4OJ1A

Crystal structure of truncated acylphosphatase from s. sulfataricus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Crystal structure of truncated Acylphosphatase from S. sulfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 24
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oj1A00
3HFKA 2GA7A 4HL9A 5B0FA 1CC8A 1Q4RA 2Q3PA 2W4DA 3LGMA 4U9RA 4QOTA 4F67A 1KVIA 1Y3KA 5B0BA 1OSDA 1LQ9A 4A46A 4HH1A 1TR0A 2QLXA 1MWZA 1SB6A 1TUVA 2BBEA 3TNVA 2PGCA 1FEEA 3HHLB 1V3ZA 3WDOA 2HFOA 5B09A 2XMWA 3K7RA 3TOQA 1Y3JA 2FHMA 1ULRA 3HHLA 4OJ1A 2OFHX 2IYGA 4OJ3A 5B0DA 1S6OA 2G9OA 2ROPA 1N5TA 1TL5A 1R6YA 1MWYA 2GV1A 3KKFA 4NPOA 1Q8BA 2N4DA 2GCFA 1KVJA 2QLWA 3DCAA 2QIFA 2ROGA 3BB5A 4ZOSA 3T9NA 1W2IA 2RMLA 1N5SA 2N4CA 2ACYA 2OD6A 1N5VA 3DXSX 4HH0A 3IWLA 2KYZA 4DPOA 3E8OA 4A48A 1AFJA 2XMVA 3FGVA 2RU9A 1AW0A 3BDEA 1Q8LA 2XMJA 1FE0A 2IFXA 2AJ1A 4NL5A 5A6PA 4Q2MA 3FMBA 2VH7A 3KG0A 5F0UA 4A47A 2OMOA 2N7YA 2LDIA 4OJHA 3LO3A 4DL0C 2XMKA 2GFFA 3I9ZA 1YJUA 2ZDOA 1TZ0A 4Y2MA 2RILA 4OIXA 1FESA 2OFGX 3BGUA 2W4CA 3QMQA 5T7LB 1CPZA 1SI9A 2L3MA 5F0WA 3FRYA 1YRXA 1AFIA 1U7LA 3MZIA 5T7LA 2K7KA 2HQIA 2BJEA 1QUPA 4FNIA 3KNGA 2HLUA 2KT3A 2ASYA 3HHLD 1JWWA 1CC7A 1OQ3A 1N5QA 3BR8A 4ZA1A 1XBWA 1P6TA 2K1RA 5B08A 2OAUA 1YJVA 3UDCA 5IXUA 3HHLC 4FNHA 3IWXA 2EW9A 2PD1A 2ROEA 1JK9B 1FE4A 4YEAA 2KT2A 1APSA 2XMMA 2OD4A 2BJDA 1Q53A 2HFNA 2LQ9A 4Q2LA 3BN7A 4Y2KA 1P8GA 5B0EA 5A6WA 2LXFA 1FVSA 2RSQA 2XMTA 5K9FA 2GO8A 1KQKA 2JDJA 4Y2IA 2BUNA 2BYCA 1VQSA 1K0VA 3HX9A 2AJ0A 3MCSA 1VQYA 3GZ7A 3KG1A 5B0GA 4DN9A 1YJTA 2K2PA 1OQ6A 2ZDPA 4HI1A 2QYCA 1URRA 3BM7A 1IUJA 2K1RB 2OP5A 2GGPB 2CRLA 3BF4A 3VTIA 1X0PA 2FTRA 5KAKA 3F44A 2AW0A 3CJKB 2GGPA 4YDXA 4A4JA 1FVQA 3LGNA 1WD6A 2AP6A 1X8DA 2K7JA 3CJKA 2XMUA 2KKHA 2FB0A 1YG0A 1Y9OA 4OJGA 2IYIA 1FD8A 3HDSA 1GXTA 4HI2A 1X7VA 1RJJA 5B0AA 2OKQA 1GXUA 2VV5A 1S6UA 2FIUA 1SQEA 1Y0HA 1OPZA 1YJRA 2LQBA 4EFAC 2W4PA 3HF5A 3QGPA 2HLTA 1TL4A 2HIQA 5B0CA 3TRGA
chains in the Genus database with same CATH superfamily
1GAOA 2OEKA 1RAAB 3V2UC 2E1CA 3BKTA 1NJXA 2ALZA 2AV5A 2G1HA 4OZ5A 3LP1A 1TL5A 5F9LA 3FKBA 8ATCB 3BB5A 4H54A 3VWSA 1CJVB 2MZTA 1M5OC 4ED7A 4ZHRA 1P1TA 3ZZUA 4Y2MA 2MGZB 4CH7A 2EK1A 3SMZA 4WFBQ 3LP2B 5G0RA 1KFDA 5KT4A 5HBMB 4BBYA 4WFNQ 4NLGA 1T8EA 1UFLA 2MEWA 4Y2KA 2B9YA 2HS0A 1RB0A 3RB0A 4WJBA 1FRMA 3DGVA 1X5SA 3EDRB 1UPMB 4FYXB 3CTRA 2KZMA 3FSXA 2XO7A 1N5YB 2Y9HA 1R0BG 2PMHA 3H42A 2B8PA 3F0NA 5AE1A 2OKQA 2Y3YA 3EUNA 3SIPB 4C8MA 2W4PA 5KG1A 4CRJA 4B3RJ 2C1EB 2GIFA 2QLXA 3HHLB 3RAMA 1X31C 1U4BA 4OX8A 1EAYC 3CJQA 3TZWA 1VRTB 1P9QC 2E29A 4NPOA 1NDCA 2QEXS 1WKLA 5A8KA 5CZXA 2GVDA 2OLWA 4TVAB 1RCOB 3OLBA 1WOOA 2FHOB 4PG4A 4XIUA 3R5BA 3C3LA 2W9AA 1IKXB 1FX4A 2GS8A 1ZAVA 4DN0A 1R7IA 2V8HA 3M30A 4G3IA 1A7GE 2W2OP 3DLHA 3QIPA 3T1HF 3MMAA 2FDNA 2B5JB 1C0UB 1SKSA 4ELVA 3MM5A 4ECVA 3CE8A 4L6V3 1AZSB 4AL5A 1Q5VA 1Q8IA 3SQGA 4FYDA 2V4RA 1JXEA 2H4YB 2PMWA 4QWCA 2MQPA 1YWXA 2HHWA 3U02A 3CPWR 1PJ5A 1VJWA 1S57A 3UCUP 4YHHJ 3QT5A 2KZZA 2JLEA 3DLLQ 1IKYA 2MZJA 4XAKA 4OZJA 1YTYA 1SQGA 4M5LA 2OPQA 1PJ6A 5KFDA 5K8PA 4ZK7M 2XTJP 3K5PA 1S6PA 1VGYA 4USJC 1TKZB 3CC7S 2BA9A 1ELOA 4BLGA 1WF1A 3TVZA 3M32B 1FWLA 4KJIA 2IJRA 3KXDA 2VHGA 3V6DB 4DX5A 2KXFA 1FJGF 1S1XB 2CQGA 3R97A 3CJ5A 1R43A 1R31A 3HJVA 3FGVA 2IC3A 1VQ4S 2PMZD 1FRXA 3R1HA 2G13A 4RNNA 1YHQS 1JLAA 4NLTA 4DR6F 1VOMA 3MAAB 4UT4A 3W3SA 1BY9A 2BRKA 3IA0A 4NXMF 1TL1B 5ETKA 5HATA 2HS3A 3GFHA 3NG8A 5DZ7A 4PWDA 5KTQA 3CDUA 2A10A 3IBFB 4JI8J 4DSLA 4Y6IA 1VQ8S 5B0EA 1UWBB 3R5GA 4R5PA 2P9CA 3BV8A 4HI1A 5HMWA 2UUAJ 3Q8PB 4WF9Q 3SI8A 4DL5A 1WC1A 1CS4A 4X84A 3BS9A 3PXGa 3E01A 3DOLB 4DDFA 3HF5A 5DDQC 5K8MA 1RLCL 2GA7A 3R5JB 2KFYA 3CDBA 3QIDA 1PAEX 2YNHA 3DYAB 2ZBQA 3SEOA 2FZCB 3I31A 4MMOA 1KOHA 1W2IA 2OD6A 1GNKA 1REVA 4QYRA 3UD4P 3NGUA 1B3TA 3IC1A 1WACA 1PSDA 3M8ZA 4JOUA 2V2VA 8RUCA 5HJYA 3ONQA 2WOMB 1J5EF 3PG9A 2OPPB 4HHHA 1HBNB 1PYSB 2ADBA 4ZVOB 2CJXB 4J90A 1FVSA 2MYFA 4F3MA 4WIIA 4IFYA 2AJ0A 2N3OA 2HS4A 1C1BB 3EZOA 5FLXY 3TQ1A 3DLGA 3FQKA 2DIVA 2R7RA 3MEDB 3GPAA 3GFYA 3L95X 2XHWA 4PAAA 1S7IA 3R7BB 4P73A 3RB4A 1HHQA 3FUYA 4YMEA 4L72B 2I38A 2OTJS 1N33J 4P72A 3DHWC 3CCRS 1WC4A 2A6OA 4O0IA 2FLPA 3VZIA 4IQXA 5FLXU 2F4FA 3CJ3A 4J91A 4YB7A 2IM1A 2D1CA 5IFMA 1VQPS 2F1FA 2VA2A 2HSEB 2VDHA 1VIOA 5J2NA 1UFWA 4ECZA 4ANDA 4EWTA 4NE9C 2CNOB 4DCJB 4UOHA 4PR6A 4K4SA 4U67Q 1NAQA 2AU0A 1TK0A 2RF2A 4HKQA 3HHNB 3UO0A 3KJFB 4LSNA 5DGAA 4LR8A 4QWAA 2VL1A 2A18A 4ES3A 5HQ8A 1YJRA 5D15A 3HM9A 3D54A 3M8PA 4HL9A 1RT1B 2QZ8A 1N48A 1JXLA 3MM8B 1X4HA 1HNVA 4Q7AA 1L5UA 1RT7B 4GO7X 3RR7A 2GC8A 4MK8A 1S1UB 2ZEJA 3V5RA 1MG7A 5LMNF 4DPOA 1F60B 4B9MA 1FK9B 2CPHA 2AGPA 2X51A 4KGZB 4WK3A 4P7TA 3BSNA 2ZVIA 4I4BA 2GFFA 1IWAA 2HBRB 2UUCF 2K8GA 2JLFA 4O23A 2FQQB 4FYWB 1WNEA 4DSIA 1YITS 3V6JA 1RXOB 2MQ8A 4L3NA 3TZXA 3K5LA 2CUYA 1EETA 3VAHA 5K8NA 1Q53A 5D4OA 5IM0A 1S1TA 3I32A 2YWKA 2YVSA 1Y7PA 3HSGA 4CO5A 2B9WA 2OEMA 4NI2A 2R2RA 2KB2A 5ETOA 1MNEA 3EWGA 4CLPA 1REGX 5AE2A 2FPHX 1OPZA 1XJWB 4EO6A 1DRZA 1FXDA 3QO9A 3V4IB 4CDIA 1N6QA 2DNNA 2LMIA 5C42B 3OXLA 4YB1P 4ILMA 1QJHA 2C2MB 2BVZA 1NXIA 2ZC3A 3WX4A 2V34A 1WJ9A 1Q95G 2DNRA 2KU7A 3PDNA 2HRTA 3W7BA 4DV2F 2DHGA 4DUYF 1JLQB 1X4BA 2D69A 1MSWD 2M8HA 1S1WA 1RWOB 2CJKA 4LF4F 1N52B 5DDRC 2KT3A 2EBEA 1WOSA 1CJUA 1WG5A 2ZH2A 1K47A 4DEZA 1IBMJ 2BJDA 4IRDA 3NGDA 2CJYB 5HP1A 2VKZG 2F7VA 4DN9A 1YJTA 2YKNB 4EBDA 2FLNA 2Q6CA 1URNA 3TJ8A 4DL3A 1WC3A 2RD5C 2H65B 1X8DA 1KD1T 2EBGA 1JJHA 3DKDA 2VJVA 4A8KA 2OEJA 3L09A 2XO6A 2G2ZA 1JLEB 5KG3A 3NAHA 1S9GA 3BKUA 4V1Ak 4ER8A 1V3SA 2HVHA 2KHDA 2AWZA 2YQ1A 2YKOA 1U8WA 5H9EJ 3S7RA 7FD1A 4TXSA 3PEJA 2RU9A 3FSIA 2YTCA 1DTQB 2LA6A 2V8DA 3DOKA 2CQIA 4DS4A 2LU1A 1TVRB 4M95A 5LMUJ 4GO5X 2ILYA 4LF5J 1VHIA 1N5QA 3ZTQA 2UU9F 4HACA 2V8GA 5C25B 4DV3F 3AAWB 2AEFA 3NOCA 3BO4A 1RT2A 2IAJB 3SYZA 4OI1A 4ZKAA 2BYCA 2OGUA 4LRBA 1SL1A 3OTCA 2ZHAA 4NMLA 4OX9F 4B08A 2BKNA 4DPYA 3OUYA 4ANCA 1SQEA 3PFOA 1HBUA 3H59A 1U1LA 5B0BA 3D7SB 2MXYA 4RR5A 2FZGB 2CQDA 1X4FA 1VHFA 4PUOB 2CXEA 1D8ZA 1CEZA 4JI1J 1N5VA 3KMQA 3B6BA 1SH0A 3M6XA 3M1VA 2MSSA 3AJ2A 1S0MA 4K4ZA 1IR0A 3TUPA 2IM2A 5ETPA 2V68A 1P1LA 2XMKA 1DQ8A 1EKSA 2IPOB 1XNRF 3J7A1 3N79A 3RW7A 2A6MA 4LMZA 2R8JA 2BJEA 1CBKA 2BANB 5BJRA 3IN5A 5K20B 1EX8A 5DO2A 4DV5J 4ZVTB 4YEAA 4Q2LA 4QU7A 2MQQA 3IFEA 4IDKA 3PRVA 2LFVA 2UZAA 2YH1A 3AFGA 2CPJA 1S59A 4XTTA 3GJRB 2H4WB 2XYPB 2XSFA 2HFVA 4N76A 5J1NA 5EDWA 5IT9Y 1Y4ZB 2LXIA 3OHAA 1YI2S 1I51B 4J9LA 1SBRA 4HHUA 3OFFA 1GXUA 3R1LA 3RG6A 4CLKA 2VFSA 1XNQF 3HFKA 4YB5A 1WTBA 2K3KA 2Z2YB 3TAMB 2Q1LA 4C8KA 1Y3JA 3PO5A 1VR6A 5B0DA 1S6OA 3D6MB 6FD1A 4FF3A 4DR7F 3MECA 1RT6B 5E3RA 2Y1JA 1ZA2B 2IJFA 4GKKJ 1NK9A 4O44A 4DR2J 1LEOA 5J1EB 2CJ9A 4NX9A 1VJQA 3FQLA 2AYGA 2VG5B 2GJ2A 5IT9U 1R8BA 1UVNA 3MM9A 1NU4A 1DJ0A 3HKZD 5IV3A 4ECRA 3N6MA 2E5LJ 1NO8A 4NLPA 2CDQA 2E5GA 3G8QA 2VBWA 2OUGA 1RTDB 1PC5A 3QGIA 2RUSA 1V9OA 4X64J 4LFAF 4KC5A 4RBVA 1XMBA 2HVZA 2N7CA 3MEGA 2HQFA 1ZBTA 2DR8A 4ZPWR 4ED8A 4F8RA 4KKOA 4JV1A 4LQ3A 3SZ2A 2AHOB 2WSCC 4MAKA 4YR2A 3VAGA 2NSCA 3ENVA 3H2UB 2C42A 3H8YA 2XCPA 2N4DA 3W1YC 3KUGA 3GV8B 4CLWA 3E8OA 3NGKA 4W92B 2EVZA 1S1VB 4FPRA 1XERA 2KM8C 2VB6A 4A47A 1VQ6S 3PY8A 4F36A 2DGQA 2NXUA 1VLOA 4HR2A 5IOLA 4EU0A 5C2CA 4LF6F 2W24A 2HW3A 1CC7A 2RRNA 3UNYA 1HNWF 4C8NA 4F4AA 4LFCF 2VBZA 2OPRB 3CCVS 3NMAA 4MKAA 4CTAB 4OLPA 2Q66A 4OYPA 1OSCA 3MR6A 1VQSA 4QW8A 2LQ8A 2VG6B 4EEYA 2AX0A 2HK3A 1LKZA 1FHTA 3MR7A 4ZN1A 4M1KA 5I3UB 4LBPA 2DT9A 1RAJA 3FZBA 4O3OA 4GC6A 4AL7A 2H54B 3BGRA 2QN6B 2HQCA 2WCXA 3CO0P 5B0FA 2W4DA 4TN2A 4TYBA 4B3MF 1M5HA 2XZWA 2MLYA 2JVOA 1VISA 2V2ZA 1XR6A 4OYBA 1ZYQA 1N5SA 4BCAA 5SUHA 2BE2B 2VOPA 1HNIB 4OL8A 3UWTA 5KG7A 4IRCA 1D8YA 2YNGA 4DV4J 1W2BR 1H72C 2WK4A 3W5ZA 4DR3J 3TVKA 1SI9A 5T7LA 4X4TA 1ITPA 1JNRB 2C3MA 2QA2A 3B4MA 1DQAA 4WWSA 1KQGB 2A3JA 1U26A 2QA1A 1CULB 3M8QA 1S6QB 1J5OB 1JIHA 2VBXA 5HQLA 3BM7A 2P6SA 4PYAA 3ZTPA 1U47A 2H5IB 1OS5A 2H51B 1FXLA 3CWJA 4PG6A 3ILOA 5KT6A 1M5VC 2IA0A 3LA0A 2LYVA 1JLGB 4PQUB 2BJ9A 3T5KA 5DG8A 2ZFHA 4LREA 3PX4A 4CZCA 1X5OA 2BDPA 2V6AA 8AT1B 4I2PB 1YRTA 4RNHA 2AF6A 1TUVA 2YWWA 3TA1A 4F26A 5LJ3Y 5C24A 3B82A 5I3QA 2XQCA 2ROGA 2W7OA 3SV3A 2ZNYA 2R7OA 4ZPDA 4JI3J 2JLGA 4LRFA 3MAQA 3ENQA 4ICLB 2V9KA 1UEKA 2C3OA 1U1RA 5ADZA 1ZM3A 1FDNA 4QWEA 1D0EA 4JI2F 4IOBA 2C2NA 1FFGB 2EFOA 3QMQA 3DC2A 1TU0B 3QLHB 4AYBD 3H20A 2DNLA 3T5LA 5F8GA 4ZA1A 1TKTB 1UVIA 2HQDA 3EVWA 1HNXJ 1B7FA 1UZHA 2PI5A 2EI5A 2HQGA 3KJVB 2XZDB 4DV6J 2IRYA 3FCVA 4E98A 4EGLA 4K2XA 3R8YA 2KJVA 5HMZA 4Y65A 2XY5A 4CLYA 3D2WA 3HSJA 3A12A 4K4WA 1Z2ZA 2MMYA 4CLLA 4KH0B 1G2EA 1WELA 3OJUA 5L8RC 2D74B 1KTVA 3TOQA 2J6UA 3R6GB 1JJCB 1I94F 2KRBA 1RHJB 2O01C 5EX3A 2EPIA 1BUXA 3KG4A 5JXSA 4NLRA 1CJVA 1IM4A 3Q0AA 3HHEA 1PJ7A 1HBMB 3N9UC 3VQTA 3TANA 3UN3A 2ZJPQ 3CGIA 2MGZA 2Y8YA 4DU8A 5GMDA 3LP2A 2COLA 1CG2A 5HBMA 2K1RA 3DU6A 4GVLA 1RHRB 1DAXA 1WI8A 2J0XA 2M4MA 2K3IA 3GE9A 3K5MA 4K5RA 3G96A 1ZM9A 3MPYA 4RWWA 2BX6A 4NOHA 1GMVA 4OI4A 2QSFA 2RUGA 2EFNA 1U1OA 1FJCA 3HSDA 2R8KA 4WTYA 2KXHA 4USIA 2IDLA 4U9RA 3RBZA 2NR0A 5CHCB 1E6YB 4HH1A 1QAYA 1RAFB 2W2NP 5MLCV 3D4JA 3HHLA 1HPZB 4NEYA 1VRTA 2FLLA 3MMCB 3D6FB 3FNNA 1IKXA 2DY1A 2M70A 2Q6BA 1HMVB 2Y0SD 2LQ5A 2QLBB 4J37A 3KYLA 3DRSB 4NWBA 1RAIB 2K7KA 3W2VB 2B5JA 3VHQA 1C0UA 1PYOB 5KFMA 4ERDA 1G1XA 4HDHA 1AZSA 3MTKA 4JI4F 2AEMA 5KFCA 4F4XA 2A1BA 5ETSA 2W9BB 1Q5YA 3CULA 4WTOB 2ILZA 2ZDPA 4MKVA 1SXLA 5JJBA 1X0PA 1IBCB 1S49A 1WC6A 3N6LA 5D8HB 1RWXB 3RU0A 3PM9A 4IH5A 1HWLA 1RGVA 3GCWP 2R7TA 1S6UA 3OR2B 2HLTA 1TL4A 2G0CA 2Z30B 1TKZA 2A0FB 4O3PA 3OL8A 1B0VA 3U1NA 3M32A 2XMWA 2DNQA 4RX6A 4LF2A 2XULA 4GKJF 3V6DA 3UN2A 1FI4A 3KFWX 1S1XA 1NK0A 1ZETA 2DHSA 3DFEA 5F8JA 4PKDB 2UXDF 1M5PC 4TKTA 3UVJB 7AT1B 4RLEA 4DUTA 2DYAA 5B7WA 4ZPAA 3G8SA 4ZVPB 1TL1A 1NDKA 1FEHA 4DV0F 2GW8A 4EI2A 3CT9A 3ZZZA 2VICA 2XG8A 4O4GB 2DNKA 2FVQA 3CD7A 2CZVC 1UWBA 2JEFA 3NCPA 5KFSA 3CO9A 2H1YA 1T7PA 1N36J 3PIPQ 3NMRA 3S1TA 2HQ3A 1LWEB 3CC4S 3ZNUA 2UUTA 1FT8A 2XS2A 1HYSB 3C66A 3DOLA 3SBMA 4UQTA 2GHWA 4EBEA 4KH1B 1YBUA 1UJ5A 2JL9A 3GR1A 3DYAA 3VV2B 2BXJA 4Q8FA 3VF0B 3SFUA 3OSPA 4J9VA 3OD2A 1UWAA 2DITA 4YY3J 4O0NA 1FFWB 4ZPBA 1AT1B 3GYGA 5E3PA 2HPUA 1RTIB 3IAM9 4ECWA 3UDVA 1KEKA 5E5NA 3DDNA 2HMIA 2WOMA 1VRUA 2OPPA 4B9LA 2NXCA 1HBNA 5AXNA 2XC9A 5H1SV 1FNOA 2QLFB 5KG0A 3A8JA 4ELUA 4Q5VA 5HSPA 1OPIA 1PYTA 1C1BA 1LW0B 5DGBA 1RK8A 4ZVSB 2XMUA 4IKAA 2HBZB 1AUSL 4KQZA 3VGVA 3R2CJ 5A2QY 2ZHBA 3H2VE 3MEDA 5D77A 4F4YA 2ADCA 4RUCA 2UUBJ 4MKBA 1OSDA 3JXOA 4PXDA 1C2PA 4QR1A 3RTVA 2LEPA 1FDDA 4RL1A 4C0HA 5KOXA 1HARA 3QFWA 4DV7J 2LEBA 3KLIB 2RQMA 2VODA 3D9BA 2ZBIA 4HHJA 3HZGA 1B64A 3FJ2A 3BGUA 4PCQA 1RZMA 1TELA 1NZ8A 1EB0A 2HNYB 4WU2A 1EARA 1DHMA 3Q86A 2KT5A 4OHVA 1D3WA 1H73A 2CPYA 4KT0C 1TV6B 4YN3B 2D3O1 3B8HA 3GYXB 4FDFA 4ITSA 4X65F 2QMXA 1GX5A 3FRZA 1HWIA 4TQRA 2F4VF 2JRSA 2JEIA 2KYXA 3I82A 1RJJA 1JMTA 1VLYA 2IBKA 4KPYA 5D0GA 1CC8A 4AUKA 2NZCA 4FBTA 1RT1A 4FXVA 5KFIA 3MM8A 3RUBL 2AEJA 3OSNA 1RT7A 2DGOA 1S1UA 4DX6A 2HFUA 2OTLS 3T1AA 3IM9A 2C2OB 4FKXA 3H5XA 3IRXB 5ETMA 1ZM4A 5A0YB 1FK9A 4Q0BB 4R8UB 4DXLA 2GHVC 2ALYB 2M5YA 1WSRA 3M2VB 1CPZA 3AOAA 4F2SA 3FBEA 2J7WA 1FX2A 3NL0A 5M2PA 9RUBA 3ZZTA 2APOA 4C3MA 1IWGA 4CO3A 1UVJA 2HURA 2B7CB 2Z58B 5CYMB 1RT4A 5JMNA 1KS2A 1UEUA 2BUNA 5IT4A 3T1HJ 1OO0B 2ATCB 1AROP 2EK6A 4USTA 2N3LA 3OVSA 2LLZA 3K58A 1WHXA 4NRTA 2GMLA 1IXKA 4QU6A 1WF2A 2FVSA 2EXUA 4DX8H 3EZ5A 2DEJA 4RW8B 1RE1B 2ZBCA 3RRGA 3A8IA 4CLFA 3JQJA 3V4IA 2OI2A 5DDOC 1R0AB 2RDDA 2WB4A 5HJXA 1YVFA 5C42A 2FGCA 2HHPA 2V50A 2IFXA 2VBYA 3GYNA 3V4MA 1XR7A 3ZTSA 3AXMA 2AIRB 2YY3A 2RHSB 2Q43A 4F0KA 5DDPC 2N82B 3OXGA 1JLQA 1FJGJ 5D3GB 2VFRA 1LOUA 1U7LA 2F3JA 4DCPB 2C22A 1GXLA 2V4JB 2VF3A 3HHDA 4ECXA 2KJWA 2JDJA 2ZZNA 4YB6A 3AT1B 1F3VA 3UCGA 3D68A 3T6JA 2YKNA 5LXRA 3AJDA 2JVRA 2Y0BB 4LVOP 3B4DA 1BWVA 1HI1A 2EKYA 3GIJA 3QJPA 2HIYA 4X4QA 5KFGA 1VQ5S 2IA6A 3BBFA 4RW4B 1QVGR 5JUMA 4L74A 1V3ZA 4G65A 1RP5A 1JLEA 2HK2A 1M1KT 3POTB 2HRYA 1ZM2A 2VPXB 2UV8A 1TL3B 2CJBA 1NJYA 3CD5A 3HJFA 3M6WA 4LF8J 1QE1B 3G6VA 3FBFA 3KLFB 1M5SA 2HZCA 1T94A 4I6WA 1DTQA 3BJYA 4C0BA 4A8YA 5L46A 3CJ8A 3MEEB 5GMEA 5F0WA 1RA6A 3OV7A 1J2VA 1TVRA 2DIUA 2HG4A 3NGSA 4XPEA 3B78A 3KHRA 1NB2A 3F73A 2MLXA 3FEXB 5LL6d 1YBAA 2FVPA 3DLBA 2DGXA 1NMEB 4P7VA 5C25A 2VFVA 4USMA 1VC0A 3GU0A 2FJVA 2L9NA 1K0VA 2IAJA 2JOQA 1NPPA 4R0JA 4OYOA 1Q79A 3GIMA 1U1PA 2DNPA 5IQ6A 4OMFG 4MKYA 4C2MA 4S0MA 3MUTP 1KP6A 1J5EJ 3EGWB 1NSQA 1RTHB 1V6HA 2MKHA 3CCQS 2QA4G 2WB1D 4YDDB 2V63A 5L38A 5J2MB 3ILLA 3C2PA 3AD8C 1T11A 2W2MP 3Q8RB 2H48B 5B09A 4PUOA 4CLTA 2XWXA 5KT2A 4ZLPA 1C4AA 3IWLA 4ZCMA 1T02A 2YXLA 2QL5B 4BWJA 1YLXA 4RBTA 2DH9A 5I4MA 2X7IA 2G1DA 3OVBA 2WAQD 2M3DA 4FYVB 1V5VA 1QTNB 1MN9A 2MKYA 1YRUA 4OYAA 3CIMA 3DRPA 3N4WA 2BANA 4LSZB 2ZH6A 3D1OA 3G82B 4Z7CA 2VIHA 3GZ7A 2J0QD 2E5HA 4YHHF 3TAQA 2ZC4A 3DM2B 3PZPA 2FVRA 2DGUA 3F44A 2AW0A 1TP7A 2ZE2B 4I56A 3HD1A 3MPUB 4PEOA 2LVWA 5AXLA 3MCNA 2NLWA 1IKWB 3VAKA 4EFAC 3NS5A 2B9XA 3G71S 3JSYA 1RQ0A 1LQ9A 1U48A 3IO1A 2V5HG 4P71A 2VA3A 3T41A 3TAMA 5KFTA 5HN0A 3CJRA 3BYPA 3EVOA 1SC1B 5H9FJ 1RT6A 3L7OA 4FKYA 2KI2A 1JLFB 4P2MA 1B0TA 3QT6A 5J1EA 2D9PA 1NZAA 4QIWD 3SSSA 2VG5A 4ZVHA 2UVWA 2DGTA 2JNJA 1ZZNA 1ZTTA 4DQSA 2PEBA 2RH3A 3HHLD 2ASJA 4J9NA 4WP3A 5B08A 3J81j 2Y1RI 1NBEB 2YKQA 5LJ5Y 3T5JA 1Q1KA 5HVGA 3FCWA 4JI8F 1RTDA 2XSJA 4PG8A 5HL7Q 3HX9A 2HBYB 2UUCJ 2B3TB 2HRUA 3W5XA 3HD2A 1RAEB 2MKSA 3IBWA 2F8EX 1V5IB 3UE2A 2UUAF 2F9JA 4JUZA 2VQFF 4PWWA 3BQ2A 4DUZJ 1YG0A 5IWAF 4BC9A 3BKFA 3CVKA 2LQBA 1SCJB 1U1NA 2QC3A 3TZYA 4HT7A 1RA7A 2PGCA 2G0JA 2B9EA 3WC0A 1KVJA 3MUVP 4A8MP 1NK5A 3RBEA 2B6AB 3PX6A 3DRXA 3ZTRA 4PG5A 3SCLE 1WOPA 3I5BA 4ZP7A 4ZMMA 1KQFB 2ZJQQ 3MD1A 2R7VA 1S77D 4ZITA 3NCRA 4LBIA 3TYTA 1SJ1A 4HYKA 1U0HB 1T9VA 1F6TA 5KFVA 3IBCB 3AXKA 1XR5A 4HTJA 2BMBA 4WXOA 4DV2J 2OPRA 4ZPTR 2MHNA 9ATCB 2HHHJ 4K50A 1FCAA 2MZQA 4CTAA 2XLKA 5F8LA 5CCLA 4FF4A 4LF4J 1Q0NA 3A3OB 2VG6A 2OO4A 2POKA 2X3GA 4LF9J 2UXBJ 5KG4A 3BF4A 2R8IA 2KFNA 1SKUB 2BJ1A 2UXCJ 1U2RA 3ETMA 2R42A 4K4YA 4KGXB 5I3UA 1R8PA 3M2UB 1R27B 3A3PB 3FEZA 4MTPA 4FS2A 4ZP6A 2W7AA 4Y2IA 2FGOA 2A2DA 2G2YA 1KHWA 3I96A 4A46A 2KHCA 1WG1A 1F2HA 3HPOA 1X4DA 2XS7A 2O5DA 3QT7A 2RIJA 4C11B 3RR8A 1RDRA 2DH7A 4X4OA 3PW7A 3BR9A 1Q8LA 2BE2A 1HNIA 2NS1B 4EO8A 2ZVSA 1U6FA 1H2VZ 2FZKB 4Q43A 1CQMA 2RQCA 3QRPA 3DLKB 2ASYA 2RRBA 4DF4A 2B4PA 2YKPA 3P6YC 1DQ9A 5K9FA 1CULA 2GO8A 3N01A 1J5OA 1S6QA 1S5ZA 4EZ9A 1BQMB 4DI6A 3TUJC 1UFKA 1XK8A 3BYRA 3L4BC 4DWIA 1Y5LB 2DGWA 1V3RA 2PC6A 5J2QB 3MPDA 1JLGA 4PQUA 2EKNA 1UA0A 4M8LA 5C5JA 2M0GB 2OPSB 4K0KJ 3AQPA 2LQJA 4U95A 3KMSA 4I2PA 2P9GA 3R5CA 2Z2MA 1SL2A 3BH7B 4JI6J 3KKFA 5H9EK 1LK7A 3PEHA 1S72S 3MMBB 3VAJA 4ELTA 4ECUA 1TMMA 3IG1B 3G2XA 2ZUGA 2MDAA 1XMQJ 1G7CB 1SJ4P 3QLHA 3CXCR 4NXNF 5I42B 5KFHA 4CO0A 3H5YA 1KC8T 2J6TA 1TKTA 4CT8A 5D4LA 3R9LA 1I6JA 4Z2XA 3OL9A 2HEKA 4TYAA 1WKJA 1S99A 2PFDA 4WCEQ 2GQ2A 2Z0GA 3GG0A 4DSJA 1KQSR 3CUNA 3KG1A 3DLEB 2YX7A 4GVBB 4PG7A 4ZVFA 3EMTA 3KJVA 4K7QA 1NKEA 2DTJA 4ZP8A 4DPWA 4NYOA 2DCLA 2PN6A 3KTQA 1RT3B 4QCLA 3OJSA 3EVMA 2GVZB 5A76A 1GMWA 1RTJA 1S10A 3HT3A 2X1FA 2WBRA 5EHHA 1LXJA 4OYIA 2DHAA 5HI7A 1C1CB 4F3QA 5A8RB 5HROB 1XNQJ 4N56A 4P2FA 2M7SA 4JV2A 3PX0A 3A1YG 1HBMA 1YJUA 2HGLA 2B4UA 2HFZA 3CMQA 2M9KA 1Q81T 3C6TB 1K73T 1N0VC 4KHPJ 4WZQA 1EP4B 3DRYA 4ED3A 5DZ6A 4A8XA 5IZHA 3N6NA 4IH6A 4O3QA 2CG4A 1YIJS 1IBMF 2QX0A 1YZ7A 4OI0A 4P2XA 5D0HA 3R3TA 4I68A 5GVQA 3FEYB 5DG7A 4PWDB 2Z2ZA 4X4RA 1MW7A 4NCGB 3EGNA 3LGNA 2GAHC 2M2BA 2HNDB 1L3TA 2E9RX 2JC0A 4Z7YA 5C2GA 2DNZA 1IQTA 3GJTB 1JKHA 1UKUA 4LJMA 4KV8B 3ZNJ1 5ETQA 4KY3A 1E6YA 2ABYA 2CA9A 2OFHX 1WSVA 1HW8A 4O4RA 4LSLB 3J81U 2C3PA 1HPZA 3AJ1A 1Z4UA 3PCOB 3ELHA 1SL0A 4A8SA 1HQUB 1H38A 2YWFA 4IRKA 3EPIA 3MMCA 3PW0A 4B02A 4FF2A 4KB7A 3M4XA 2RILA 1HMVA 1EQMA 2VOOA 4F4ZA 2CQ1A 1AFIA 4NLDA 3DRSA 4LF5F 4LFBJ 2ERRA 1H0HB 3W2VA 3WX8A 4USHA 2VPYB 2DBBA 3JAMY 1SQFA 4DV1F 4OYZA 5FDLB 4KRWA 2DHXA 1K0TA 1FKPB 3PJ9A 3TQEA 4I64A 4NASA 2W9BA 4RU9A 2NPFA 1YGYA 3T19A 4LFCJ 5AJ3J 4B3OB 2CVIA 4IFYB 5B0AA 3O44A 4M5MA 1RCXB 2W25A 4IQMA 2DY9A 4FBUA 2CQPA 3EXCX 4CLUA 3JAMU 4DQRA 3OXFA 4M63A 2GIRA 4H4KA 4LIWA 2RB7A 3LAMA 4WU3A 5F8MA 3HVAA 2XYHB 4ECQA 1NHUA 3LALA 2IMOA 3DN9A 4I1TA 3MHYA 4B3MJ 3ZZPA 1QAXA 3HHKA 1LXNA 4CH0S 3D0IE 4ID5A 4O3SA 3UVJA 2CAJA 1H7XA 4OYXA 4DG1B 3PVXA 1IM6A 2R4FA 4C98A 1Z2LA 4I69A 1N54B 2MQMA 2ZHOA 2YQ3A 3KLVA 1P8GA 4O4GA 4RW7B 4YUDA 5L1LA 1YDLA 2D41A 4X62F 1X9WA 3JQMA 1IBLF 1B4SA 3RZAA 3VTIA 3TP2A 3I0SB 2JFDA 2HZVA 3PNIA 4WZMA 3OQ2A 2VC0A 1UMJA 1Y9OA 2MY8A 1LWEA 1N4LA 1IVZA 2DJWA 3BQ1A 4MFBB 1HYSA 1N8RT 3CJ0A 5EX0A 3QRRA 1F5BA 2LCWA 2V0NA 1T9XA 2C2RA 1R6YA 1JQGA 2J8SA 1XIQA 3OHBA 3NNHA 3CDAA 3CCJS 2ZJRQ 1F5AA 4K8RA 5D0RA 1GEHA 4BWMA 1CSJA 1KRPA 4FP9A 1FKAF 1HI0P 3TA2A 2E5LF 1R8HA 3F41A 2KO1A 1G3OA 3KUEA 1RTIA 2D3UA 1RWNB 3US5A 2EW9A 2K06A 2M8DB 3PKMA 3OTBA 4ATNA 1VQ9S 4X64F 1DY3A 2BACA 4RW9B 2F8HA 2WTFA 1OWXA 1ZPVA 1LW0A 5EWEA 3HDSA 1GXTA 3MFHA 3DDIA 5F8IA 4OV6A 2V2QA 5KFJA 2H3EB 4ECTA 5CYQB 1GTHA 1AW0A 1AYEA 3D3BJ 2FHMA 2FY8A 4H4OB 2J0SD 2DEIA 2VASA 5I3PA 3OT9A 2CADA 4K2JA 4NLYA 2VQEJ 3GWCA 3KLIA 4MYUA 1VMBA 4OHZA 2ZD1B 2SXLA 1QSSA 4EYIB 4AT1B 2VFTA 3L9ZA 3F56A 5ETLA 2KDOA 4IG0B 1TK5A 1RADB 1LW2B 2J8AA 3OVAA 2HNYA 1W7WA 2CJAA 5KG5A 2FJWA 3CIZA 2MQNA 4C3LA 3T6BA 2GHPA 2FHKA 3QNWB 2GGPB 1TV6A 4NA2A 4A8FA 3WZ0A 1MU2A 2PFFB 1Q82T 4NCAA 2BOAA 2PSZA 2JEGA 3WQPA 4B3TJ 1CJTB 4LRCA 1Y0HA 2P5VA 4JV5J 4W98A 5SZTA 2AJQA 1T3OA 1VBXA 4JI5F 1KDNA 2WVDA 1JX4A 3D6TB 4WKRA 3LGHA 4E0DA 2WONB 1VBKA 3K7RA 4FYYB 4ES1A 4KAIA 2FHJD 2LU2A 4ZLJA 1SC6A 3JB9k 5LM7E 1C0TB 2G0IA 4OHYA 3EM1A 1F0XA 1U1MA 5A6PA 5E7OB 3IRXA 5F8HA 5A0YA 4Q0BA 3V6HA 4NLOA 4R8UA 1IBKJ 3MF5A 1RAGB 1X60A 2J0WA 4DV4F 3M2VA 4PPDA 2EFPA 2GZOA 4K5SA 1OQ3A 2B8QA 2ROEA 2L08A 4ZJLA 2DR6A 5CYMA 2GQQA 2J9DE 5A8WB 4KTQA 4DR5F 4OZ2A 4C8YA 2XY7A 2CPEA 4QPTA 4F4WA 2DNYA 1VQLS 4TU7A 3BDPA 1WD6A 4P10A 1T05B 3OTOF 1RT2B 1FRIA 2W8KA 3G4SS 3GV7B 4ZPVR 1OYDA 1OY6A 3DGPB 3BSAA 3C14B 3THVA 3NNCA 4RW8A 4NCBA 4AXJA 2HWTA 4ED5A 1MROB 2DNHA 1NJZA 3LAKA 2QV6A 1R0AA 1ZZFA 5CD4A 3M9MB 2F8MA 2BJ7A 1R8CA 4X4SA 1FA0A 1UW9A 2E9TA 1KFSA 4M5KA 4JP8A 4JYAF 1I5OB 3AOCA 2LDYA 1YBTA 2H5EA 1QVFR 3W61A 4TLQA 1H7WA 1HI8A 5D3GA 3CCZA 2OSRA 3HFVA 2I9SA 1XTZA 4BS2A 2X1AA 1LWFB 3QSYB 4PXCA 5L1JA 2HAFA 2R7QA 2CPXA 1ZAXA 4DSKA 1M1GA 4DV6F 4DV0J 3AQOA 2NUHA 1NSKL 1U49A 2NYHA 4QWDA 3RJMB 3N28A 1SUQB 4CNZA 5L1IA 4DPUA 2GJFA 3PW5A 4DQQA 4URQU 1RU2A 1NHVA 4RW4A 4LIRA 1E6VB 2IBOA 1Y11A 3IGNA 3POTA 3U7JA 4ZVGA 4K4TA 2DXFA 1TL3A 1IJEB 1QE1A 4CIOA 3KLFA 3GFZA 2L41A 1I1GA 2OMOA 4CQ1A 1WI6A 2Y1LB 1FKOB 3UR0A 2O66A 1F1BB 2CNLB 4Z37A 2XS5A 2RE1A 3EZUA 1YRXA 3GTYX 3MZIA 3QZ7A 3MEEA 5EUHA 1QTMA 3MOZA 3ULHA 2ACMA 4WE1B 3MM6B 1KR4A 1JK9B 3HO1A 4AFFA 4DL7A 1IN0A 4IR1A 2XMTA 3TEGA 5E3AA 4J9SA 1SJFA 3MUMP 4ZPCA 2V67A 4OI2A 4WPAA 3C16B 2PT0A 4NA3A 2PO4A 6AT1B 3LP0B 2DRBA 2IHR1 3DMJB 1UA1A 3PHEA 4DR1F 5J2MA 3BPDA 4Y34A 1FEEA 2E7VA 5CABA 4DSEA 2OJ3A 4JV0A 2HHQA 1RKIA 1TKXB 2YNFB 4LUBA 3CCWA 2QIFA 3JSRA 3M2RB 3QSIA 1HR0F 3P96A 4J9MA 2BQ3A 3RB3A 2KG1A 2MPUA 3PYDA 2CPIA 4ZIWA 5E3CA 1FJ7A 1GMWD 5KT3A 5L1KA 1R89A 1KLNA 1HKAA 4N5SA 1JWWA 5MAOA 2GX8A 2OAUA 1PG5B 5IXUA 4DL2A 3HHLC 4NZ0A 3EXYA 3LANA 2EC2A 1BQNB 3G82A 2BR0A 3KWMA 4ILRA 1SKWA 5DG9A 4K4VA 3Q8YA 3DM2A 3CCUS 2KKHA 2ZE2A 5C7PA 2I2YA 1IKWA 1RT5B 5E2QA 4AQYJ 3P5BP 2B0GA 5KFBA 2HFOA 4UTGA 2XLJA 2MY7A 3T1YJ 3M9NB 2XNQA 3DCAA 3D6HB 4USKA 3EDQB 1WKKA 2VG7B 4F0HA 1OJ4A 1JLFA 1FRKA 2WW8A 3RRKA 3HP6A 4USVA 3MFIA 4KGKA 2AYBA 2LDIA 1S79A 4B9TA 2RS8A 1TZ0A 4X4UA 1IKVB 3FRYA 2HQIA 1HW9A 2KG0A 4P6QA 3SCKE 1F9HA 2NXNA 5DLGA 3SFGA 2KT2A 2OD4A 2CQHA 4Q8EA 3TW0A 1FERA 4JI0F 4RNFA 3VQSA 4WP9A 2P9EA 4IOCQ 1FNXH 1IUJA 1WHVA 5KFUA 4ZVRB 3M05A 5KFEA 2H9ZA 3KLHB 1U0SA 5KT7A 3Q83A 5GAEU 4TQSA 2RVJA 2AT1B 3A4TA 3BREA 2Q3PA 4ZDNA 3W63A 3PHTA 1ZAWA 1MWZA 2BABA 4CNYA 4ZLNA 3OL7A 3QRQA 3OFGA 2GV1A 1HIYA 3T3FA 2Q79A 3DXSX 3QGGA 2B6AA 3MMJA 1FE0A 5CXTA 1N32J 4KO0B 4Y28C 3EICA 4C3KA 1BGXT 3C8YA 3OR1A 4AXIA 5IV4A 3GFXA 1RWUA 1Q86T 3H40A 1CJKB 1U0HA 1W25A 1FF2A 1KOOA 3QBCA 4FNIA 2E66A 2WVFA 3ZTOA 2R8GA 3H2LA 4H4MB 1XMOF 2NYIA 2WBMA 2NZ4A 2YWEA 3KK2B 1SH2A 3TARA 1RU1A 3X3UA 5HLFB 2KL8A 2CVEA 3MEKA 4OZ1A 4USUA 1S0OA 2OH2A 3UW1A 4DFKA 3M2UA 3NP5A 2WRMA 1VK8A 2RU3A 3H5UA 5J2PB 3LGMA 1JLBB 4B9VA 3TVYA 2UUBF 3MWBA 5CYJA 3KDOA 2HWIA 3LPEA 2CQ0A 4LF7F 2HHXA 2HHVA 3CD6S 2IVMA 4DBQA 2F63A 4C11A 3CCLS 3ZZYA 4DV7F 3SV4A 1PKUA 5KFXA 2JEJA 1T03B 3ITHB 2DPIA 4RNOA 1DARA 3WIUA 2R2UA 2MQOA 4ANEA 2ZDOA 3O3LA 4FZVA 3KDNA 4G1PA 4LR9A 1PBAA 3DLKA 3R7SB 4K59A 4YR0A 4ALZA 2IRXA 2PD1A 1VRQC 3TZZA 5D0EA 1MN7A 4G6VB 5KFFA 2V9WA 1VQNS 2VPZB 5KG2A 3PJXA 1S76D 2KVIA 3VALA 2J7UA 3KHGA 2G4BA 4CP5A 2K1RB 2HZAA 1BQMA 2E44A 5M2RA 2R8HA 2FB0A 4NRUA 1FDAA 5J2QA 3OTDA 4M5JA 2CQ2A 3N5FA 4UQGA 1N34J 1D09B 3QZ8A 2XM3A 2BQUA 3A8EA 2OPSA 4M5IA 2G2OA 4FN5A 1N5TA 4QIEA 3J80Y 1HQEB 2QMUB 3I9V9 2JWNA 5FD1A 2ZOFA 1EQ0A 1UCNA 3MMBA 3W2WB 5DS7A 1RBOB 5K8OA 5T14A 1IR1A 3IG1A 4IFVB 3TJAA 4DZ6A 4X2BA 3THTA 5KFOA 3IR7B 3CCTA 3ISND 5I42A 2DISA 1WWHA 3AODA 1FE4A 3J80U 1NPKA 4IG3B 1RLDA 4LT6A 2PA3A 3DLEA 3ZC4A 4GVBA 4RBUA 3NRBA 1DLOB 2AP6A 3AD7C 2B7BB 2I8EA 2K7JA 2DH8A 2D9OA 1VQMS 4IOAQ 3MXHP 3QGHA 3JSMB 2IYIA 4TY8B 4GRSA 1NLKL 3K0JA 4M5DB 1X4EA 4AD6A 1RT3A 3DI6B 2GVZA 3SDEB 3KOAA 3O2IA 3W9HA 1KVKA 3V81B 2FLOA 1LWCB 1SH3A 4XPCA 4Y3CA 2BKOA 2GCFA 3L7PA 2ASLA 3W9JA 3IR5B 3OFHA 1FRHA 1Q78A 1C1CA 5A8RA 5HROA 2V8VA 2MZ1A 1FO1A 4NL5A 2NXJA 1KSPA 4OHWA 4A8WA 4B3SJ 3H4DA 2AZ3A 3KNGA 1S4FA 1O0PA 1T9YA 3C6TA 1YJWS 1R0CB 1EP4A 1SIWB 3I56S 2ZH5A 3CJSA 3MDFA 4HDGA 3KK1B 1VQOS 2YX4A 2OMLA 2NSBA 3CJ2A 3IR6B 3HMJG 2FJBB 3VZHA 1NDLA 1L3KA 4F4KA 4NCGA 4K4UA 1YJ9S 3G6XA 2HNDA 2QGFB 2ATLA 2XCAA 1ZOTA 4TNOA 5AE3A 3M6VA 1ZPWX 1H98A 4KV8A 3GLJA 2EFGA 3Q89A 1RAOA 2I5JB 2VQFJ 4OJ1A 5H9FK 1KKHA 5IWAJ 1RI7A 4N77A 2MKJA 4LSLA 5IS2A 1QM9A 1U8SA 2N4CA 3NLCA 2UVUA 1X4AA 4ZCIA 4IYQA 4LF8F 1HQUA 1U02A 3CMES 3ZZ0A 1TL7B 5DQHA 1BMQB 4I6AA 1HWJA 4URGA 3BBBA 2Z4PA 5F41A 1N5YA 4OHXA 5FDLA 3M8YA 3TWZA 2AJ4A 3KK3B 2ZZMA 1FKPA 2DRDA 2PA8D 4WXWA 4W90B 3CDWA 2HMIB 3CJKB 4ZVUB 1NSPA 1BXNA 2KM8B 1VRUB 2W1BA 1NCLA 1NJIT 4B3OA 2GNKA 3NXZA 3I55S 3DU5A 3LWMA 2FIUA 2JZ5A 2MZRA 4U8VA 3HI9A 3BEGB 3HKWA 1TUWA 1K8AT 4HVZA 5HMYA 2C2KB 4HLBA 3ZO7A 4J9PA 2MB0B 4U96A 3TUIC 3CJ4A 2L48A 4UW2A 2VC1A 2HAIA 3BZQA 5EGYA 1S48A 1SV5B 1K1SA 2ZOMA 4QZVB 1QDUB 2YQ0A 4KSEB 3UD3P 2ZM6F 4RPFA 1KLMB 3ENWA 4CYUB 3LO3A 3VAMA 3A13A 3NOGA 5EWFA 2X1GA 1FXRA 2YNIB 1AA1B 4DG1A 1VS3A 3NS7B 4PXEA 4NLWA 3NWGA 3ETOA 3NCQA 1RACB 2HVDA 4RW7A 4JI7J 3BSCA 3IXQA 5GAEI 2IMWP 4FXWA 5GAHU 3BQ0A 4IO9Q 1EJ7L 1L3UA 3I0SA 2J6SA 2VKRA 1LV5A 2VJUA 4TY9A 2MKKA 3SXLA 5FIIA 4MFBA 3Q24A 1YJNS 1DTTB 4OZLA 2GMJA 3D0GE 3ET6B 3J7Z5 3T9ZA 1TAQA 4UF4A 4DPXA 3QPIA 1YK9A 1WEZA 2AKWB 3Q22A 1UZDA 3O5TB 1NM2A 3VGTA 3MAAA 1T9TA 4KR0B 1SJ3P 2VPWB 4ILLA 1HWUA 2J9EA 4CO2A 2MSTA 3EGVA 4Q45A 4J9UE 3D67A 4DU7A 1S0NA 3U1LA 4P75A 3HVRA 2DPJA 3Q2TC 1Y10A 4MIWA 1EIYB 4WFZA 4UZBA 3QWPA 2CYYA 2V8PA 4OFZA 5BXIA 3LTOA 3BGOP 2QT7A 4ZN3A 1SVDA 1DBDA 2YWHA 1RKJA 4WKYA 1VQYA 4J9KA 1URRA 2FC8A 4NXNJ 3GONA 4TU9A 1WORA 4RW9A 4IO1A 1AB8A 1C4CA 3AB2B 4I0WA 4LBHA 4DUZF 1RT4B 3LWLA 1MMNA 3PACA 4L3KA 4KHMA 4USWA 3ZXWA 3DHXA 4ZCKA 4B17A 2VDIA 4NLUA 5CYQA 2LA4A 2Z56B 5CCMA 4OZNA 3GIRA 1H2TZ 5ETNA 2XZTB 1ZTWA 5BR8J 4H4OA 5K14B 4FVCA 4WBFA 2FY1A 2H5JB 3BDEA 5K5MA 4CH1A 2AZ1A 3GP9A 2HNZB 2ZD1A 3GSIA 2YBVA 4KFBB 2JFKA 2CZ4A 3D3CJ 1YSJA 3HVTB 3ZFVA 3NBPB 1H3DA 5LXYA 2P2CB 2FVCA 4IG0A 3A3NB 5IQQA 1LW2A 3J7ZT 1F9FA 1QAJA 4P9SA 2GJIA 2HHHF 4DSFA 4RWXA 4QW9A 3JTOA 3NKYA 2VD3A 3EYZA 3G8TA 1Q7YT 3AOBA 4LF9F 2UXBF 1O6XA 2GGPA 1A9NB 3GCXP 4BHQA 2UXCF 1UP1A 1U6BA 5ETTA 1X9MA 1CJTA 1S9EB 3PTWA 3M8WA 1QD1A 3M8SA 4RW6B 1VBYA 2NQPA 3M8RA 3CDEA 1GQEA 2WONA 3GQCA 4NYPA 3UDEA 4RUHA 1GK8A 2Z57B 1HD1A 4D3HA 5LSRA 1C0TA 3I4HX 4I6YA 3GSDA 2DGSA 2XGPA 4QYZJ 4DR4F 1WHYA 3I87A 2EWHA 4OIXA 2LEAA 1NNDA 1Q8KA 4TLRA 3RRHA 4DPTA 1VDHA 2ZKUA 1B99A 3ENAA 3UFCX 3C15B 3ICLA 3NGRA 4P2SA 1RAHB 4QQBA 3P8BB 4ZIVA 3PFEA 1TAUA 1HBOB 5GADU 4WFAQ 5KOWA 2QYGA 5A8WA 2HHTA 1BE4A 4IH7A 2CZ9A 3QAEA 4DX7A 3JS9A 4C9DA 2ZKTA 3TJ9A 4DFMA 1G4CA 4KGVB 1FJEB 4DV1J 2DNGA 3UR3C 1T05A 4PWUA 1IR2A 3H25A 1RISA 4L76A 1Q4RA 4K0KF 1PO6A 3DGPA 3JTPA 4UOCA 2XI2A 3BN4A 2C28A 2BBEA 5F3TA 3HFZB 3C14A 2HHSA 3PKYA 1FNMA 2G9OA 2FJEB 1B7YB 3MR3A 3RAQA 4JI6F 3BH6B 3QFHA 4CO1A 1MROA 1ACMB 2HVIA 4J9OA 4GMKA 3UD5A 3PIOQ 4OX6A 3GIKA 4WYWA 3K57A 2F9DA 3TA0A 2N7YA 1FDBA 3HK2A 3HSZA 1XMQF 1TFYA 4X4VA 2R7SA 1SC3B 2L3MA 2UV8G 1WEXA 3AA9A 2HLUA 3R2DJ 4DHVA 1YJVA 4QBUA 2A2CA 3CCMS 1S97A 3OL6A 3I0RB 2J7KA 3DLJA 1LWFA 5DRKA 4OV1A 2KFZA 3DRPB 4X4PA 5DLFA 2YKMB 3DNCA 2PDAA 4AL6A 2KXNB 2WZ1A 3M6UA 4X62J 4C8OA 2FYXA 1SUQA 4OI3A 1IBLJ 4X66F 3NWRA 2U1AA 4QR2A 4ECSA 5KAKA 2MKCA 5AT1B 3PJWA 5U47A 1HHTP 1HNZF 2BQRA 3H4BA 1R8AA 2RDJA 4Y2AA 2C2EA 1E6VA 2V94A 4WK1A 5D4NA 1WC5A 4WYLA 3TUZC 1N56A 2VH7A 4OJHA 2EEYA 2W8LA 4DR6J 4RUBA 4U7UK 1NKBA 1FKOA 3C6UB 4WIQA 4NXMJ 2YPZA 1QSLA 3QT8A 4KHPF 3BR8A 1EKRA 3TX8A 4WE1A 1U09A 4ETXA 4GC7A 3MM6A 2XMMA 1UEVA 2LQ9A 2BV3A 5IC6B 2RAQA 5RUBA 2YH0A 3WHIA 5KT5A 1QUVA 1O51A 4MIAA 1S12A 3C16A 4M5HA 3S8SA 3W60A 2XSJB 4QIGA 2RKIB 2E1AA 3H90A 2LECA 3LP0A 3DMJA 3GJSB 4OLOA 4A4JA 1RWPB 5DM7Q 1UPPA 2DRAA 1TKXA 2YNFA 3M9OB 3M2RA 4NZ7A 4D3GA 1KONA 1OMSA 2C2DA 1D9AA 3D0HE 3X1LB 1Z1ZA 2BM1A 2LXUA 4NA1A 1W26A 2MHEA 4F3OA 2M88A 1TMJA 2QO3A 4DLGA 4LFBF 5GAHI 3E51A 4N8OA 1HWKA 3IWNC 2ZH7A 1JB0C 2IY5B 3G87A 3IAS9 1NSAA 2WSEC 2MTLA 1BQNA 4J5OA 4DJBA 2VU5A 2QYCA 3CNQP 4OYMA 3KLEB 4B3RF 4YFUA 2Z2LA 2MLZA 3SCJE 2YKAA 2RRAA 5AJ3F 3MM7B 2AGOA 1JXVA 2ZWOA 4HI2A 3S6EA 1QLNA 5BYQA 3LOUA 2HGNA 2XNRA 3MCMA 1ZH5A 4RKUC 1U24A 1RT5A 4MYTA 4I2QB 4P52A 4RO0A 3NS6A 3JYTB 3FC9A 3K59A 4XDCA 1D9DA 3OW2R 5D78A 2CQ3A 2BZ2A 1NH7A 2GO9A 1NDPA 1S4EA 4JI5J 2BJ3A 2VG7A 1X5TA 3EGZA 2C2ZB 1HLWA 3W66A 4F25A 3CD0A 4LR7A 1XQIA 2CG8A 4K4XA 3QAUA 2E7XA 3MTJA 2JH3A 1IKVA 4ETZA 4PYDA 2MKIA 1RABB 1VYAA 5ITHA 3IM8A 3K8WA 5AXKA 4H4KC 2DO0A 2HFNA 1PAUB 2HKEA 4UUWA 4KBIA 5ETRA 3RBXA 3QATA 3DRRB 1HL6A 1K44A 2CDRB 3AY0A 4HT5A 2ZITA 2VONA 3W65A 3FFIB 2WW4A 4FXDA 4N41A 3D66A 1A6LA 2QSWA 1F3FA 5E33A 3KLHA 4DR5J 3RB6A 4G1QB 2HIQA 2RS2A 3LUYA 4F67A 5E0OA 2J76E 2XYGB 3MURP 2E7WA 1L3SA 3OTOJ 1BHNA 1JLCB 1M0SA 4C4WA 4ED4A 3T9NA 5LMNJ 2QA4S 4LRAA 3QQCD 4I7FB 4OQJA 3VAIA 1RWVB 2ZOGA 2AQ4A 4I67A 1WDTA 4KO0A 2BRLA 3BGFA 2CNNB 1RYRA 2OHDA 3K8VA 3MCOA 1NRKA 5HVFA 1CJKA 3UCZP 2EFQA 3IGVA 2BEFA 5JVHQ 1H74A 3FBBA 2JSXA 4JYAJ 3MR2A 5KFPA 1RHUB 4F04B 3OBIA 5T41A 2LXFA 2ZWPA 4H4MA 1D9FA 3RYLA 4KE5A 3KLGB 1NEEA 2OP5A 3I6PA 2AJ2A 1QY7A 3IS9B 3OLAA 3KK2A 3KHLA 5KFKA 5F9NA 1M5KC 2RHQB 3LQVA 1GMUA 5HLFA 2B43A 3R7NB 2WSFC 4EZ6A 4NYZA 1UW4A 5B0CA 2I0XA 3TR5A 5J2PA 1S1VA 2WVEA 5BYSA 1JLBA 3WDOA 3AB4B 3GG1A 3E2EA 3HULA 1WEYA 2B4VA 1R6VA 3ZZOA 3VR1A 5IT0A 2RMLA 1XEZA 4UY85 1FTRA 4LF1A 3UNGC 1RTJB 2VQEF 1WUUA 2J9CA 1CLFA 1T03A 5CA5A 4DUYJ 3ITHA 2AJFE 1HFEL 4DL0C 3DOMB 2OFGX 2W4CA 3FDSA 1KTQA 4KHRA 2P8IA 1ICEB 5GADI 2CIMA 2W9CB 1B0PA 4KIAA 2L9DA 3LH2S 4G1IA 1AUDA 1HHSA 2RNEA 3GMGA 4J9QA 4PZVA 3ISNC 4X4NA 3R27A 5CD4H 4OYWA 3EJMA 4F0MA 1RHMB 3P45B 4W4MA 2NPIA 2K2PA 2IVYA 1S9FA 2QRRA 4PABA 3ILIA 4IR9A 2J9DA 1N33F 4B3TF 3C46A 1HD0A 1D1UA 4OX7A 4JV5F 5E41A 2DCUB 1K1QA 2DR9A 3LP1B 4DMZA 3VCDA 1HQ2A 3KNAA 3RW6A 1NK6A 1JKHB 1HQEA 4E8UA 2CQBA 3NAIA 3BGLA 2W7PA 2AJ1A 4DR1J 3FMBA 4ZHRB 3W2WA 4DQPA 1IBKF 3HLUA 4IFVA 4PPZA 4MIBA 4WFYA 5G0RB 2ZNZA 2KVQE 1WG4A 1HR0J 1QAIA 4WFXA 3Q8VA 2UU9J 3FVYA 2XHCA 4DV3J 1UETA 1ZS6A 2CPZA 1KHVA 2PI4A 4UY8T 2L9WA 7FDRA 2OELA 4IG3A 1XC9A 2R9LA 2R7WA 2D3OR 1FVQA 4OX9J 3CC2S 1DURA 1YKWA 1DLOA 2F65A 1NB7A 4ENOA 2UUWA 4LRDA 3JSMA 4TY8A 2FD2A 1VC5A 4MK7A 4ZCLA 3BO2A 5KFWA 2NXEA 4M5DA 3MPWA 2C3YA 4ICLA 3DI6A 3I5AA 1FTCA 3SDEA 1Y5NB 5A8KB 3VAFA 2GVDB 2ZBPA 3V81A 1LWCA 4DL4A 4BDPA 3PR4A 3CW2C 1SPBP 4PXBA 1PC4A 1VFJA 3W8PA 3M30B 1VQ7S 3QIPB 2R3VA 3MMAB 3P49B 1XNRJ 2ZH3A 4M5NA 4U7UD 3MM5B 4ES2A 3D28A 4XO0A 3W8GA 4BC7A 3SQGB 4NLSA 2WVCA 1VIXA 3NEKA 3LPYA 1NUEA 4ID5B 3KK1A 2X1BA 4NLXA 3TO8A 2RSQA 1X5PA 1F9EB 1TK8A 1IKYB 3ZZRA 2CRLA 2OPQB 4KYZA 1LFPA 2P6TA 1X0FA 3PYFA 4CM2A 1S6PB 4OJGA 2UP1A 3FCHA 3GILA 1QSYA 2B51A 4JI0J 3R6LB 3GIIA 4FNHA 3QYYA 4WP8A 2U2FA 4PRFA 2AYMA 3UQSA 5KFRA 2I5JA 4AE5A 4DR7J 2RDIA 2QG9B 2HWHA 2DNOA 2VUGA 3CCES 2I6WA 5L39A 3DXBA 2IC3B 2CFXA 2QLJB 1VK3A 4RU2A 3MAHA 1PILA 4EBCA 3GR0A 1EZZB 2EC0A 3J81Y 1JLAB 1NPRA 4FPIA 4YOEA 2QFJA 1TQLA 3W62A 1U2CA 1TL7A 1T9WA 3R5AA 1IJFB 2Y1IA 4DLEA 2FJAB 1P9YA 2NREA 4R5PB 5CH7B 2AGQA 2HGMA 5A6WA 4LFAJ 2MJUA 4QIVA 3FK4A 5B0GA 3I4PA 2E5JA 3KK3A 2IRUA 1GFWB 3VVTA 2E9ZA 1KN6A 3HZEA 4CI0B 1CS4B 3AH6A 2QL7B 3CJKA 1YX2A 3ADAC 3E01B 4QPXA 3RAXA 1XMOJ 4B9NA 2Z8QA 4C8LA 2EG1A 1TTHB 4V19J 4URSA 2R7XA 4CO4A 5IC4B 2YNHB 4CWBA 3Q8SB 4MT1A 4OJ3A 4LVNP 4YR3A 1REVB 1RTZA 3O1LA 2ACYA 4C48A 5LMUF 3PR5B 4A48A 1SV5A 2XMVA 4A8QA 2E1MC 3LW5C 5EN1A 4Q44A 3EPGA 4LF7J 1MMDA 1KLMA 5KFQA 4CYUA 2BE9B 4LF6J 1FD2A 1X9SA 1NHKL 1O8BA 2Y8WA 3G6YA 1HNWJ 1XBWA 2QL9B 2YNIA 4FS1A 3W5YA 3D1HA 4N47A 1APSA 5HK4A 1AXQA 1RHKB 3FMWA 1KNZA 1U2FA 5DQGA 5A2QU 1SJQA 4B9UA 3SSRA 3OR2A 1OQ6A 3J7YU 3ILJA 4ECYA 3DLGB 2B4OA 3CF5Q 3MI7X 3AA8A 4U6PA 1FD8A 3Q2SC 4JI1F 1F2GA 3A8KA 3R5DA 2ZUAA 4AQYF 3CB4A 1MU2B 4DCOB 1TR0A 1BC6A 1J27A 3T1YF 3FSYA 1RWKB 3MR5A 3JSBA 2GMHA 2IJNA 1DTTA 2VFUA 3ET6A 4ID8A 2O3DA 2ZH4A 2XMAA 4TU8A 4CLSA 4O3NA 2OSQA 4V19X 4DV5F 5L9XA 2JC1A 4F7VA 1OY8A 2QTWA 2RT3A 3O6QA 1UAWA 1IQZA 1K9MT 3MOJB 4QIFA 3PRBA 4ZS6A 5J2NB 4ED6A 3JQKA 1VC6A 3BSOA 4JB8B 1RUSA 1LK5A 1L3VA 2RF2B 2LP4A 1YZ6A 2LKZA 4YQWA 4LSNB 3W9IA 3VVUA 3PW4A 3NGTA 4CM0A 2NCKL 5FJ4A 4P74A 3K2YA 1GX6A 5LSLA 3M8PB 4GKKF 4JBCA 4Y00A 4DR2F 4F50A 5L9NA 3J7AN 1HNVB 2CPDA 3B54A 2BW2A 4Y0FA 3TNVA 3QWUA 3SSQA 5DETA 1PCAA 4ZOSA 3G86A 4HH0A 2KYZA 4UOGA 5K14A 1T9UA 4RZRA 3PYEA 2NUUG 1N32F 5KFAA 2HNZA 4JI2J 5GAGU 3P4UB 2O67A 1FESA 1U6ZA 3SCIE 1TKDA 4KFBA 4L73A 4ZJOA 3HVTA 2E5IA 2R7UA 3NBPA 4DF8A 4R0EA 1Q7LB 3UN5A 1EETB 2CNKB 4OZ3A 1S1TB 5IM0B 2XLIA 3BN7A 3AD9C 4OZ0A 2IM3A 2HFSA 3QJLA 2B56A 4NI2B 3IP0A 2CQCA 1VCTA 1ROFA 4DL6A 1PBUA 1WF0A 4E2FB 2DKOB 3QGPA 1S9EA 3N0VA 1U45A 3C19A 4RW6A 3QO9B 4MJKA 1N6QB 1X4CA 4XDDA 1HA1A 1WTFA 1Q8BA 4EK2A 1I94J 2XB2D 5HMXA 2MJNA 1NJWA 2KN4A 1AFJA 1CVJA 3T5HA 4LQ9A 3PRDA 3KG0A 1UVMA 3KUHA 1BD6A 4F02A 1WDDA 1BQXA 4R25A 1Q16B 3U27A 1S1WB 3TX0A 3LF0A 3ISZA 4PQAA 1KBRA 3WBZA 5AXMA 1QUPA 2CWXA 1CJUB 2F5GA 1T95A 4FVMA 3IWXA 2BJ8A 1JNZB 1RYSA 4QJVA 2HVEA 3C15A 3MD3A 5HP1B 1T0TV 3UDLA 2BOPA 1FRJA 3QJJA 1HBOA 5CQGA 5HVHA 2FUG9 3V6KA 1NK4A 3IMQJ 1N34F 1B70B 2AD9A 2ASDA 2JHEA 1S9GB 1GH8A 1BLUA 1FWKA 1SKRA 1LNQA 1RBAA 2IYGA 5HANA 3BBCA 2AYEA 1WHWA 4B9SA 4C7QA 5KFZA 4DR3F 5DQIA 2GAGC 2ZH1A 2XMJA 1T3NA 3DOKB 3RGIA 5D4PA 2MQLA 3I9ZA 3HT0A 1G6BA 1Y5IB 3D5MA 4C6AA 4IUFA 2V2KA 4HACB 2YPYA 1H2UX 2ZM6J 4EYHB 5D6GA 3KJQB 2DXEA 4Y2CA 4JI4J 2ZH9A 5M2UA 2KRRA 3I0RA 5ETVA 3HCXA 3K89A 4DFPA 3H7HB 3JTNA 2FC9A 2YKMA 3OUYB 4RUAA 2V69A 4N7TA 1UVLA 4DZDA 4A8OA 3MPVA 2D7SA 1HBUB 4JI3F 3UPFA 2R2TA 1RWMB 1UVKA 4ZVQB 1KVIA 1H6KX 2ZZTA 4M5GA 2DGVA 2XBPA 4GKJJ 5HQMA 1O5JA 5F8NA 4NEZA 3M1VB 1GTEA 4ZP9A 2UXDJ 2V4JA 2GQCA 2DNMA 1HNXF 4B3SF 2UVVA 2I1RA 2W2QP 3C6UA 4EMDA 3H98A 1UJ4A 5GMKa 3K17A 1P6TA 2XWYA 3P5TL 3TEHB 2CQ4A 4NLQA 5BYRA 1NK7A 1SIZA 4KPCA 3S01A 4ED2A 4IDKB 4DQIA 4ED0A 1OY9A 3MGJA 1XN9A 4J7CA 2RQ4A 3PV8A 2WVBA 2YX1A 1FFSB 2ZH8A 2CWKA 4CT9A 2RKIA 1JJ4A 1YQHA 3GJQB 4QOTA 2FHJA 3CEDA 1UJ6A 3M7VA 2BM0A 2M52A 5E3QA 3MECB 1KWMA 2ROPA 1MWYA 2X3DA 2QLWA 2PIIA 3D1QA 4O44B 3THPA 4QR0A 1MMLA 3O8WA 2RJZA 4CLZA 2DXDA 4NMXA 3MM9B 1P27B 3N5BA 3UI3A 3PO4A 3BPSP 2AMCB 3DDKA 2DK2A 2EFVA 3J7YI 5KFLA 3KJNB 3CJTA 4DOZA 4XK8C 1BWEA 3OR1B 1RTHA 1SJRA 2DR5A 2DB1A 2D3ZA 1WC0A 1S7HA 4MK9A 1A0OB 2XEXA 2BW7A 3MEGB 2V4QA 4ZJQA 2BE7D 4O3RA 3EE3A 4KKOB 3KLEA 3FBCA 2KH9A 3U1MA 3MM7A 3TI0A 2IM0A 1X7VA 4ZVEA 1U1QA 3VGSA 4U8YA 1RSCA 2W01A 3AHPA 1LWXA 5J1PA 2JJ4D 1Y3KA 1SB6A 4I2QA 3JYTA 4NZ6A 2DO4A 1DFDA 4OI6A 3K5NA 3HXMA 5THWA 2PEHA 3BO3A 3NNAA 2QMWA 2IIHA 2DD8S 2GIQA 3H0PA 4J9RA 4Q2MA 3Q8QB 2DVIA 4UUXA 5DJBA 1M1HA 1NK8A 4KGMA 4HTIA 4DFJA 5HO4A 2QE5A 3CCSS 5KG6A 2FJXA 1RBLA 4UOFA 1FWPA 2RQKA 1VQKS 2W2PP 3PYGA 3P3DA 4DR4J 2QFIA 5EWGA 4JI7F 4DS5A 1LFWA 3GB0A 1UL3A 4EUVA 1XWLA 1UTAA 3DRRA 3OFEA 4X65J 2C3UA 3I5CA 1OIAA 4UZCA 1VBZA 3OTEA 2OIHA 3BGRB 2F4VJ 3FFIA 2VV5A 5KFYA 2HBQB 4RJVA 3TRGA 4G1QA 3PW2A 2WHOA 5LSOA 2CPFA 3HVWA 3VGUA 4C8ZA 4U7CA 1RWWB 1VI7A 2DHHA 5GAGI 5F3ZA 2IDEA 1JLCA 3G6ES 3G9CA 2UVRA 2MZSA 4F2RA 2BKPA 1ZA1B 1DZ5A 1NKCA 1PGZA 3TAPA 1NH8A 3OPKA 4I7FA 5CAAA 3W64A 4QYZK 2J5AA 4RNMA 2HHUA 5F0UA 2YNGB 2HYIB 1S0VA 1N88A 5T7LB 2O1PA 1I3OB 4YS2A 3KHHA 5CZVA 2IVFB 1TUGB 3CMAS 1N0UA 1N36F 1X4GA 1MLAA 1OYEA 3M8QB 4C97A 1RHQB 2XY6A 1KQKA 3Q8UA 5LT5A 2DR7A 3KLGA 2FTRA 4YDXA 5LOQA 2CJQA 3IS9A 3NY0A 4FF1A 5DM6Q 3IRWP 2VZ9A 4CCHA 3SQOP 2ZBRA 4MH8A 3H5SA 3E3XA 1JJ2R 3WIVA 5C24B 4HEA9 1MWQA 2QJ3A 1ULRA 1R3NA 1U1KA 4YY3F 2E1PA 5G4DA 4NLVA 5BR8F 2PE8A 3WC2A 6FDRA 5KFNA 4YP3A 2FJDB 2E1RA 4X66J 4ZLLA 2F40A 4M94A 3L7UA 4ED1A 2XI3A 1HNZJ 1F5CA 3RBDA 1SC4B 2EG2A 3DOMA 1FRLA 4N8NA 2KTQA 1YJ7A 2W9CA 1M90T 3UDCA 3K5OA 1CQNA 4L75A 4QWBA 4C0OC 1U25A 3FZ2A 3GV5B 1Y00A 2CKWA 2YWGA 3Q23A 3MCSA 1GT8A 3CSKA 2XGQA 3EX7B 1TFWA 2AX1A 1PIEA 5HAOA 1EHWA 5JVGQ 3L3CA 2JX2A 2R2SA
chains in the Genus database with same CATH topology
3DOLA 1GAOA 4RKUC 1ZH5A 1U24A 3BSAA 4UQTA 1RT5A 2GHWA 4MYTA 4EBEA 3THVA 3NNCA 4RW8A 4NCBA 3V2UC 4I2QB 4AXJA 2E1CA 3NS6A 3JYTB 1NJXA 2ALZA 3K59A 2AV5A 4XDCA 1D9DA 2HWTA 3OW2R 4OZ5A 1UJ5A 5D78A 3LP1A 2CQ3A 2JL9A 4ED5A 1TL5A 1MROB 2DNHA 5F9LA 1NJZA 2BZ2A 3GR1A 3BB5A 3DYAA 3LAKA 4H54A 2BXJA 2QV6A 1R0AA 4Q8FA 1NH7A 1ZZFA 2GO9A 3VF0B 3VWSA 2MZTA 3SFUA 1M5OC 4ED7A 3M9MB 2F8MA 3OSPA 1R8CA 4X4SA 2VG7A 1FA0A 1X5TA 3EGZA 2E9TA 1KFSA 4JYAF 4ZHRA 1P1TA 4F25A 3ZZUA 2LDYA 2H5EA 3CD0A 1QVFR 2DITA 4Y2MA 2MGZB 4K4XA 4CH7A 3QAUA 2EK1A 2E7XA 3SMZA 4WFBQ 4TLQA 1H7WA 3MTJA 4ZPBA 2JH3A 3LP2B 5G0RA 1HI8A 1KFDA 5D3GA 1IKVA 5HBMB 5KT4A 5E3PA 2HPUA 4ETZA 4BBYA 3CCZA 4WFNQ 1RTIB 2MKIA 3IAM9 4NLGA 1T8EA 4ECWA 2OSRA 5ITHA 1KEKA 5E5NA 1UFLA 3DDNA 3K8WA 2HMIA 5AXKA 4H4KC 2WOMA 2I9SA 1VRUA 1XTZA 2OPPA 2DO0A 2HFNA 4Y2KA 4B9LA 4BS2A 2X1AA 5AXNA 1HBNA 1LWFB 2B9YA 4PXCA 2HS0A 4UUWA 5L1JA 4KBIA 3RB0A 4WJBA 1FRMA 2XC9A 5H1SV 1FNOA 5KG0A 1X5SA 2R7QA 3DRRB 1HL6A 4ELUA 3CTRA 2CPXA 4Q5VA 2KZMA 1ZAXA 4DSKA 1OPIA 1C1BA 1LW0B 3AY0A 4HT5A 5DGBA 1RK8A 2ZITA 3FSXA 2XO7A 4DV6F 2VONA 1N5YB 3AQOA 3FFIB 2XMUA 2PMHA 4IKAA 2NUHA 4FXDA 4KQZA 4N41A 5A2QY 2ZHBA 1A6LA 2QSWA 1U49A 5AE1A 2OKQA 4QWDA 3EUNA 5E33A 3KLHA 3H2VE 4C8MA 3N28A 1SUQB 3MEDA 4CNZA 3RB6A 2W4PA 5D77A 5KG1A 4G1QB 5L1IA 4F4YA 2HIQA 2RS2A 3LUYA 2ADCA 3PW5A 4RUCA 4DQQA 4F67A 4MKBA 4URQU 1OSDA 5E0OA 2J76E 4PXDA 1C2PA 1NHVA 2QLXA 4QR1A 3HHLB 4RW4A 3RTVA 2LEPA 4LIRA 3RAMA 3MURP 1FDDA 1U4BA 4OX8A 2E7WA 1L3SA 1VRTB 4C0HA 4C4WA 1JLCB 1M0SA 1E6VB 1P9QC 2E29A 2IBOA 4NPOA 2QEXS 3IGNA 5A8KA 5CZXA 3POTA 1HARA 3T9NA 4ZVGA 3U7JA 5KOXA 2OLWA 4K4TA 1TL3A 2QA4S 2LEBA 3KLIB 3OLBA 4I7FB 2RQMA 1IJEB 2FHOB 4OQJA 4PG4A 3VAIA 4XIUA 3R5BA 1QE1A 3C3LA 4CIOA 2VODA 2ZOGA 3KLFA 2W9AA 1IKXB 2AQ4A 3GFZA 2L41A 4I67A 1I1GA 1ZAVA 2ZBIA 4DN0A 1R7IA 2OMOA 4HHJA 2V8HA 3M30A 4KO0A 4CQ1A 4G3IA 1A7GE 3HZGA 1B64A 1WI6A 1FKOB 2BRLA 3FJ2A 3UR0A 2O66A 3BGFA 3BGUA 1RYRA 4Z37A 4PCQA 3QIPA 3DLHA 3T1HF 3MMAA 3K8VA 2RE1A 2FDNA 2XS5A 2B5JB 1NRKA 3EZUA 1YRXA 3MZIA 3QZ7A 3MEEA 5EUHA 3UCZP 2EFQA 3IGVA 1QTMA 1C0UB 1SKSA 5JVHQ 4ELVA 3MOZA 3ULHA 2HNYB 4WE1B 3MM5A 4WU2A 4ECVA 3CE8A 3MM6B 2JSXA 4L6V3 4AL5A 1KR4A 3MR2A 1DHMA 5KFPA 1JK9B 3HO1A 4AFFA 1Q8IA 4DL7A 1IN0A 3SQGA 4FYDA 2V4RA 1JXEA 2KT5A 3OBIA 4IR1A 5T41A 2LXFA 4QWCA 4OHVA 2MQPA 2XMTA 5E3AA 1YWXA 4J9SA 2HHWA 1D3WA 2CPYA 4H4MA 1D9FA 1SJFA 3RYLA 3U02A 4KE5A 3MUMP 3CPWR 3KLGB 1VJWA 1NEEA 1TV6B 4KT0C 4ZPCA 3UCUP 4OI2A 3B8HA 2KZZA 3GYXB 2OP5A 3I6PA 2JLEA 1QY7A 3DLLQ 1IKYA 2MZJA 4XAKA 3IS9B 3OLAA 3KK2A 3KHLA 4ITSA 4OZJA 1YTYA 5KFKA 4X65F 5F9NA 2QMXA 1M5KC 2OPQA 3LQVA 5KFDA 1GX5A 5K8PA 2PT0A 1HWIA 3FRZA 5HLFA 2B43A 4TQRA 4ZK7M 2F4VF 2JRSA 2JEIA 2KYXA 4NA3A 3I82A 2PO4A 2WSFC 3K5PA 1RJJA 1S6PA 1JMTA 1VGYA 1VLYA 2IBKA 4USJC 4EZ6A 3LP0B 1TKZB 4NYZA 2DRBA 4KPYA 1UW4A 2IHR1 3DMJB 3CC7S 2BA9A 1UA1A 5B0CA 1CC8A 1ELOA 4AUKA 1WF1A 3TVZA 2I0XA 3TR5A 3M32B 5J2PA 3PHEA 4DR1F 1RT1A 1S1VA 4FXVA 5J2MA 4FBTA 5BYSA 4KJIA 1JLBA 4Y34A 3WDOA 1FEEA 5KFIA 3AB4B 3GG1A 3MM8A 3E2EA 4DSEA 3OSNA 2OJ3A 1WEYA 3V6DB 1RT7A 2DGOA 4JV0A 2KXFA 2HHQA 1RKIA 1TKXB 2B4VA 2YNFB 1S1UA 4LUBA 3CCWA 2QIFA 3JSRA 2OTLS 3ZZOA 3VR1A 5IT0A 1S1XB 2CQGA 2RMLA 1XEZA 3M2RB 3T1AA 1HR0F 3CJ5A 1FTRA 4UY85 1R43A 3P96A 1R31A 4J9MA 2BQ3A 3RB3A 3UNGC 3H5XA 3FGVA 1RTJB 2KG1A 2VQEF 2IC3A 3IRXB 2J9CA 1ZM4A 5A0YB 1FK9A 4Q0BB 1CLFA 4R8UB 1VQ4S 2MPUA 2PMZD 1FRXA 3R1HA 2CPIA 1T03A 2G13A 5CA5A 4RNNA 3ITHA 1YHQS 2GHVC 2AJFE 1HFEL 5E3CA 4DL0C 1FJ7A 1JLAA 4NLTA 2M5YA 5KT3A 4DR6F 1VOMA 2OFGX 2W4CA 3M2VB 3FDSA 1KTQA 4KHRA 5L1KA 1CPZA 1R89A 3W3SA 1KLNA 5GADI 1BY9A 2BRKA 2CIMA 4F2SA 3IA0A 2W9CB 1TL1B 4NXMF 1B0PA 4KIAA 2L9DA 2J7WA 4N5SA 2HS3A 1JWWA 5MAOA 3GFHA 3LH2S 2GX8A 5M2PA 3NL0A 3NG8A 4G1IA 3ZZTA 1AUDA 2APOA 2OAUA 4C3MA 1HHSA 5IXUA 5KTQA 4DL2A 4PWDA 3CDUA 3HHLC 3EXYA 4NZ0A 2RNEA 3GMGA 3LANA 4J9QA 3ISNC 4CO3A 1UVJA 4X4NA 2A10A 3R27A 5CD4H 2B7CB 5CYMB 4DSLA 4Y6IA 1VQ8S 5B0EA 1UWBB 1RT4A 1BQNB 1KS2A 4R5PA 1UEUA 2BUNA 2P9CA 5IT4A 1OO0B 2BR0A 2NPIA 2K2PA 4HI1A 2IVYA 1AROP 2EK6A 3KWMA 2N3LA 4ILRA 5HMWA 3OVSA 1S9FA 2QRRA 1SKWA 5DG9A 2LLZA 4K4VA 3Q8PB 4WF9Q 3K58A 1WHXA 3DM2A 4IR9A 3SI8A 4NRTA 4DL5A 2GMLA 2J9DA 2KKHA 4X84A 2ZE2A 3CCUS 1IXKA 1N33F 4QU6A 3BS9A 4B3TF 3C46A 1HD0A 1WF2A 3E01A 3PXGa 1D1UA 4OX7A 3DOLB 2FVSA 4DDFA 3HF5A 5DDQC 2I2YA 4JV5F 1IKWA 1RT5B 5K8MA 5E2QA 2GA7A 4DX8H 3EZ5A 4RW8B 5E41A 2DCUB 2KFYA 2B0GA 1K1QA 5KFBA 2ZBCA 3CDBA 2DR9A 3RRGA 3QIDA 2HFOA 2YNHA 3LP1B 4DMZA 2XLJA 2MY7A 3VCDA 3DYAB 3V4IA 3KNAA 5DDOC 3SEOA 1R0AB 3I31A 3M9NB 1NK6A 4MMOA 3RW6A 2XNQA 3DCAA 1KOHA 2WB4A 1W2IA 1JKHB 2OD6A 5C42A 1YVFA 1GNKA 1HQEA 4E8UA 2CQBA 1REVA 2FGCA 2HHPA 3BGLA 3NAIA 4QYRA 2W7PA 2VG7B 3UD4P 1JLFA 1FRKA 2IFXA 2AJ1A 2VBYA 3GYNA 3FMBA 3V4MA 4ZHRB 2WW8A 3RRKA 1XR7A 3IC1A 1WACA 3HP6A 3MFIA 3W2WA 4DQPA 1PSDA 4KGKA 2AYBA 2YY3A 1IBKF 3HLUA 2LDIA 2Q43A 5DDPC 1S79A 4B9TA 4JOUA 2RS8A 3OXGA 1TZ0A 2N82B 4IFVA 4PPZA 4MIBA 4X4UA 4WFYA 1JLQA 5G0RB 2ZNZA 5D3GB 1WG4A 1IKVB 3FRYA 2VFRA 1LOUA 1U7LA 2F3JA 4WFXA 1QAIA 2HQIA 2C22A 1GXLA 1HW9A 2KG0A 3ONQA 4P6QA 3SCKE 3FVYA 2V4JB 2WOMB 5DLGA 1J5EF 1UETA 3SFGA 2CPZA 2OPPB 2KT2A 1KHVA 1HBNB 2ADBA 2OD4A 3HHDA 2PI4A 2CQHA 4ECXA 4Q8EA 4UY8T 1FVSA 2KJWA 3TW0A 2MYFA 2JDJA 2L9WA 4F3MA 7FDRA 2ZZNA 4WIIA 1FERA 4JI0F 4IFYA 2AJ0A 4RNFA 2N3OA 4YB6A 3VQSA 4IG3A 2P9EA 4IOCQ 2HS4A 1C1BB 1XC9A 1FNXH 1IUJA 1WHVA 2R9LA 5KFUA 3UCGA 3T6JA 2YKNA 5LXRA 2R7WA 2D3OR 1FVQA 3M05A 5FLXY 3CC2S 1DURA 3TQ1A 3DLGA 5KFEA 1DLOA 2JVRA 2H9ZA 4LVOP 3FQKA 2DIVA 3B4DA 1NB7A 3KLHB 1HI1A 2EKYA 3MEDB 5KT7A 3GIJA 2R7RA 2UUWA 3QJPA 3JSMA 3GFYA 5GAEU 4TQSA 4TY8A 2FD2A 2RVJA 1VC5A 3L95X 4MK7A 2XHWA 4ZCLA 4X4QA 5KFGA 3BO2A 5KFWA 1VQ5S 4M5DA 3BREA 2Q3PA 2IA6A 3MPWA 4ZDNA 2C3YA 4RW4B 1QVGR 4ICLA 5JUMA 1ZAWA 3DI6A 1MWZA 3I5AA 1FTCA 2BABA 4CNYA 1V3ZA 3SDEA 3OL7A 1RP5A 1JLEA 1Y5NB 3RB4A 5A8KB 1M1KT 3VAFA 4YMEA 3POTB 4L72B 3OFGA 2GV1A 2HRYA 1ZM2A 2I38A 2VPXB 2UV8A 2OTJS 3T3FA 3V81A 1TL3B 2Q79A 1LWCA 2CJBA 3DHWC 4DL4A 3CD5A 1NJYA 4BDPA 3CCRS 3DXSX 3HJFA 3M6WA 3QGGA 3PR4A 2B6AA 4O0IA 2FLPA 3MMJA 3VZIA 1QE1B 3G6VA 3KLFB 1FE0A 1M5SA 5CXTA 4PXBA 1PC4A 4IQXA 1VFJA 2HZCA 1T94A 3M30B 4KO0B 3CJ3A 4I6WA 4Y28C 1DTQA 4C3KA 3BJYA 1BGXT 3C8YA 3OR1A 4C0BA 4A8YA 1VQ7S 3QIPB 4YB7A 4AXIA 3MMAB 2IM1A 3P49B 2D1CA 3GFXA 1RWUA 1Q86T 3H40A 3MEEB 2ZH3A 5IFMA 1VQPS 5F0WA 1RA6A 1W25A 3OV7A 1FF2A 1KOOA 1J2VA 1TVRA 3MM5B 4FNIA 4ES2A 2DIUA 2HG4A 3D28A 4XPEA 2E66A 3B78A 2F1FA 2VA2A 3KHRA 3F73A 1VIOA 3FEXB 5LL6d 4XO0A 5J2NA 1YBAA 1UFWA 4BC7A 3SQGB 3H2LA 2FVPA 2R8GA 2DGXA 4NLSA 4ECZA 3DLBA 1VIXA 4P7VA 5C25A 2VFVA 3LPYA 4ID5B 3KK1A 1VC0A 4EWTA 2X1BA 4H4MB 4NLXA 2RSQA 3TO8A 1XMOF 2FJVA 2L9NA 4PR6A 1K0VA 4K4SA 4U67Q 1NAQA 2IAJA 2JOQA 2NYIA 2WBMA 1X5PA 2NZ4A 4R0JA 1TK8A 2AU0A 1IKYB 1Q79A 2YWEA 3GIMA 1U1PA 2DNPA 3ZZRA 5IQ6A 3KK2B 2RF2A 1TK0A 4OMFG 1SH2A 2CRLA 3TARA 4MKYA 4HKQA 4C2MA 2OPQB 3HHNB 3X3UA 3MUTP 1LFPA 5HLFB 3EGWB 2CVEA 2P6TA 3MEKA 4LSNA 1RTHB 4OZ1A 5DGAA 1S0OA 1X0FA 1S6PB 1V6HA<