4OJ1A

Crystal structure of truncated acylphosphatase from s. sulfataricus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
b'MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEYKGEFEDFETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Crystal structure of truncated Acylphosphatase from S. sulfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 24
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oj1A00
2L3MA 1Q4RA 1N5SA 2HFNA 2OFHX 2ASYA 1N5VA 3I9ZA 3MCSA 2ROGA 1V3ZA 3KNGA 2IYGA 1N5QA 2K2PA 2XMWA 4YDXA 3BR8A 4A4JA 4NL5A 1APSA 3BDEA 4DPOA 2XMMA 3BF4A 1WD6A 2G9OA 2OFGX 4HH0A 5B0FA 2RU9A 3HHLC 4YEAA 5T7LA 1N5TA 2OKQA 2XMVA 2W4PA 1TR0A 3KKFA 1YG0A 2K1RA 1VQSA 3TNVA 1JK9B 3CJKA 3TRGA 1S6UA 2JDJA 1KQKA 3E8OA 4F67A 2HLUA 2ROEA 1S6OA 3KG1A 4NPOA 1Y3KA 1QUPA 5B09A 5A6PA 1Y3JA 2FIUA 2QYCA 1TL4A 1AFIA 1VQYA 2N7YA 4Y2IA 2W4CA 2AJ0A 1ULRA 5A6WA 3HF5A 4U9RA 2AW0A 3F44A 3BGUA 1FE0A 3HHLB 1TUVA 3WDOA 1X8DA 4OJHA 4DN9A 5T7LB 3KG0A 3LGNA 2QIFA 2VV5A 3LGMA 4HL9A 2GO8A 4EFAC 5B0BA 5B0CA 2HFOA 3GZ7A 3QGPA 2N4DA 4OJGA 2AP6A 4HH1A 2BUNA 4FNIA 1OQ3A 3BB5A 3VTIA 5F0WA 3FMBA 1FESA 2KT2A 2KT3A 2OD6A 2OP5A 5B0EA 1SI9A 2BJEA 2BJDA 2QLWA 2QLXA 3DCAA 3QMQA 1OSDA 2Q3PA 4Y2KA 4Q2LA 4Y2MA 3FGVA 4ZOSA 2ZDOA 4OJ3A 3IWLA 1KVIA 1AW0A 4A46A 5B0DA 2OMOA 2VH7A 3T9NA 2RILA 2GGPA 1GXUA 1U7LA 3DXSX 3HDSA 5F0UA 1K0VA 4FNHA 3LO3A 2KKHA 1GXTA 1Q8LA 2GV1A 3K7RA 2LQBA 1FVSA 2XMTA 5KAKA 3HHLA 4OJ1A 1CC7A 2OAUA 2LQ9A 1R6YA 2CRLA 1X7VA 2HQIA 2W4DA 2RMLA 4Q2MA 2GA7A 1YJUA 2N4CA 2XMKA 3HHLD 3HFKA 1MWYA 2K7JA 2IYIA 3UDCA 1OQ6A 2ACYA 1RJJA 4A48A 1Y0HA 2AJ1A 2ZDPA 2OD4A 1FEEA 1P8GA 2LDIA 1XBWA 4OIXA 3FRYA 5IXUA 3IWXA 2BYCA 1URRA 2FTRA 1FE4A 1SB6A 1FD8A 1MWZA 1YJVA 5B08A 1CPZA 2ROPA 1IUJA 1CC8A 1YJTA 2HIQA 2K1RB 1SQEA 3TOQA 4A47A 4DL0C 1JWWA 3CJKB 1FVQA 1YJRA 2XMUA 4HI2A 5K9FA 1KVJA 1Q8BA 2XMJA 4QOTA 5B0AA 2PGCA 1Y9OA 3MZIA 2BBEA 2K7KA 2GFFA 1X0PA 1TZ0A 2FB0A 1AFJA 2RSQA 2HLTA 1YRXA 3BN7A 2FHMA 1LQ9A 1W2IA 2IFXA 3HX9A 1P6TA 5B0GA 2EW9A 1OPZA 2PD1A 1TL5A 4HI1A 4ZA1A 2GCFA 3BM7A 2KYZA 1Q53A 2LXFA 2GGPB
chains in the Genus database with same CATH superfamily
2GHWA 2OFHX 2V2VA 1UVNA 2FJWA 3WZ0A 3EYZA 1B0PA 1O5JA 2CQ2A 3A13A 1DTQA 4JI2J 2RQCA 2VODA 4EBEA 3WBZA 2BDPA 3NS7B 2WW4A 3TVKA 3K5LA 1SQGA 1AUSL 4G3IA 4FP9A 1RT3B 1S6UA 2DHAA 4CH1A 2D3UA 2ZBIA 2DXFA 1SJQA 2EBEA 1SKSA 3FSYA 3EGNA 3IGVA 1RA6A 4CM2A 3H40A 3G87A 4UOCA 1IN0A 1VI7A 2MQ8A 2IY5B 2VDHA 4OHVA 2MJNA 3KLHB 2DGSA 4ZIVA 2D69A 1RT5B 5SUHA 1FX4A 2GJIA 2RS2A 4F3MA 1FK9A 3DOMA 3VAHA 1HKAA 2XMKA 1B70B 5CYQA 3R27A 1JQGA 2YXLA 1EAYC 1JJ4A 4Q8FA 4UOFA 1WEZA 4FXDA 1FDNA 4NLTA 5KG5A 1FRKA 2DHXA 2PMWA 2XEXA 3R6LB 3LANA 5E5NA 5I3UA 2DNNA 3FEYB 1TL5A 4NA1A 2RRAA 2VBXA 2HFZA 3UI3A 2KDOA 3OL6A 1S6QA 1SC6A 1SVDA 3KMSA 3CDUA 2BANA 5J2PB 4GVBA 2YNHB 4NX9A 4RR5A 3MM7B 4HHUA 2FGCA 1GTHA 4RNHA 1NUEA 1PYOB 3K8VA 1F3VA 3HMJG 4B3SF 3J7AN 3KDNA 4NLDA 3MTKA 2DNRA 4ZKAA 4B02A 3DDIA 4CIOA 2FLLA 1H98A 3TANA 1Z1ZA 4J5OA 1GEHA 2E5GA 4USHA 1MN7A 4FKYA 1S9FA 1UVLA 1R27B 4Q2MA 3CJTA 1U4BA 5G0RA 1R6VA 2NUHA 4ATNA 5IWAJ 2CJQA 2FJVA 2KN4A 5KFZA 1T9TA 3H5SA 1S1WA 4RW8B 1PYSB 1M90T 5LXYA 2FLOA 3QJPA 2A1BA 4DCOB 1I94F 1FWLA 3UFCX 2R4FA 3CCQS 2WONB 4WFXA 4M63A 4RW4A 2KT5A 2F8HA 4KFBB 3GFYA 4JV0A 4MIAA 3D6HB 1BLUA 3H5YA 2F4VF 4P73A 1RBOB 2POKA 4IFVB 1PAUB 2ZITA 5LMNJ 1VR6A 2XYGB 3KK1B 5IT9U 4UUWA 1D9AA 2W4CA 1OO0B 2UUTA 3TEHB 2FHJD 4PXDA 4DJBA 3CJSA 3UD4P 1XWLA 3DLEB 2FDNA 3SFGA 5C5JA 2GAGC 3H4DA 1CULA 4Q5VA 4U67Q 1BUXA 4G6VB 1E6VB 4V19J 4JI5J 1DQ8A 2VBZA 4HKQA 4LSNB 1H2UX 5CABA 3W7BA 4DFKA 3UCZP 1RKIA 4KPCA 2VHGA 5KFLA 4QWAA 1HNVB 2ABYA 1T9VA 1SL0A 2KVIA 3D6TB 1FE4A 4B3OB 2OPPB 3H2UB 2YNFB 2W7OA 4O44A 1TZ0A 3HZEA 1K44A 1MN9A 4DG1A 2NYIA 4FN5A 1P1LA 4DMZA 3AT1B 5KFXA 1UVIA 2J8SA 2W2NP 2AJFE 2VG7A 4FYXB 2XMVA 5SZTA 4KC5A 5HN0A 5CAAA 2DGOA 2CG4A 2R2RA 4ZIWA 4JI1F 3JYTB 2VA3A 4BCAA 2QL5B 3PVXA 4A8XA 3TARA 3QAUA 4KGVB 3A8JA 3EZUA 1KSPA 3DU6A 1HBUB 2QRRA 1OJ4A 5J2MA 4DSIA 1XR6A 3SEOA 4ILMA 2JEIA 4EYHB 1K8AT 4OIXA 2HNYB 1KHVA 2IAJA 2PE8A 1S1XB 4ZLJA 2B4PA 1UW9A 1XERA 1X4DA 1VBZA 3GE9A 2FHMA 3RW7A 4YDDB 4CI0B 3K5PA 3Q8RB 1XR5A 1NJIT 4RWWA 1R0CB 2F40A 1X60A 3ONQA 4M5IA 3D68A 2C2MB 3L9ZA 5LJ5Y 2YKQA 2RQKA 3CULA 2IVFB 1DBDA 4TU7A 3M32B 1UL3A 2ASLA 3ETOA 1UA1A 2NREA 3CIZA 5HLFB 2R2TA 3CC7S 3VHQA 2EK1A 2H48B 1EQMA 5AE3A 4EBDA 3PRDA 1MROA 5DG7A 4WXOA 4JV5J 3ELHA 2E1AA 3PO4A 3C2PA 1ZAVA 6FD1A 3QIPB 4GMKA 1TVRB 1U1NA 3T1YJ 4DI6A 3SQOP 3GJTB 2NPFA 1WF0A 2SXLA 3SI8A 4F0MA 1VISA 1YZ6A 3EWGA 2BJ7A 4DR2F 2RF2A 3LWLA 1IBCB 5F8LA 2W9AA 2O67A 2FC9A 4MK8A 1Q95G 4JI0F 1JNRB 1Y5IB 4PWDA 2HNZB 1H0HB 3D6FB 1S1VB 3LPYA 5M2UA 4CZCA 2R8IA 1VBKA 4KIAA 4DPOA 5RUBA 1HNXF 3VGSA 1BMQB 2P9EA 2XYPB 3C14B 1MNEA 8RUCA 2XTJP 2ZEJA 3D1OA 3PR5B 2CJKA 1ZA2B 3BGUA 1DTTB 2IDLA 2O1PA 4NE9C 3GILA 2E66A 2RIJA 4KGKA 2CADA 2MDAA 3I0RB 1RBAA 4ES3A 2IBKA 2HWHA 3LPEA 4ZVOB 4LF6J 3ENVA 5FLXY 4RKUC 2BXJA 3TYTA 2AZ3A 2JZ5A 2OAUA 2D9OA 4PRFA 2ZBQA 3MCOA 4KTQA 4JB8B 2PT0A 3DYAB 2FYXA 4C8LA 2CNNB 3G96A 4FYYB 1NKBA 1FJGF 2HBZB 1EETA 3PDNA 4FS2A 2KU7A 1UPMB 1VQOS 4ZA1A 4YB1P 3FFIB 2D41A 2HURA 1RT4B 3EE3A 1G2EA 1UWBB 1FA0A 5A0YB 4F26A 4ZP7A 2LQ8A 3TUPA 3AD7C 2XLKA 1VC0A 1KP6A 1GMWA 1FT8A 3A1YG 2E1CA 1YG0A 1CVJA 3OL7A 4ANCA 3VAGA 4DF4A 1S6OA 1YJ9S 1JLBA 4NCAA 3GV5B 4HT5A 3MEGB 4P7VA 3UNGC 2QN6B 2ADCA 3HXMA 4B3SJ 1PILA 3HHLB 3D0GE 3SSSA 3OL9A 1LXNA 3EPIA 3C6TA 3M8PA 3CE8A 2N4DA 1M5KC 2R2UA 1HMVA 4PZVA 4USJC 2EPIA 1UW4A 2HKEA 3DDNA 3VWSA 4OHZA 4DX8H 2UVWA 4OX9F 3MEEA 4LRBA 2B9XA 1N34J 2HS0A 3D6MB 1GMUA 1HQEB 3M7VA 1RTZA 2R7TA 4NMXA 4N56A 5KG3A 4AYBD 5B0AA 4MT1A 3HX9A 4OZ3A 5KFBA 4PWUA 3VZHA 1SKUB 3J7Z5 1AA1B 4QU6A 1VQPS 1S7IA 2WRMA 1FRMA 2XSJA 1FRIA 4PQAA 2J0SD 1TK8A 4PXEA 1REGX 4R25A 4DN9A 1T7PA 4ZPBA 2DO0A 4FS1A 5IV3A 1FEHA 4ANDA 4QIEA 2VFVA 3E51A 2F9JA 2N82B 2KM8B 3THPA 4OHXA 5ITHA 5DDOC 1NKCA 3DXSX 2CA9A 3KFWX 2YKNA 5A8WA 5HVFA 4ED8A 1YBAA 3MMAB 3MOZA 1N6QA 4MMOA 2Y0SD 5KTQA 1SJ3P 3W64A 1YJVA 5HJYA 1OMSA 2ZKTA 3PEJA 4PG5A 3BJYA 3DLHA 3DXBA 1W2IA 2V94A 1PGZA 2EI5A 2G2OA 4JI8F 1IBMF 2HMIB 2HK2A 2BE7D 2ASYA 2XNRA 2K2PA 3PW0A 1FDDA 1GNKA 1RTDB 4KHRA 3BF4A 3I5BA 2P9CA 4M1KA 3FQLA 3OFFA 4DPYA 2LKZA 1BHNA 4ZVSB 1WJ9A 4X4TA 2B7BB 2J0WA 2OEMA 2MKJA 3LP2B 2G4BA 3HK2A 1KD1T 1CJUA 5DRKA 1S48A 4DWIA 3L95X 4DV1F 1D1UA 3R7BB 3HVWA 3FRZA 5ETMA 4FVCA 5AXLA 4J9UE 1LW2B 5LL6d 3U27A 1WEXA 1Y4ZB 4K4VA 4O3SA 3DM2A 2BACA 2ZKUA 2YBVA 2B4OA 1RXOB 3RW6A 2DEIA 4L75A 1XIQA 3QNWB 1FKPB 1F0XA 5AXMA 5K8OA 4E2FB 2X51A 1T05A 1S79A 2V8GA 1RAJA 3MEDB 2Y0BB 4WP3A 2YVSA 5JUMA 1FD2A 2Y1JA 4FF1A 3FZBA 4ZPAA 2PIIA 2ZH7A 4ETXA 2HQDA 1EX8A 1RHUB 4HEA9 3IG1A 3DRYA 1OS5A 2GQCA 3NMAA 2XI3A 3DKDA 4OZ0A 2WB4A 3OTDA 2C28A 2XO6A 1U24A 2PEHA 3NNAA 1XMQF 3UD5A 3U1NA 1VMBA 4KKOB 5ETNA 4C98A 3PX0A 4I1TA 5HP1A 2W25A 4ED3A 1MW7A 2ACMA 2ILYA 4RUHA 3G8TA 3VAMA 2WVDA 2J9EA 2BJDA 4EO8A 3KUEA 4A46A 4NZ6A 2VH7A 3LP0B 3OVAA 2BE2B 4C0BA 5LMUF 5BYRA 2CQ4A 1JLQB 1CC7A 2LQ9A 5A8KA 3RJMB 5J2PA 1V3SA 2YNGA 2HBYB 3EPGA 4DR2J 1KFDA 1FF2A 3IWXA 2YQ1A 3NWRA 3KWMA 2CQPA 1HBOB 4PYAA 3BGOP 2V34A 5IT9Y 4BS2A 4NYZA 3AOCA 1N5VA 3EXCX 4CO5A 5J1PA 2OPSB 1FJCA 4CT8A 1G4CA 1HNXJ 2ZH3A 2D3O1 4H4OA 4UOHA 3C3LA 1PC5A 1IXKA 4ZMMA 3B8HA 1ROFA 2DNOA 1RACB 4WU2A 2ZH5A 3NCQA 2AWZA 2AGQA 3QO9B 2CZ9A 3NOCA 2WK4A 2V4JA 4R8UB 4DV0F 1O6XA 2WVCA 2HFOA 1P1TA 3X1LB 4WKYA 4DX7A 4K7QA 4B9MA 5K9FA 1UVMA 2B6AB 3EVWA 1KBRA 4CTAB 5B0DA 4I64A 2K8GA 2A2DA 3O6QA 3FSXA 2CWKA 2E9ZA 4IFVA 2LA4A 3IXQA 3AQOA 2PA8D 2B4VA 1QE1A 3KK1A 1KRPA 4JI4F 3W8GA 2BYCA 4U95A 1N33F 2AYGA 1FJGJ 1SH2A 4P2SA 2AYMA 4JV2A 5ETPA 4DL0C 1K1QA 2MKCA 1SQEA 1RT1B 4LBHA 4EGLA 3TUIC 1RWVB 2DTJA 4ECUA 1CJTB 1BQMB 2QT7A 3VR1A 3DI6A 3V6JA 2OTJS 1UP1A 2MY7A 1WOSA 4OZLA 4LSNA 2OMLA 4GO5X 4Y65A 4NLRA 1VFJA 3NGUA 3M05A 1EB0A 3CCRS 1S99A 1SUQB 4LFAF 2MLXA 3GPAA 4F2RA 1LWFB 2NS1B 1V5IB 2LEBA 3GIKA 2I6WA 4B3OA 2MQPA 2J9DA 2OPPA 2LQ5A 3W60A 2WSEC 2CPIA 2AMCB 4WXWA 4CLTA 4OX9J 4OX6A 2BQRA 1NCLA 3BKUA 1SCJB 1IBKF 3BDPA 3UR3C 1RT6B 3CCTA 2IA6A 3A4TA 2V8VA 1DARA 2ZJPQ 3AA8A 1HD0A 2HQ3A 1RTHB 3JYTA 2QL9B 2YX1A 2ZBRA 5IQQA 1NJZA 1UEKA 4IOAQ 3RR8A 2DK2A 2DXDA 1C0UA 2R8GA 4CLYA 2YWGA 4YEAA 1ZH5A 4ES1A 1TFYA 1HBUA 1J5EF 1I3OB 4CH7A 3KJFB 3ZZYA 5DJBA 1F2HA 4TNOA 4QYZK 5A6WA 2O5DA 4M5DB 2DR9A 2Q6BA 2HNYA 4LF4F 5HVHA 3ZO7A 4PWWA 2ZC3A 1VYAA 2GMHA 1VGYA 1TMMA 3CCLS 3BO4A 3LAKA 4WP9A 5JXSA 1S5ZA 3CC2S 1RSCA 4QPXA 4DFMA 2J0QD 1Q86T 2QGFB 2ZWPA 2MMYA 1A6LA 4PQUB 2MLYA 3MPDA 5HMYA 3M8QA 4S0MA 1L5UA 1X4BA 3IBCB 3ICLA 1PJ5A 4J9MA 4OZNA 4DQQA 1AFJA 1N52B 4NCGA 2VJUA 4TYAA 1QD1A 2B56A 4Q8EA 3LQVA 2DIVA 1M0SA 1G3OA 1TVRA 2JLFA 3SCIE 3N4WA 3V2UC 3MMBB 1DY3A 3VVUA 4CP5A 1C4CA 2QFJA 4NA3A 1EP4B 3I87A 3ILJA 2DNHA 2NXCA 1BQNB 2KHDA 1KWMA 2ZE2B 4DZ6A 1PKUA 9RUBA 2M70A 2AYBA 3UNYA 2XS2A 4ZOSA 1KNZA 1RUSA 4MKBA 4I6WA 3OTOJ 2HNZA 1S1VA 5AE2A 2MTLA 3CDEA 1SV5B 2GA7A 1CJKA 1JX4A 1N56A 3MD3A 4PABA 3BBFA 3PKMA 3K0JA 1WDTA 2W9BA 5D8HB 2H9ZA 2ZD1A 4F4AA 4O23A 3DN9A 3OTEA 2KJWA 2CQHA 3W9HA 2ZH2A 3PR4A 1RT7A 1LKZA 3KK3B 1U09A 3CCMS 1RHQB 1REVA 3TI0A 3I0RA 4K4SA 2HYIB 4LMZA 4TQSA 2G1DA 3CIMA 2XMMA 3CB4A 3BPDA 1JLGA 4C8ZA 5H9EK 3M2RB 1U26A 4NXNF 2OPRA 4JP8A 2QLFB 3QWUA 4ZP6A 2AU0A 4LQ3A 1Y7PA 3R8YA 1U25A 4OQJA 1F9EB 4ED6A 3HHKA 2FQQB 2ZOMA 5D0HA 2Y1IA 2IJNA 2GVZA 2OD6A 3OW2R 4G1PA 2B43A 4LQ9A 1FKOB 3Q2TC 4DLEA 4ZCMA 1Y5NB 2I38A 5LMUJ 1DJ0A 3M2VB 1M5PC 3OR1A 1JKHB 1JLAB 3G2XA 1UWBA 2UUCJ 3CCSS 5AJ3F 4OV6A 3JSBA 2BMBA 3TJ9A 4AL6A 1SJFA 2GVDA 4X4RA 2L9DA 1T02A 3FCWA 1JWWA 4FXVA 1H38A 1VJWA 5F8JA 3GYGA 4C0OC 2HVDA 3AD8C 5CYMB 3ITHB 2OFGX 1KTQA 4IKAA 4B9VA 1FWKA 1HQUA 2DNZA 4UY8T 2IC3B 3Q83A 4RW7A 2B9EA 2QA1A 3KLVA 1T3NA 1WHWA 4M8LA 4EU0A 4DR7F 3UDVA 4DV0J 3B82A 4ZHRB 2RE1A 3KUHA 1PBUA 1X31C 5D0EA 3JSYA 2QLXA 3DCAA 3EMTA 4K0KF 2CPZA 1ZS6A 4EZ6A 3HO1A 3MGJA 1NMEB 1VC6A 4URSA 1XMOF 4Y28C 4OJ1A 2ZBCA 3DRPA 2Q43A 3CJQA 2ZUGA 2MQLA 3C16A 3G9CA 1P8GA 2VFTA 3QGIA 4X62J 3UVJB 2O66A 1EZZB 3EJMA 1RTIB 2N3OA 3M6WA 4FF2A 5CQGA 2PD1A 2PDAA 2V67A 3V4IB 4QBUA 3ET6A 3GLJA 4P74A 2PEBA 1IVZA 1TKZB 5JMNA 1VIOA 2KXFA 3QYYA 1WD6A 2R9LA 2KFZA 3UWTA 4A8QA 2OKQA 2YWFA 4CLUA 5KT3A 4B3MJ 3OT9A 4LFAJ 1LWEB 1IKWB 5FJ4A 4LF1A 3ISNC 3BQ2A 1RISA 1ZM9A 2I1RA 4AL7A 4N8OA 1WI8A 1JLFA 2CQIA 1DQ9A 3CD5A 3TZYA 4NASA 1PIEA 2BUNA 4HACA 2OELA 1RAAB 1U02A 3IWLA 3HVAA 2X3GA 2HMIA 3HHDA 3VQTA 2FY8A 5L38A 3ULHA 1UETA 2GQQA 4Q43A 3KLGA 3EZ5A 4J9NA 1MWYA 1OY9A 2H65B 5DGAA 2OSRA 4CLSA 3FRYA 1SB6A 1LFWA 2Z0GA 4A47A 1NSAA 2ZH4A 1HWLA 2VF3A 1NJYA 2GHPA 4FVMA 2RKIA 4C11A 1KQFB 5K8NA 1HNZF 1R0AA 5FIIA 4CNZA 2XHWA 4LFBF 4LRDA 1J5EJ 3FVYA 1FRXA 1KEKA 1N36F 3N79A 3FDSA 3E01B 2PA3A 1Q8KA 2BJ3A 1X9WA 1U45A 3MPWA 1VK8A 4OI1A 3ILIA 2CWXA 4DL6A 2DNPA 1ZAWA 4ETZA 3V6HA 5HJXA 3DGPA 1P9YA 4ZN3A 3EUNA 4A8FA 4ENOA 1UJ5A 1Q5VA 5BYSA 4IG0B 2KKHA 1FVSA 1QLNA 2H3EB 2KFNA 4PUOB 2FJDB 1YDLA 1D9DA 4C97A 1TAQA 2W2PP 2OD4A 3T9ZA 1UJ4A 3D3CJ 2MGZB 2FHKA 3B4MA 4GVLA 1S9GB 1YKWA 4ZDNA 5H1SV 3KK2A 3KHLA 1XNRF 1IQZA 2BM1A 1KVJA 4KKOA 1O8BA 4CLKA 1IJEB 1RZMA 1LWXA 5LT5A 2NUUG 2NXEA 1NK8A 1WTFA 5HBMA 2ROGA 2BR0A 5BR8F 3GCWP 4WIIA 2FZCB 1I5OB 1HBNA 2VG5B 5F3TA 5DS7A 2GMLA 1X9SA 3FKBA 4F67A 4IRKA 3DRSB 3KG1A 2YY3A 5HK4A 3N6NA 1AFIA 4QQBA 2RVJA 2GJFA 1TV6A 4AXJA 3F56A 4F3OA 4NCBA 4IH6A 3J7YI 4B9LA 2DBBA 2C2EA 2WBRA 4URGA 4DV4F 2CQBA 2HEKA 3R1HA 3TA2A 1AT1B 2E1PA 3SCKE 3PY8A 2H1YA 4DV7F 1V3RA 2OPSA 5U47A 1LV5A 4RBVA 3UQSA 2B7CB 3K59A 3K5NA 1AZSB 4CO2A 2CYYA 2ZDPA 3OR2A 1GQEA 3X3UA 4LRFA 5HROB 5I42A 4DN0A 2ZH6A 4NYPA 5C2CA 3AFGA 5C25B 4QWBA 3CJKB 3J80U 1X4CA 3GIMA 2FB0A 3C8YA 4XK8C 1YK9A 3CCWA 4HI1A 1KLMB 4DF8A 4L3NA 2DYAA 1HA1A 4GRSA 5KFPA 2W01A 2VBYA 3CC4S 2B6AA 4CTAA 4ZPCA 2MJUA 4DSLA 1JXLA 2HVIA 5LSRA 1N5TA 4GC7A 2D74B 2DGXA 4NXNJ 3H42A 5CXTA 3R5DA 4Y2IA 4IR1A 1MG7A 5A8RA 1HPZB 4IRCA 2MPUA 3G8SA 4FYVB 3EDRB 1NSQA 4LSLB 4TLRA 2MSSA 3L4BC 1RAEB 3JTOA 4OJ3A 5HATA 5KFJA 3BN4A 2PFDA 1YRUA 4PXCA 1BQMA 4PCQA 4OZJA 3POTA 3R5AA 1S12A 5ETOA 3DMJA 3HFKA 2F9DA 3QFHA 4N7TA 1XEZA 4A48A 4ZVHA 2W9CB 2ZZNA 3K17A 2P9GA 1Y10A 5IZHA 5M2PA 2WZ1A 1Y9OA 1VQKS 2DGUA 2VQEF 2PC6A 5ETKA 1M1HA 2K3KA 4ECQA 3RBXA 3BV8A 2XMWA 4OX7A 3A8IA 1D3WA 1YGYA 3OBIA 5F41A 3NAIA 2QFIA 1JK9B 3NG8A 2VUGA 4DR7J 3HULA 3KG4A 1IQTA 2UVVA 4X4PA 1TL7B 4WF9Q 4ECXA 2VL1A 1RAOA 1G7CB 1D9FA 5KFIA 1UWAA 4DUZJ 2KFYA 3MR2A 3HSDA 2FHJA 1WTBA 3TR5A 2NZCA 1IBLJ 2R3VA 3W2VB 4LBPA 2JSXA 3BGRA 3I0SB 3B4DA 2J0XA 4C8MA 1JNZB 3MM6B 2CJXB 4RZRA 2M7SA 2VU5A 2RB7A 5HMZA 1FNMA 4DOZA 3PFEA 1HFEL 1GK8A 3IWNC 1ZTWA 4BDPA 4LFCF 3K58A 2D3ZA 3NL0A 4M5DA 1U0HB 1HWJA 4M95A 5D4NA 2XY7A 3UCUP 5H9FK 3ZZTA 4TYBA 1OYDA 3RAQA 5HL7Q 2KJVA 3HSZA 1V3ZA 2XYHB 4YR3A 2AQ4A 4F25A 1HNWF 5EWFA 4Z37A 1WKJA 3H2LA 4U8YA 4CLZA 1IKXA 2EFPA 4Q0BB 5E7OB 1ZPVA 3GFZA 2YNIA 1OY6A 4PQUA 1M5HA 2DJWA 2DKOB 5D6GA 4DQIA 1SIZA 3KG0A 4XAKA 5HVGA 2FJXA 3ILLA 5L1IA 1S1TA 3DLLQ 2A2CA 1RHMB 2VPXB 5E41A 3RRHA 1C1CB 3HVTA 4BC7A 1TQLA 5KG7A 1B99A 2R7RA 2XG8A 2V8PA 2BJ8A 4J7CA 2V63A 1UJ6A 4USMA 1OPIA 2ZE2A 4L74A 3BM7A 1NB2A 4QZVB 4D3GA 1HNZJ 4Y34A 4X84A 2JC0A 5BXIA 3N6LA 3TUZC 3MWBA 2ATLA 5HAOA 3M2UB 3AODA 2B4UA 3Q8VA 4URQU 4LBIA 5D4OA 3N28A 4XO0A 1G1XA 4RW9B 4FBUA 2EK6A 3PIPQ 1S1UB 4DV3F 3KK3A 1PJ6A 1VQMS 3ENAA 5K14A 3WX4A 2C2ZB 3BPSP 2EKYA 2CZVC 1FEEA 2DXEA 1LK5A 1TK0A 4WZQA 4DR3F 3P8BB 4TN2A 2Y8YA 3KHHA 3ZZ0A 1HD1A 2K1RB 1ACMB 1YRTA 2BW2A 2QG9B 2OPQB 1CSJA 5L1LA 3CWJA 1YITS 1N5QA 3DOKB 4J9PA 4F4ZA 1J5OA 3J7A1 4NLYA 1FKOA 2MZTA 3V81B 2FHOB 5EWEA 3KKFA 3M2VA 3OTCA 1WG4A 2DGVA 1JKHA 3MM9B 1NZAA 4G1QB 3OFHA 2MZSA 1ZM4A 4X64F 5IC6B 3PFOA 1NDPA 3MPUB 3QSYB 4LRAA 3TW0A 4ZVEA 3FJ2A 4RW6A 3BKFA 5KFTA 1C2PA 1CS4B 3O8WA 3CXCR 2W24A 4WE1B 3GFHA 1GXUA 4DZDA 4FXWA 2J6UA 5CYMA 5AXKA 3Q0AA 1F1BB 5GMEA 4ZLPA 2JNJA 5IXUA 2IC3A 2VOPA 4TY8A 5J2NA 2E5JA 2MY8A 3J7ZT 3KTQA 1RHKB 4UQGA 3G82B 1U1LA 1OPZA 4J91A 2CJYB 3NGRA 4MK7A 3R7SB 3ETMA 5L39A 1JJ2R 3ZTRA 1HI8A 1NAQA 1SQFA 1S6PB 1FXRA 3HHLC 1QTMA 3RAXA 4MK9A 3RZAA 1AUDA 1RWPB 3MM8B 3G86A 5D4LA 5B09A 3NNHA 2W1BA 4XPCA 3MUMP 3IA0A 2N7YA 1ZA1B 1VQ8S 2W2MP 3H4BA 4WK1A 5KT7A 3W63A 4CO0A 2DPIA 4EFAC 3J7YU 3H20A 1R8PA 2IRUA 2E44A 5CYJA 1RWUA 3AXMA 2BJEA 3HD2A 2GIFA 2CFXA 1C1BB 1GT8A 3V4IA 1JXVA 2KG0A 2PN6A 4KBIA 3HT0A 4O3RA 5EGYA 1TKZA 2LXUA 4O4GB 2PO4A 1TELA 2WVBA 1RCOB 3QLHB 4G1IA 1LWEA 1IKWA 4B9NA 3GR1A 5KOWA 4MTPA 5IT4A 3NOGA 2VQEJ 1YIJS 3D3BJ 2WOMB 2A0FB 1VRUA 2Y1RI 4NLPA 3MAAB 1Q16B 4DSFA 4GKKJ 1NK0A 2FZGB 3LP1B 3GR0A 5DLFA 4TQRA 1UA0A 2KRRA 1T9YA 1WF1A 2DRDA 4WP8A 3QWPA 2UXDJ 2AX1A 2ROEA 1T11A 4NMLA 1A9NB 3F44A 2UV8A 2KM8C 1VRTB 2JRSA 1Q7LB 2EBGA 1D09B 4KYZA 4ED0A 2WVFA 3VZIA 3W9IA 1M5VC 5H9FJ 3Q8YA 3JS9A 1ITPA 2IM3A 4ECWA 3M8ZA 2AF6A 3MDFA 2BA9A 4B08A 4ZVRB 3W8PA 2F63A 3JAMU 4X65J 5CHCB 3MM5A 4WFNQ 1N5YB 3P49B 1HW8A 2VB6A 2M8HA 2J7WA 2CDQA 4B9UA 3PW7A 4LSZB 3QT8A 1VQ4S 1LW0B 1LWCA 5J1NA 1TL3B 4DR1F 2FLPA 3CW2C 4X4UA 1T3OA 2KL8A 4DU7A 5J1EA 4U7CA 1QUPA 1PO6A 4PUOA 9ATCB 4YHHF 3PYFA 4ZVGA 1KDNA 1WNEA 2H5IB 3WDOA 3WC0A 4ILLA 4KH1B 3T5HA 2GO8A 1S9GA 4DPXA 2BZ2A 1HHQA 4AFFA 4ELVA 2HQFA 2KT3A 4I6YA 1RB0A 1QM9A 5IM0A 2JH3A 3ZC4A 3W65A 5GMKa 3C6UB 4DSEA 2BABA 3E3XA 1NLKL 4FNHA 4JI3F 2XLIA 3CO0P 1RBLA 2C3YA 3FNNA 3J80Y 4JI6J 1C4AA 4RPFA 4FF3A 4EI2A 4I7FB 3W9JA 3PRVA 1MWZA 4JYAF 2WAQD 3ZNUA 2G13A 4ZK7M 3D1QA 4MH8A 2ZH1A 3ZXWA 4J37A 4CWBA 4F4XA 2CUYA 4OYMA 3ZZPA 2IVYA 1Q4RA 2DGTA 3BSNA 1F9FA 5F8HA 4U6PA 1ZTTA 4ZP8A 2GNKA 1RTJA 4P72A 2M0GB 3QZ7A 4DL4A 1A7GE 3ADAC 4OHYA 3FMWA 5DQIA 3QIDA 1FFWB 3JSRA 3TO8A 3H59A 3MPYA 1NHVA 3C15A 1T94A 2ZM6J 1KONA 4EEYA 1UKUA 1TUGB 3LF0A 3ENQA 3QGPA 5C25A 4C48A 2HRYA 4DV3J 2FVSA 4U96A 3RB6A 4BBYA 5IQ6A 2H5JB 3L7UA 4DFPA 1JJCB 1FRHA 3NEKA 2ZHOA 5C42B 3MUVP 2RRBA 1S97A 3B78A 2IHR1 1WC0A 4PAAA 1FRLA 2IDEA 1XR7A 1L3UA 1Z2LA 1KS2A 4AXIA 1SL1A 1LQ9A 1WWHA 2K3IA 3W66A 3Q89A 1RADB 3KNGA 5EX3A 3MF5A 3CNQP 4C8OA 3OFGA 4JUZA 2BKNA 3JQMA 1QSYA 4IFYB 4PEOA 3IRWP 4B3TF 1TKTA 2BX6A 4USIA 3NS5A 2E7VA 4ZITA 2CJ9A 2QSWA 2P6SA 4C8YA 3WC2A 2C1EB 2DNLA 3LGHA 3J81j 1FE0A 1VQNS 1RWNB 2IMOA 3CDBA 3MMCA 2QIFA 5KG2A 3NCRA 4ECRA 3MR5A 2GQ2A 1NO8A 2CQCA 4WU3A 2YWWA 5FDLA 2J6SA 3QMQA 3THTA 3R2CJ 3PM9A 5F3ZA 2J9CA 5IC4B 3OVSA 4E98A 4LF9F 1RHJB 4YFUA 1GH8A 1URNA 5DETA 1DTQB 4J9QA 3I56S 2OO4A 1CPZA 2HQGA 5MLCV 3TOQA 1X5SA 1I6JA 2NPIA 4OI2A 2X1BA 2YKMA 4LF7F 4XDDA 4I67A 1EARA 2B5JA 1WHYA 2ZZTA 3A8KA 4TY9A 1Q7YT 4OYXA 4LR9A 3RBZA 4YR0A 3W2VA 2HLUA 4ER8A 3IBFB 5GAEI 3BO3A 3PYDA 7AT1B 3MM6A 1FK9B 3W61A 4ED4A 1NJXA 4OX8A 3I5AA 3SZ2A 3TEGA 4V1Ak 2YX4A 2O01C 3VAJA 1NPKA 2YKPA 4NRTA 5I3UB 2E5HA 3DGVA 2DO4A 3CF5Q 1XN9A 1PYTA 2LU2A 2A6MA 3CMAS 4DV2F 3HJFA 4KE5A 4DQPA 1ZAXA 3I31A 3EXYA 2BANB 5C24B 2Z30B 4KY3A 5K20B 4Q0BA 2R7QA 4GVBB 2ZUAA 3TAMA 4DL2A 5HSPA 4NRUA 2J7UA 2HVEA 2N3LA 4P10A 4HYKA 4FPRA 3QFWA 1UEUA 3M8SA 2RAQA 3BREA 3QGHA 3PZPA 3TX0A 1B7YB 2LLZA 3QBCA 3DRRA 4Z7CA 5LSLA 3DLGA 2VZ9A 4YMEA 4NZ0A 4W92B 3GV7B 2JJ4D 4UZBA 2LXIA 1QUVA 3SBMA 1RT2A 2K06A 5KFMA 3D4JA 2V2ZA 2X7IA 4OL8A 2RUSA 2BVZA 1NBEB 4R5PA 3BZQA 2KB2A 3T19A 4F2SA 2HHXA 4F04B 1F9HA 3GP9A 3FBBA 5IV4A 4X2BA 3H5UA 4NI2A 5I4MA 4KO0B 4RW4B 3VV2B 3W1YC 1TKXB 4WCEQ 1YZ7A 3W3SA 5DGBA 1Q1KA 2MEWA 3UN3A 4LR8A 4R0JA 2HWTA 4FPIA 1VDHA 3FUYA 2VA2A 4H54A 4AUKA 3Q8SB 5KFQA 5CCLA 2PFFB 2QA4G 2WSCC 4DS5A 3D0IE 2OJ3A 3I32A 1DHMA 4DR1J 4ZJLA 3K5MA 1S1UA 3BDEA 5GAHI 1BD6A 4QW8A 1JLEA 4UTGA 1CULB 2JEJA 5FD1A 5L1JA 3CJ4A 1IM6A 5DLGA 1LEOA 4KT0C 5HI7A 4RWXA 3KJVB 3VAFA 2DRBA 4U9RA 4MFBB 1R7IA 1RLDA 2UXBJ 1RYRA 3PIOQ 4RUCA 4NLGA 3MD1A 1NH7A 2IMWP 4QIWD 4Y3CA 1NZ8A 2OPQA 3S7RA 3G6XA 1IR0A 1RKJA 2XMAA 4O44B 4PKDB 4NLWA 4N8NA 3K57A 2VG6B 3DOKA 4QPTA 3N5BA 3Q8QB 2R2SA 3V81A 3G8QA 3GG0A 3D1HA 3HI9A 1EKRA 4J90A 1QAYA 1U8WA 3M6XA 2MKYA 4CT9A 2VG7B 1HYSA 4DR5F 2R8KA 1HQ2A 1O51A 2OI2A 1YTYA 2JEGA 1X5PA 1TL1A 1M5OC 1FX2A 1H6KX 2XS7A 1IKVB 1FTCA 1CEZA 1GTEA 2YWHA 1TU0B 2QE5A 1U47A 1F6TA 4JI7F 3S1TA 5F8NA 3PEHA 4WKRA 2QMWA 1F5CA 2AKWB 3KLFB 4F7VA 4IQMA 4X4SA 5C7PA 4JI2F 5CD4H 1BY9A 3M1VA 3DDKA 1T95A 2ZVIA 4J9OA 4B17A 2IAJB 2MQQA 1KOOA 3A3PB 3FCVA 3TAPA 3TQEA 1T03B 1RP5A 2H5EA 1S9EA 3P4UB 1KQGB 3AHPA 1R6YA 5E3CA 3JXOA 4RL1A 1FNOA 2LA6A 4LREA 4WFAQ 2I9SA 2OH2A 3H0PA 4AT1B 4IDKA 2R7VA 1VIXA 4DX6A 1ELOA 2PI4A 4O0NA 2JVOA 2DRAA 1YJTA 4ZPDA 2HNDA 1NSPA 3S01A 3HKWA 2VIHA 2LXFA 2KI2A 4IO9Q 1MROB 2IA0A 4ID5B 4WFYA 2BJ1A 1H7XA 5KFUA 3OHBA 4DSKA 4HVZA 4F0KA 4B3TJ 2VQFF 3R3TA 2I5JB 4LIRA 1LK7A 4O4GA 2MQMA 1RA7A 3IFEA 3F0NA 3UW1A 1W2BR 4I2QA 3BYRA 3I82A 1CJVB 2CPFA 1MU2A 1U2FA 3BBCA 1SJRA 2M52A 3JAMY 1DZ5A 2RF2B 4HLBA 4NLVA 4N5SA 3MR6A 2D9PA 3QZ8A 2FZKB 4W4MA 5DDPC 3MAAA 4ALZA 3WIUA 4LF9J 5LSOA 3LP1A 5KFOA 4UQTA 2CRLA 1I94J 3BSOA 4OLPA 1RHRB 5KFRA 1NM2A 3M9OB 2X1AA 5IT0A 4MKVA 3OJSA 1N48A 1MWQA 4DUTA 3KXDA 2F4VJ 1I51B 1YX2A 2E7XA 3IC1A 4C3LA 1LXJA 4I2PA 2BOPA 2XQCA 1WG5A 1VRTA 2ERRA 4LF7J 1Q79A 4M94A 3MOJB 4I56A 3T5KA 3PJXA 2MZQA 3PX6A 2AD9A 4P2FA 1TMJA 5E3RA 3GSIA 5IWAF 2YPZA 2DY9A 2M5YA 3KLIA 2J5AA 2WW8A 1Z2ZA 2DCLA 4L76A 3LALA 1Y3KA 5CH7B 2FIUA 1XTZA 5AE1A 1H3DA 3NXZA 1N5YA 3HM9A 1R8BA 2EVZA 1U2RA 5LMNF 3QAEA 4Y2KA 1R8HA 1ICEB 2UUWA 1EETB 2B9YA 3M6VA 4DEZA 1UVJA 3FZ2A 4FKXA 2C2KB 2N4CA 2E29A 4DV2J 4U7UK 2UVUA 2DISA 2Q1LA 3QT5A 4ZPTR 2L08A 5F8GA 5CCMA 3OXLA 2IRXA 1JLBB 2HLTA 3HPOA 5D3GA 1GAOA 1NNDA 1HNIB 1RAHB 1YJ7A 3I9V9 3IRXB 3IS9B 1NK7A 5E3QA 2QYGA 4JI1J 1U8SA 2XGQA 2EWHA 3GIRA 1O0PA 1X4FA 2C3MA 4QR1A 3C6UA 3GG1A 5IFMA 1V5VA 3C66A 4ZPWR 4A8MP 2EFQA 5L8RC 4LF5F 1PJ7A 3AOAA 3GCXP 4GC6A 1P27B 4HDGA 4UUXA 4QIFA 2GHVC 3MEEB 4N76A 7FDRA 4JV1A 4I7FA 1EIYB 4RBUA 4ILRA 3PW4A 2BW7A 4K4WA 1M1GA 1K47A 1J2VA 1OSDA 1RT3A 3D9BA 3N5FA 1RU2A 3B6BA 4OZ1A 2CQ1A 3K2YA 5DDRC 3TX8A 1S77D 4NLSA 4UY85 4AE5A 5DM6Q 1GMVA 3HT3A 1RABB 4DPWA 2FPHX 4MKAA 2R8JA 3RRGA 4PR6A 5DQGA 1R3NA 4C2MA 3KLHA 2UUBF 1RT5A 2XSJB 4F3QA 2C3OA 1KOHA 3IR6B 1J27A 2GGPB 3MCMA 3M8RA 2WHOA 4CYUB 4M5MA 5E33A 2DGQA 4IH5A 1X4EA 1SJ4P 3HHEA 3MHYA 3W62A 1BQXA 4OV1A 1NDKA 2PI5A 2XZTB 1V6HA 3AB2B 1VQ5S 2YKNB 2CIMA 5DG9A 5A8WB 1NDLA 5KG0A 4WBFA 3CMQA 4X66F 2BRLA 5KFKA 2Q79A 1N6QB 3MR3A 3CTRA 3PHTA 2YNHA 3OQ2A 5D4PA 2QLWA 2CJAA 3MM7A 3S8SA 1DFDA 4OI4A 3T9NA 3GWCA 1K0VA 2W7PA 1NXIA 1QY7A 3W2WB 1WELA 4JI0J 2W4DA 2Q66A 2ZOFA 4OZ5A 3NBPB 5D77A 4JV5F 3RTVA 2M9KA 3Q23A 3W5ZA 4Q45A 1Y11A 2RHQB 2XWXA 4DR5J 3HVRA 5KT4A 3PW2A 4L3KA 1FVQA 1YJRA 2XMUA 3VGUA 4RUBA 4A8KA 3T1YF 2DVIA 4ZVFA 5J2QB 2CPHA 3S6EA 3EZOA 3RG6A 1CJUB 2CPXA 3GJQB 4OI3A 5GAHU 4JI7J 2CPDA 4RW8A 3CDWA 1AYEA 2WBMA 2V9WA 2VOOA 4K4UA 5KT2A 1ULRA 3DM2B 2AW0A 2WONA 4M5NA 4P71A 4KFBA 5T7LB 5I3PA 3LOUA 3Q8UA 2CVEA 5ADZA 4EUVA 4DQSA 4I6AA 3GJSB 1M5SA 4NLXA 2MYFA 2VASA 1KR4A 1T05B 3SCJE 3CUNA 1PAEX 2UVRA 4PG6A 3AY0A 4H4MB 2XMTA 2QL7B 1N32F 1U49A 2DNGA 5CD4A 3DLEA 3IGNA 2AX0A 3EGZA 3IG1B 3PCOB 4LF6F 2XB2D 3LTOA 1HBMB 1E6VA 3H25A 1K0TA 3N9UC 2EKNA 2GFFA 2Q6CA 4ZVQB 1HNVA 3OSPA 4YS2A 3MI7X 2I2YA 2QZ8A 3U1LA 5HP1B 5JVHQ 3SCLE 2VQFJ 1EKSA 2RU9A 2YNFA 4YN3B 2HS3A 4N41A 3L09A 3Q2SC 3GU0A 2QYCA 2EFNA 5DZ6A 3E2EA 2CNOB 2LECA 1WHVA 2GW8A 5A8KB 3UDLA 4DPTA 5C24A 2YNGB 2WVEA 3BKTA 2NYHA 2A18A 3R1LA 4C0HA 4DLGA 5F0UA 1GXTA 1Q8LA 3KNAA 2DH8A 4P6QA 4ERDA 2MXYA 5C2GA 4QR2A 3OSNA 1URRA 4H4OB 5E0OA 2ROPA 1D0EA 3FEZA 1R0BG 4IRDA 2OIHA 5EWGA 2XI2A 4A8SA 1N34F 2CJBA 3QGGA 2GAHC 1VLYA 2V4JB 2W7AA 1QSSA 4QCLA 3BR8A 4EZ9A 3FBFA 4H4KC 3TA1A 1L3SA 1S1XA 4I68A 4PG8A 3K5OA 4J9SA 2DHGA 1PSDA 5ETTA 1OIAA 4KO0A 1TKXA 1N54B 2NQPA 2VV5A 4DFJA 1U48A 4FYWB 2V6AA 1QE1B 3AD9C 3UDEA 3N6MA 5E3AA 3M32A 2NXUA 1YBTA 4RJVA 4IOBA 5HLFA 3PO5A 1RU1A 3F73A 3GYXB 1UEVA 2YWKA 1RWOB 2CZ4A 4JI8J 2QJ3A 1IBMJ 1UFLA 2V4RA 4NLOA 4OHWA 1F5BA 3ZZZA 2JWNA 3DI6B 2CKWA 2RNEA 1VCTA 3NGSA 3KJVA 3QIPA 1W26A 4MFBA 1BWEA 3A3OB 4Y00A 1HI0P 3KHGA 2Z2ZA 1N5SA 2HFNA 4PPZA 1OY8A 5KFSA 3T1AA 3MCNA 2FVQA 2HAFA 5EN1A 1WC5A 3OLBA 4DV1J 1A0OB 3M6UA 2HFSA 4CCHA 3PXGa 2AEJA 2BRKA 1KFSA 1YBUA 2ZBPA 3U7JA 4LIWA 1FXLA 1TR0A 4LF5J 3SMZA 2VG6A 4DCJB 3WIVA 4YQWA 1QDUB 2G0IA 2QEXS 2QO3A 3MEKA 4USKA 4TKTA 1UFKA 3IAM9 3D5MA 1WC1A 4ECVA 3FMBA 1WF2A 4KV8B 3C14A 2Q3PA 3THVA 4DBQA 5D78A 1N8RT 1IKVA 4X4QA 1WHXA 4LRCA 3B54A 1DTTA 1R43A 2CQDA 2DITA 2QV6A 2LEAA 3BH6B 1C0UB 2UUBJ 2V8HA 3KLFA 3NGDA 4WIQA 2HGNA 3KUGA 1VK3A 2Z58B 3SV3A 5KFYA 3I6PA 5B0GA 4ZLNA 5I3QA 3PRBA 1XMQJ 1HR0F 4NYOA 3P5TL 3GMGA 3DYAA 2KRBA 1ZBTA 2HBQB 4WFBQ 1T03A 3UPFA 3P6YC 3A8EA 4CO1A 3N01A 4Y6IA 1VQYA 3FEXB 1WC4A 2AJ0A 2XC9A 3M30B 3FFIA 1TUVA 1RT4A 3NY0A 4X66J 2KH9A 3M8QB 5A0YA 3K89A 3BSAA 5F0WA 1PBAA 2KT2A 3DLBA 3BBBA 3CD7A 4Q2LA 5G4DA 1WDDA 1U7LA 3MEGA 3OXFA 1MMDA 4KPYA 3L3CA 4NCGB 5K8PA 4ID5A 3HHLA 3QJJA 5MAOA 1B0TA 4DU8A 2OSQA 4ZVUB 1UPPA 2Z57B 2XSFA 1X5TA 2CQ3A 2XCAA 2I5JA 4EWTA 2YKAA 3QQCD 2C3UA 2QLBB 2XY6A 2C2OB 3N0VA 1Q8BA 2XMJA 2PGCA 4F4WA 4XTTA 3HFZB 1CJVA 4DHVA 1L3VA 1Q53A 1IKYB 1VHFA 4QU7A 1Q8IA 3HJVA 4CNYA 1U6FA 1HQEA 5GAGI 1EJ7L 2LEPA 2HSEB 2P6TA 3RB4A 3AOBA 1U0SA 2RDJA 1FHTA 2DB1A 2JC1A 3SQGB 2ZFHA 2GX8A 4XPEA 4E0DA 3WQPA 2XNQA 4NZ7A 5B7WA 1QAXA 3IP0A 1CJKB 2QX0A 2R8HA 3DU5A 3EGVA 1NKEA 4JI4J 1QVGR 1N33J 2W9BB 3BQ1A 2ZD1B 2CNKB 2Z4PA 3CJ2A 1U6ZA 4UOGA 3LO3A 1N32J 4ZCIA 1RT7B 2HQIA 4ZCLA 1REVB 2KTQA 3RBDA 1H2TZ 3KJNB 4MYTA 2V8DA 8AT1B 1JLGB 1SKWA 4P52A 4HI2A 2OPRB 4F36A 1UVKA 1P9QC 1VOMA 2QLJB 4K5RA 3NMRA 3MECB 3AJ1A 4ECTA 3MMAA 4C3KA 3IR7B 2C3PA 3DLKB 4C9DA 2GVZB 3C46A 3NLCA 3BYPA 1DLOB 3E8OA 2HAIA 3ENWA 2HZAA 5CZVA 4ZJOA 1GXLA 3TJ8A 2XS5A 3OR1B 3V6DB 5HQLA 1IBKJ 1RTDA 3KYLA 2DHSA 4HHHA 1YLXA 2GVDB 2I8EA 1FESA 4MIWA 3GJRB 2ZDOA 1HNIA 3IRXA 3IS9A 4P9SA 5A76A 3CCES 3LP2A 2E5LF 2AJQA 1U1KA 2OUGA 2OTLS 4ED5A 2K7JA 2V50A 3T1HF 5KG1A 4DCPB 4AL5A 1LW2A 3D0HE 2GO9A 4X4NA 1HQUB 2EC0A 1QSLA 2DEJA 4RW7B 2XULA 1C0TB 1D8ZA 2HIYA 1IM4A 4USVA 5F9LA 4ZN1A 2J7KA 3BSCA 5E2QA 1FKPA 3RUBL 2ZNYA 3FK4A 4LF4J 4OMFG 2M8DB 4C7QA 3OJUA 5GMDA 2RD5C 5KG6A 1SL2A 4FDFA 3RB0A 3MEDA 1FRJA 1TL4A 2VKRA 3ZTSA 2GIRA 1Q5YA 2ZNZA 3CSKA 5DZ7A 4UW2A 3DRPB 1NU4A 4QWCA 3C16B 4UZCA 5GADI 4GO7X 3L7OA 2MB0B 4U8VA 4YOEA 4TU9A 2GGPA 2OEKA 4CYUA 2ZOGA 4WWSA 4OYBA 2YWEA 3ET6B 3UDCA 1OQ6A 2ACYA 4MYUA 3RR7A 1Y0HA 2MKIA 4RU9A 4P75A 3RGIA 1U1RA 1PCAA 5L1KA 1X0FA 2U2FA 3G6VA 3PTWA 1Y00A 4M5HA 3IN5A 4DL3A 3LP0A 2BE2A 1VC5A 1VLOA 2LQJA 4EO6A 2MKKA 1JLQA 3VVTA 4ICLB 1NK6A 1JLFB 2C2RA 2L9NA 1FJ7A 3MCSA 1APSA 4BLGA 2RQ4A 1N4LA 4EMDA 4HACB 3JSMB 1HBOA 3NNCA 1U1PA 3W2WA 4DV6F 1SJ1A 1SC1B 3NBPA 2JL9A 4F4YA 1R89A 3RYLA 4B3RF 2RRNA 2LFVA 4ES2A 1UCNA 3KLGB 4M5LA 1S72S 4ED1A 4IOCQ 2ASDA 4K2XA 1QAJA 4W90B 4WTYA 4PPDA 1VHIA 5F9NA 1NK5A 3AB4B 2PMHA 4OFZA 5J2QA 2N7CA 3QO9A 5KAKA 1S0OA 1R31A 4QR0A 3CJ8A 4R8UA 2W8LA 2XZDB 4ZCKA 2R7XA 2VPZB 3V6KA 3MURP 2RKIB 4C11B 4I4BA 1HHTP 1HWUA 1R0AB 3OTOF 3G6ES 2DY1A 2F8MA 3PW5A 3UD3P 2CQ0A 2OGUA 3HSJA 4K8RA 5T7LA 1HR0J 4WYWA 1RDRA 3GV8B 1JIHA 1M1KT 4RO0A 3EDQB 2P8IA 2F4FA 2YH1A 2G2ZA 4Z2XA 4EBCA 2QC3A 3CD6S 3DGPB 1RT1A 1VQSA 4H4MA 2V0NA 2NR0A 2QSFA 3MTJA 3HF5A 4ZPVR 4AQYF 2IM2A 1CJTA 4OJHA 3MFHA 3LWMA 4WFZA 3Q24A 3OFEA 4HL9A 5AJ3J 3CT9A 4X4OA 1HBMA 2GIQA 2DGWA 3ZZUA 1TK5A 3FGVA 3KK2B 3T3FA 1SUQA 4TVAB 1TFWA 5BYQA 1X9MA 2IVMA 4ID8A 3HSGA 2HS4A 1FXDA 1LWFA 2BV3A 1Q78A 5HBMB 2NCKL 5DDQC 3JQKA 2COLA 3VAIA 4I0WA 2KZMA 1HBNB 2DR8A 3OUYB 1IJFB 1IUJA 1WOOA 4QYRA 1HIYA 2BM0A 3MZIA 2UU9F 2MHEA 4ELUA 1CBKA 2GS8A 3CMES 4TLQA 1TV6B 2UUCF 3AQPA 4DXLA 2ADBA 2EEYA 4KB7A 2F1FA 2RT3A 2CXEA 3R5JB 1RT6A 4IYQA 2XHCA 3I5CA 3QPIA 3SFUA 2EFOA 2DHHA 1W25A 2BEFA 4C8NA 4NXMF 1RWWB 3LH2S 1RTHA 4K0KJ 2CDRB 2B0GA 1QTNB 3QRQA 1XMOJ 4ECSA 1T0TV 1RI7A 2G0CA 4NWBA 1OWXA 2XCPA 3OR2B 1RLCL 2Z8QA 1FJEB 5I42B 1MSWD 1VRQC 2NZ4A 1U2CA 4L72B 4OYZA 2XGPA 4AD6A 4IO1A 5KFNA 4QWEA 4NEYA 4CLPA 1U1QA 2KYXA 1S49A 2HZVA 1KKHA 1JMTA 2HGMA 1YJUA 2CVIA 5KFFA 1XMBA 2P2CB 2P5VA 5EUHA 4FYDA 5HANA 4K2JA 2XM3A 2HHTA 4OYPA 1SIWB 4J9LA 1G6BA 2AEFA 1V9OA 4DL5A 2ZZMA 4OLOA 2J76E 3V5RA 2DNYA 3SXLA 3HFVA 5A8RB 3R5GA 3PACA 2OLWA 2IYGA 1QJHA 4RNFA 4X62F 5GAGU 3D7SB 3SSQA 4QW9A 4I69A 3H7HB 4NPOA 1Y3JA 2R7SA 4HHJA 1L3KA 1WKKA 1NPPA 2VPWB 4LF2A 1F60B 1B4SA 3FQKA 4P7TA 3LW5C 3POTB 2X1GA 2ATCB 3DMJB 2AGOA 1VS3A 4YR2A 2RHSB 4OJGA 3CPWR 3MAHA 4B3MF 2QA4S 2J8AA 5LOQA 2H4WB 1KVIA 3MMBA 2R7UA 2E5LJ 2E9RX 3TZXA 3A12A 3IM9A 1EP4A 2YKOA 3CJ0A 1BQNA 1UZDA 4DL7A 3T1HJ 1DURA 2HFUA 2W2OP 1YWXA 1AXQA 2XO7A 5HQ8A 3DNCA 5BJRA 4PXBA 5D0GA 1ZYQA 4LFBJ 3PX4A 1N36J 2A3JA 2K7KA 2ASJA 7FD1A 2EG2A 3UCGA 4OYIA 2GCFA 1SV5A 2LYVA 1KHWA 1JLCB 4KV8A 4YDXA 2RH3A 5KG4A 2DNKA 3KLEB 3GIJA 4P2XA 2HFVA 5JJBA 3MR7A 2VICA 3BGRB 2L41A 3CCVS 4C6AA 1EHWA 3G71S 1ZETA 3VALA 3R5CA 4O3QA 3M2RA 2JHEA 3CO9A 1KLNA 4DX5A 1XNRJ 3NCPA 3QT6A 3RAMA 1ZPWX 2RMLA 3OV7A 2AEMA 1MMLA 1RE1B 3BGFA 4KRWA 4CLLA 4XIUA 5IOLA 2UV8G 5BR8J 1BXNA 1R8CA 3M30A 3TAQA 2MLZA 5ETLA 2MZJA 4CLFA 2LP4A 3PV8A 1IKXB 2EFGA 1JB0C 2Z56B 4DR4F 2YNIB 1JLAA 2JFKA 3HHNB 1YSJA 4M5JA 1ZM3A 4PG7A 3MAQA 5JVGQ 2HQCA 2V2KA 4Z7YA 5B0FA 4CQ1A 1OSCA 2VONA 4DV4J 2JX2A 3UE2A 4DV6J 2ZC4A 1S1TB 5E3PA 4B3RJ 4DV7J 1LOUA 2MHNA 1CQNA 3D2WA 3Q22A 2FLNA 5K5MA 4QWDA 1K73T 3HVTB 2WSFC 2V68A 3ITHA 5GADU 4ECYA 5HMXA 1SI9A 3QT7A 1IKYA 4USUA 2YH0A 3UO0A 3ZNJ1 2HK3A 1YVFA 1NK4A 1Z4UA 1YI2S 4BC9A 4ZHRA 2QMUB 2CPJA 1WOPA 2GMJA 3SQGA 3O5TB 4OZ2A 4IG3B 2XZWA 3HZGA 1YRXA 2VDIA 4MIBA 3ZFVA 4WYLA 2E1MC 3KMQA 2DR7A 4K4XA 3BO2A 2IM0A 1UZHA 4LF8F 3SV4A 3AA9A 2RDIA 1YJNS 4K5SA 1SC3B 3UVJA 3T6JA 1RTIA 3I96A 4CO4A 3DLJA 2JLEA 1VJQA 3NKYA 4AQYJ 2MZRA 5K14B 5KFDA 4EYIB 3P96A 2FVPA 3GZ7A 3R7NB 1OQ3A 3BB5A 2OP5A 3TA0A 3K8WA 1BC6A 3HKZD 3H2VE 3NGTA 4EK2A 1RYSA 2F7VA 1WUUA 3MECA 3GQCA 3VAKA 1FFGB 5DM7Q 5L9XA 2NXNA 3DLKA 1U6BA 1RJJA 3GSDA 4C3MA 1DLOA 1J5OB 5L9NA 2HHWA 3FC9A 5B08A 4K4TA 4C4WA 2B3TB 2HIQA 5K8MA 2UU9J 4CO3A 4U7UD 3BN7A 1GMWD 1FTRA 2IFXA 2E7WA 3V6DA 4N47A 4Y2AA 3PHEA 2XY5A 2M2BA 4DUYF 1RAFB 2ALYB 1ZOTA 4RNOA 3EX7B 3GTYX 2EG1A 3R6GB 4RW6B 3BEGB 1Y5LB 2XLJA 4NXMJ 1XNQF 2M3DA 3PYEA 3BS9A 1SKRA 1HL6A 5D15A 1YQHA 2IRYA 4LVOP 1IR2A 2F65A 1HWKA 5DO2A 4HT7A 1C0TA 2HHVA 1RWXB 4TY8B 5J2NB 2EXUA 4LFCJ 2R42A 4IUFA 2MSTA 1UTAA 4DDFA 2ZH8A 4MAKA 3W5XA 2G2YA 3E01A 2LQBA 2C2DA 4YY3F 3DC2A 1H7WA 4CDIA 2ZH9A 1NRKA 1K9MT 4DUZF 4O0IA 3ISND 1QAIA 2HBRB 1HNWJ 3QRRA 1KQSR 2FGOA 1IBLF 4J9KA 3NRBA 3UR0A 4IG0A 2RSQA 2BQ3A 3M4XA 3QRPA 2EFVA 3PJWA 2GJ2A 2MGZA 4WZMA 3FSIA 3QATA 3ZZOA 3AXKA 1D8YA 1FNXH 5KFCA 1S0NA 2RUGA 2QTWA 1LFPA 1SH3A 3CJ5A 3WX8A 3DOLB 4ECZA 4NLUA 3ZZRA 2HW3A 1QVFR 5F8IA 4DPUA 5ETSA 4HH1A 4BHQA 5KFVA 2VG5A 3DRSA 4O3NA 4ICLA 4RU2A 3J81U 4DV5F 4ELTA 1VRUB 4KHPF 2C42A 1FO1A 2BQUA 2AV5A 2IYIA 1RGVA 4USWA 3JTNA 3JSMA 1XBWA 2AJ4A 1S76D 1RK8A 1S0MA 1NK9A 3H98A 4FBTA 3M8WA 1VBXA 2IJFA 1K1SA 4ZS6A 1P6TA 3SYZA 3CCJS 4QYZJ 1AZSA 3CGIA 4PYDA 2IBOA 3I55S 4BWJA 5HROA 2F3JA 4M5KA 5ETRA 4F8RA 4YB7A 1S4EA 1WSVA 2Y3YA 3CJKA 3CEDA 5GVQA 3EVMA 2G0JA 1KLMA 1IWGA 3EICA 1U1MA 3Q86A 1TTHB 2WB1D 3MM5B 4LT6A 3ISZA 2LU1A 4FNIA 1AROP 5B0EA 4DR3J 1TKDA 3SDEB 2RDDA 4J9VA 4RLEA 1E6YB 1W7WA 2Z2MA 1YHQS 5A2QU 3QSIA 3VGVA 2BOAA 1HPZA 2LVWA 2Z2LA 3TZWA 4YB5A 1Q82T 2FVRA 1LWCB 4USTA 2UZAA 4LSLA 2E9TA 2HGLA 2ZJQQ 3O44A 4NEZA 3MFIA 1S4FA 2FD2A 4G65A 5J1EB 1NH8A 4DR4J 3CDAA 1ZM2A 4GKJF 1NPRA 1NJWA 3W5YA 1GX6A 4OYOA 4OI0A 4ZVPB 4K50A 3FBEA 4X64J 2DD8S 1ZZFA 2W9CA 4HH0A 2G9OA 3L7PA 4ZVTB 5IM0B 2AZ1A 2CPEA 3BR9A 1BE4A 3IO1A 1WI6A 3HP6A 2C22A 1H2VZ 4BWMA 1S57A 5THWA 1GX5A 3OLAA 2Y1LB 3BQ0A 5T41A 3OUYA 3KOAA 4ITSA 2AJ2A 3IM8A 2DH9A 2XWYA 4LJMA 4KH0B 1SC4B 1AW0A 5F8MA 6AT1B 3TJAA 1HWIA 1B0VA 2WCXA 1TL7A 2HHHF 4RNMA 2KHCA 1UMJA 2FY1A 1NSKL 2VC0A 4DSJA 3VGTA 1RQ0A 1RTJB 3JQJA 5KFEA 2ZJRQ 2AYEA 2AIRB 3AJDA 3I4PA 3GFXA 3OD2A 2BBEA 3EGWB 2CQGA 5H9EJ 3I0SA 3C15B 2KYZA 4A8OA 1FWPA 3DOMB 2UUAF 4LF8J 1VQ7S 4Y2CA 5CYQB 1FDBA 4ANEA 3OXGA 2W4PA 3OTBA 2FJEB 4NOHA 4DR6F 2QMXA 1U0HA 2PMZD 2V2QA 1HHSA 5ETVA 4C8KA 2UXCF 1VQ6S 3I4HX 3Q8PB 4XDCA 3CCUS 3P5BP 1CG2A 1KN6A 2HPUA 3VTIA 1F2GA 1S6QB 1Q81T 3ILOA 4Q44A 2FC8A 4CH0S 2QA2A 3ZTPA 4FZVA 3HDSA 3TVYA 2HHSA 1FI4A 4H4KA 2MKSA 1TP7A 4UF4A 4KQZA 1SBRA 2V9KA 4B9TA 1BWVA 4V19X 2OHDA 2DT9A 3DHXA 3O3LA 3IAS9 3JB9k 3QJLA 2MZ1A 2A10A 2A6OA 1TKTB 2J9DE 5HMWA 3P3DA 3PG9A 2BKOA 4LVNP 2EW9A 3MUTP 2B9WA 6FDRA 4DUYJ 4ED2A 1C1CA 3NWGA 3MMCB 3GONA 4NL5A 1FCAA 2H54B 2HG4A 5G0RB 1XNQJ 1HARA 5FDLB 5KFGA 3NP5A 1WKLA 4ZLLA 3TUJC 4WK3A 2W2QP 2VD3A 1S1WB 2DNQA 4GKKF 2V5HG 1X8DA 1F5AA 2LCWA 2JEFA 3OVBA 2HHQA 1EQ0A 3D67A 3RU0A 5ETQA 4QIGA 3OL8A 2H51B 2UXDF 4Y2MA 1N0UA 3DHWC 4HDHA 5LM7E 2OMOA 3TP2A 1MMNA 2IM1A 2IJRA 3AAWB 4YY3J 3K7RA 1JLCA 2YKMB 3M2UA 1TAUA 1OYEA 2B5JB 2B51A 1X4HA 3KLEA 1PC4A 5EX0A 3RRKA 4RW9A 5IS2A 1FD8A 1KTVA 3P45B 4MJKA 3HD1A 4QIVA 1NDCA 2FVCA 4YUDA 5HQMA 4YHHJ 3OHAA 3T5LA 4X65F 1X4GA 1KC8T 2KXHA 3I9ZA 2XBPA 3CVKA 4RX6A 4ZJQA 3PJ9A 4RBTA 3M9NB 4K4ZA 3KDOA 3KJQB 2K1RA 3U02A 3TNVA 1DQAA 1RWKB 5KOXA 2V4QA 2MQOA 4JI3J 4OYWA 4ZP9A 4F50A 3SIPB 3H8YA 1NB7A 2UP1A 4WJBA 1PG5B 1FDAA 2AP6A 4DG1B 3VF0B 3NAHA 4DS4A 2DCUB 4JYAJ 3MM9A 3TAMB 4G1QA 3CCZA 4DV5J 3KHRA 2GV1A 3U1MA 4KHPJ 1IR1A 1N0VC 1X7VA 3R9LA 2U1AA 2EC2A 1FFSB 3DFEA 4IR9A 4CM0A 3MPVA 2DPJA 1KVKA 2DH7A 3BH7B 4F4KA 4KGXB 3DRRB 4A8YA 1CS4A 2ZHBA 3DLGB 4WE1A 2MQNA 3G6YA 2VFSA 2Y9HA 2VFUA 4JI6F 1U1OA 2D7SA 3TQ1A 3LA0A 1JJHA 3D66A 2BJ9A 3O2IA 2ZVSA 1RT2B 3IBWA 4YB6A 5J2MB 5KFAA 2X3DA 2L9WA 3EM1A 4MKYA 1KQKA 1NHKL 4YP3A 4R5PB 1RAIB 3SSRA 3G82A 1S0VA 4QJVA 3O1LA 2R7OA 1F3FA 5KFWA 1WORA 3WHIA 1AB8A 4NI2B 2MKHA 3AH6A 1RWMB 1S6PA 4WPAA 3D28A 2YX7A 2DR5A 4IG3A 4FF4A 2KG1A 3MM8A 1FKAF 2F5GA 2B8PA 1XJWB 1B7FA 2ZHAA 2ZM6F 5AXNA 4JBCA 2BE9B 3F41A 3H90A 5L46A 5EDWA 3CJRA 4CRJA 2LDIA 3UN5A 2VJVA 2DR6A 1JLEB 4LUBA 2IPOB 1C1BA 1XK8A 3ZTOA 1MLAA 4QOTA 1ZZNA 4GKJJ 2RJZA 4WTOB 2DNMA 4B9SA 1S59A 2W8KA 3RB3A 1BGXT 1WSRA 3ZTQA 2GC8A 3QLHA 1X5OA 3CJ3A 4A4JA 2FJAB 2Z2YB 2J6TA 3IMQJ 2BKPA 5KFHA 1T9XA 3M8YA 2HVHA 4O3PA 2WOMA 4K4YA 1IWAA 4KGZB 3AJ2A 3GYNA 1B3TA 2OEJA 3LGNA 3T6BA 2E1RA 3TVZA 1YJWS 3R2DJ 4X4VA 3LGMA 1TUWA 4PWDB 1HW9A 2CPYA 5HO4A 2WTFA 2KZZA 1HYSB 1HLWA 3MMJA 1TL1B 3DRXA 2HHHJ 2FUG9 4KHMA 3HHLD 4IH7A 4F0HA 3GB0A 5LJ3Y 2AJ1A 1N88A 2HRTA 1WG1A 3LUYA 2CG8A 3HCXA 2RQMA 3CD0A 3VCDA 1RAGB 2M4MA 1X4AA 2IIHA 3HLUA 1CC8A 5DQHA 1NEEA 2B8QA 2VPYB 4KGMA 2VFRA 3PNIA 2HHUA 1NHUA 4L6V3 3PYGA 2RU3A 4D3HA 2UUAJ 4A8WA 2PSZA 2YQ0A 1GFWB 4NA2A 2GZOA 1S7HA 3M1VB 3MXHP 4O4RA 3IR5B 4DR6J 4ED7A 2LMIA 2JDJA 5DG8A 4E8UA 2UXCJ 2HWIA 2ILZA 1S9EB 1LW0A 2CAJA 1TL3A 2KO1A 2LDYA 4KR0B 4R0EA 3TZZA 3J81Y 1B64A 2AT1B 2KXNB 4KSEB 4IDKB 2APOA 2O3DA 2E5IA 4KJIA 3BGLA 2G1HA 1WEYA 3D54A 4TXSA 2HNDB 2RILA 2V69A 4HTIA 4JI5F 2AHOB 4LR7A 5FLXU 2YQ3A 3C6TB 2L48A 3M8PB 4TU8A 1WACA 1HMVB 3DOLA 3C19A 1X0PA 1SXLA 5EHHA 2L3MA 3T5JA 3GIIA 4L73A 4I2QB 5GAEU 4P2MA 1HI1A 2DIUA 1MU2B 5KT5A 3OPKA 1VQ9S 4IQXA 3TWZA 2M88A 3VQSA 2NSBA 5A6PA 1T9UA 4K59A 2HZCA 2FJBB 1RCXB 3A3NB 3LAMA 1Q0NA 2D3OR 1I1GA 4N77A 1H72C 5A2QY 3FCHA 1FERA 1VQLS 4HTJA 5B0CA 2HVZA 4Q7AA 4F02A 2C2NA 4DQRA 2JFDA 4J9RA 3NGKA 4I2PB 1H74A 2VC1A 2I0XA 1UAWA 3FBCA 1DAXA 3UN2A 4O3OA 1VBYA 2HRUA 4Y0FA 1H73A 2FTRA 3KLIB 4NLQA 5LXRA 2AGPA 4RNNA 4RUAA 1LNQA 4CLWA 5C42A 2JLGA 1WC3A 1CQMA 3G4SS 2VBWA 3R5BA 2H4YB 4OI6A 3SDEA 1E6YA 4W98A 3M9MB 2VKZG 2Y8WA 4M5GA 3T41A 5AT1B 3TRGA 3US5A 5KT6A 1CLFA 2CNLB 2YTCA 2RS8A 1XQIA 8ATCB 5M2RA 1T9WA 2YPYA 1XC9A 2X1FA 3JTPA 5B0BA 2KVQE 2JOQA 5CZXA 2F8EX 1DRZA 5CA5A 4PG4A 4IFYA 2HHPA 4KAIA 1SH0A 3RBEA 5T14A 3PKYA 2NSCA 2NLWA 3R97A 4UT4A 5D3GB 1L3TA 3H5XA 5D0RA 2R7WA 2UXBF 4HR2A 2NXJA 4JOUA 1WC6A 1R8AA 4OYAA 1UFWA 3EVOA 2D1CA 2ALZA 3V4MA 1T8EA 1S10A 1SPBP 2ZWOA 3NS6A 1JXEA 2JVRA
chains in the Genus database with same CATH topology
2GHWA 1IKVB 1FTCA 4QBUA 2OFHX 1CEZA 1UVNA 5A8RB 2FJWA 3WZ0A 3PACA 3EYZA 1B0PA 1O5JA 2CQ2A 1DTQA 1GTEA 2OLWA 2IYGA 1QJHA 2RQCA 1TKZB 2VODA 1VIOA 4RNFA 4EBEA 2KXFA 3QYYA 2YWHA 4X62F 5GAGU 1WD6A 3WBZA 2R9LA 2KFZA 2BDPA 3UWTA 4A8QA 2OKQA 2QE5A 2YWFA 5KT3A 1U47A 3TVKA 3K5LA 3SSQA 4JI7F 4G3IA 4QW9A 4FP9A 1RT3B 4I69A 1S6UA 2DHAA 3S1TA 5F8NA 4CH1A 4NPOA 3PEHA 1Y3JA 4WKRA 1LWEB 1IKWB 2D3UA 2R7SA 2ZBIA 4HHJA 5FJ4A 3ISNC 2QMWA 1SJQA 2EBEA 1F5CA 1SKSA 1L3KA 3FSYA 3KLFB 3BQ2A 1RISA 2VPWB 1ZM9A 1F60B 3EGNA 3FQKA 2I1RA 4P7TA 3IGVA 4AL7A 4IQMA 3LW5C 1WI8A 3POTB 1JLFA 2CQIA 4N8OA 4X4SA 1RA6A 4JI2F 2X1GA 3DMJB 5CD4H 3H40A 4UOCA 1DQ9A 1IN0A 1BY9A 3CD5A 1VS3A 3M1VA 1VI7A 2AGOA 3DDKA 4YR2A 1T95A 4OJGA 3CPWR 3MAHA 4J9OA 2BUNA 4B3MF 4B17A 2QA4S 2IAJB 2J8AA 4OHVA 2MQQA 2MJNA 1KOOA 3KLHB 1KVIA 3IWLA 3MMBA 2DGSA 3HVAA 3TAPA 2X3GA 2R7UA 1RT5B 5SUHA 2HMIA 2E9RX 1T03B 1RP5A 2GJIA 2H5EA 3HHDA 3VQTA 2RS2A 4F3MA 1EP4A 1FK9A 1S9EA 2YKOA 3CJ0A 3DOMA 5L38A 3ULHA 1KQGB 3AHPA 1BQNA 1R6YA 1UETA 5E3CA 2GQQA 4Q43A 3VAHA 3KLGA 3EZ5A 2XMKA 4J9NA 1FNOA 5CYQA 4DL7A 3R27A 1MWYA 2LA6A 1DURA 4WFAQ 2I9SA 2OH2A 1JJ4A 4Q8FA 1YWXA 5DGAA 1AXQA 2OSRA 1WEZA 3FRYA 4IDKA 2R7VA 2XO7A 1FDNA 1VIXA 3DNCA 5HQ8A 4FXDA 5BJRA 4PXBA 1SB6A 4NLTA 1ELOA 5KG5A 2PI4A 1LFWA 2JVOA 1ZYQA 2DRAA 2Z0GA 1YJTA 1FRKA 2DHXA 4A47A 4ZPDA 3PX4A 2HNDA 2XEXA 2ZH4A 2A3JA 2K7KA 3LANA 2ASJA 1HWLA 5E5NA 7FD1A 5I3UA 2EG2A 2DNNA 3S01A 3HKWA 3FEYB 3UCGA 1TL5A 4NA1A 2RRAA 2VBXA 2GCFA 2HFZA 2LXFA 1SV5A 2LYVA 2KI2A 3UI3A 4IO9Q 1NJYA 1MROB 2KDOA 2IA0A 2GHPA 1KHWA 4FVMA 1JLCB 4ID5B 4KV8A 4WFYA 3OL6A 1S6QA 1H7XA 5KFUA 1SC6A 2RKIA 4YDXA 4C11A 3OHBA 3KMSA 1KQFB 5K8NA 1HNZF 1R0AA 2RH3A 4DSKA 5FIIA 3CDUA 5KG4A 2BANA 4HVZA 5J2PB 4CNZA 2XHWA 4LFBF 2DNKA 2VQFF 2YNHB 3FVYA 1FRXA 3KLEB 4NX9A 1KEKA 3GIJA 1N36F 3MM7B 3R3TA 2FGCA 1GTHA 3N79A 2I5JB 3FDSA 4LIRA 1LK7A 4O4GA 2MQMA 5JJBA 1RA7A 4RNHA 3IFEA 3K8VA 3E01B 2PA3A 3BGRB 3UW1A 3HMJG 2L41A 1W2BR 4B3SF 3CCVS 4I2QA 3I82A 4NLDA 1X9WA 3MTKA 2DNRA 2CPFA 4ZKAA 3G71S 1MU2A 1ZETA 1U45A 3MPWA 1VK8A 1U2FA 4OI1A 4B02A 1SJRA 4DL6A 2M52A 2DNPA 1ZAWA 3JAMY 4ETZA 3VALA 3V6HA 3DGPA 3R5CA 1DZ5A 4CIOA 2RF2B 2FLLA 1H98A 3TANA 4HLBA 4NLVA 4N5SA 3MR6A 1Z1ZA 2D9PA 3EUNA 4O3QA 3M2RA 2JHEA 3QZ8A 4A8FA 4J5OA 3CO9A 1KLNA 5DDPC 1UJ5A 3NCPA 4ALZA 5BYSA 4IG0B 2KKHA 5LSOA 3RAMA 2E5GA 3LP1A 4USHA 1ZPWX 5KFOA 1FVSA 1QLNA 4UQTA 2CRLA 1S9FA 2KFNA 3BSOA 2RMLA 4OLPA 3OV7A 4PUOB 1R27B 2FJDB 4Q2MA 5KFRA 1UVLA 3M9OB 2X1AA 1U4BA 1D9DA 4C97A 5IT0A 1TAQA 5G0RA 1MMLA 3OJSA 1N48A 2OD4A 3T9ZA 3BGFA 4KRWA 4XIUA 2NUHA 4ATNA 1UJ4A 2UV8G 2MGZB 2FHKA 2CJQA 3B4MA 2FJVA 1R8CA 2KN4A 1S9GB 5KFZA 4ZDNA 5H1SV 2E7XA 3H5SA 3IC1A 4C3LA 1LXJA 3KK2A 1S1WA 3KHLA 4RW8B 1XNRF 1M90T 3M30A 4I2PA 3TAQA 1IQZA 2BOPA 2BM1A 2MZJA 5LXYA 1KVJA 2FLOA 1WG5A 1VRTA 4KKOA 3PV8A 1IKXB 1O8BA 2EFGA 2ERRA 3QJPA 1IJEB 1JB0C 2A1BA 4DR4F 1Q79A 5LT5A 1I94F 2YNIB 2NUUG 4M94A 1JLAA 2JFKA 3UFCX 3HHNB 2R4FA 3MOJB 3CCQS 4I56A 3T5KA 2WONB 4WFXA 1NK8A 4M63A 4RW4A 1YSJA 3PJXA 2KT5A 2F8HA 2MZQA 4KFBB 1WTFA 3GFYA 1ZM3A 4PG7A 5HBMA 4MIAA 4JV0A 3MAQA 2ROGA 5JVGQ 2AD9A 2BR0A 5BR8F 5E3RA 2V2KA 1BLUA 4WIIA 3H5YA 2F4VF 5IWAF 2POKA 4IFVB 5B0FA 4CQ1A 1OSCA 1HBNA 2VONA 2ZITA 2M5YA 2JX2A 3KLIA 2J5AA 2VG5B 5F3TA 2WW8A 5DS7A 3UE2A 2GMLA 3KK1B 2ZC4A 1Z2ZA 1S1TB 1X9SA 4F67A 4UUWA 2DCLA 4IRKA 3DRSB 3KG1A 3LALA 1Y3KA 5CH7B 2FIUA 5E3PA 1D9AA 2YY3A 3N6NA 1AFIA 1XTZA 5AE1A 4QQBA 2W4CA 1OO0B 2RVJA 2UUTA 1TV6A 4AXJA 1LOUA 2MHNA 3F56A 1CQNA 1H3DA 1N5YA 3D2WA 3Q22A 2FHJD 2FLNA 4F3OA 5K5MA 4PXDA 4QWDA 4NCBA 4IH6A 4DJBA 3J7YI 4B9LA 2DBBA 1XWLA 3UD4P 1K73T 3HVTB 2WSFC 3DLEB 2C2EA 2FDNA 2WBRA 3SFGA 5C5JA 1R8BA 3HM9A 3ITHA 2EVZA 4URGA 4DV4F 2CQBA 3H4DA 1U2RA 4Q5VA 5GADU 4U67Q 4ECYA 5LMNF 3QAEA 5HMXA 1SI9A 3R1HA 3TA2A 4G6VB 4Y2KA 1R8HA 3SCKE 1E6VB 2UUWA 1EETB 3PY8A 4V19J 2B9YA 1IKYA 1DQ8A 3M6VA 2VBZA 4LSNB 4HKQA 1H2UX 4DEZA 4DV7F 2YH0A 1UVJA 1V3RA 3FZ2A 3W7BA 4DFKA 2OPSA 1YVFA 5U47A 1LV5A 3UCZP 1NK4A 1RKIA 4RBVA 3UQSA 2B7CB 5KFLA 4QWAA 3K59A 2N4CA 1Z4UA 3K5NA 1HNVB 2ABYA 4CO2A 2CYYA 2E29A 1YI2S 4BC9A 4ZHRA 2ZDPA 3OR2A 4U7UK 1GQEA 2UVUA 2CPJA 2DISA 3X3UA 1SL0A 2Q1LA 4ZPTR 2L08A 5HROB 2KVIA 5F8GA 5I42A 4DN0A 2ZH6A 4NYPA 2GMJA 1FE4A 4B3OB 3SQGA 2OPPB 3H2UB 2YNFB 5C25B 3O5TB 4QWBA 5CCMA 2W7OA 3CJKB 3OXLA 2IRXA 4IG3B 1X4CA 4O44A 2XZWA 3GIMA 1TZ0A 2FB0A 3C8YA 1JLBB 2HLTA 3HZGA 3HPOA 3HZEA 1YRXA 4XK8C 5D3GA 1GAOA 1NNDA 4MIBA 1HNIB 3CCWA 1KLMB 4HI1A 4DF8A 3I9V9 3IRXB 3IS9B 4L3NA 1HA1A 3ZFVA 1NK7A 5E3QA 4DG1A 1U8SA 5KFPA 2NYIA 2VBYA 2E1MC 4WYLA 2XGQA 3KMQA 2DR7A 2EWHA 4FN5A 1P1LA 4DMZA 1O0PA 4K4XA 5KFXA 3CC4S 3BO2A 2IM0A 1X4FA 2B6AA 4CTAA 4LF8F 4ZPCA 1UVIA 2MJUA 2C3MA 4QR1A 3SV4A 4DSLA 3AA9A 1JXLA 2RDIA 2AJFE 2VG7A 1N5TA 3C6UA 4K5SA 5LSRA 2XMVA 1YJNS 3GG1A 4GC7A 5IFMA 2D74B 5SZTA 3C66A 4ZPWR 2DGXA 3T6JA 4A8MP 2EFQA 4KC5A 5L8RC 1RTIA 3I96A 4LF5F 4CO4A 5HN0A 5CXTA 4GC6A 3DLJA 2JLEA 1P27B 4HDGA 2DGOA 4UUXA 3R5DA 4Y2IA 4QIFA 3NKYA 2CG4A 2R2RA 2GHVC 4IR1A 3MEEB 4N76A 4JI1F 2MZRA 7FDRA 5A8RA 3JYTB 4JV1A 1HPZB 4IRCA 4I7FA 5K14B 2MPUA 4RBUA 4ILRA 2VA3A 3G8SA 5KFDA 4EYIB 4BCAA 3PVXA 3P96A 2FVPA 4A8XA 3PW4A 3GZ7A 3TARA 3QAUA 4K4WA 1OQ3A 3BB5A 4LSLB 2OP5A 4TLRA 3TA0A 2MSSA 1J2VA 1OSDA 1RT3A 3K8WA 1BC6A 3JTOA 4OJ3A 3N5FA 5KFJA 3EZUA 3BN4A 1KSPA 3DU6A 4OZ1A 3HKZD 2CQ1A 3H2VE 1YRUA 4PXCA 1RYSA 2F7VA 3K2YA 5DDRC 3MECA 1BQMA 1HBUB 3TX8A 3GQCA 4PCQA 3VAKA 5DM7Q 2QRRA 5L9XA 1S77D 4NLSA 4OZJA 3POTA 4UY85 3R5AA 4AE5A 5DM6Q 5J2MA 3DMJA 3HFKA 3DLKA 4DSIA 2F9DA 3HT3A 1U6BA 1XR6A 3SEOA 1RJJA 1XEZA 4A48A 4ZVHA 4ILMA 2JEIA 3GSDA 4C3MA 1DLOA 4EYHB 1J5OB 1K8AT 2FPHX 4OIXA 4MKAA 2R8JA 3RRGA 2HNYB 1KHVA 4PR6A 5L9NA 2IAJA 1R3NA 5DQGA 2W9CB 2HHWA 4C2MA 2ZZNA 3KLHA 5B08A 4K4TA 2PE8A 2UUBF 4C4WA 2P9GA 1S1XB 2B3TB 5IZHA 2HIQA 5M2PA 1RT5A 2XSJB 4F3QA 2C3OA 5K8MA 2B4PA 1Y9OA 1VQKS 1XERA 4CO3A 1X4DA 2DGUA 1VBZA 2VQEF 2PC6A 1KOHA 2FHMA 1FTRA 2IFXA 2E7WA 3BN7A 3GE9A 3RW7A 4YDDB 3V6DA 4N47A 4Y2AA 3PHEA 4CI0B 3IR6B 3K5PA 3Q8RB 2K3KA 2GGPB 2XY5A 1XR5A 2M2BA 1NJIT 4ECQA 3M8RA 4RWWA 4DUYF 2WHOA 1ZOTA 2F40A 3ONQA 5E33A 4RNOA 3EX7B 2XMWA 4OX7A 2DGQA 2EG1A 4IH5A 1X4EA 5LJ5Y 1D3WA 2YKQA 4RW6B 3HHEA 1SJ4P 1YGYA 3BEGB 3MHYA 1Y5LB 2RQKA 3OBIA 2XLJA 3CULA 2IVFB 1BQXA 4OV1A 5F41A 1DBDA 3NAIA 4TU7A 1XNQF 1JK9B 3M32B 1UL3A 2M3DA 3NG8A 2ASLA 2PI5A 1V6HA 3ETOA 1UA1A 2NREA 3CIZA 3BS9A 5HLFB 3AB2B 1VQ5S 2VUGA 2R2TA 1SKRA 3CC7S 2YKNB 3KG4A 2CIMA 2EK1A 1HL6A 5DG9A 5A8WB 1IQTA 5AE3A 4EBDA 2UVVA 5KG0A 4X4PA 3PRDA 1MROA 4WF9Q 1YQHA 4ECXA 2IRYA 2VL1A 4LVOP 4X66F 5DG7A 4WXOA 1G7CB 1HWKA 2BRLA 5KFKA 1D9FA 2Q79A 1N6QB 2E1AA 5DO2A 5KFIA 3MR3A 4HT7A 3PO4A 3CTRA 2KFYA 3C2PA 2YNHA 1C0TA 2HHVA 3OQ2A 4TY8B 2QLWA 5D4PA 2CJAA 1ZAVA 3MM7A 5J2NB 3MR2A 3S8SA 4IUFA 6FD1A 1DFDA 4OI4A 3QIPB 4GMKA 3T9NA 2FHJA 2MSTA 3TR5A 1WTBA 2ZH8A 4DDFA 1TVRB 3GWCA 4MAKA 1U1NA 1K0VA 3E01A 3W2VB 2W7PA 2LQBA 2JSXA 3BGRA 3I0SB 2C2DA 1QY7A 3W2WB 1WELA 3B4DA 4YY3F 2J0XA 2W4DA 3DC2A 1H7WA 2Q66A 4C8MA 2ZOFA 4OZ5A 3NBPB 1JNZB 2NPFA 1WF0A 2SXL