H 32C2B 1J0HA 1X5LA 2MQ0A 3LHPH 3H3KA 5CSBA 3KPQB 4WO4C 2OZ4L 2R0LL 2VZ1A 3P9MB 3BP4B 1OTSD 2YK1L 1TIUA 3C2SA 4PRHE 1RSFA 4ODBD 4JDZB 1IZKA 3K1KC 1CXHA 3PWPA 1A1NB 5AD0A 3SBWC 3UYRL 4HX1A 3KPOA 3P0YH 1U3ZA 5DVLA 4ZD3L 5HHNB 1MEXL 3ZDYE 2AEPH 2ADJA 2EE9A 3SDAB 2BNUB 3O3EA 1W2KT 3QNXA 1HSAB 1XGPB 1A21A 3HI5H 3D0VA 4E5XB 3OKLB 4IMLB 5JQHC 1FVEA 2FEEI 2B1HH 1MI5D 2R29H 4K3JH 2NW3A 4QHUB 2D4DA 2WBJB 4K23L 4ONFH 1T80A 2JCCB 3IDNA 5GZOC 1LP9B 3O2DL 2OXGA 4O58H 2NLJA 5HGAA 4R2GB 1JZ4A 3ZYOA 4BK4A 1A6UL 5A1AA 4G9FB 2CDGA 4OF6A 3PWPB 4HWBH 5AD0B 4AT6B 2APTA 5IROC 5I1JL 5J11C 1C5DB 1U8NB 4RZCA 3QUKB 3RVVD 5E00B 1JPGA 4DZBA 4YDIL 5C9JB 1CFQA 5EO0A 2Q7YA 2V17L 4WWID 2PXYA 4OUUB 4U1SB 5GSRB 4YHLH 5EFIA 1CFNB 3B2UD 3TIEA 3GRWL 3EOBA 1YQVL 4JKLA 4M9OA 1LP9F 2FO4A 1T5WA 1DQDH 4IHOA 4X6CA 5D1QD 4J2XA 1VADA 5D70L 5INDB 5JORB 1TJIH 2FIKB 2Z31B 1JF1B 1NCWH 1FRGL 3FFDB 2C1OB 3BE1H 4LVNC 2C5DC 4MMXC 2XKNB 1NEZB 2XV6B 5HHVH 1KB5H 2X7LA 3WE6A 5D1ZD 4HJGB 3G6JB 3J7HA 4G43A 2XRAH 4PRHA 5DRNA 3Q2CA 4NO0D 1U92A 4MLIA 4BSVB 3RWFA 4KQ4L 2IPKB 4H1LB 5DK0A 1UXWA 5DO2C 2YPLE 2MQ3A 2ICWA 1HN1A 5F7YC 4KDWA 4GG6A 4LIQE 3SGEH 3ULVC 3KLHC 3PL6D 1JV5B 3MQIA 5HYJD 3DJ9A 4P2QE 3MRQB 3L9RB 5C9KA 1ORQB 5DUBA 3QFJA 2ZUYA 3OF6A 4RDQF 5E8PA 5FGCB 3RA7L 3J8F7 4J8RA 1NC4A 4UOJA 4XC1L 5I75C 2H9GB 2YD8A 2YN5A 2CLZB 4J4PA 4OZGF 1Q9LA 4L4VA 5KJRL 1RIVL 2ITCB 5SV4A 4M3JA 4PRPA 1TJGL 2H32B 4L8BA 3QO1A 4M93C 3TEUA 4MJIE 4MD0B 6CGTA 4ONFL 1ZEAL 1KJMA 4IS6B 1S5HA 4QRTB 1P4IL 1D6VH 1O7SA 3NZHL 3ARUA 1VKXA 2JE8A 4PIRF 4L3AA 3GSNA 3U30C 4KTEH 4LKCA 4N0YH 4LAQL 4O00A 3E6HA 3AM8A 3DHMA 4KGJA 4GLRI 5ESVA 5IEKA 5FA4B 4GS7B 3T04D 5EU5A 2EXYD 4TVPH 2IMNA 1QFUL 3BH8B 2A6DA 1A0QL 3VWKA 5JO5B 1YNTB 5EWIL 4E0RA 3VXMD 3IFPA 1CTNA 3QHZH 4P23D 4LLAA 3VFOB 4M1DH 3FAXA 3RFZC 3U2SA 5CD5C 3AS3A 2FR4B 3GSVA 3L5WA 3ZZ1A 4M6OL 5EZJB 4M6NL 4OFYD 4WUUE 1UKSA 2YPLA 5FECB 2GCYA 3EBAA 5GS2H 3ARTA 4EI5A 3S4SB 3EHBC 4YBHA 4ELMB 5FK9B 1EAPB 1KPVA 4PS4L 1JPTH 3G5XB 3V6FB 5D1ZA 1GAFL 4BSWA 1Q9KA 2VXTH 4WV1A 5GRUH 3IFNL 43C9B 1KYOJ 4RAVA 1CXEA 2WP3O 1WVZA 4OIIH 4X98B 3CU1A 4PUBH 2GSIB 4Q9QL 4M4RA 4UIKL 4NGHL 1HEZA 1MRCH 4OD1L 1XMWA 4H26A 1G7MB 3OQ3B 4IOFD 2NTFA 1QVOB 1XIWC 2WIIA 3IGAA 5H37G 1MWAL 1IGTB 5BXFB 3FHAA 5LBSH 3R8QA 4XTRC 3LKOA 4AIZA 1TFHA 3VGDA 3VXSB 1JVKA 2HJKB 4ODHL 1A7QL 1GOHA 3PWPD 2B7DT 4ZSOB 2VAJA 4NZJA 1UADC 3GIVB 1MFBL 1T5XB 4LQFH 3NVQA 5DA4A 2W60B 1CXFA 1CGTA 3S88L 2FGWL 2Y4SA 3SO3C 1RUQL 3BQUA 3DMMD 3EGSB 5J06A 1MI5B 2OJZH 3I9GL 5L2JB 1UVQB 2X9XA 5I8KL 5L8KB 1QSEB 3UTTE 5D2NE 4FQ1L 3FRPA 3D48R 5KS9E 3QNYA 2WW8A 4A6YA 5TDPA 4MXWH 4G43B 4HQQL 3U9PH 4KUZH 1ZT7A 1ZLUH 4WUUA 5CD3B 5INCA 35C8L 2P46B 1U8LA 1BFOA 4PJ7F 3LKPA 1X5XA 3FO9B 1QP1A 1MAML 4JFFB 2X4QB 4TNVF 3DGGB 2C3VB 2R0ZL 1KCRH 3QQ3B 3ARYA 4D94A 3T1FA 1B0WA 3MNVB 5KOVC 4RQQA 2EKSB 3NA9H 1VEOA 3ARGA 4S1RL 4XVTL 3RI5F 3CCHB 3RIAF 4QWWC 4TQEH 1I9JL 1RK0A 1T1ZB 5JLZB 3W39A 5IOPA 1AE6L 2QJDA 3RNKA 1G7MA 1F11B 2A74A 3FQNA 3KPRB 3ILPB 3K4AA 2V5MA 4K3DL 5LJYH 3LD8C 3KPLB 2FL5A 1AXSA 1NMCB 4HS3A 2FJFA 1YEGH 1SJXA 5IESL 3SQOL 2YXMA 3FL7A 2IJ0C 3U0WH 3RY5A 1S5HB 4OZIE 1RIUH 2P5ED 1K85A 2BNRB 3RU8L 3ZL4L 4F80A 3STLA 2IAND 4NC1E 4N8VG 4L8SB 4X7TA 4K7FB 1UZ6E 3QULB 1HQ4B 5J6HB 2ZUQC 3MLTB 4JO1L 3QXDA 5DHVA 1JL8A 1Z0MA 4NC0B 1S9YB 5L2KD 3RI5K 4JG0L 5F3BB 4TUJB 1NANI 3WLBB 1G6RB 3OR6B 1CGXA 1KPUA 5BS0E 3KPOB 4GLRH 2FB4L 3CIQA 2BOBA 1PYWA 4OZHA 4NQSA 5I9QB 4CJ0A 3QUXB 2D7PA 4M5YL 5GJSL 5C7XH 1ZHKA 3PGFL 5MEQA 3MV7B 4O02H 2FEEL 4OZFH 4MYWB 3S36X 3EYFB 7CGTA 5MHSE 3CFJA 1BGXL 4XWGL 4OLZH 4ZTPL 3MNWA 5EC2A 2G60H 3HI1B 3UO1L 4I48B 2XPGA 1BBDH 1PYWB 3U46A 1QBMH 4NJ9H 1RJCA 2GJJA 1SQ2N 5CCKH 3NCJL 2WMPA 1G6RA 3OR6A 4M62L 5GS0H 3W11C 3GUTA 1IAII 1RU9H 4POYA 2ZUSA 1B4JH 4HMDA 1I3RB 2KZWA 3DX6B 2VABB 3HNVL 3NABL 3AU1A 4G80A 1JPST 4AYFA 1FNEA 1GGIL 1TZIA 4AIOA 3S37X 3VE0B 4GQPH 1L7TL 3GMRB 3QDHA 5IV2A 3GM0A 1Q0YL 5ISZA 1D5BB 5EU4A 4ISVA 5FA3B 5GJTL 3LZFH 5BOPA 2E7LC 3WXWH 4PRIB 4APQC 3TH4T 1NAMH 4JFDA 3GFUA 3HR5B 2VQ1B 3UPAA 5GZND 5E8PB 3SE4A 4KRPB 2JELH 1U3YA 2NY4B 3ET9F 3FO2A 4NKMA 4Y16B 3BP7A 2AEQL 4KMQA 2JELL 3VA6A 2HFEA 4HULB 1F4WL 3CZFB 2CDGB 4JB9L 4R4NC 1NAML 3RBSA 2OL3A 4LVOB 4DTGL 4Q0XH 5GJTH 2WUCL 4LCYB 4Z7UE 3OSKA 4LMQE 4NQDE 1ZLVK 3KYKH 3SE8H 1TENA 3LB6D 4BA8A 5L7XL 3GKWH 3V4UL 1TVDA 3S36H 1RIHH 2QSQA 2MHAB 1D5XA 4YBLB 1G9EA 4MDIB 1QO3A 3TYFA 5MP6L 4EI5D 3FQXB 3MUZ1 2AKRA 4PREA 5JZ7C 1BQUA 4JHWH 4JRYB 5IB3B 3DOSA 4L29A 3SKJL 4LIQL 2YD2A 1PQZA 1G6VK 3MLYL 2CGRH 2P47B 1G0XA 1QBML 3KLSA 3V6OC 1QLEH 3D39D 1PSKL 1FJ1B 2VDLL 3DGCR 5EB9A 4QOKA 4P23C 1ACYH 1DUYA 3P2TA 1FBIL 3BPOB 3DRQA 3IU3B 1BIIA 2ADGA 1X6NA 3OAZH 4ZTPH 1XF5B 5I73C 4XWGH 2VL5B 3RWGA 4JRXB 4GG8B 5JPMB 4BFIA 5FUOL 4XZUA 5CHNA 4M5YH 1MCLA 4RQQB 3ILPA 3QXVA 1C5DA 2AK1H 2P8LB 5D8JL 1MCIA 1DE4B 1KJ2L 3LKQB 1IMHC 3D3VA 4GSDL 1T1ZA 3GSOB 3C09C 4KKLC 1JWMB 4Z7UF 2XKSA 5T1LD 1YEIH 4DGYL 5FDWB 1CR9H 4PJAA 1CE1L 4DEPB 2EO1A 5ITFA 3OKNB 3TLRA 2YEZA 3BIBX 1VSCA 4GKZA 5DSCB 1XR9A 4DKFH 2P42B 2IAMD 5EOTB 4PJEB 5DQJA 4ETQB 3WFEL 3GI8H 2VXQH 1G7HA 4R7NA 5HI4C 4ZO8A 1F6AA 5FHAH 5JHLL 3LKPB 4I8DA 5JR1L 4L3CB 4JJ5A 1C12B 1FO0L 2DRUA 5C0RL 3MJ9H 3TO4B 4LSSH 1C16A 1HHIA 1JPFB 1SVZA 4R7NB 1RZ7L 1ACYL 3CCHA 4KC3B 1UVQA 5HDBF 3GB7A 4LL9A 3ARGB 1IEBA 1VFOA 1ZANL 3FQRB 1X7QB 4G6MH 5HDQH 5JDSA 3V52L 3TESA 1N7ML 4GW1A 1XGTB 5C2BL 4FQCL 5GRVL 1I9IH 2D0GA 1J0IA 3RGVA 1HIML 3BI9X 3VFSB 1CD8A 2GQHA 4JVUA 4C59B 3TT1L 1HH9B 4N0CC 5IB2B 4JDTH 1YEJL 3BHBB 5FF6B 4KVCH 2R4SH 4JY6A 1A7OL 4BH7B 1PLGH 4HLZH 3A6BL 3IRZA 1IC7L 4PJDF 3BH8A 1F4YH 3KYKL 3RY6A 4QF1A 4PY8I 2XZAH 4LFHD 1FCGA 1Q1JH 2WUCH 3DIFB 4XZUB 4ZUTA 5TPWL 1IGIH 3QEQD 1UM4L 3IGAB 3U36A 3F62A 3PIQA 4MXWL 3CAFA 5CEZD 5KSBB 2IANA 1FVDB 3U82B 1A7NL 2J8UA 1KEMH 4PRDB 1IAOA 4UDUA 2UWEB 3UPCA 2JLLA 2H45A 1T7YA 1YEEH 4XX1G 4WGWB 5CJXA 5HPOA 4Y2DA 3IJSB 1JF6A 3OBAA 4FABL 3M8OL 1Q0YH 5CJOL 3RVVC 3CXDH 4GAJH 3KPRE 5E6YA 2D7MA 4N9OB 3UBXA 1TVHA 1DN0A 4X9IA 1NSNH 5GZNC 1M1SA 1FLTX 4HHAB 5F9WC 3VXNA 4PD4K 1B4JL 5BMFL 4ZPVA 3KR3L 2X4OA 2D7NA 3DVGB 1N0XL 1T04A 1U8IA 4LCYA 2X6MA 3VRJA 2NTFB 1H3PL 5DFVD 3H7BA 5CUSH 2J8OA 4C83A 4OGXH 1VACA 3JUZA 4MMZC 3CVHA 4ZNCD 3PQYE 1IKNC 4PJHF 3W11D 2BC4B 5DUPL 2WQRA 4GW5A 3DV4B 3QCVH 5J13C 1OP5H 1DL7L 3KYNA 5C7XL 4Q2ZB 1IILE 3LS4H 4BM7A 1FJ1A 4RRPA 5CEYB 3ARFB 5E9DD 8CGTA 2I60H 2XQBL 4QCIB 4HJ0C 1BLNB 4EEEA 1UT9A 2N1KA 4PG2A 3ZTJH 2OQJB 3RNQB 1TZGH 1S5IH 4JO1H 4NSKA 1A4JB 1IGCH 1KCUL 1MF2H 2YXFA 5BV7L 1NBVL 3QPXH 2UZYB 5KS9B 3LN5A 2W0KA 1ODAA 5HDLA 1PVHA 1FNAA 4HJJL 2O61B 4OKVB 3F7PC 3MCLL 3P0VL 4YEFA 4OD3L 1HINL 5IFJB 1BQHA 4LHUG 4EKXA 4PR5B 3B9KA 1EUTA 4CGTA 3CK0L 4OTXH 1RK0B 4Y4HD 1I8IA 2UVFA 4D0DA 2HTLC 1MJJA 2O61A 4ZS7H 3ZYJA 4WI4A 1F02I 3RDTA 1MFEL 3L95B 1U3HC 5ADPL 1A6WH 5DJ6A 4OT1H 3RHWK 1LEKB 3V5KB 1RJLB 2O93L 3MRGA 5JXAH 4KJPD 5C0CE 1U8QB 1NC4B 1T7VA 3UTOA 5DWUL 7FABH 4L8SA 4X7TB 4ZUUA 4GW4B 4X6CB 1FYHB 3QQNA 2SEBA 3UTSE 2CJUH 5C0GA 3NFNB 3X11B 4JVWA 5DFWH 5BV7C 3QH3B 2O26U 4O2CA 4PJXA 4HS6B 2Q8BH 5C0JB 2BJML 4GG6B 1DZBA 1XGUB 2MCPL 3BQUB 4I0CC 3QUXA 4QRRE 5BZDB 1DEEA 4KQ4H 2VIRA 4JKPH 1KENH 5GGUA 4BSVA 4LQFL 3S5LB 3H7BB 3K2MC 3FN0L 5TDOA 5IQ9B 3SGKC 1K9TA 4PJDA 5L6YL 2Q86A 2V2XA 3NACL 1A7QH 3C5SA 1NC2D 2AJXH 4NQDB 3QUML 4FP8H 2WINA 4P2QB 1EO7A 3JWOL 4YC2B 1CT8B 5BJTB 2XG5A 4CMHC 3K8MA 4PTTA 2DMKA 3WN5B 4B7IA 3H8NA 1OOAA 5F1KC 3V4PL 2J2ZA 1HOCB 1EEQA 2VZOA 4UDTA 5C0BA 4FXGB 4U1JB 1DCLA 1L7IL 3VI3E 3D87B 2NNAA 3SY0B 2FJHB 3GGWA 4I5BA 4JFZL 1RJZA 3OWEA 2AQ1A 3WDIA 1GC1H 2LU3A 4PG9A 4HV8A 2X1WL 5AG9A 4YFEA 2VR4A 4OZGE 43C9A 4YDLB 1A1NA 1LO3H 4J3SA 4L3CA 1DN2A 3O11B 2LABA 4WHTB 4BKLB 5DHYB 1JPTL 1BOYA 3V4VH 5H35A 3FQWB 4NPYB 1A22B 1EMTL 5FOBA 3MA7A 1ZK9A 4W6YB 3TO4C 2VLKD 3ARFC 5KVDL 1EUUA 5T3XL 2BRQA 4NUJB 5IHLB 2JJSC 4L8CB 3OGCA 1G7JA 5E2TH 4FQLL 4JZOB 4Y4FC 5F89A 2J8HA 2APBA 3P3YA 1BX2B 5HHXL 4MA7H 1WISA 3LB6C 3ZHLA 1HHGB 4JQIL 3EDKA 5EUOE 3VG0L 5ICZB 1M71B 5D7KE 1OAUH 4MD4A 2EE6A 4X9BA 3CFIC 3JTSA 1WWCA 3S3SA 3MV7E 2KPNA 3P0YL 2AEIT 5H2BB 5ECJE 5D5MA 2D31A 4CDGC 3OKMB 4PJ7E 3G6JF 2VRAA 2BP3A 3PHOA 4NRYB 4X8XA 1ZS8B 4M6AA 5JW4M 2LE9A 1C5CL 1MFDH 1MLBA 4AMKH 1NCCL 5E8OB 4EI5B 2HN7B 3H3BC 2IPUK 3R06B 5ETUB 3U7WL 3FRUB 5DHVH 3CLFL 3ESUF 3KLHD 1T0NA 3FFCE 3GSWB 4OV6F 5D7SH 5CFHA 3DXAD 5FDYA 1CGVA 3QZWA 1IM3B 1BD2E 1ZA6A 2VC2H 4KK6C 1INQA 3FKUS 5IB1B 2X5PA 4OB5H 1RD6A 3BN9C 1IM9D 1LWRA 3MV9A 4YQXH 1YMMB 4U6YA 4EI6A 1W8OA 5D72H 1ZLUK 1AY1L 1JN6A 4EVNB 4ZG1A 3RL2B 4IRJA 4RGNE 3KXFE 4MX7B 5JW3L 4HC1L 4HXAL 3QZWB 5E9DA 5D2LF 4OLWL 1NCUA 5D6DC 5DMKA 1DJSA 4H0IA 1FFPA 3R06A 2IGFH 5ETUA 1CFTA 5HYSG 2JJTA 4PGDB 3SKOB 4X6BB 2UUDH 2E6PA 1XGYH 4KV5E 1WEJH 3JV4B 3HHRB 3IU3A 2W0LA 5IV2B 5LQBH 5E9DB 3KPSA 4IEFB 3P40A 4WI2A 1H15B 4XPAH 3ZDZF 3FN0H 5EUOA 4MJ5A 2B8OT 1FFPB 5EPMA 1Q9LB 5CZVL 4HIHB 4Z0XA 4J3OC 1C5BL 5KW9L 2FIKA 1WFOA 3CPLB 5D70H 5DGRA 5E56A 4XP9L 2ITCA 1UA6L 4XNUH 2R2BB 3W5MA 4PJFA 1HXMA 1D9KA 4OCNC 4OSUH 1M7DB 2D7TH 1MCQA 5E8OA 3VWKD 1ZHBB 1P5VA 4WHDA 1LE9B 4MNQB 4JCMA 4NO2A 4AEHL 1OGAD 2GI7A 2YRLA 1HDMB 1J0YA 2AQ2A 4EOWH 4MGXA 4NQSB 4TRPL 1HYSD 4EDWL 1CG9A 4NWUL 3WNPA 1MCPL 4J3TA 2Q8AL 1T1WB 3EYVA 1J11A 5ACMA 4P49A 1D5ZA 1M4KA 3DX8B 5KSAD 4GRWB 1UYWH 3QIWD 1MHEB 3HC0B 4G3YL 2CLVB 2YRZA 3QIWB 4MJ6B 2OMBA 1X5YA 3DX6A 2BVEA 3B9DA 1NGXB 4RGMB 3OGCB 1JNLH 3O3EB 5ID0A 4UAOC 2OMNA 4FXKA 4ERSH 2YEZB 2YD6A 4ZO7A 5FOBB 1MEXH 1JHTB 3MCLH 5LWYH 1NGWA 4HWZA 5JIPA 3C6LD 1FV1B 2BXYA 1LK2A 1MCFA 1OSZA 1UJTA 1WBZB 1G7JB 1OAQL 5E2JA 1ZHNA 2IPUG 2PXYD 5T1MA 3MLVL 1AKJB 1YEFH 4KKAD 4UB0H 4XCFH 5HI5C 2XQYK 4FFYH 4UNVA 5AWNH 5MEQB 2EDDA 3ARBA 1RI8A 4XB8A 5HHOD 2UY7A 3WFZA 4Z7QE 1QBLL 1CFVL 3WNOA 3MZTA 3L3KB 1MJ8L 4F57L 1OSZB 1U95A 3H6JA 4PG9B 3STBA 5A40E 3RL1B 5J7CC 4ODTH 3GKZA 3ZTNL 2FX7H 5A16A 4ORGB 4JO2L 3SDAA 3B4NA 4DW2L 3QUXC 1KT2A 3IDXH 4Y16C 3BKYL 2F15A 1WZKA 5DUPH 3OKYA 3TNNB 5I1CL 2P1YA 3TN0A 2NZIA 5BJTA 3TBWA 2BOCB 3N1MC 2FWOA 3VGEA 2Y5TB 4DN3L 3NFSH 3C60B 5ILTL 3ZKXC 2EKJA 3P30L 1IC4L 4UU9A 3P9MA 2V2XB 4MJ2A 4RX4D 3V8OA 1T22B 3SKNA 1MQKL 5LXGL 3T65B 3FB6A 2BSED 5L2KA 5JXED 2FYYA 2BFVH 3CDCA 1T7XA 3VWJC 1MCDA 1REIA 4GJTB 3ARSA 3U1SL 3MLRL 4RBPK 1EVUA 1DVFD 1IM9B 3BVNA 4GAJL 3QPQC 1INDL 1RHFA 5IVXA 2P5EE 3OXSB 2NY5C 5JOFA 3HTLX 3I6GA 2DQFB 4NHUA 2JJTC 4FFYL 4OGYH 4M7LT 3LH2L 2E9BA 3NCCB 2X44D 4JHZA 1NGWB 4HWZB 1QYGL 2RHEA 4O2EA 1P1ZA 2F53E 4PBWD 3KPMA 4OF7A 5IMOA 1UH3A 4D9RD 1ED3B 4YEEA 5F7EH 2OQJA 5J8OA 3HN3A 1TTGA 4B53A 5J13B 1KNOB 3ULVD 3BDBA 3QQ9D 1KN2L 1Q9KB 4P2OA 1TXKA 4NN6C 4Q6IB 1MHCA 3QIBA 4LSUL 4M03A 3IETA 4PB9L 4LEOA 1FL6B 3BP4A 1QA9A 4JDTL 3MRRB 4I3SH 4F2MB 2EYSA 1ZTXH 5AG8A 4OLYL 5I16A 3BD4A 2DLGA 3C2AL 3T0BA 3L5WB 1TETH 3F7YB 2VERN 2WP3T 1CF8H 3C8DA 3E8UL 1T03H 2ZG2A 3HS0B 4EDXB 2HJKA 3L5HA 3AUVA 1ORSB 4PRAB 2CIIA 3VFGH 1RZ8A 4GXUM 3CFCL 1CD0A 2GYSA 5EC1B 1VCAA 3DLQR 1F5WA 4DKEH 2NY5L 2HAZA 4Z78A 1IKNA 9CGTA 5I19L 3WHE1 5B3JF 1E4WH 1EEZB 1MHEA 3HC0A 5T3XE 5C0DA 4HT1H 4WEBL 4DKAA 2GK2A 1QLRA 2OZ4A 3LH2H 1JK8A 2VLJA 4P9HL 3WCYA 1GGBL 1KJ2A 1JNJA 3MRNA 2CD0A 4BH8B 2I9TB 2DDQL 4LF3B 2FHBA 1V7MH 5I1LA 4HPYL 5IEHB 1AHWC 3BEWB 2ZNWA 4MVBC 4AQOA 1WEJL 3HMWH 4GSDH 1SMOA 2BFVL 4IDJL 3Q5OA 3VFMB 2BCKA 2ZOLB 2CK0L 4P5MA 3EW3B 2ATPB 1MJUH 5FKAA 5HYJA 5ILTH 4JPVL 3MV8A 2GTZB 2MSPA 4Z6AT 4L5FH 3G5ZA 1AC6A 3MYJA 2UV3A 3QDJB 4AH2A 3RTQA 3U6RA 4HWEH 2CQVA 2ZUXA 3GMPB 4L3EB 5I1CH 3BYYA 5F7FA 1KB5B 5F7MC 1XZ0A 1F8TL 5C6TH 3BP5B 4Y5VA 1CGYA 1ZA6B 3CVIH 4G8IA 3IDXL 4NQEE 3RY6C 1P7HL 1ZHLB 3QUYD 2LQRA 1GIGH 5D7LE 5LKNA 2DQTH 1IKFH 1PEWA 2IANB 1FL3A 4KJQD 5SX5K 2LFGA 4XAWH 2X9WA 4YZFE 4O2FA 4ZUTB 4DWHA 1CFVH 4RGNC 3AC0A 1LEGB 3BGMB 5ESQA 2YA0A 4CVUA 4WI7A 3CFDB 4RISL 5EIVA 4RA0C 2L0DA 1RZKC 2VDQL 1OF2B 1BPVA 1XR8A 3U4EA 4KI5F 3MR9A 5I2IB 1NMAH 2VXVL 4UUJB 5B38G 4XNMB 4QXGH 1F13A 3TM6A 5E4EB 4JG1L 1SY6A 4XMKH 2F54A 3O2VH 1FZKB 3GHBL 4CBPA 3VFWA 4GW1B 3P9LA 4HH9A 3TFKD 3RUGE 1IM3A 1BX2A 2R2EA 2Y72A 4JLRA 4N8CH 1HH9A 5IBLD 3SDYH 3L9RA 1U8NA 5F9JB 1KFAL 4TSCL 5C09D 4O4YL 4KUCF 1D6EB 4WWKB 3V5DB 4JRXA 3TVMD 1FFRA 5DVMA 5IVZA 2FWOB 2CXGA 2QQKL 2Y06H 4IM8A 1MCCA 5IFAH 1JPFA 2Q8AH 3WDJA 4RMUA 3NH7L 5DJ0A 4NFCA 3MJ7B 1P7QD 1JF1A 2D7QA 4KUCD 3OKNA 1AGFA 1CL7I 3OB0K 4P2RE 5IP4A 4ELKA 1AGBB 1VEPA 1SYVA 5I0ZA 2JB6B 4U3HA 1FN4A 1IGJA 2YKLL 4QHNB 1EERB 3LD8B 4C54A 1NMBH 1KPRA 2ADIB 2QQLH 3VRIB 5DJ8A 2H41A 1PKQE 4G7YH 4NDMB 1O5DT 1CFQB 5E2VH 4YHML 1B0RB 3AS2A 4H5SB 4HS6A 3FJTA 3W2DL 3TBSA 2E9WA 5C0GB 3DURB 4ZFOL 1I9EA 3PWUA 4PR5A 1JTTA 2ICEB 1U8OA 5TGBA 4OCYH 5CWSA 1T20A 2V9TA 4PLKD 3ARDC 1MREH 3OAYK 2XA8L 1U8HB 4FMFA 4MNGB 2BOCA 3QUZC 1IGML 3W82A 1JUFA 3DMMA 1YEGL 2YMXH 1BD2B 3H7LA 2IGFL 5IHUH 3VFUB 1QLFB 2AXFA 5SX5H 2A1WH 4LLVB 1TZHA 2H32A 3QAZB 4U49A 4XPBL 1FYTE 4U7KA 1MIMH 3O0RH 5I9QC 3ULUL 1BQLL 2IADB 5DJZB 1A3RL 2IH3A 3L3JB 3T8XA 3AAZB 3N1QC 1NBYA 4OZ4A 1ZT4A 3BH9A 2P4AB 3TNMB 4S2SB 5HBBA 2OSLA 2E7LA 3D5OF 4YDKH 1UCBH 4JPIA 3UJJH 4YQXL 4RFEB 5SWSB 1ORQA 5DUBB 2XZCH 4GXVH 2XTJB 5C08D 4QY8B 4LHUB 3P77A 3MREB 1N64L 4M6ML 3QH3A 4PJXB 4LSTH 3MO1B 2GKIA 1AKJA 4X7CC 2VLKB 3MLWL 4TSBL 1PZ5A 2V7HB 3C5ZD 3CUPA 5L88H 1JYWA 2Q3ZA 2R1WA 3U9PL 1HXYA 3LDBB 5I66B 5MHSD 3EOTH 5CLTA 4NT6B 4DFIA 2EYRB 1JNNL 5IR1B 2N7BA 1WITA 3FFDA 5IK3B 2ZCHL 2IMMA 1CLZL 4XPFL 2VXUH 3LQAL 4XRCB 3QULA 4MAUL 2ED8A 4MJ6A 1T2QL 1HSBA 4DUXA 4XH2B 3QZWG 3QPXL 4DOHE 4RAUA 5HDOA 4U6XA 1YC8A 4LCWA 2H2PD 3JVGA 1IGFH 2AV7A 4LVOC 3EAKA 4APQD 1MFNA 4LARL 2BC4A 1WCQA 4PP1C 1QBBA 1FP5A 2VXSH 5T1KA 1Z2KA 4G42B 4IOSD 4S1QH 2ORBH 4X8JB 5BZWB 3KYNB 3LS4L 3ROOA 2EYTB 3F65A 4PJ8C 5E8NB 1P84K 4XCEB 2Z92A 1J0KA 5GGSY 5GS1B 1JJUA 4F7PB 1LO3L 1N6QH 4P48A 3BQUD 1B2WL 2NZ9C 2WBJC 4QHUA 4H25A 4Q9QH 4N1EA 1HKLL 2OLDA 2IBZX 1AR1D 5DRWA 2OTUA 1JBJA 3PHSA 4WEMB 4NSKB 1CICA 3C5ZC 5F7DA 2X4OB 5GS0C 1CXIA 1RZIA 4WFGE 2Y36L 4PS4H 3L7FA 4PJ9D 1U6AL 3GBNH 4YHKH 3P4NA 1ZT7B 5H37H 5ENWB 4PGJA 3VFUA 3QUMH 4FP8L 3UC0H 2PR4H 5T3XD 3RZCD 3O9WC 3N50A 3CSBA 1JYNA 1WJ3A 5IT2L 5KVGL 3V79C 3D39E 3NIGE 4I3RL 1UB5B 2CUMA 4PJIE 2Z93A 3GMOB 1EBPA 2CRZA 4TVPL 5BS0A 4XXCA 2HKHL 4Y4HB 3WKML 2Q8BL 4Z7VF 4QRSA 4Y19E 5CZXC 3WS3B 4JZNA 4MB3A 3RVXD 4L1DA 5HPMA 2VE6A 3G5VA 1U8IB 2DLTA 1CBVL 4NZTH 1XT5A 5F88B 3TC9A 4LCWE 1S9VA 4YHPB 3TVMA 3I3EA 3A67L 4U1IB 1QRNE 4YO0A 2OS7A 2WWKT 3TWCL 3O6ML 3MSPA 2LVEA 3KJ6L 3QUZA 3QIUC 1NUGA 1EHAA 2A9ML 4LSTL 2HWZH 3V95A 3SOBH 4YXLL 1UZ6F 3HMXH 3RPIB 3WNMA 2R56L 3MRCB 2X4NB 1WTGT 1TTFA 5AUMA 1I9IL 3UJJL 1ZOXA 3LIZL 1UCBL 4M4PA 5FUCE 4PP2B 3WUWG 2HWZL 3B5GA 3O3AB 3UTTD 4K3HA 2RCSH 5D5MB 3BPCB 1GOGA 4JVPA 3ULVF 5L8LB 5CEXB 1NGZA 2YD5A 1H3UA 1EO8H 4LCIH 4G8IB 5FOJA 1KLUB 4KZDH 2X4NA 4GRLD 4K94C 4LCWD 4XPBH 3DO7B 4ZOBA 2A1WL 3ULUD 4LP5A 5F9JA 3IKKA 4JFDE 2WINB 5DR5H 4QHKJ 1G7HB 2DWDB 4HJJH 2OYPA 2K7PA 5F89B 1MREL 1Q9WB 1XR9B 5KSBE 4Y4KB 3MOAL 5C08B 3F7QA 4PBVC 4MD5A 1PW3A 3QUXD 2R0KL 1YEKH 1CD1A 4Y5VC 5SWSD 4EUPA 5K9QI 1SEBB 3W2DH 1RY7B 5AZEL 4J12A 3Q6GL 1CE1H 3UC0L 3I02B 4DGYH 5ERWB 2QL1A 1GXEA 1MAKA 4Y19A 4KRLB 4ZPTA 4UIMA 1AH1A 2I07B 5AYUH 4HXBH 2VUOA 3KVQA 3HC3H 3RVTD 1YQVH 3LEXB 5FXCH 2VITA 3S4SA 4LSPL 5ELIA 4OI8A 1HILB 3BXNA 4WDIA 1U8JA 5FECA 4HBCL 4XVUD 2YBRB 3MLUL 1BD2D 3ECBB 5GS1C 5BO1L 1W0WB 3SJVA 1P6FA 3SO3B 2YPKA 5E24E 1BZ9A 4P46C 3WJLC 5JIIA 3TBYA 5DJ2A 1WBYA 1P5UA 4LRIA 5I74B 5DSCA 3KGRA 1MHPH 4H25B 4X4ZA 2CKNA 3QEQB 3M1BB 4X6DF 4EBQH 3D85B 5IB4A 2M26A 4NT6A 2VLMD 5I1HL 1X5JA 3UTQB 1T1YB 4Y4HA 1WSST 3THMH 4HPOL 1NSNL 4Y16A 5E1AB 2GTWB 1NCDH 1TLKA 2X4SA 2P5WB 4PJAE 3HI5L 1X5KA 2OL3B 2MMXA 3B6SB 1EXUA 4OCLC 3VMPA 3QR2A 1H0DA 3L6FA 1N6VA 4LCWB 3WFDL 5B3NA 43CAA 4JB9H 1HI6A 4U1HB 2GIYA 3MACL 3TA3B 5DK0B 4L8BB 1M6OB 4LDEB 4XPFH 4N5ED 1TZIB 4UINH 1NANH 1AHWB 4HKZA 5A2FA 3TNMA 1MUJB 4QRTA 4PJIB 4PGCA 3RNQA 4JRYA 4OLUL 1ZA3B 1CTOA 4EXPX 1IJ9A 2VDRH 1FNEB 3OJVC 1F4YL 2NXZD 1UENA 2EDBA 5DJCA 2O5ZH 4YPJA 4RMQA 3SDDB 3S7GA 2NX5B 3IXTB 4HUVB 1PZ5B 3LSOB 5DMIH 3U0PB 1J9CT 1K3IA 3TT1H 2XKUA 3EFDH 2J6EA 3Q1SH 2XZCL 3V0VA 3DV4A 3A0OA 4GW5B 5I66A 1UJ3C 4ZUWA 3M17B 3GSRA 3QXUA 5F1IB 3G9VA 5HGBA 2C4FT 5DK2A 1N4XL 3MUGA 4JE4B 1JIBA 3HI1A 2FYYB 1I4FB 3FZUD 4P4KC 1NCTA 2VR5A 2FIRT 4X80L 3LQZB 3V7MA 1B0RA 4OUOA 5CEZL 3BSZL 5E7FA 1X9QA 2ARJA 2JCCA 1NAKH 5B8CB 4RFEA 4WY7H 2QQNL 3HG1E 3QISA 5SWSA 1WT5A 3PGFH 4BQCA 4HKBA 1G9NL 3QEHA 4M1GL 2DIJA 2V5TA 5D7LB 4FQQA 1Q94B 4N90E 2WBWB 3MBXH 4Z7OE 3QJHA 1RUPL 4PJEF 4X4YB 1OTSC 3WFEH 2B4CC 5D7KD 4OUUA 3VFRB 3PL6C 4ORGA 4Z77B 4ZSOE 1AXSB 1KV3A 2VYRE 1YN6A 3P9WB 2JIXD 5GGTL 1HI6B 4U1HA 2NY2D 4P4KB 2OR8A 3D18B 2GJZA 4K55A 3S34L 5C0CD 3GSNH 2DWEA 3GSUB 3T2QA 5DF0A 1RIUL 1EZVY 3ARRA 1OGTA 3EKCA 4HT1L 5D6CA 1LK3L 4HGKC 4NDMA 1E4WL 3LQMA 3QDJD 4JRYE 1D5IH 4K7PH 4Y19B 2BDNH 5IQ7L 2YUZA 3QQ3A 1T5XA 1J8KA 4JQXA 5JW4R 3MCG1 5EOCH 3TJHD 5LGJB 5J89A 3FQTB 3BZFB 4Y16D 2NY4D 2P8MA 3L3HA 3L1OL 1B9ZA 4HMEA 3BOVA 4S1RH 4XVTH 5ALCH 4GH7B 4JR9L 4P5TA 2MQCA 2LTQB 3RIFF 2VDOH 3ELAT 2CPCA 5MEPB 3V6ZA 5KANI 4OZFA 1QVOA 2KKQA 2WIIB 1W0WA 4RWYL 2IG2H 1DR9A 3IJSA 4UILH 3JWNC 1G9NC 4MA1B 1BFOB 4WUUB 5CD3A 1QSEA 3VWKC 5C3LD 1EEYA 3W9EB 1AD9A 1B90A 4YUEL 3O8XB 3HPJA 5IVXF 4S0SD 4F9PA 4MZ2A 4QNPF 2R8SL 3VGHA 3HG1A 4G6AD 4Q0XL 4GBXB 2KBGA 1SY6L 4KMTH 3TBSB 2ZSWA 5IVZB 4JPKL 4R4FH 3ILQD 4JKKA 5JW4Q 3ULVL 3TPKA 4NHCL 2E7BA 1W0VB 4PLNC 3QIBD 5I8KH 4JY4A 4HIXH 2LTQC 4WNQB 3VGAC 3ARWA 5GIRB 1MWAA 3UTZA 4R4BA 4DZ8A 2E27L 4PGBA 4ZSOA 3WXWL 1MVUA 5F7NC 5D7IB 3SPVB 4PGEA 1KLGB 3MTRA 1XR8B 1RPQA 4YDVB 1K6QL 3RJQB 5HHPB 1DBJL 5C92A 1BQSA 3BKJH 3KYMA 3FB7A 2YD3A 1FGNH 1U8LB 3CX5K 1GGIH 1Z9LA 5D1QA 4ODHH 4HPOH 1YMHB 3IDMA 2GSIA 1R5WB 5GS2D 3IU4H 4J4PC 3H42H 4CKVX 3R0NA 4QRQA 2RBLA 5JPMA 2ERJB 2F53B 4M62H 5FA4A 2UWEF 1IC4H 4OD2B 2BVQB 4F7EB 5JOEA 3BPLC 1J1XH 5ITBH 5D7IF 1AGDB 3VDAA 5JMRA 4NP4H 3RWCA 5FYLL 1T89C 2VZSA 4Y5VB 3O3DB 1G9ML 1NBZB 3MJ8B 4WHYH 4NKDB 4I0PC 4LASL 4K9EL 3JTTB 3K4DA 5GRUL 5IB3A 4DKDC 5MERA 1BGXH 3V7AG 3GSVB 2APFA 1R3JB 1KPVB 1NDMB 4JO2H 4G8EB 2W9DH 3CDYA 3KPRD 4FQXA 4XP1L 2R9HD 1X5ZA 1DQQA 1QQDA 3HRZB 2FB4H 3ARQA 1QSEE 4F57H 5I73B 2C9AA 2NY6B 1OF2A 4ZNEA 1T7WA 5D6DA 1R3JA 1OD7A 3MNZB 4M1DL 3MFFB 1FNHA 1B6UA 1EJOH 1S8DB 2EZ0C 3U48A 3PGCA 4JFFD 4TUKL 3AXLA 2W9EL 3RU8H 1I8LC 3X13B 2HN7A 1FYTB 1T1XA 5J11B 4KAQL 3QEUA 4ZFFB 1QA9B 2NXZB 3R4DA 5D1XC 4H88L 4LF3A 3OJDA 5I1LB 2W07A 4ERSL 5I30L 1YN6B 5FK9A 1JNLL 5FO8B 3LPFA 2A6IB 4N0YL 2HKFL 3VFGL 4WI9A 5J12B 1R5WA 2I9LA 3C08L 4FXLA 3LY6A 2R2CA 3H9HB 4P3CL 1E4XH 1NFIB 2JTDA 2NY6C 3I85A 5IR1A 4ENED 3O4OB 4MX7A 5C09B 5B39A 2GY7B 2N7AA 3QFDA 5BW7A 1ZTXL 3BW9A 4Z7QF 5A3ID 4Z7VB 4PPTA 4HZLB 5MEOB 4NPYA 2FZ3A 4LSUH 4P5TD 5GGSA 2EDWA 4E42A 2ATKB 4IOIA 4ZUWB 4N68A 4LPYA 5DRNB 4O9HH 4PRIA 3SGDI 2MPAL 4PRPD 5F3BA 2EE2A 4L9LB 5T3ZL 2DMCA 1A6ZB 5JTWA 4WTWA 2NNAB 2HT3D 3TPUA 4Z7NF 1WLHA 3EFFA 1EO5A 1BVKA 1UJ3A 5KSAB 4HK3J 4QXWA 4PJ7A 3C6LC 3WEXA 3LKRB 1R0AL 2V9RA 3T0EB 5IHZB 3CMOH 1YEDA 3L3IB 5B8CC 1IFHL 3BE1L 3GM8A 4NM8L 4R90L 4QYOB 2FJFB 1FDLH 1QLFA 2AXFB 3ARVA 5HHOE 1ZV5A 4I0PA 1U2CA 2CIKA 3C9NB 4X5XA 4L8CA 5EFIB 2AV1B 3OKDB 5CJ8A 5I16B 3IDYB 2FGZA 2BK8A 5IKCA 3MV9E 1I7RB 3ARBB 3WS6A 1B0GA 3Q5YA 3I75A 3FAWA 4X7DC 2ZJSH 4MCYA 1FLRH 2VLRE 3QUMA 5F9WB 1KPRB 3FB5A 2WWMC 4NGHH 3QWQB 4FFZH 1U8PA 4U7MA 4I0PB 3G6JA 2IFGA 2FRGP 2AJUL 3PWVB 4HUUA 4R9HA 5DD3L 1S9YA 4CNIA 5C0IB 4XT1C 3OKEA 3PHQA 1CXLA 4OFIA 3GJFK 1JYVA 3OG6B 3HG1D 1F6FB 4O2EB 4WUUD 2VZ3A 4K3JL 5HYEA 5CSZB 2R39A 3DHJA 4PY7A 4X4XB 1QBLH 2XI9A 3MBEC 5TQ2L 4GOSA 1L6XA 4LLDA 1CLOH 5EU6B 2BNUA 1JZ2A 4WDIB 1CLYH 4ODWA 4LOUD 5CGYD 1F2XK 1OARH 4G6KH 2X2YA 4L9LA 4YX2H 1JZ5A 3FMGH 4K71B 4IIQC 1A0QH 3UAJD 1H3VA 4LHJB 1T2QH 4HF5H 4XCYB 4ODUB 2VXUL 3LQAH 2VIRB 4F9PC 1NCNA 5ADOL 5LWYL 1OWWA 1FVCB 1CD1B 2VDPH 1FZJA 1ZLWH 1U3HA 5CZKA 2Q7NA 4PJFE 3P11H 1OARL 1CDCA 1D5MA 2CSPA 1SYSB 4M9PA 1YEDB 5HHXH 5IVNA 4PJFB 3LHPL 4UUJA 3NZHH 1D6VL 1OSPL 5TH2A 2GJ6D 3RWHA 1ZVYA 4M6MH 3FT4A 4NFBA 1S7QB 2VLJD 4U1GB 1LD9A 2HJFA 4K3EH 5I74C 1I75A 1FAKT 1EEUA 5I1AA 3L3DA 3RKDD 2DLIA 2DQHH 4J3WA 2Z35A 2FSEB 3S37H 1S7TB 2QEJA 4PP2A 5D7LD 3G6JE 2F58H 1N8ZA 5C07B 3G08A 1J1OH 1GZPB 4GAGH 3DSFL 5IHUL 3QI9B 1CFSB 1FIGL 3O9WD 2XY1A 5IMMB 5IGXL 5F9OL 4NJAL 1DBBL 2XA8H 3G9AB 1ZHBA 1EAJA 1KXTB 3C8KA 4BZYA 5FEBA 3LS5L 5I8EA 2ZOKB 3SEPA 5IBUG 2QV2A 4NCDA 5A2KH 1AC0A 3D0LA 3V8CA 1IGTA 5GRXG 5BXFA 1BECA 1CGSH 3G5ZB 3MYJB 3MRLB 2G75A 2HFGH 3WS3A 3MRDB 3GMLB 2NY0D 1OP5K 2MCPH 1PFCA 1G7PB 1NMBL 2QQLL 3H9HA 3O41B 1AI1H 3H9SD 4PJGE 1T1WA 3T77B 2CJUL 3BP6B 4LRNL 3ZYZA 3TIDB 3KPNA 5DMGC 1ZS8A 3F7VB 4BQ6A 5I8CB 3ZT6A 1OAZL 3PGCB 3LKSA 4OI9A 4PJ8D 1I7TA 5D96B 5C71A 4N0FB 5DHXB 5K59F 1SM3H 43CAB 4KROB 5TE7L 2CKBL 2YOCA 3DVIA 1EHXA 4P59L 5J3HC 3U7YL 3FT2A 1NPUA 1JMZA 3KPPA 3QIUB 4P2OD 5F96H 1MNUH 5D72L 2KH2B 4WU7B 4HWBL 2IQ9H 1HH6B 4X7SL 4MD4B 1XF2A 3DECA 4U6YB 4HEPG 2H8PA 5DUMH 1JNHB 2BSRB 1L0YA 1V8HA 3IF1A 4N1CA 4UV7L 4YC2C 4Z78B 2GW5A 4BK5A 4YXHH 4ZS7L 4OLXL 5L2KE 1IQDB 4R97C 3U7WH 5BS0D 4PJ9C 2HTKD 2FX9H 3GSQA 2ENSA 1NCCH 3JTTA 3L5IA 1F00I 3KNBA 3GMNB 4FQHB 2JF1A 3U30B 3RWEA 4F2MA 1MLBB 1UCTA 2L7UA 1N5AB 1YQ2A 4FQIL 4LEXL 1T0NB 4KI5E 2EXWD 4YDLC 4ONHB 4QXGL 5EZOL 4YPGA 2OTWA 2YSSB 2PO6C 1S7VB 2IAMC 1I9RH 3HPJB 5JOPD 4N0UB 3W9EA 4F7EA 3FRPG 3L3GB 1C12A 3GMQB 3OAYH 2DLEA 1JE6A 2XYCA 4DK6A 3IDGA 3U36B 3V7AE 3PNWB 2VDNL 3RZCA 4LPTA 4X0KB 4QT5A 3HAEA 4K7PX 1QSFE 2X4UB 1EK3A 3T4AB 2XQBH 1VFBB 1KACB 5GIRA 5DDHB 4ZXBA 1IL1B 3Q6FA 1CZ8H 5GSRA 3CFEA 3TH3T 1U3HB 4POZD 4FNLH 5SWZB 5TE6L 3MMEA 2FBOJ 4A2LA 5C6TL 4LASH 1MWAB 3HKFA 5JMOC 1RVFL 1XGTA 3LKNB 4Z7VE 2GITA 1L9NA 5DURB 1JWUA 2ZJSL 4C55A 4L5FL 3WNKA 1UXSB 1JGEB 4JPVH 3MROA 4PLKC 3PE9A 3U4BL 5KTEL 4U1KB 4LLUA 2AI0H 3H2WA 1A3LH 3B43A 4LSRL 4O5LH 3PWJA 4HMCA 4JHAH 3Q3GA 1BREA 4NWTH 3H0TB 1KNOA 4QRQB 3O8XA 1KTKE 3KDMA 1FDLL 4PV9B 5KVMC 1A9EB 2EH7L 2HVJA 4NM8H 4R90H 1EV2E 3RZWA 1J18A 4XP5H 1UACH 4X4YA 4F58L 1FNGB 2VLJE 5F1NA 3EJZD 3O6LH 3ZKQD 2G9HA 1R3HA 1I3UA 2IEPA 4MQ7B 2Z8WC 4YO0B 1YEHL 5C0AE 3HZYA 2AABH 2UZIL 4ONGH 4P23A 2Y9RT 3B5TA 1A6ZA 3QHTC 4LPCA 3HPLB 2AJSH 3HR6A 3MA7B 3B2VL 1RZKL 3GHEL 1JHLH 4L4TE 3D3VD 2H3NB 3KS0H 1OGTB 3T3PF 3CC5A 2XN9A 1ZGLA 4F37K 3OPZL 5SWZD 5DEGA 3V0AC 5HGHB 5HYJE 2PF6A 1U3HD 5K9KA 5EOQH 5K33A 3MV8E 5CLWA 3O6FC 4RGNB 4I1NB 3CD4A 4MCYB 3ARDA 4JO4L 2YZ1A 3IDNB 3MRJB 1OAXH 1CF8L 3E8UH 3V0VB 5ANMA 2AXHA 1ETZA 2J88L 2NR6D 2VLRD 2CIKB 1QHOA 5FGBA 1YDPB 5ISZB 1BOGA 1FORL 4NQEA 4F7MB 3TT3H 4XP4L 5HJ3A 5E4EC 3ZDZE 3AGVA 1MFEH 5I76A 1BBJB 2D9QB 1MCWW 3S5LG 5FO9B 3RWIA 1Z0NA 1YPZA 3V5HA 3NCFB 1KEGH 3DX8A 1DBAL 3L1OH 2R0WH 1J10A 4HS8L 2ILLA 2HKFH 3C09B 4HKBB 3WLWC 1G0DA 4U33A 3TO2B 1H3XA 1KIQB 5DLMH 5TJWK 1NFDE 3VJ6A 3PF2A 3BRDA 4F7PA 2QADD 2O5XL 2WIMA 5D6CB 1QFWL 3NMEA 4JM4L 2ARWA 1G6RL 2AV1A 4OBRA 2VXQL 4UT9H 4M00A 4MB5A 4GW4A 1BQHB 2BNQE 1TZGL 3HR5A 5TFSL 1KJ3H 3BESR 1GPOH 2HT3C 1R5IB 3BPOC 4I18B 3V0WH 2G5RA 1CQKA 2EEAA 3CVHH 1RUPH 3L3JA 4HIEA 1OTUD 2DQGL 3WNNA 1HHJB 3NTCH 4IBLT 4YHYB 1U58A 3OMZA 1Z3GL 3OX8A 1LO0L 2WQ8A 4LKXB 4LVHB 1MRDL 4I77H 4NQTA 2QSCH 4KKBC 4PJCF 3SHSA 1YA5A 4R8WH 2R1YA 5FUOH 2XWTA 2VDMH 1KULA 1NAKL 4JFED 1XCQA 1GGCL 3H9SB 1D5ZB 5JPNB 1S7XB 4WO4D 5EPMB 1ZLWK 2OI9C 2Y7QB 3E6FB 4LLWB 4QRRD 5AAWA 1A14H 3CVHB 3EOYG 3PWUB 4Y1AA 2V7HA 3HZKB 5JOPE 5DK2B 3UBXI 1BQHG 3PP3K 4P2RA 3VFPB 3SKJH 5T33H 4JHWL 3QEGL 4LLMB 2ESVE 2G75B 1FFNB 5DD0L 5DMGD 1MCRA 4KWUA 4KY1L 2HG5A 3WXVL 4U2ZA 1JRHI 1NDGB 3QQ4A 4NUGL 5F6HI 4QHNA 4G6FB 1L6ZA 3F8UB 3W9DB 4JFXA 2EDQA 4L8DB 4QKXB 5I15L 4UT7H 5DEFA 2H6PA 2C3VA 2YWZA 2BY0A 1YUHB 5D7IA 2LU4A 4DTGH 1NFDA 3QEQA 1NAMB 1YEFL 4YE4H 1M05B 3ARGC 3L3OB 5F6HJ 1LE5A 1A7NH 4YZFF 4MQXC 2XTJC 4PJEE 1BFTA 2BVPA 4NQED 4HUWB 4UQ2B 1HE7A 4BH8A 2I9TA 2GT9B 1AIFA 1HILA 4Y2DD 4GAYB 5A3IC 3PIQB 4ZFZA 4POZC 2NCMA 5ALBH 4JJ5B 1G7PA 4QTIL 1CL7H 4PFEA 2Z4QB 3FO1B 4GKSA 5GXBB 4R96B 5HVFB 1XIWD 4OCSL 3QEGH 2OX5A 4NBZB 2RAMA 4TN9A 4UQ3A 2R2EB 3NCJH 3MJ9A 4W4OA 5I18L 3QQ9C 4IRZH 1MHPL 2C4XA 1D5MB 4WNQA 3I6LD 3PUCA 5JDSB 4LU5H 3HAEB 4PJAB 5DMJB 3N85H 1Y0LA 3MRKA 4A6YH 1MVUB 5TF1H 2X4QA 3ETBF 4OLZL 4PGBB 3GSWA 3QCUL 4HBCH 5FYKL 3INUH 4HKXB 4NC1C 2AVGA 5IQ7H 4QWWD 3F58H 2QSCL 3MUJA 4X5LA 3WIFB 1Z3GH 3K1DA 4QHMB 4U6VL 1AP2B 5J4MA 3QA3B 1UB6B 4MHHI 4AK1A 4ONHA 1S7TA 4ODWB 4LMQI 1BIHA 4PJ9A 3HG1B 5DD6A 2AGJL 5CZVH 4BUHA 5IB5B 3ALXA 2OR7A 2FATL 3TA3C 5T1DL 2IBGA 1XF3A 5IBTH 1AQKL 2R9HC 4XNQB 3S6CA 1LEIB 2FHFA 1OCWH 3MRIA 4J3VA 3KWWB 1PX3A 4NO5A 2R23A 4WFFD 1VPOL 1DTUA 2VJXA 1A8JH 5D1ZC 4M1GH 5DRXB 4YHYC 2EDTA 5IVXB 4R0LA 3QG7H 2NX5E 5HGDB 4KZDL 2R4RH 1EO8L 3PQYB 4EI5C 1X5AA 2GK0B 3C6LB 4GKSB 1T83C 1J12A 1KIPA 2ADGB 4OF3A 1QLEL 3BP7B 5SWQB 3DRQB 2E3VA 3JV6B 3BQUC 2L4OA 1PG7W 3E6HB 5CP3A 4GFTB 3E3QE 1OP3H 1ND0B 4U3CA 3BP6A 4P3WA 2VC2L 4JFDB 2CDFA 1FC2D 2W1NA 1S7XA 1QFOA 5DMIL 2PYEE 3SOBL 5DC0A 1CVRA 3T2NL 3PGDB 2JCCF 1OAXL 2O5ZL 4QOKD 5HYQA 3S36L 1F90L 3RWDB 3VFRA 1FGVL 3HLAB 4ODVH 1HWHB 1CWVA 4PJ5A 5CBAA 1CBVH 1MJJB 3V9FA 1C08A 4DJMA 5BRZB 4FFVC 5GGRY 4GQ9H 4JFXB 2OJZL 3L95A 4G42A 4JFFE 2EIEA 3MACH 1AGEB 3VFMA 3WFDH 3OKKB 2DLFH 4XCEA 3VXUB 4P4RB 2A0LD 3EYFA 4EJ1C 3ESVF 1G7IB 2BVYA 4NM4L 5C6PB 4XPHH 1Q38A 2EH7H 3SGDH 5BQ7A 5IFJA 3EYOA 3GBNL 4KROD 4E9LA 4NFDA 1RUML 4QGTA 4WO4A 2QHRL 4J1UB 4PJ8B 2A6JA 1ZA3A 3RTQC 3M1BA 4PJCB 2I9LB 1TQBC 1LD9B 4PJBE 3K81A 1WIUA 1EEZA 4Y1AD 4KK8C 1BBJA 5DJ2B 5DGQA 3RGVD 3DI2B 4HIIB 1HKLH 4L4VB 4OIIL 5JXEC 2NY0B 3EJZC 4DQOH 4J1UA 3B6SA 1ADQH 3MREA 1A6PA 1XGQA 2QHRH 5AYUL 4AZ8A 3WJJC 3JWOH 1MFAH 2VLKA 1AO7D 3MNWB 1A4KB 1LE9A 1ZGLB 1T66D 4LAJH 4XGZB 1ZXQA 2R15A 4RMWA 5E03A 3C60A 4YBQD 2F5BL 3I84A 4JDVB 4H1LH 4UTAH 2X4RB 25C8H 3TBYB 2E5EA 2YUXA 3D0VB 3RVUD 2BY1A 4TUJA 4JFFA 4NQVB 2VZUA 3D39B 3LV3B 1U8HA 3BZ4B 4TSAH 4MCZA 1MHHA 5C0IA 5I76B 3NBNA 3FZUC 3KDMB 3QDJE 4JRYD 4N90D 5EO1A 1OTTC 4G5ZL 5I1EH 1AE6H 1G7IA 4U1NA 5DJXA 5DWUH 7FABL 2BSSB 1WZ1L 4ZUSA 1BAFH 3IS1X 4BFGA 4RGOL 4UV7H 5EBLA 1TVBB 5HTSA 4HDIB 1I7RA 4UMGA 1TJGH 1KCRL 3JBG7 5T1LA 4MQTB 3JZ7A 2COQA 3CLEH 4P23B 5DEGB 4HKXA 5HGHA 3N1FC 3C6LA 4P46D 4MSWA 1T22A 1VGKA 1ZT4B 4D8PB 4P9MH 4EUPB 3QUZB 5MI0B 2CKBH 4MA3B 5HYFA 4J3XA 3HNSL 4QYOA 3VFWB 4DCQB 2BZDA 2D0FA 1MY7A 1OAZH 1OGAA 1XGRB 2OTPA 3RP1A 5IB1A 1GZQA 2H1PL 5JQ6H 4BYHA 3IJHA 4GBXD 5C70A 3SDDC 4J7RA 3MPCA 1BFVH 4XHJC 4J6RH 3U4EB 3PGDA 4NKQB 4L4VD 4QO1A 2CLVA 4XXDA 3I9GH 2VO5A 4JJHA 3WFCH 4JQXC 3MJ8A 2GJ6A 2HLAB 3BISA 3OR7A 2A38A 1OL0A 1LEGA 3BGMA 5HHNA 5IJKA 2IALA 4JFEB 1P69B 4QRUA 3BN9D 1CGSL 4UTAL 1NGZB 3WIIL 2YSSA 1K8DB 5T1DH 2HT2D 2P44B 1CN4A 2ATKA 3CNKA 4AL8H 4AEEA 1Q9OA 3CDFA 4XNZC 1F6AB 5T5FL 2FX8L 4Q6YA 3TZVA 5H2BA 4I0PD 1OAYL 4YHMH 5C0ND 4NJAH 4WRLA 2OP4L 5B21A 2C4FU 1FZMB 1YY8A 1FFQA 4G7VL 4NQXB 1EVTC 1FIGH 1WCBB 2XTJE 5L9DH 3EDDA 3QFDB 4PLJC 2P8MB 2HT4C 4ZAKA 3GSOA 3T08A 1L9MA 5IJKC 2P8PA 3CZJA 4PUBL 4OFPA 1CS6A 1Q8MA 3EJJX 3Q48A 1N6QL 5F3HA 5CUSL 5F7UA 2P43B 1MCSA 2P48B 1XF5A 5SWSE 4XMLL 4BSWB 3BEWA 3GK8L 3LRSA 4YHIB 3NOIA 1V3KA 3KR3H 1OB1B 1B3JA 4XPGL 4HGWA 4WHCA 5CHNB 5I1GH 1HHKA 1MI5A 1DBML 1NH6A 4TULH 3QEUB 2OTWB 4TNWK 1KFAH 1XZ0B 1AIFB 1U91A 2AQ3A 3CXDL 3NPSC 3PABA 3OJ2C 5FV2A 4ZFGL 2B39A 4N8CL 1GGUA 1PG7L 4PJFF 1W72L 2Z31C 4X6DB 1LMKA 4P5TB 1AD0A 3L5XL 4EQ2A 4JDVA 4XMKL 4MNQD 4NQDA 5ITFB 2VXVH 4DGVL 1JZ8A 4XP6L 4F33A 1O7VA 3FMGL 2P7TA 4YX2L 4QRSB 1K8IA 4M8VA 3QAZC 2NY3C 3CSYB 3F5WA 3HUJE 5L88L 4KTEL 3FO0L 3QQ4B 4ZO9A 1R3IL 3MLWH 4TSBH 3MRMA 3B2UC 1FSKC 2I25N 4KKNA 3RUGB 3H9ZA 1YJDL 3O3DA 1VKXB 4WU5A 3FOMB 3CSGA 4OKDA 2HFEB 2AK4E 3G08B 3IDYC 1KJVB 4AIXA 2X41A 1BFSA 2DQTL 5C3TA 1RAMA 1XCQB 3LKSB 3EJYC 3C60C 3OGOE 1KJ2B 4UTBL 3C5JA 3MRBA 3E6FA 3MGOB 4LLWA 2H26A 3JV5A 3UJIH 5C0AD 1QPPA 4XC1H 3AAZA 4KMLB 3BUYB 1R24B 2RFXA 3ARFD 4HWEL 5GRWA 4AY0A 4YJZL 6FABL 3WD5H 4OZIF 4D3CH 1UWEL 2CUIA 5FO9A 1CK0H 1BQLH 1WGOA 3FT4B 3B8SA 3VFOA 4RFOH 5BCAA 5HJ3B 5GGVH 1IC5H 2MNUA 1I3RA 2EDLA 1NJ9A 4JO3L 2EECA 4LK4A 1MI5E 5GS1A 1WZMA 5DD1H 3UTSD 3RAJL 5JXEA 3RTQD 3QCTL 1VFUA 2DTMH 3B9KD 5B39G 3QB7C 2IQAB 1CDUA 2AS5M 2XG4A 2CLRA 5DTFA 1A1MA 3JUYA 1R0AH 1V7ML 3QUKA 4S0TD 3SDXE 1NL0L 2R69H 5C0EB 4P9HH 3QXWA 3MV11 3T65A 4ODUA 3UROR 2NTSP 1YEIL 4OKVA 1WAAF 3K8LA 3BKCL 5DJ8B 4M3KB 5EUKA 5GISH 3TCLB 2JB5L 3UXFA 1YJDC 2MKLC 2C3XA 3OB0H 5CP7A 1S7QA 4JM2F 4JPIB 5EU6A 1B4RA 2UY6A 4U05A 3I3BA 1E27B 5L0QC 5DLML 4OZFB 3HUJA 4NQEB 4QXUH 2FH8A 4HLJA 4PRBA 4A6YL 1N0LA 3BXNB 5KS9F 4P2QA 5F21B 4EDXA 2HVJB 4IMKA 1IM9A 3BVNB 3MV9D 4Y4KC 3EYOB 3QFJE 1G7QA 1TETL 3RWJA 1FC1A 4GRWH 1EX0A 3MRQA 2ZP0T 2X42A 4LCCC 1CU4L 2ZSVA 5FHBL 4PG2C 4OLYH 2BNQD 4MLSA 5FGSA 4TTDC 1U2HA 4XCYA 2FL5B 1XF4A 1EGJH 3V2AR 3I50L 1JWUB 3VGFA 4GMSH 2IFFL 3RKPA 5C0JA 4N5EC 3O3UN 2Y5TA 3EYQD 1RK1A 3ZKNC 1NC2A 3FN3A 4S2SA 3QJFA 2Z8SA 3OPZH 4JQVC 4UU9B 4LLYA 5I30H 4KRPC 3T8XB 3VRIA 4DAGH 2IWGA 1IGYA 1ZAGA 3GHBH 1SEQL 2NW3B 3RIFK 3T1FB 3LOWA 1FFOA 3VGAB 3NFPA 2AABL 2UZIH 3IAQA 3MR9B 4HIJA 4OLVH 5I2IA 4EUPH 4W4OC 1YEHH 4AJ0A 2D7OA 3BPCA 4OGYL 1EJOL 3DUHA 1EPFA 4M61B 2YK1H 2MWCA 1S9WA 3LEYL 4HGMA 4YHZH 2XACC 4KKCD 5H94A 1L7TH 2RGSA 1B0GB 1YMME 3NZ8A 1E6OL 1S7UB 4YPGB 1J8HB 1Y6NR 2I5YL 2YR3A 3MV8D 3ISWA 1PY9A 5CJQL 1VESA 4JHAL 1ZHNB 3V5DA 1M7IB 3N9GH 3PQYA 2AI0L 3P30H 4N9GB 3CX5J 4ALAL 2EIZA 3QT2A 4MD5B 3DXAE 4KHTL 3GJFB 4DN3H 2WAHA 3MNVA 3DROA 2CO6B 2VLLB 4XVJH 4AIZB 5E8DL 32C2A 3HZMB 4MQ7A 2BY3A 1SBSL 2QADB 3AY4A 3LN5B 5HHMB 4KK9D 4PJ7B 3LN4B 4NZRH 1A6AA 4DGIL 2VR9A 1FNGA 3Q6FB 3KXFD 3ME0A 4JRXD 4R8WL 4KTYA 3DO7A 4XCNB 1MRDH 4I77L 4KHXL 2DBLH 5IFHL 1LO0H 4NQCA 1E4KC 3MJ7A 4P3DA 4IRSD 4IDJH 5D2LB 3H42L 4HX1B 3CVHL 1LO4L 2HVKA 3STZB 1MCBA 2Z31D 5FB8B 3SCMD 1M6OA 4RRPG 4FTVB 3G5XA 1UB6A 2RQ8A 3EO0B 4NN5B 5DVNA 1OVZA 1NGYA 3HZVA 2FO1A 5JUEL 5LGHL 4UT9L 2PN5A 1ES0A 3DBXA 3DUSB 4N0RA 3VDBA 1M7DA 2G5BB 4PGDA 4FS0A 1E4XI 2DQEL 5D93B 1QFWH 1OAQH 3GMPA 4L3EA 1HWGB 3I6LE 4RBPH 4WEBH 2NXZC 2UUDK 4LRIC 5E1AA 4DUVA 2CLRB 5DTFB 5HI3D 1SEQH 1L4IA 5HHOA 5DMYA 5IESH 1LQSR 4UOW0 5T3ZE 2MKWA 2FJGA 4MNGE 3O3BB 4MNHA 5D4QA 1LILA 5KSBF 5ID0B 2YPLB 2BMKA 3N1GC 4EI6B 5KS9A 1NLDL 1E4JA 1YMMA 4YUEH 2VLRA 4PV8A 1DBAH 3FONA 3FT3B 4LSQH 1FCCA 2DD8L 3NIGF 4CADB 4OAWB 3OG4B 3ROOB 2CDEB 3GMOA 1DSFH 4NNPH 1FQ9C 2QQQA 2ATPA 4PRID 4FN0A 3SE3A 3HNTL 2NZ9D 1K3ZA 1PKQB 4KZEL 4H8WL 4X7SH 2Z0BA 2DB8A 2R0ZH 3SDAD 1GZPA 4NWUH 3RWCB 5FO8A 5D93C 1HQRA 5E2WH 1UEYA 3AREA 5CEYA 5IMKB 3B83A 1WAAA 4HGWB 4PRDA 3IETB 5JA9A 3ZKMC 4LSQL 2CDEA 1NLDH 3D9AL 2HA1A 4ZFOB 1N2RB 3U79A 4XNYL 1CFTB 3IDIA 4KUZL 5A43C 2DJ4A 1BJ1J 2EC9T 4L29B 4R26H 3OV6A 1S7SA 1OP3K 4FZ8H 3LEVL 4Y5YB 1IEAB 4XNUL 5DFTA 1LO5A 1AI1L 1RZKH 3GHEH 4HG4J 2CRMA 3TJEL 5E99H 2YWYA 2ZUVA 5D7JA 2IBZY 4L8DA 4PJDE 1A1OB 4ONGL 3FHQA 4MS8C 5KW9H 3S34H 3QFJD 1S78C 3CFKB 1Y18A 1WCBA 1ORSA 4PRAA 4U2YA 4U6HA 3ZKSD 4XAKD 5JOFB 4MNQE 4OZIA 4EQ3A 4J23A 5K9QG 1INDH 4OCXH 1ES0B 2V5YA 2XFXA 3DBXB 1UWXH 5DD5L 3LS5H 1A7BA 4I9WD 3VXPB 4NWTL 1JK8B 5LBSL 2EYSB 2AJ3B 2J8UF 2ICCA 3MA9H 1IC5L 1QSFD 5H94B 1QKZH 4EIZC 4OLWH 3UEZA 5EOCJ 3VXTA 1IBGH 4FQ2L 8FABB 4OZHE 1UWEH 4I2XA 3AMKA 6FABH 3VXOA 1F3JB 4UIKH 1RVFH 3SCMA 3ZDYF 3MRLA 2XIDA 4PY7B 2QKIB 5EDXA 3QNZA 1HHJA 4K07A 4XVJL 3C87A 3IFNH 3JTSB 1JUFB 3BKYH 3VH8B 4QRPB 5GSVA 4U0QB 3RJDA 4YHNA 4KJPC 5CWSB 1CDBA 5C9JA 1WAAE 1JPGB 1CIUA 4KPHH 1CFSA 3CLFH 4LGSB 1TQBB 3BGFB 2H3NA 2QHLA 4HAGA 1FZJB 4IRSC 4R3SB 5F6IB 1IEBB 3LEYH 1K2DA 4BFIB 5AWNL 4HKJA 3DSNA 3VJ6B 3G6AA 4GRLB 4GS7C 3WFBH 1S9WB 5CILH 1I9RL 3QIUD 4P2OB 3FB6B 2GJZB 3DYPA 1X44A 1EBAA 5E8EA 3ROLB 4KXZH 4X6CF 1EEYB 1LP9A 2GAZA 5JW5B 3VH8G 3WUWB 4DAGL 3MLTA 3O2DA 3MRHA 3UTPD 1H3GA 4PJGA 1DQMH 2XA3A 5IHZA 3VU2A 3T0EA 2ARJQ 2OL3H 1EIBA 5TQ2H 4F8TA 3IJHB 4X83A 1UKQA 4WWKD 1FYTD 4PJAF 1OAKH 4RX4A 3UYOD 3THML 4Z7UA 1AO7E 4XPGH 3WUWA 3UZVB 5D2LE 1X5FA 1PJ9A 5I1HH 5FYJD 4MXVE 1VDGA 2H32H 5DD3H 3JVGC 4ZXBD 2IAMA 1XEDA 5K9KB 5KJRH 2E7MA 1QR1B 5T1LB 3FB5B 3EDJA 4CU8A 1VENA 3MLSH 2HJLA 4HV8B 4EN3A 5ICXA 1X3DA 1S7RB 3E0GA 3KPQA 4KJQC 2D7TL 3FQUB 4M7ZB 1RZJC 3SKMA 1L7IH